Directory of Open Access Journals (Sweden)
Michael Andrew Meyer
2013-07-01
Full Text Available The JC polyoma viral coat protein VP1 was analyzed for amino acid sequences homologies to the IDSP sequence which mediates binding of VLA-4 (integrin alpha 4 to vascular cell adhesion molecule 1. Although the full sequence was not found, a DSP sequence was located near the critical arginine residue linked to infectivity of the virus and binding to sialic acid containing molecules such as integrins (3. For the JC polyoma virus, a DSP sequence was found at residues 70, 71 and 72 with homology also noted for the mouse polyoma virus and SV40 virus. Three dimensional modeling of the VP1 molecule suggests that the DSP loop has an accessible site for interaction from the external side of the assembled viral capsid pentamer.
JC virus chromogenic in situ hybridization in brain biopsies from patients with and without PML.
Procop, Gary W; Beck, Rose C; Pettay, James D; Kohn, Debra J; Tuohy, Marion J; Yen-Lieberman, Belinda; Prayson, Richard A; Tubbs, Raymond R
2006-06-01
Progressive multifocal leukoencephalopathy (PML) is a demyelinating disease of the central nervous system caused by the JC polyoma virus. Electron microscopy and immunohistochemistry are the traditional methods of confirming the presence of the virus in brain biopsies from these patients. We studied the brain biopsies from 7 patients with PML and 6 patients without PML with chromogenic in situ hybridization (CISH) for the JC polyoma virus using a commercially available probe. The biopsies from the patients with the PML cases were proven to contain the JC polyoma virus by traditional and molecular methods. The CISH findings were compared with the known state of infection. All (7/7) of the biopsies from patients with PML were positive for the presence of polyoma virus by CISH, whereas the biopsies from patients without PML were uniformly negative. CISH seems to be a useful tool for the detection of the JC virus in brain biopsies from patients with PML, and is more accessible because a commercial probe is available.
Beck, Rose C; Kohn, Debra J; Tuohy, Marion J; Prayson, Richard A; Yen-Lieberman, Belinda; Procop, Gary W
2004-03-01
We evaluated 2 methods, a LightCycler PCR assay and pyrosequencing for the detection of the JC polyoma virus (JCV) in fixed brain tissue of 10 patients with and 3 control patients without progressive multifocal leukoencephalopathy (PML). Nucleic acid extraction was performed after deparaffinization and proteinase K digestion. The LightCycler assay differentiates the BK virus (BKV), JCV, and SV40 using melt curve analysis. Conventional PCR was used with the same primers to generate products for pyrosequencing. Two sequencing primers were used that differentiate the polyoma viruses. Seven of 11 biopsies (1 patient had 2 biopsies) with PML were positive for JCV by real-time PCR and/or PCR/pyrosequencing. Three of 4 remaining biopsies were positive by real-time PCR but had melting points between JCV and SV40. The 4 specimens that were negative or atypical by LightCycler PCR were positive by traditional PCR, but 1 had an amplicon of lower molecular weight by gel electrophoresis. These were shown to represent JCV by at least 1 of the 2 pyrosequencing primers. The biopsies from patients without PML were PCR negative. Both the LightCycler and pyrosequencing assays are useful for confirming JCV in brain biopsies from patients with PML, but variant JCVs may require supplementary methods to confirm JCV infection.
Polyoma Virus Nephropathy, First reported case in Saudi Arabia
International Nuclear Information System (INIS)
Siddiqui, N.A.; Hamid, M.H.; Bokhari, E.; El-Tayeb, A.
2006-01-01
Polyoma virus nephropathy (BK virus) is being recognized as an important cause of graft failure. It is usually confused with acute rejection. No cases have been reported from the kingdom of Saudi Arabia. We report a case of a Saudi gentleman, who was transplanted outside the country, with persistently elevated creatinine and urethral stenosis. He was treated for acute rejection on more than one occasion with no significant improvement in his renal function. Polyoma virus nephropathy was diagnosed by detecting the virus DNA by the polychain reaction techniques (PCR). The patient's renal function stabilized after the calcineurin inhibitors were discontinued. (author)
International Nuclear Information System (INIS)
Huang, Y.; Wen, J.
2018-01-01
To better understand the functions of key genes involved in terpenoid biosynthesis in Jatropha curcas, we cloned and characterized three genes, namely acetyl CoA acyltransferase (JcAACT), diphosphate mevalonate decarboxylase (JcMDC) and farnesyl pyrophosphate synthase (JcFPS). The opening reading frames (ORFs) of JcAACT, JcMDC and JcFPS were 1239 bp,1248 bp and 1029 bp, respectively, encoding a 412-amino acid, 415-amino acid and 342-amino acid polypeptide, respectively. Results of homology analysis showed that JcAACT, JcMDC and JcFPS encoded proteins that all had the highest identity and closest relationship with the corresponding genes in Hevea brasiliensis, with identities of 89%, 92% and 93%, respectively. JcAACT, JcMDC and JcFPS were expressed in all organs tested of J. curcas; the highest expression level for each gene occurred in seeds. In the early growth stage of seeds, the expression level of each of these three genes increased with time, with JcAACT and JcMDC expression level reaching a peak at the late stage of seed development (50 d), while JcFPS expression level reached a peak at the mid-late stage (40 d). Following the peak, the expression of each gene then declined. The expression level of JcAACT was the highest of the three genes, regardless of the organ or the stage of seed growth, indicating its important role in J. curcas. This study lays the foundation for a better understanding of the important role of the JcAACT, JcMDC and JcFPS genes in the terpenoid biosynthesis pathway of J. curcas. (author)
Drop, Bartłomiej; Strycharz-Dudziak, Małgorzata; Kliszczewska, Ewa; Polz-Dacewicz, Małgorzata
2017-01-01
Most research providing evidence for the role of oncogenic viruses in head and neck squamous cell carcinoma (SCC) development is focused on one type of virus without analyzing possible interactions between two or more types of viruses. The aim of this study was to analyse the prevalence of co-infection with human papillomavirus (HPV), Epstein–Barr virus (EBV) and polyoma BK virus (BKPyV) in oral, oropharyngeal and laryngeal squamous cell carcinomas in Polish patients. The correlations between...
International Nuclear Information System (INIS)
Barra, Yves; Imbert, Jean; Planche, Jacqueline; Meyer, Georges.
1977-01-01
Peritoneal Mouse macrophages were used to study the stimulation of cell DNA synthesis by polyoma virus. Using ultraviolet-irradiated polyoma virus, it was possible to show a difference between the inactivation of infectivity and of induction of DNA synthesis. By statistical analysis of these two phenomena it was found that 39% of the viral genome is necessary for the induction of cell DNA synthesis [fr
de Abreu Corrêa, Adriana; Carratala, Anna; Barardi, Celia Regina Monte; Calvo, Miquel; Bofill-Mas, Sílvia
2012-01-01
Viruses excreted by humans affect the commercial and recreational use of coastal water. Shellfish produced in contaminated waters have been linked to many episodes and outbreaks of viral gastroenteritis, as well as other food-borne diseases worldwide. The risk can be reduced by appropriate treatment following harvesting and by depuration. The kinetics of inactivation of murine norovirus 1 and human adenovirus 2 in natural and artificial seawater by free available chlorine was studied by quantifying genomic copies (GC) using quantitative PCR and infectious viral particles (PFU). Human JC polyomavirus Mad4 kinetics were evaluated by quantitative PCR. DNase or RNase were used to eliminate free genomes and assess potential viral infectivity when molecular detection was performed. At 30 min of assay, human adenovirus 2 showed 2.6- and 2.7-log10 GC reductions and a 2.3- and 2.4-log10 PFU reductions in natural and artificial seawater, respectively, and infectious viral particles were still observed at the end of the assay. When DNase was used prior to the nucleic acid extraction the kinetic of inactivation obtained by quantitative PCR was statistically equivalent to the one observed by infectivity assays. For murine norovirus 1, 2.5, and 3.5-log10 GC reductions were observed in natural and artificial seawater, respectively, while no viruses remained infectious after 30 min of contact with chlorine. Regarding JC polyomavirus Mad4, 1.5- and 1.1-log10 GC reductions were observed after 30 min of contact time. No infectivity assays were conducted for this virus. The results obtained provide data that might be applicable to seawater used in shellfish depuration. PMID:22773637
DEFF Research Database (Denmark)
Duedahl, Poul
I mange år var det en almindelig antagelse, at statsminister J.C. Christensens dagbøger var blevet brændt efter hans død. Nu er hans dagbøger fra årene 1900-09 imidlertid dukket op, og de giver et indblik i dansk politik i årene omkring Systemskiftet. Dagbøgerne dækker den periode, hvor J.C...... af justitsminister P.A. Albertis bedragerier og optakten til en rigsretssag. De tyve små dagbøger indeholder optegnelser om stort og småt fra perioden. De tjente som et sted, hvor den normalt tillukkede J.C. Christensen fik luft for private og ikke mindst politiske bekymringer, og mange af aktørerne...... i det politiske liv blev i dagbøgerne udsat for skarpe bemærkninger. J.C. Christensens dagbøger giver et enestående indblik i et stykke Danmarkshistorie set fra første række....
Could JC virus provoke metastasis in colon cancer?
Sinagra, Emanuele; Raimondo, Dario; Gallo, Elena; Stella, Mario; Cottone, Mario; Orlando, Ambrogio; Rossi, Francesca; Orlando, Emanuele; Messina, Marco; Tomasello, Giovanni; Lo Monte, Attilio Ignazio; La Rocca, Ennio; Rizzo, Aroldo Gabriele
2014-01-01
AIM: To evaluate the prevalence of John Cunningham virus (JC virus) in a small cohort of patients with colon cancer and to assess its presence in hepatic metastasis. METHODS: Nineteen consecutive patients with histologically diagnosed colon cancer were included in our study, together with ten subjects affected by histologically and serologically diagnosed hepatitis C virus infection. In the patients included in the colon cancer group, JC virus was searched for in the surgical specimen; in the control group, JC virus was searched for in the hepatic biopsy. The difference in the prevalence of JC virus in the hepatic biopsy between the two groups was assessed through the χ2 test. RESULTS: Four out of 19 patients with colon cancer had a positive polymerase chain reaction (PCR) test for JC virus, and four had liver metastasis. Among the patients with liver metastasis, three out of four had a positive PCR test for JC virus in the surgical specimen and in the liver biopsy; the only patient with liver metastasis with a negative test for JC virus also presented a negative test for JC virus in the surgical specimen. In the control group of patients with hepatitis C infection, none of the ten patients presented JC virus infection in the hepatic biopsy. The difference between the two groups regarding JC virus infection was statistically significant (χ2 = 9.55, P = 0.002). CONCLUSION: JC virus may play a broader role than previously thought, and may be mechanistically involved in the late stages of these tumors. PMID:25400458
Costa, Helen P S; Oliveira, Jose T A; Sousa, Daniele O B; Morais, Janne K S; Moreno, Frederico B; Monteiro-Moreira, Ana Cristina O; Viegas, Ricardo A; Vasconcelos, Ilka M
2014-01-01
Jatropha curcas seed cake is a low-value by-product resulting from biodiesel production. The seed cake is highly toxic, but it has great potential for biotechnology applications as it is a repository of biomolecules that could be important in agriculture, medicine, and industry. To explore this potential, a novel trypsin inhibitor called JcTI-I was purified by fractionation of the crude extract with trichloroacetic acid (2.5%, v/v) followed by affinity chromatography (Trypsin-Sepharose 4B) and molecular exclusion (Sephacryl S-200). Non-reducing sodium dodecyl sulfate-polyacrylamide gel electrophoresis and gel filtration showed that JcTI-I has approximately 20.0~kDa. Mass spectrometry analysis revealed that the intact molecular mass of JcTI-I is 10.252~kDa. Moreover, JcTI-I is a glycoprotein with 6.4% (m/m) carbohydrates, pI of 6.6, N-terminal sequence similarity around 60% to plant albumins and high stability to heat, pH, and salinity. JcTI-I presented antibacterial activity against the human pathogenic bacteria Salmonella enterica subspecies enterica serovar choleraesuis and Staphylococcus aureus, with minimum inhibitory concentration less than 5~μg/mL. Furthermore, JcTI-I did have inhibitory activity against the serine proteases from the tested bacteria. Otherwise, no hemolytic activity of human erythrocytes and signs of acute toxicity to mice were observed for JcTI-I. The results demonstrate the benefits of J. curcas seed cake as a source of trypsin inhibitor with potential for biotechnological application as a new antimicrobial agent against human pathogenic bacteria.
Directory of Open Access Journals (Sweden)
Helen Paula S Costa
2014-01-01
Full Text Available Jatropha curcas seed cake is a low-value by-product resulting from biodiesel production. The seed cake is highly toxic, but it has great potential for biotechnology applications as it is a repository of biomolecules that could be important in agriculture, medicine and industry. To explore this potential, a novel trypsin inhibitor called JcTI-I was purified by fractionation of the crude extract with trichloroacetic acid (2.5%, v/v followed by affinity chromatography (Trypsin-Sepharose 4B and molecular exclusion (Sephacryl S-200. Non-reducing SDS-PAGE and gel filtration showed that JcTI-I has approximately 20.0 kDa. Mass spectrometry analysis revealed that the intact molecular mass of JcTI-I is 10.252 kDa. Moreover, JcTI-I is a glycoprotein with 6.4% (m/m carbohydrates, pI of 6.6, N-terminal sequence similarity around 60% to plant albumins and high stability to heat, pH and salinity. JcTI-I presented antibacterial activity against the human pathogenic bacteria Salmonella enterica subspecies enterica serovar choleraesuis and Staphylococcus aureus, with minimum inhibitory concentration (MIC less than 5 µg/mL. Furthermore, JcTI-I did have inhibitory activity against the serine proteases from the tested bacteria. Otherwise, no hemolytic activity of human erythrocytes and signs of acute toxicity to mice were observed for JcTI-I. The results demonstrate the benefits of J. curcas seed cake as a source of trypsin inhibitor with potential for biotechnological application as a new antimicrobial agent against human pathogenic bacteria.
Infectious Entry and Neutralization of Pathogenic JC Polyomaviruses
Directory of Open Access Journals (Sweden)
Eileen M. Geoghegan
2017-10-01
Full Text Available Summary: Progressive multifocal leukoencephalopathy (PML is a lethal brain disease caused by uncontrolled replication of JC polyomavirus (JCV. JCV strains recovered from the brains of PML patients carry mutations that prevent the engagement of sialylated glycans, which are thought to serve as receptors for the infectious entry of wild-type JCV. In this report, we show that non-sialylated glycosaminoglycans (GAGs can serve as alternative attachment receptors for the infectious entry of both wild-type and PML mutant JCV strains. After GAG-mediated attachment, PML mutant strains engage non-sialylated non-GAG co-receptor glycans, such as asialo-GM1. JCV-neutralizing monoclonal antibodies isolated from patients who recovered from PML appear to block infection by preventing the docking of post-attachment co-receptor glycans in an apical pocket of the JCV major capsid protein. Identification of the GAG-dependent/sialylated glycan-independent alternative entry pathway should facilitate the development of infection inhibitors, including recombinant neutralizing antibodies. : Geoghegan et al. show that JC polyomavirus strains that cause brain disease infect cells via a pathway involving a heparin-like attachment receptor and a non-sialylated co-receptor. Candidate therapeutic human monoclonal antibodies neutralize by blocking co-receptor engagement. Keywords: polyomavirus, JC, BK, SV40, progressive multifocal leukoencephalopathy, PML, monoclonal antibody, mAb, virus entry, receptor
Performance of Microbial Concrete Developed Using Bacillus Subtilus JC3
Rao, M. V. Seshagiri; Reddy, V. Srinivasa; Sasikala, Ch.
2017-12-01
Concrete is vulnerable to deterioration, corrosion, and cracks, and the consequent damage and loss of strength requires immensely expensive remediation and repair. So need for special concrete that they would respond to crack formation with an autonomous self-healing action lead to research and development of microbial concrete. The microbial concrete works on the principle of calcite mineral precipitation by a specific group of alkali-resistant spore-forming bacteria related to the genus Bacillus called Bacillus subtilis JC3, this phenomenon is called biomineralization or Microbiologically Induced Calcite Crystal Precipitation. Bacillus subtilis JC3, a common soil bacterium, has inherent ability to precipitate calcite crystals continuously which enhances the strength and durability performance of concrete enormously. This microbial concrete can be called as a "Self healing Bacterial Concrete" because it can remediate its cracks by itself without any human intervention and would make the concrete more durable and sustainable. This paper discuss the incorporation of microorganism Bacillus subtilis JC3 (developed at JNTU, India) into concrete and presents the results of experimental investigations carried out to study the improved durability and sustainability characteristics of microbial concrete.
Association between the JC polyomavirus infection and male infertility.
Directory of Open Access Journals (Sweden)
Manola Comar
Full Text Available In recent years the incidence of male infertility has increased. Many risk factors have been taken into consideration, including viral infections. Investigations into viral agents and male infertility have mainly been focused on human papillomaviruses, while no reports have been published on polyomaviruses and male infertility. The aim of this study was to verify whether JC virus and BK virus are associated with male infertility. Matched semen and urine samples from 106 infertile males and 100 fertile males, as controls, were analyzed. Specific PCR analyses were carried out to detect and quantify large T (Tag coding sequences of JCV and BKV. DNA sequencing, carried out in Tag JCV-positive samples, was addressed to viral protein 1 (VP1 coding sequences. The prevalence of JCV Tag sequences in semen and urine samples from infertile males was 34% (72/212, whereas the BKV prevalence was 0.94% (2/212. Specifically, JCV Tag sequences were detected in 24.5% (26/106 of semen and 43.4% (46/106 of urine samples from infertile men. In semen and urine samples from controls the prevalence was 11% and 28%, respectively. A statistically significant difference (p<0.05 in JCV prevalence was disclosed in semen and urine samples of cases vs. controls. A higher JC viral DNA load was detected in samples from infertile males than in controls. In samples from infertile males the JC virus type 2 strain, subtype 2b, was more prevalent than ubiquitous type 1. JCV type 2 strain infection has been found to be associated with male infertility. These data suggest that the JC virus should be taken into consideration as an infectious agent which is responsible for male infertility.
Molecular Epidemiology of Human Polyomavirus JC in the Biaka Pygmies and Bantu of Central Africa
Directory of Open Access Journals (Sweden)
Sylvester C Chima
1998-09-01
Full Text Available Polyomavirus JC (JCV is ubiquitous in humans and causes a chronic demyelinating disease of the central nervous system , progressive multifocal leukoencephalopathy which is common in AIDS. JCV is excreted in urine of 30-70% of adults worldwide. Based on sequence analysis of JCV complete genomes or fragments thereof, JCV can be classified into geographically derived genotypes. Types 1 and 2 are of European and Asian origin respectively while Types 3 and 6 are African in origin. Type 4, a possible recombinant of European and African genotypes (1 and 3 is common in the USA. To delineate the JCV genotypes in an aboriginal African population, random urine samples were collected from the Biaka Pygmies and Bantu from the Central African Republic. There were 43 males and 25 females aged 4-55 years, with an average age of 26 years. After PCR amplification of JCV in urine, products were directly cycle sequenced. Five of 23 Pygmy adults (22% and four of 20 Bantu adults (20% were positive for JC viruria. DNA sequence analysis revealed JCV Type 3 (two, Type 6 (two and one Type 1 variant in Biaka Pygmies. All the Bantu strains were Type 6. Type 3 and 6 strains of JCV are the predominant strains in central Africa. The presence of multiple subtypes of JCV in Biaka Pygmies may be a result of extensive interactions of Pygmies with their African tribal neighbors during their itinerant movements in the equatorial forest.
JC polyomavirus infection is strongly controlled by human leucocyte antigen class II variants.
Directory of Open Access Journals (Sweden)
Emilie Sundqvist
2014-04-01
Full Text Available JC polyomavirus (JCV carriers with a compromised immune system, such as in HIV, or subjects on immune-modulating therapies, such as anti VLA-4 therapy may develop progressive multifocal leukoencephalopathy (PML which is a lytic infection of oligodendrocytes in the brain. Serum antibodies to JCV mark infection occur only in 50-60% of infected individuals, and high JCV-antibody titers seem to increase the risk of developing PML. We here investigated the role of human leukocyte antigen (HLA, instrumental in immune defense in JCV antibody response. Anti-JCV antibody status, as a surrogate for JCV infection, were compared to HLA class I and II alleles in 1621 Scandinavian persons with MS and 1064 population-based Swedish controls and associations were replicated in 718 German persons with MS. HLA-alleles were determined by SNP imputation, sequence specific (SSP kits and a reverse PCR sequence-specific oligonucleotide (PCR-SSO method. An initial GWAS screen displayed a strong HLA class II region signal. The HLA-DRB1*15 haplotype was strongly negatively associated to JCV sero-status in Scandinavian MS cases (OR = 0.42, p = 7×10(-15 and controls (OR = 0.53, p = 2×10(-5. In contrast, the DQB1*06:03 haplotype was positively associated with JCV sero-status, in Scandinavian MS cases (OR = 1.63, p = 0.006, and controls (OR = 2.69, p = 1×10(-5. The German dataset confirmed these findings (OR = 0.54, p = 1×10(-4 and OR = 1.58, p = 0.03 respectively for these haplotypes. HLA class II restricted immune responses, and hence CD4+ T cell immunity is pivotal for JCV infection control. Alleles within the HLA-DR1*15 haplotype are associated with a protective effect on JCV infection. Alleles within the DQB1*06:03 haplotype show an opposite association. These associations between JC virus antibody response and human leucocyte antigens supports the notion that CD4+ T cells are crucial in the immune defence to JCV and
Basara, N.; Rasche, F.-M.; Schwalenberg, T.; Wickenhauser, C.; Maier, M.; Ivovic, J.; Niederwieser, D.; Lindner, T. H.
2010-01-01
We report here a case of acute lymphoblastic leukemia in remission presenting a late-onset bilateral hydronephrosis probably due to polyoma BK virus-induced proliferation of bladder endothelium on both ostii. The diagnosis was made virologically by BK virus Polymerase Chain Reaction (PCR) detection in the absence of any other bladder disease. Awareness of this late complication is necessary not only in patients after renal transplantation but also in patients after hematopoietic stem cell tra...
Basara, N; Rasche, F-M; Schwalenberg, T; Wickenhauser, C; Maier, M; Ivovic, J; Niederwieser, D; Lindner, T H
2010-01-01
We report here a case of acute lymphoblastic leukemia in remission presenting a late-onset bilateral hydronephrosis probably due to polyoma BK virus-induced proliferation of bladder endothelium on both ostii. The diagnosis was made virologically by BK virus Polymerase Chain Reaction (PCR) detection in the absence of any other bladder disease. Awareness of this late complication is necessary not only in patients after renal transplantation but also in patients after hematopoietic stem cell transplantation from matched unrelated donor.
Basara, N.; Rasche, F.-M.; Schwalenberg, T.; Wickenhauser, C.; Maier, M.; Ivovic, J.; Niederwieser, D.; Lindner, T. H.
2010-01-01
We report here a case of acute lymphoblastic leukemia in remission presenting a late-onset bilateral hydronephrosis probably due to polyoma BK virus-induced proliferation of bladder endothelium on both ostii. The diagnosis was made virologically by BK virus Polymerase Chain Reaction (PCR) detection in the absence of any other bladder disease. Awareness of this late complication is necessary not only in patients after renal transplantation but also in patients after hematopoietic stem cell transplantation from matched unrelated donor. PMID:20936157
Directory of Open Access Journals (Sweden)
N. Basara
2010-01-01
Full Text Available We report here a case of acute lymphoblastic leukemia in remission presenting a late-onset bilateral hydronephrosis probably due to polyoma BK virus-induced proliferation of bladder endothelium on both ostii. The diagnosis was made virologically by BK virus Polymerase Chain Reaction (PCR detection in the absence of any other bladder disease. Awareness of this late complication is necessary not only in patients after renal transplantation but also in patients after hematopoietic stem cell transplantation from matched unrelated donor.
Characterization of the Tetraspan Junctional Complex (4JC) superfamily.
Chou, Amy; Lee, Andre; Hendargo, Kevin J; Reddy, Vamsee S; Shlykov, Maksim A; Kuppusamykrishnan, Harikrishnan; Medrano-Soto, Arturo; Saier, Milton H
2017-03-01
Connexins or innexins form gap junctions, while claudins and occludins form tight junctions. In this study, statistical data, derived using novel software, indicate that these four junctional protein families and eleven other families of channel and channel auxiliary proteins are related by common descent and comprise the Tetraspan (4 TMS) Junctional Complex (4JC) Superfamily. These proteins all share similar 4 transmembrane α-helical (TMS) topologies. Evidence is presented that they arose via an intragenic duplication event, whereby a 2 TMS-encoding genetic element duplicated tandemly to give 4 TMS proteins. In cases where high resolution structural data were available, the conclusion of homology was supported by conducting structural comparisons. Phylogenetic trees reveal the probable relationships of these 15 families to each other. Long homologues containing fusions to other recognizable domains as well as internally duplicated or fused domains are reported. Large "fusion" proteins containing 4JC domains proved to fall predominantly into family-specific patterns as follows: (1) the 4JC domain was N-terminal; (2) the 4JC domain was C-terminal; (3) the 4JC domain was duplicated or occasionally triplicated and (4) mixed fusion types were present. Our observations provide insight into the evolutionary origins and subfunctions of these proteins as well as guides concerning their structural and functional relationships. Copyright © 2016 Elsevier B.V. All rights reserved.
Vilkin, Alex; Niv, Yaron
2011-04-01
Incorporation of viral DNA may interfere with the normal sequence of human DNA bases on the genetic level or cause secondary epigenetic changes such as gene promoter methylation or histone acetylation. Colorectal cancer (CRC) is the second leading cause of cancer mortality in the USA. Chromosomal instability (CIN) was established as the key mechanism in cancer development. Later, it was found that CRC results not only from the progressive accumulation of genetic alterations but also from epigenetic changes. JC virus (JCV) is a candidate etiologic factor in sporadic CRC. It may act by stabilizing β-catenin, facilitating its entrance to the cell nucleus, initialing proliferation and cancer development. Diploid CRC cell lines transfected with JCV-containing plasmids developed CIN. This result provides direct experimental evidence for the ability of JCV T-Ag to induce CIN in the genome of colonic epithelial cells. The association of CRC hMLH1 methylation and tumor positivity for JCV was recently documented. JC virus T-Ag DNA sequences were found in 77% of CRCs and are associated with promoter methylation of multiple genes. hMLH1 was methylated in 25 out of 80 CRC patients positive for T-Ag (31%) in comparison with only one out of 11 T-Ag negative cases (9%). Thus, JCV can mediate both CIN and aberrant methylation in CRC. Like other viruses, chronic infection with JCV may induce CRC by different mechanisms which should be further investigated. Thus, gene promoter methylation induced by JCV may be an important process in CRC and the polyp-carcinoma sequence.
Thickness dependence of J_c (0) in MgB_2 films
International Nuclear Information System (INIS)
Chen, Yiling; Yang, Can; Jia, Chunyan; Feng, Qingrong; Gan, Zizhao
2016-01-01
Highlights: • A serial of MgB_2 superconducting films from 10 nm to 8 µm have been prepared. • T_c and J_c (5 K, 0 T) of films are high. • J_c (5 K, 0 T) reaches its maximum 2.3 × 10"8 A cm"−"2 for 100 nm films. • The relationship between thickness and J_c has been discussed in detail. - Abstract: MgB_2 superconducting films, whose thicknesses range from 10 nm to 8 µm, have been fabricated on SiC substrates by hybrid physical–chemical vapor deposition (HPCVD) method. It is the first time that the T_c and the J_c of MgB_2 films are studied on such a large scale. It is found that with the increasing of thickness, T_c elevates first and then keeps roughly stable except for some slight fluctuations, while J_c (5 K, 0 T) experiences a sharp increase followed by a relatively slow fall. The maximum J_c (5 K, 0 T) = 2.3 × 10"8 A cm"−"2 is obtained for 100 nm films, which is the experimental evidence for preparing high-quality MgB_2 films by HPCVD method. Thus, this work may provide guidance on choosing the suitable thickness for applications. Meanwhile, the films prepared by us cover ultrathin films, thin films and thick films, so the study on them will bring a comprehensive understanding of MgB_2 films.
Protection against polyoma virus-induced tumors is perforin-independent
International Nuclear Information System (INIS)
Byers, Anthony M.; Hadley, Annette; Lukacher, Aron E.
2007-01-01
CD8 T cells are necessary for controlling tumors induced by mouse polyoma virus (PyV), but the effector mechanism(s) responsible have not been determined. We examined the PyV tumorigenicity in C57BL/6 mice mutated in Fas or carrying targeted disruptions in the perforin gene or in both TNF receptor type I and type II genes. Surprisingly, none of these mice developed tumors. Perforin/Fas double-deficient radiation bone marrow chimeric mice were also resistant to PyV-induced tumors. Anti-PyV CD8 T cells in perforin-deficient mice were found not to differ from wild type mice with respect to phenotype, capacity to produce cytokines or maintenance of memory T cells, indicating that perforin does not modulate the PyV-specific CD8 T cell response. In addition, virus was cleared and persisted to similar extents in wild type and perforin-deficient mice. In summary, perforin/granzyme exocytosis is not an essential effector pathway for protection against PyV infection or tumorigenesis
International Nuclear Information System (INIS)
Jaeger, T.; Ring, J.; Andres, C.
2012-01-01
Merkel cell carcinoma is a rare, but highly malignant tumor of the skin with high rates of metastasis and poor survival. Its incidence rate rises and is currently about 0.6/100000/year. Clinical differential diagnoses include basal cell carcinoma, cyst, a melanotic melanoma, lymphoma and atypical fibroxanthoma. In this review article clinical, histopathological and immunohistochemical features of Merkel cell carcinoma are reported. In addition, the role of Merkel cell polyoma virus is discussed.
International Nuclear Information System (INIS)
Eberhart, Charles G; Chaudhry, Aneeka; Daniel, Richard W; Khaki, Leila; Shah, Keerti V; Gravitt, Patti E
2005-01-01
p53 mutations are relatively uncommon in medulloblastoma, but abnormalities in this cell cycle pathway have been associated with anaplasia and worse clinical outcomes. We correlated p53 protein expression with pathological subtype and clinical outcome in 75 embryonal brain tumors. The presence of JC virus, which results in p53 protein accumulation, was also examined. p53 protein levels were evaluated semi-quantitatively in 64 medulloblastomas, 3 atypical teratoid rhabdoid tumors (ATRT), and 8 supratentorial primitive neuroectodermal tumors (sPNET) using immunohistochemistry. JC viral sequences were analyzed in DNA extracted from 33 frozen medulloblastoma and PNET samples using quantitative polymerase chain reaction. p53 expression was detected in 18% of non-anaplastic medulloblastomas, 45% of anaplastic medulloblastomas, 67% of ATRT, and 88% of sPNET. The increased p53 immunoreactivity in anaplastic medulloblastoma, ATRT, and sPNET was statistically significant. Log rank analysis of clinical outcome revealed significantly shorter survival in patients with p53 immunopositive embryonal tumors. No JC virus was identified in the embryonal brain tumor samples, while an endogenous human retrovirus (ERV-3) was readily detected. Immunoreactivity for p53 protein is more common in anaplastic medulloblastomas, ATRT and sPNET than in non-anaplastic tumors, and is associated with worse clinical outcomes. However, JC virus infection is not responsible for increased levels of p53 protein
Directory of Open Access Journals (Sweden)
Shah Keerti V
2005-02-01
Full Text Available Abstract Background p53 mutations are relatively uncommon in medulloblastoma, but abnormalities in this cell cycle pathway have been associated with anaplasia and worse clinical outcomes. We correlated p53 protein expression with pathological subtype and clinical outcome in 75 embryonal brain tumors. The presence of JC virus, which results in p53 protein accumulation, was also examined. Methods p53 protein levels were evaluated semi-quantitatively in 64 medulloblastomas, 3 atypical teratoid rhabdoid tumors (ATRT, and 8 supratentorial primitive neuroectodermal tumors (sPNET using immunohistochemistry. JC viral sequences were analyzed in DNA extracted from 33 frozen medulloblastoma and PNET samples using quantitative polymerase chain reaction. Results p53 expression was detected in 18% of non-anaplastic medulloblastomas, 45% of anaplastic medulloblastomas, 67% of ATRT, and 88% of sPNET. The increased p53 immunoreactivity in anaplastic medulloblastoma, ATRT, and sPNET was statistically significant. Log rank analysis of clinical outcome revealed significantly shorter survival in patients with p53 immunopositive embryonal tumors. No JC virus was identified in the embryonal brain tumor samples, while an endogenous human retrovirus (ERV-3 was readily detected. Conclusion Immunoreactivity for p53 protein is more common in anaplastic medulloblastomas, ATRT and sPNET than in non-anaplastic tumors, and is associated with worse clinical outcomes. However, JC virus infection is not responsible for increased levels of p53 protein.
Eberhart, Charles G; Chaudhry, Aneeka; Daniel, Richard W; Khaki, Leila; Shah, Keerti V; Gravitt, Patti E
2005-01-01
Background p53 mutations are relatively uncommon in medulloblastoma, but abnormalities in this cell cycle pathway have been associated with anaplasia and worse clinical outcomes. We correlated p53 protein expression with pathological subtype and clinical outcome in 75 embryonal brain tumors. The presence of JC virus, which results in p53 protein accumulation, was also examined. Methods p53 protein levels were evaluated semi-quantitatively in 64 medulloblastomas, 3 atypical teratoid rhabdoid tumors (ATRT), and 8 supratentorial primitive neuroectodermal tumors (sPNET) using immunohistochemistry. JC viral sequences were analyzed in DNA extracted from 33 frozen medulloblastoma and PNET samples using quantitative polymerase chain reaction. Results p53 expression was detected in 18% of non-anaplastic medulloblastomas, 45% of anaplastic medulloblastomas, 67% of ATRT, and 88% of sPNET. The increased p53 immunoreactivity in anaplastic medulloblastoma, ATRT, and sPNET was statistically significant. Log rank analysis of clinical outcome revealed significantly shorter survival in patients with p53 immunopositive embryonal tumors. No JC virus was identified in the embryonal brain tumor samples, while an endogenous human retrovirus (ERV-3) was readily detected. Conclusion Immunoreactivity for p53 protein is more common in anaplastic medulloblastomas, ATRT and sPNET than in non-anaplastic tumors, and is associated with worse clinical outcomes. However, JC virus infection is not responsible for increased levels of p53 protein. PMID:15717928
El-Cheikh, Jean; Fürst, Sabine; Casalonga, Francois; Crocchiolo, Roberto; Castagna, Luca; Granata, Angela; Oudin, Claire; Faucher, Catherine; Berger, Pierre; Sarran, Anthony; Blaise, Didier
2012-01-01
We report here the case of progressive multifocal leukoencephalopathy (PML) related to human polyomavirus JC (JCV) infection after an allogeneic transplantation with umbilical cord blood cells in 59-year-old woman with follicular Non Hodgkin lymphoma. She presented with dysphagia and weakness; magnetic resonance imaging demonstrated marked signal abnormality in the sub-cortical white matter of the left frontal lobe and in the posterior limb of the right internal capsule. Polymerase chain reaction (PCR) analysis of the cerebrospinal fluid (CSF) was positive for John Cunningham (JC) virus. JC viral DNA in the CSF was positive, establishing the diagnosis of PML. Brain biopsy was not done. Extensive investigations for other viral infections seen in immuno-compromised patients were negative. The patient's neurologic deficits rapidly increased throughout her hospital stay, and she died one month after the diagnosis. These findings could have practical implications and demonstrate that in patients presenting neurological symptoms and radiological signs after UCBT, the JCV encephalitis must be early suspected.
International Nuclear Information System (INIS)
Gee, Gretchen V.; Manley, Kate; Atwood, Walter J.
2003-01-01
JC virus (JCV) is a common human polyomavirus that infects 70-80% of the population worldwide. In immunosuppressed individuals, JCV infects oligodendrocytes and causes a fatal demyelinating disease known as progressive multifocal leukoencephalopathy (PML). The tropism of JCV is restricted to oligodendrocytes, astrocytes, and B lymphocytes. Several mechanisms may contribute to the restricted tropism of JCV, including the presence or absence of cell-type-specific transcription and replication factors and the presence or absence of cell-type-specific receptors. We have established a system to investigate cellular factors that influence viral tropism by selecting JCV-resistant cells from a susceptible glial cell line (SVG-A). SVG-A cells were subjected to several rounds of viral infection using JC virus (M1/SVEΔ). A population of resistant cells emerged (SVGR2) that were refractory to infection with the Mad-4 strain of JCV, the hybrid virus M1/SVEΔ, as well as to the related polyomavirus SV40. SVGR2 cells were as susceptible as the SVG-A cells to infection with an unrelated amphotropic retrovirus. The stage at which these cells are resistant to infection was investigated and the block appears to be at early viral gene transcription. This system should ultimately allow us to identify glial specific factors that influence the tropism of JCV
Tao, Yan-Bin; He, Liang-Liang; Niu, Long-Jian; Xu, Zeng-Fu
2015-04-01
The JcUEP promoter is active constitutively in the bio-fuel plant Jatropha curcas , and is an alternative to the widely used CaMV35S promoter for driving constitutive overexpression of transgenes in Jatropha. Well-characterized promoters are required for transgenic breeding of Jatropha curcas, a biofuel feedstock with great potential for production of bio-diesel and bio-jet fuel. In this study, an ubiquitin extension protein gene from Jatropha, designated JcUEP, was identified to be ubiquitously expressed. Thus, we isolated a 1.2 kb fragment of the 5' flanking region of JcUEP and evaluated its activity as a constitutive promoter in Arabidopsis and Jatropha using the β-glucuronidase (GUS) reporter gene. As expected, histochemical GUS assay showed that the JcUEP promoter was active in all Arabidopsis and Jatropha tissues tested. We also compared the activity of the JcUEP promoter with that of the cauliflower mosaic virus 35S (CaMV35S) promoter, a well-characterized constitutive promoter conferring strong transgene expression in dicot species, in various tissues of Jatropha. In a fluorometric GUS assay, the two promoters showed similar activities in stems, mature leaves and female flowers; while the CaMV35S promoter was more effective than the JcUEP promoter in other tissues, especially young leaves and inflorescences. In addition, the JcUEP promoter retained its activity under stress conditions in low temperature, high salt, dehydration and exogenous ABA treatments. These results suggest that the plant-derived JcUEP promoter could be an alternative to the CaMV35S promoter for driving constitutive overexpression of transgenes in Jatropha and other plants.
Det danske landskab. De danske malere på J.C. Dahls tid
DEFF Research Database (Denmark)
Monrad, Kasper
Om værker af Jens Juel, C.W. Eckersberg, J.C. Dahl, Thomas Fearnley, Christen Købke, Johan Thomas Lundbye, Peter Christian Skovgaard, Dankvart Dreyer, Vilhelm Kyhn, Janus la Cour......Om værker af Jens Juel, C.W. Eckersberg, J.C. Dahl, Thomas Fearnley, Christen Købke, Johan Thomas Lundbye, Peter Christian Skovgaard, Dankvart Dreyer, Vilhelm Kyhn, Janus la Cour...
#GeriMedJC: The Twitter Complement to the Traditional-Format Geriatric Medicine Journal Club.
Gardhouse, Amanda I; Budd, Laura; Yang, Seu Y C; Wong, Camilla L
2017-06-01
Twitter is a public microblogging platform that overcomes physical limitations and allows unrestricted participation beyond academic silos, enabling interactive discussions. Twitter-based journal clubs have demonstrated growth, sustainability, and worldwide communication, using a hashtag (#) to follow participation. This article describes the first year of #GeriMedJC, a monthly 1-hour live, 23-hour asynchronous Twitter-based complement to the traditional-format geriatric medicine journal club. The Twitter moderator tweets from the handle @GeriMedJC; encourages use of #GeriMedJC; and invites content experts, study authors, and followers to participate in critical appraisal of medical literature. Using the hashtag #GeriMedJC, tweets were categorized according to thematic content, relevance to the journal club, and authorship. Third-party analytical tools Symplur and Twitter Analytics were used for growth and effect metrics (number of followers, participants, tweets, retweets, replies, impressions). Qualitative analysis of follower and participant profiles was used to establish country of origin and occupation. A semistructured interview of postgraduate trainees was conducted to ascertain qualitative aspects of the experience. In the first year, @GeriMedJC has grown to 541 followers on six continents. Most followers were physicians (43%), two-thirds of which were geriatricians. Growth metrics increased over 12 months, with a mean of 121 tweets, 25 participants, and 105,831 impressions per journal club. Tweets were most often related to the article being appraised (87.5%) and ranged in thematic content from clinical practice (29%) to critical appraisal (24%) to medical education (20%). #GeriMedJC is a feasible example of using social media platforms such as Twitter to encourage international and interprofessional appraisal of medical literature. © 2017, Copyright the Authors Journal compilation © 2017, The American Geriatrics Society.
Anti-JC virus antibody prevalence in a multinational multiple sclerosis cohort
DEFF Research Database (Denmark)
Olsson, Tomas; Achiron, Anat; Alfredsson, Lars
2013-01-01
JC virus (JCV) is an opportunistic virus known to cause progressive multifocal leukoencephalopathy. Anti-JC virus (Anti-JCV) antibody prevalence in a large, geographically diverse, multi-national multiple sclerosis (MS) cohort was compared in a cross-sectional study. Overall, anti-JCV antibody...... prevalence was 57.6%. Anti-JCV antibody prevalence in MS patients ranged from approximately 47% to 68% across these countries: Norway, 47.4%; Denmark, 52.6%; Israel, 56.6%; France, 57.6%; Italy, 58.3%; Sweden, 59.0%; Germany, 59.1%; Austria, 66.7% and Turkey, 67.7%. Prevalence increased with age (from 49...
Directory of Open Access Journals (Sweden)
Mingyong Tang
2016-04-01
Full Text Available Jatropha curcas is a promising feedstock for biofuel production because Jatropha oil is highly suitable for the production of biodiesel and bio-jet fuels. However, Jatropha exhibits a low seed yield as a result of unreliable and poor flowering. APETALA1 (AP1 is a floral meristem and organ identity gene in higher plants. The flower meristem identity genes of Jatropha have not yet been identified or characterized. To better understand the genetic control of flowering in Jatropha, an AP1 homolog (JcAP1 was isolated from Jatropha. An amino acid sequence analysis of JcAP1 revealed a high similarity to the AP1 proteins of other perennial plants. JcAP1 was expressed in inflorescence buds, flower buds, sepals and petals. The highest expression level was observed during the early developmental stage of the flower buds. The overexpression of JcAP1 using the cauliflower mosaic virus (CaMV 35S promoter resulted in extremely early flowering and abnormal flowers in transgenic Arabidopsis plants. Several flowering genes downstream of AP1 were up-regulated in the JcAP1-overexpressing transgenic plant lines. Furthermore, JcAP1 overexpression rescued the phenotype caused by the Arabidopsis AP1 loss-of-function mutant ap1-11. Therefore, JcAP1 is an ortholog of AtAP1, which plays a similar role in the regulation of flowering in Arabidopsis. However, the overexpression of JcAP1 in Jatropha using the same promoter resulted in little variation in the flowering time and floral organs, indicating that JcAP1 may be insufficient to regulate flowering by itself in Jatropha. This study helps to elucidate the function of JcAP1 and contributes to the understanding of the molecular mechanisms of flower development in Jatropha.
Tang, Mingyong; Tao, Yan-Bin
2016-01-01
Jatropha curcas is a promising feedstock for biofuel production because Jatropha oil is highly suitable for the production of biodiesel and bio-jet fuels. However, Jatropha exhibits a low seed yield as a result of unreliable and poor flowering. APETALA1 (AP1) is a floral meristem and organ identity gene in higher plants. The flower meristem identity genes of Jatropha have not yet been identified or characterized. To better understand the genetic control of flowering in Jatropha, an AP1 homolog (JcAP1) was isolated from Jatropha. An amino acid sequence analysis of JcAP1 revealed a high similarity to the AP1 proteins of other perennial plants. JcAP1 was expressed in inflorescence buds, flower buds, sepals and petals. The highest expression level was observed during the early developmental stage of the flower buds. The overexpression of JcAP1 using the cauliflower mosaic virus (CaMV) 35S promoter resulted in extremely early flowering and abnormal flowers in transgenic Arabidopsis plants. Several flowering genes downstream of AP1 were up-regulated in the JcAP1-overexpressing transgenic plant lines. Furthermore, JcAP1 overexpression rescued the phenotype caused by the Arabidopsis AP1 loss-of-function mutant ap1-11. Therefore, JcAP1 is an ortholog of AtAP1, which plays a similar role in the regulation of flowering in Arabidopsis. However, the overexpression of JcAP1 in Jatropha using the same promoter resulted in little variation in the flowering time and floral organs, indicating that JcAP1 may be insufficient to regulate flowering by itself in Jatropha. This study helps to elucidate the function of JcAP1 and contributes to the understanding of the molecular mechanisms of flower development in Jatropha. PMID:27168978
Directory of Open Access Journals (Sweden)
Hui-Liang Li
2014-09-01
Full Text Available The cDNA encoding the R1-MYB transcription factor, designated as JcR1MYB1, was isolated from Jatropha curcas using rapid amplification of cDNA ends. JcR1MYB1 contains a 951 bp open reading frame that encodes 316 amino acids. The deduced JcR1MYB1 protein was predicted to possess the conserved, 56-amino acid-long DNA-binding domain, which consists of a single helix-turn-helix module and usually occurs in R1-MYBs. JcR1MYB1 is a member of the R1-MYB transcription factor subfamily. A subcellular localization study confirmed the nuclear localization of JcR1MYB1. Expression analysis showed that JcR1MYB1 transcripts accumulated in various examined tissues, with high expression levels in the root and low levels in the stem. JcR1MYB1 transcription was up-regulated by polyethylene glycol, NaCl, and cold treatments, as well as by abscisic acid, jasmonic acid, and ethylene treatment. Analysis of transgenic tobacco plants over-expressing JcR1MYB1 indicates an inportant function for this gene in salt stress.
The effect of silver nanoparticle size on Jc of YBa2Cu3O7-x superconductor
International Nuclear Information System (INIS)
Farbod, M.; Batvandi, M.; Shoushtari, M. Z.
2007-01-01
Full text: Critical current density Jc is one of the most important superconducting parameters which is crucial in superconductor's applications. Introducing silver into the superconductors as intergrain filler has been a routine way to increase the Jc. In this work, YBa 2 Cu 3 O 7-x (YBCO), was doped by silver nanoparticles and their effect was studied on Jc as the flux pinning centers. Silver nanoparticles with sizes ranging from 30 to 1000 nm have been prepared using the reduction of silver in ethanol. The stoichiometric amounts of initial material of YBCO superconductor were added to the solution. After evaporation of ethanol, the obtained powder was used to fabricate YBCO samples. The total weight ratio of silver nanoparticles to superconductor was 1:100. The samples were characterized using SEM, EDX and XRD measurements. Jc was measured by a standard four probe technique. The results show by increasing silver nanoparticle size up to 700 nm, Jc increases then decreases by further increase in silver particle size. (authors)
Tushar, L.; Sasi Jyothsna, T. S.; Sasikala, C.; Ramana, C. V.
2015-01-01
We announce the draft genome sequence of Clostridium sp. JC272, isolated from a sediment sample collected from marine habitats of Gujarat, India. Clostridium sp. JC272 is an obligate anaerobe and has the ability to produce antimicrobial compounds. The genome sequence indicates the strain?s capability of producing small peptides (microcins), which are potential novel antibiotics.
JC Polyomavirus (JCV and Monoclonal Antibodies: Friends or Potential Foes?
Directory of Open Access Journals (Sweden)
Roberta Antonia Diotti
2013-01-01
Full Text Available Progressive multifocal leukoencephalopathy (PML is a demyelinating disease of the central nervous system (CNS, observed in immunodeficient patients and caused by JC virus ((JCV, also called JC polyomavirus (JCPyV. After the HIV pandemic and the introduction of immunomodulatory therapy, the PML incidence significantly increased. The correlation between the use of natalizumab, a drug used in multiple sclerosis (MS, and the PML development of particular relevance. The high incidence of PML in natalizumab-treated patients has highlighted the importance of two factors: the need of PML risk stratification among natalizumab-treated patients and the need of effective therapeutic options. In this review, we discuss these two needs under the light of the major viral models of PML etiopathogenesis.
Tang, Yuehui; Liu, Kun; Zhang, Ju; Li, Xiaoli; Xu, Kedong; Zhang, Yi; Qi, Jing; Yu, Deshui; Wang, Jian; Li, Chengwei
2017-01-01
Transcription factors of the AP2/ERF family play important roles in plant growth, development, and responses to biotic and abiotic stresses. In this study, a physic nut AP2/ERF gene, JcDREB2 , was functionally characterized. Real-time PCR analysis revealed that JcDREB2 was expressed mainly in the leaf and could be induced by abscisic acid but suppressed by gibberellin (GA) and salt. Transient expression of a JcDREB2-YFP fusion protein in Arabidopsis protoplasts cells suggested that JcDREB2 is localized in the nucleus. Rice plants overexpressing JcDREB2 exhibited dwarf and GA-deficient phenotypes with shorter shoots and roots than those of wild-type plants. The dwarfism phenotype could be rescued by the application of exogenous GA 3 . The expression levels of GA biosynthetic genes including OsGA20ox1 , OsGA20ox2 , OsGA20ox4 , OsGA3ox2, OsCPS1 , OsKO2 , and OsKAO were significantly reduced in plants overexpressing JcDREB2 . Overexpression of JcDREB2 in rice increased sensitivity to salt stress. Increases in the expression levels of several salt-tolerance-related genes in response to salt stress were impaired in JcDREB2 -overexpressing plants. These results demonstrated not only that JcDREB2 influences GA metabolism, but also that it can participate in the regulation of the salt stress response in rice.
Directory of Open Access Journals (Sweden)
Bartłomiej Drop
2017-12-01
Full Text Available Most research providing evidence for the role of oncogenic viruses in head and neck squamous cell carcinoma (SCC development is focused on one type of virus without analyzing possible interactions between two or more types of viruses. The aim of this study was to analyse the prevalence of co-infection with human papillomavirus (HPV, Epstein–Barr virus (EBV and polyoma BK virus (BKPyV in oral, oropharyngeal and laryngeal squamous cell carcinomas in Polish patients. The correlations between viral infection, SCC, demographic parameters, evidence of metastases and grading were also investigated. Fresh-frozen tumour tissue samples were collected from 146 patients with laryngeal, oropharyngeal and oral cancer. After DNA extraction, the DNA of the studied viruses was detected using polymerase chain rection (PCR assay. Males (87.7% with a history of smoking (70.6% and alcohol abuse (59.6% prevailed in the studied group. Histological type G2 was recognized in 64.4% cases. The patients were most frequently diagnosed with T2 stage (36.3% and with N1 stage (45.8%. Infection with at least two viruses was detected in 56.2% of patients. In this group, co-infection with HPV/EBV was identified in 34.1% of cases, EBV/BKV in 23.2%, HPV/BKV in 22.0%, and HPV/EBV/BKV in 20.7%. No difference of multiple infection in different locations of cancer was observed. The prevalence of poorly differentiated tumours (G3 was more frequent in co-infection with all three viruses than EBV or BKV alone. A significant correlation was observed between tumour dimensions (T and lymph-node involvement (N in co-infected patients compared to single infection. Further studies are necessary to clarify whether co-infection plays an important role in the initiation and/or progression of oncogenic transformation of oral, oropharyngeal and laryngeal epithelial cells.
Drop, Bartłomiej; Strycharz-Dudziak, Małgorzata; Kliszczewska, Ewa; Polz-Dacewicz, Małgorzata
2017-12-19
Most research providing evidence for the role of oncogenic viruses in head and neck squamous cell carcinoma (SCC) development is focused on one type of virus without analyzing possible interactions between two or more types of viruses. The aim of this study was to analyse the prevalence of co-infection with human papillomavirus (HPV), Epstein-Barr virus (EBV) and polyoma BK virus (BKPyV) in oral, oropharyngeal and laryngeal squamous cell carcinomas in Polish patients. The correlations between viral infection, SCC, demographic parameters, evidence of metastases and grading were also investigated. Fresh-frozen tumour tissue samples were collected from 146 patients with laryngeal, oropharyngeal and oral cancer. After DNA extraction, the DNA of the studied viruses was detected using polymerase chain rection (PCR) assay. Males (87.7%) with a history of smoking (70.6%) and alcohol abuse (59.6%) prevailed in the studied group. Histological type G2 was recognized in 64.4% cases. The patients were most frequently diagnosed with T2 stage (36.3%) and with N1 stage (45.8%). Infection with at least two viruses was detected in 56.2% of patients. In this group, co-infection with HPV/EBV was identified in 34.1% of cases, EBV/BKV in 23.2%, HPV/BKV in 22.0%, and HPV/EBV/BKV in 20.7%. No difference of multiple infection in different locations of cancer was observed. The prevalence of poorly differentiated tumours (G3) was more frequent in co-infection with all three viruses than EBV or BKV alone. A significant correlation was observed between tumour dimensions (T) and lymph-node involvement (N) in co-infected patients compared to single infection. Further studies are necessary to clarify whether co-infection plays an important role in the initiation and/or progression of oncogenic transformation of oral, oropharyngeal and laryngeal epithelial cells.
Drop, Bartłomiej; Strycharz-Dudziak, Małgorzata; Kliszczewska, Ewa; Polz-Dacewicz, Małgorzata
2017-01-01
Most research providing evidence for the role of oncogenic viruses in head and neck squamous cell carcinoma (SCC) development is focused on one type of virus without analyzing possible interactions between two or more types of viruses. The aim of this study was to analyse the prevalence of co-infection with human papillomavirus (HPV), Epstein–Barr virus (EBV) and polyoma BK virus (BKPyV) in oral, oropharyngeal and laryngeal squamous cell carcinomas in Polish patients. The correlations between viral infection, SCC, demographic parameters, evidence of metastases and grading were also investigated. Fresh-frozen tumour tissue samples were collected from 146 patients with laryngeal, oropharyngeal and oral cancer. After DNA extraction, the DNA of the studied viruses was detected using polymerase chain rection (PCR) assay. Males (87.7%) with a history of smoking (70.6%) and alcohol abuse (59.6%) prevailed in the studied group. Histological type G2 was recognized in 64.4% cases. The patients were most frequently diagnosed with T2 stage (36.3%) and with N1 stage (45.8%). Infection with at least two viruses was detected in 56.2% of patients. In this group, co-infection with HPV/EBV was identified in 34.1% of cases, EBV/BKV in 23.2%, HPV/BKV in 22.0%, and HPV/EBV/BKV in 20.7%. No difference of multiple infection in different locations of cancer was observed. The prevalence of poorly differentiated tumours (G3) was more frequent in co-infection with all three viruses than EBV or BKV alone. A significant correlation was observed between tumour dimensions (T) and lymph-node involvement (N) in co-infected patients compared to single infection. Further studies are necessary to clarify whether co-infection plays an important role in the initiation and/or progression of oncogenic transformation of oral, oropharyngeal and laryngeal epithelial cells. PMID:29257122
Li, Chaoqiong; Luo, Li; Fu, Qiantang; Niu, Longjian; Xu, Zeng-Fu
2014-05-08
Physic nut (Jatropha curcas L.) is a potential feedstock for biofuel production because Jatropha oil is highly suitable for the production of the biodiesel and bio-jet fuels. However, Jatropha exhibits low seed yield as a result of unreliable and poor flowering. FLOWERING LOCUS T (FT) -like genes are important flowering regulators in higher plants. To date, the flowering genes in Jatropha have not yet been identified or characterized. To better understand the genetic control of flowering in Jatropha, an FT homolog was isolated from Jatropha and designated as JcFT. Sequence analysis and phylogenetic relationship of JcFT revealed a high sequence similarity with the FT genes of Litchi chinensis, Populus nigra and other perennial plants. JcFT was expressed in all tissues of adult plants except young leaves, with the highest expression level in female flowers. Overexpression of JcFT in Arabidopsis and Jatropha using the constitutive promoter cauliflower mosaic virus 35S or the phloem-specific promoter Arabidopsis SUCROSE TRANSPORTER 2 promoter resulted in an extremely early flowering phenotype. Furthermore, several flowering genes downstream of JcFT were up-regulated in the JcFT-overexpression transgenic plant lines. JcFT may encode a florigen that acts as a key regulator in flowering pathway. This study is the first to functionally characterize a flowering gene, namely, JcFT, in the biofuel plant Jatropha.
High prevalence of human polyomavirus JC VP1 gene sequences in pediatric malignancies.
Shiramizu, B; Hu, N; Frisque, R J; Nerurkar, V R
2007-05-15
The oncogenic potential of human polyomavirus JC (JCV), a ubiquitous virus that establishes infection during early childhood in approximately 70% of the human population, is unclear. As a neurotropic virus, JCV has been implicated in pediatric central nervous system tumors and has been suggested to be a pathogenic agent in pediatric acute lymphoblastic leukemia. Recent studies have demonstrated JCV gene sequences in pediatric medulloblastomas and among patients with colorectal cancer. JCV early protein T-antigen (TAg) can form complexes with cellular regulatory proteins and thus may play a role in tumorigenesis. Since JCV is detected in B-lymphocytes, a retrospective analysis of pediatric B-cell and non-B-cell malignancies as well as other HIV-associated pediatric malignancies was conducted for the presence of JCV gene sequences. DNA was extracted from 49 pediatric malignancies, including Hodgkin disease, non-Hodgkin lymphoma, large cell lymphoma and sarcoma. Polymerase chain reaction (PCR) was conducted using JCV specific nested primer sets for the transcriptional control region (TCR), TAg, and viral capsid protein 1 (VP1) genes. Southern blot analysis and DNA sequencing were used to confirm specificity of the amplicons. A 215-bp region of the JCV VP1 gene was amplified from 26 (53%) pediatric tumor tissues. The JCV TCR and two JCV gene regions were amplified from a leiomyosarcoma specimen from an HIV-infected patient. The leiomyosarcoma specimen from the cecum harbored the archetype strain of JCV. Including the leiomyosarcoma specimen, three of five specimens sequenced were typed as JCV genotype 2. The failure to amplify JCV TCR, and TAg gene sequences in the presence of JCV VP1 gene sequence is surprising. Even though JCV TAg gene, which is similar to the SV40 TAg gene, is oncogenic in animal models, the presence of JCV gene sequences in pediatric malignancies does not prove causality. In light of the available data on the presence of JCV in normal and cancerous
J.C. Nalle Community School: A Study of a School Turnaround Effort. Publication #2015-14
Redd, Zakia; Princiotta, Daniel; Stratford, Brandon; Caal, Selma; Li, Weilin; Murphy, Kelly; Coffey, Amelia; Carrington, Nicholas; Carney, Rachel; Oster, Maryjo; Horton, Susannah
2015-01-01
J.C. Nalle is a Community School located in the Marshall Heights neighborhood of Ward 7 in Washington, D.C. The community in which J.C. Nalle is located, historically one of the more economically disadvantaged areas of the city, has experienced a number of changes in recent years. This report of evaluation findings begins with an introduction to…
Pharmacological cdk inhibitor R-Roscovitine suppresses JC virus proliferation
International Nuclear Information System (INIS)
Orba, Yasuko; Sunden, Yuji; Suzuki, Tadaki; Nagashima, Kazuo; Kimura, Takashi; Tanaka, Shinya; Sawa, Hirofumi
2008-01-01
The human Polyomavirus JC virus (JCV) utilizes cellular proteins for viral replication and transcription in the host cell nucleus. These cellular proteins represent potential targets for antiviral drugs against the JCV. In this study, we examined the antiviral effects of the pharmacological cyclin-dependent kinase (cdk) inhibitor R-Roscovitine, which has been shown to have antiviral activity against other viruses. We found that Roscovitine significantly inhibited the viral production and cytopathic effects of the JCV in a JCV-infected cell line. Roscovitine attenuated the transcriptional activity of JCV late genes, but not early genes, and also prevented viral replication via inhibiting phosphorylation of the viral early protein, large T antigen. These data suggest that the JCV requires cdks to transcribe late genes and to replicate its own DNA. That Roscovitine exhibited antiviral activity in JCV-infected cells suggests that Roscovitine might have therapeutic utility in the treatment of progressive multifocal leukoencephalopathy (PML)
Tao, Yan-Bin; He, Liang-Liang; Niu, Longjian; Xu, Zeng-Fu
2016-08-01
The 1.5 kb JcAP1 promoter from the biofuel plant Jatropha curcas is predominantly active in the inflorescence buds of transgenic plants, in which the -1313/-1057 region is essential for maintaining the activity. Arabidopsis thaliana APETALA1 (AP1) is a MADS-domain transcription factor gene that functions primarily in flower development. We isolated a homolog of AP1 from Jatropha curcas (designated JcAP1), which was shown to exhibit flower-specific expression in Jatropha. JcAP1 is first expressed in inflorescence buds and continues to be primarily expressed in the sepals. We isolated a 1.5 kb JcAP1 promoter and evaluated its activity in transgenic Arabidopsis and Jatropha using the β-glucuronidase (GUS) reporter gene. In transgenic Arabidopsis and Jatropha, the inflorescence buds exhibited notable GUS activity, whereas the sepals did not. Against expectations, the JcAP1 promoter was active in the anthers of Arabidopsis and Jatropha and was highly expressed in Jatropha seeds. An analysis of promoter deletions in transgenic Arabidopsis revealed that deletion of the -1313/-1057 region resulted in loss of JcAP1 promoter activity in the inflorescence buds and increased activity in the anthers. These results suggested that some regulatory sequences in the -1313/-1057 region are essential for maintaining promoter activity in inflorescence buds and can partly suppress activity in the anthers. Based on these findings, we hypothesized that other elements located upstream of the 1.5 kb JcAP1 promoter may be required for flower-specific activation. The JcAP1 promoter characterized in this study can be used to drive transgene expression in both the inflorescence buds and seeds of Jatropha.
Directory of Open Access Journals (Sweden)
Jaione Simon-Santamaria
Full Text Available Liver sinusoidal endothelial cells (LSECs are specialized scavenger cells that mediate high-capacity clearance of soluble waste macromolecules and colloid material, including blood-borne adenovirus. To explore if LSECs function as a sink for other viruses in blood, we studied the fate of virus-like particles (VLPs of two ubiquitous human DNA viruses, BK and JC polyomavirus, in mice. Like complete virions, VLPs specifically bind to receptors and enter cells, but unlike complete virions, they cannot replicate. 125I-labeled VLPs were used to assess blood decay, organ-, and hepatocellular distribution of ligand, and non-labeled VLPs to examine cellular uptake by immunohisto- and -cytochemistry. BK- and JC-VLPs rapidly distributed to liver, with lesser uptake in kidney and spleen. Liver uptake was predominantly in LSECs. Blood half-life (∼1 min, and tissue distribution of JC-VLPs and two JC-VLP-mutants (L55F and S269F that lack sialic acid binding affinity, were similar, indicating involvement of non-sialic acid receptors in cellular uptake. Liver uptake was not mediated by scavenger receptors. In spleen, the VLPs localized to the red pulp marginal zone reticuloendothelium, and in kidney to the endothelial lining of vasa recta segments, and the transitional epithelium of renal pelvis. Most VLP-positive vessels in renal medulla did not express PV-1/Meca 32, suggesting location to the non-fenestrated part of vasa recta. The endothelial cells of these vessels also efficiently endocytosed a scavenger receptor ligand, formaldehyde-denatured albumin, suggesting high endocytic activity compared to other renal endothelia. We conclude that LSECs very effectively cleared a large fraction of blood-borne BK- and JC-VLPs, indicating a central role of these cells in early removal of polyomavirus from the circulation. In addition, we report the novel finding that a subpopulation of endothelial cells in kidney, the main organ of polyomavirus persistence, showed
Ryschkewitsch, C F; Friedlaender, J S; Mgone, C S; Jobes, D V; Agostini, H T; Chima, S C; Alpers, M P; Koki, G; Yanagihara, R; Stoner, G L
2000-07-01
The peopling of the Pacific was a complex sequence of events that is best reconstructed by reconciling insights from various disciplines. Here we analyze the human polyomavirus JC (JCV) in Highlanders of Papua New Guinea (PNG), in Austronesian-speaking Tolai people on the island of New Britain, and in nearby non-Austronesian-speaking Baining people. We also characterize JCV from the Chamorro of Guam, a Micronesian population. All JCV strains from PNG and Guam fall within the broad Asian group previously defined in the VP1 gene as Type 2 or Type 7, but the PNG strains were distinct from both genotypes. Among the Chamorro JCV samples, 8 strains (Guam-1) were like the Type 7 strains found in Southeast Asia, while nine strains (Guam-2) were distinct from both the mainland strains and most PNG strains. We identified three JCV variants within Papua New Guinea (PNG-1, PNG-2 and PNG-3), but none of the Southeast Asian (Type 7) strains. PNG-1 strains were present in all three populations (Highlanders and the Baining and Tolai of New Britain), but PNG-2 strains were restricted to the Highlanders. Their relative lack of DNA sequence variation suggests that they arose comparatively recently. The single PNG-3 strain, identified in an Austronesian-speaking Tolai individual, was closely related to the Chamorro variants (Guam-2), consistent with a common Austronesian ancestor. In PNG-2 variants a complex regulatory region mutation inserts a duplication into a nearby deletion, a change reminiscent of those seen in the brains of progressive multifocal leukoencephalopathy patients. This is the first instance of a complex JCV rearrangement circulating in a human population.
International Nuclear Information System (INIS)
Tada, Hiroomi; Lashgari, M.; Amini, S.; Khalili, K.; Rappaport, J.; Wong-Staal, F.
1990-01-01
Progressive multifocal leukoencephalopathy (PML) is a demyelinating disease of the central nervous system caused by the JC virus (JCV), a human papovavirus. PML is a relatively rare disease seen predominantly in immunocompromised individuals and is a frequent complication observed in AIDS patients. The significantly higher incidence of PML in AIDS patients than in other immunosuppressive disorders has suggested that the presence of human immunodeficiency virus type 1 (HIV-1) in the brain may directly or indirectly contribute to the pathogenesis of this disease. In the present study the authors have examined the expression of the JCV genome in both glial and non-glial cells in the presence of HIV-1 regulatory proteins. They find that the HIV-1-encoded trans-regulatory protein tat increases the basal activity of the JCV late promoter, JCV L , in glial cells. They conclude that the presence of the HIV-1-encoded tat protein may positively affect the JCV lytic cycle in glial cells by stimulating JCV gene expression. The results suggest a mechanism for the relatively high incidence of PML in AIDS patients than in other immunosuppressive disorders. Furthermore, the findings indicate that the HIV-1 regulatory protein tat may stimulate other viral and perhaps cellular promoters, in addition to its own
Directory of Open Access Journals (Sweden)
Attila Szücs
Full Text Available Alcohol dependence and withdrawal has been shown to cause neuroadaptive changes at multiple levels of the nervous system. At the neuron level, adaptations of synaptic connections have been extensively studied in a number of brain areas and accumulating evidence also shows the importance of alcohol dependence-related changes in the intrinsic cellular properties of neurons. At the same time, it is still largely unknown how such neural adaptations impact the firing and integrative properties of neurons. To address these problems, here, we analyze physiological properties of neurons in the bed nucleus of stria terminalis (jcBNST in animals with a history of alcohol dependence. As a comprehensive approach, first we measure passive and active membrane properties of neurons using conventional current clamp protocols and then analyze their firing responses under the action of simulated synaptic bombardment via dynamic clamp. We find that most physiological properties as measured by DC current injection are barely affected during protracted withdrawal. However, neuronal excitability as measured from firing responses under simulated synaptic inputs with the dynamic clamp is markedly reduced in all 3 types of jcBNST neurons. These results support the importance of studying the effects of alcohol and drugs of abuse on the firing properties of neurons with dynamic clamp protocols designed to bring the neurons into a high conductance state. Since the jcBNST integrates excitatory inputs from the basolateral amygdala (BLA and cortical inputs from the infralimbic and the insular cortices and in turn is believed to contribute to the inhibitory input to the central nucleus of the amygdala (CeA the reduced excitability of the jcBNST during protracted withdrawal in alcohol-dependent animals will likely affect ability of the jcBNST to shape the activity and output of the CeA.
O'Hara, Bethany A; Gee, Gretchen V; Atwood, Walter J; Haley, Sheila A
2018-04-15
JC polyomavirus (JCPyV) establishes a lifelong persistence in roughly half the human population worldwide. The cells and tissues that harbor persistent virus in vivo are not known, but renal tubules and other urogenital epithelial cells are likely candidates as virus is shed in the urine of healthy individuals. In an immunosuppressed host, JCPyV can become reactivated and cause progressive multifocal leukoencephalopathy (PML), a fatal demyelinating disease of the central nervous system. Recent observations indicate that JCPyV may productively interact with cells in the choroid plexus and leptomeninges. To further study JCPyV infection in these cells, primary human choroid plexus epithelial cells and meningeal cells were challenged with virus, and their susceptibility to infection was compared to the human glial cell line, SVG-A. We found that JCPyV productively infects both choroid plexus epithelial cells and meningeal cells in vitro Competition with the soluble receptor fragment LSTc reduced virus infection in these cells. Treatment of cells with neuraminidase also inhibited both viral infection and binding. Treatment with the serotonin receptor antagonist, ritanserin, reduced infection in SVG-A and meningeal cells. We also compared the ability of wild-type and sialic acid-binding mutant pseudoviruses to transduce these cells. Wild-type pseudovirus readily transduced all three cell types, but pseudoviruses harboring mutations in the sialic acid-binding pocket of the virus failed to transduce the cells. These data establish a novel role for choroid plexus and meninges in harboring virus that likely contributes not only to meningoencephalopathies but also to PML. IMPORTANCE JCPyV infects greater than half the human population worldwide and causes central nervous system disease in patients with weakened immune systems. Several recent reports have found JCPyV in the choroid plexus and leptomeninges of patients with encephalitis. Due to their role in forming the blood
Yoshihara, K.; van Mierlo, M.; Ng, A.; Shankar Kumar, B.; De Ruiter, A.; Komatsu, Y.; Horiguchi, H.; Hashimoto, H.
2008-08-01
This paper introduces the Japan Canada Joint Collaboration Satellites - Formation Flying (JC2Sat-FF) project. JC2Sat-FF is a joint project between the Canadian Space Agency (CSA) and the Japan Aerospace Exploration Agency (JAXA) with the end goal of building, launching and operating two 20kg- class nanosatellites for technical demonstration of formation flight (FF) using differential drag technique, relative navigation using commercial off-the-shelf (COTS) dual band GPS receivers and far infra-red radiance measurement. A unique aspect of this project is that the two JC2Sats are developed by a united small team consisting of engineers and researchers from both agencies. Technical exchange in this international team gives stimulation to the members and generates a synergistic effect for the project.
Chattaraj, S; Bera, N K; Dutta, C; Bhattacharjee, S
2015-01-01
Human polyomavirus JC (JCV) is a widespread human virus with profound pathogenic potential. A study was undertaken to quantify JCV load in urine and peripheral blood samples of immunocompetent, apparently healthy tribal individuals of North-Eastern part of West Bengal, India for the first time. One hundred and thirteen samples of urine or blood were collected from different tribal groups of this region. For the quantitative estimation of the viral load in each sample, real-time polymerase chain reaction method using the SYBR Green dye was employed. The viral load estimated was found in the range between 3.5 × 102 and 2.12 × 106 copies/ml of samples having a mean and median viral copy numbers of 8.67 × 105 and 9.19 × 105 copies/ml of sample respectively. The mean viral DNA load in urine samples of the studied immunocompetent population was found to be higher than that found in a study conducted in the USA, but lower than similar groups of Italy and healthy adult women in the USA. However when compared with median values of viral DNA loads in urine samples of immunocompetent human subjects of Kuwait, Portugal, and Switzerland the observed viral DNA load was found to be substantially higher.
International Nuclear Information System (INIS)
Richter, Christian; Reif, Bernd; Woerner, Karlheinz; Quant, Stefanie; Marino, John P.; Engels, Joachim W.; Griesinger, Christian; Schwalbe, Harald
1998-01-01
A new experiment for the measurement of nJ(C,P) coupling constants along the phosphodiester backbone in RNA and DNA based on a quantitative-J HCP experiment is presented. In addition to coupling constants, in which a carbon atom couples to only one phosphorus atom, both the intraresidual 3J(C4'i,Pi) and the sequential 3J(C4'i,Pi+1) for the C4' resonances that couple to two phosphorus atoms can be obtained. Coupling constants obtained by this new method are compared to values obtained from the P-FIDS experiment. Together with 3J(H,P) coupling constants measured using the P-FIDS experiment, the backbone angles β and element of can be determined
Energy Technology Data Exchange (ETDEWEB)
Hiser, A.L. (Materials Engineering Associates, Inc., Lanham, MD (USA))
1990-03-01
Reactor pressure vessel (RPV) surveillance capsules contain Charpy-V (C{sub v}) specimens, but many do not contain fracture toughness specimens; accordingly, the radiation-induced shift (increase) in the brittle-to-ductile transition region ({Delta}T) is based upon the {Delta}T determined from notch ductility (C{sub v}) tests. Since the ASME K{sub Ic} and K{sub IR} reference fracture toughness curves are shifted by the {Delta}T from C{sub v}, assurance that this {Delta}T does not underestimate {Delta}T associated with the actual irradiated fracture toughness is required to provide confidence that safety margins do not fall below assumed levels. To assess this behavior, comparisons of {Delta}T's defined by elastic-plastic fracture toughness and C{sub v} tests have been made using data from RPV base and weld metals in which irradiations were made under test reactor conditions. Using as-measure'' fracture toughness values (K{sub Jc}), average comparisons between {Delta}T(C{sub v}) and {Delta}T(K{sub Jc}) are: (a) All data: {Delta}T(K{sub Jc} 100 MPa{radical}{bar m}) = {Delta}T(C{sub v} 41 J) +10{degree}C; (b) Plates only: {Delta}T(K{sub Jc} 100 MPa{radical}{bar m}) = {Delta}T(C{sub v} 41 J) +15{degree}C; and (c) Welds only: {Delta}T(K{sub Jc} 100 MPa{radical}{bar m}) = {Delta}T(C{sub v} 41 J) {minus}1{degree}C. Fluence rate is found to have no significant effect on the relationship between {Delta}T(C{sub v}) and {Delta}T(K{sub Jc}). 12 refs., 12 figs., 5 tabs.
Peel v Hamon J&C engineering (pty) ltd: Ignoring the result ...
African Journals Online (AJOL)
This case note provides a concise and understandable version of the confusing facts in Peel v Hamon J&C Engineering (Pty) Ltd, and deals with the remedy provided for in section 163 of the Companies Act (the oppression remedy). The importance of drawing a distinction between the application of this section and the ...
Directory of Open Access Journals (Sweden)
Chun-Nun Chao
Full Text Available Lung adenocarcinoma, the most commonly diagnosed type of lung cancer, has a poor prognosis even with combined surgery, chemotherapy, or molecular targeted therapies. Most patients are diagnosed with an in-operable advanced or metastatic disease, both pointing to the necessity of developing effective therapies for lung adenocarcinoma. Surfactant protein B (SP-B has been found to be overexpressed in lung adenocarcinoma. In addition, it has also been demonstrated that human lung adenocarcinoma cells are susceptible to the JC polyomavirus (JCPyV infection. Therefore, we designed that the JCPyV virus-like particle (VLP packaged with an SP-B promoter-driven thymidine kinase suicide gene (pSPB-tk for possible gene therapy of human lung adenocarcinoma. Plasmids expressing the GFP (pSPB-gfp or thymidine kinase gene (pSPB-tk under the control of the human SP-B promoter were constructed. The promoter's tissue specificity was tested by transfection of pSPB-gfp into A549, CH27, and H460 human lung carcinoma cells and non-lung cells. The JCPyV VLP's gene transfer efficiency and the selective cytotoxicity of pSPB-tk combined with ganciclovir (GCV were tested in vitro and in a xenograft mouse model. In the current study, we found that SP-B promoter-driven GFP was specifically expressed in human lung adenocarcinoma (A549 and large cell carcinoma (H460 cells. JCPyV VLPs were able to deliver a GFP reporter gene into A549 cells for expression. Selective cytotoxicity was observed in A549 but not non-lung cells that were transfected with pSPB-tk or infected with pSPB-tk-carrying JCPyV VLPs. In mice injected with pSPB-tk-carrying JCPyV VLPs through the tail vein and treated with ganciclovir (GCV, a potent 80% inhibition of growth of human lung adenocarcinoma nodules resulted. The JCPyV VLPs combined with the use of SP-B promoter demonstrates effectiveness as a potential gene therapy against human lung adenocarcinoma.
Chao, Chun-Nun; Lin, Mien-Chun; Fang, Chiung-Yao; Chen, Pei-Lain; Chang, Deching; Shen, Cheng-Huang; Wang, Meilin
2016-01-01
Lung adenocarcinoma, the most commonly diagnosed type of lung cancer, has a poor prognosis even with combined surgery, chemotherapy, or molecular targeted therapies. Most patients are diagnosed with an in-operable advanced or metastatic disease, both pointing to the necessity of developing effective therapies for lung adenocarcinoma. Surfactant protein B (SP-B) has been found to be overexpressed in lung adenocarcinoma. In addition, it has also been demonstrated that human lung adenocarcinoma cells are susceptible to the JC polyomavirus (JCPyV) infection. Therefore, we designed that the JCPyV virus-like particle (VLP) packaged with an SP-B promoter-driven thymidine kinase suicide gene (pSPB-tk) for possible gene therapy of human lung adenocarcinoma. Plasmids expressing the GFP (pSPB-gfp) or thymidine kinase gene (pSPB-tk) under the control of the human SP-B promoter were constructed. The promoter's tissue specificity was tested by transfection of pSPB-gfp into A549, CH27, and H460 human lung carcinoma cells and non-lung cells. The JCPyV VLP's gene transfer efficiency and the selective cytotoxicity of pSPB-tk combined with ganciclovir (GCV) were tested in vitro and in a xenograft mouse model. In the current study, we found that SP-B promoter-driven GFP was specifically expressed in human lung adenocarcinoma (A549) and large cell carcinoma (H460) cells. JCPyV VLPs were able to deliver a GFP reporter gene into A549 cells for expression. Selective cytotoxicity was observed in A549 but not non-lung cells that were transfected with pSPB-tk or infected with pSPB-tk-carrying JCPyV VLPs. In mice injected with pSPB-tk-carrying JCPyV VLPs through the tail vein and treated with ganciclovir (GCV), a potent 80% inhibition of growth of human lung adenocarcinoma nodules resulted. The JCPyV VLPs combined with the use of SP-B promoter demonstrates effectiveness as a potential gene therapy against human lung adenocarcinoma.
Mudalkar, Shalini; Sreeharsha, Rachapudi Venkata; Reddy, Attipalli Ramachandra
2016-05-20
Abiotic stress leads to the generation of reactive oxygen species (ROS) which further results in the production of reactive carbonyls (RCs) including methylglyoxal (MG). MG, an α, β-dicarbonyl aldehyde, is highly toxic to plants and the mechanism behind its detoxification is not well understood. Aldo-keto reductases (AKRs) play a role in detoxification of reactive aldehydes and ketones. In the present study, we cloned and characterised a putative AKR from Jatropha curcas (JcAKR). Phylogenetically, it forms a small clade with AKRs of Glycine max and Rauwolfia serpentina. JcAKR was heterologously expressed in Escherichia coli BL-21(DE3) cells and the identity of the purified protein was confirmed through MALDI-TOF analysis. The recombinant protein had high enzyme activity and catalytic efficiency in assays containing MG as the substrate. Protein modelling and docking studies revealed MG was efficiently bound to JcAKR. Under progressive drought and salinity stress, the enzyme and transcript levels of JcAKR were higher in leaves compared to roots. Further, the bacterial and yeast cells expressing JcAKR showed more tolerance towards PEG (5%), NaCl (200mM) and MG (5mM) treatments compared to controls. In conclusion, our results project JcAKR as a possible and potential target in crop improvement for abiotic stress tolerance. Copyright © 2016 Elsevier GmbH. All rights reserved.
Rodio, Donatella Maria; Anzivino, Elena; Mischitelli, Monica; Bellizzi, Anna; Scrivo, Rossana; Scribano, Daniela; Conte, Gianlorenzo; Prezioso, Carla; Trancassini, Maria; Valesini, Guido; Palamara, Anna Teresa; Pietropaolo, Valeria
2016-01-01
Chronic inflammatory rheumatic diseases (CIRDs) are immune-mediated pathologies involving joints. To date, TNFα-blocking agents administration is the most promising therapy, although these treatments are associated with an increased Polyomavirus JC (JCPyV) reactivation, the etiological agent of the Progressive Multifocal Leukoencephalopathy (PML). The aim of this study was the recruitment and the analysis of a CIRDs cohort in order to investigate a possible correlation between JCPyV presence and the influence of anti-TNF-α agents on viral loads. Blood and urine samples were collected from 34 CIRDs subjects prior the first anti-TNF-α infusion (T0) and after 3 (T3), 6 (T6), 12 (T12), and 18 (T18) months. Results showed persistent JC viruria significantly higher than JC viremia throughout the 18 month follow-up study (p = 0.002). In JCPyV positive samples, the non-coding control region (NCCR) was analyzed. Results evidenced archetypal structures (type II-S) in all isolates with the exception of a sequence isolated from a plasma sample, that corresponds to the type II-R found in PML subjects. Finally, the viral protein 1 (VP1) genotyping was performed and results showed the prevalence of the European genotypes 1A, 1B, and 4. Since only few studies have been carried out to understand whether there is a PML risk in CIRDs population infected by JCPyV, this study contributes to enrich literature insight on JCPyV biology in this cluster. Further investigations are necessary in order to recognize the real impact of biologics on JCPyV life cycle and to identify possible and specific viral variants related to increased virulence in CIRDs patients.
Spendere meno, spendere meglio: una proposta panottica di J.-C. Guédon
Directory of Open Access Journals (Sweden)
Maria Chiara Pievatolo
2013-06-01
Full Text Available J.-C. Guédon ha commentato la nostra campagna di crowdsourcing in merito alle spese delle biblioteche sulla mailing list Nexa. Offriamo, qui di seguito, la versione italiana delle sue osservazioni – che presuppongono un mondo accademico molto diverso da quello impostoci...
Zhang, Xianping; Wang, Qingxiao; Li, Kun; Cai, Yao; Jiang, Fuguo; Wang, Zhen; Li, Jianqi; Yao, Chao; Lin, He; Zhang, Qianjun; Dong, Chiheng; Wang, Dongliang; Zhang, Xixiang; Ma, Yanwei
2015-01-01
Pnictide superconductors will be very promising for applications if wires with high critical current density Jc can allow reel-to-reel large-scale fabrication at low costs. To understand the mechanism(s) that limited Jc in flat-rolled Sr0.6K0.4Fe2As
Directory of Open Access Journals (Sweden)
Ying-Xiong Hu
2017-12-01
Full Text Available Gibberellins (GAs are plant hormones that play fundamental roles in plant growth and development. Gibberellin 2-oxidase (GA2ox plays a direct role in determining the levels of bioactive GAs by catalyzing bioactive GAs or their immediate precursors to inactive forms. In this study, a GA2ox gene, designated JcGA2ox6, was isolated from Jatropha curcas. JcGA2ox6 is expressed in all tissues of adult Jatropha, with the highest expression level in male flowers and the lowest expression level in young leaves. Overexpression of JcGA2ox6 in Arabidopsis resulted in a typical dwarf phenotype, along with late flowering, smaller leaves and flowers, shorter siliques and smaller seeds. Similarly, when JcGA2ox6 was overexpressed in Jatropha, the transgenic plants exhibited a dwarf phenotype with dark-green leaves and smaller inflorescences, flowers, fruits and seeds. However, the flowering time of Jatropha was not affected by overexpression of JcGA2ox6, unlike that in the transgenic Arabidopsis. Moreover, the number of flowers per inflorescence, the weight of 10 seeds and the seed oil content were significantly decreased in transgenic Jatropha. The results indicated that overexpression of JcGA2ox6 had a great impact on the vegetative and reproductive growth of transgenic Jatropha. Furthermore, we found that the dwarf phenotype of transgenic Jatropha was caused by a decrease in endogenous bioactive GA4, which was correlated with the degree of dwarfism.
Roussos, Evanthia T; Wang, Yarong; Wyckoff, Jeffrey B; Sellers, Rani S; Wang, Weigang; Li, Jiufeng; Pollard, Jeffrey W; Gertler, Frank B; Condeelis, John S
2010-01-01
The actin binding protein Mammalian enabled (Mena), has been implicated in the metastatic progression of solid tumors in humans. Mena expression level in primary tumors is correlated with metastasis in breast, cervical, colorectal and pancreatic cancers. Cells expressing high Mena levels are part of the tumor microenvironment for metastasis (TMEM), an anatomical structure that is predictive for risk of breast cancer metastasis. Previously we have shown that forced expression of Mena adenocarcinoma cells enhances invasion and metastasis in xenograft mice. Whether Mena is required for tumor progression is still unknown. Here we report the effects of Mena deficiency on tumor progression, metastasis and on normal mammary gland development. To investigate the role of Mena in tumor progression and metastasis, Mena deficient mice were intercrossed with mice carrying a transgene expressing the polyoma middle T oncoprotein, driven by the mouse mammary tumor virus. The progeny were investigated for the effects of Mena deficiency on tumor progression via staging of primary mammary tumors and by evaluation of morbidity. Stages of metastatic progression were investigated using an in vivo invasion assay, intravital multiphoton microscopy, circulating tumor cell burden, and lung metastases. Mammary gland development was studied in whole mount mammary glands of wild type and Mena deficient mice. Mena deficiency decreased morbidity and metastatic dissemination. Loss of Mena increased mammary tumor latency but had no affect on mammary tumor burden or histologic progression to carcinoma. Elimination of Mena also significantly decreased epidermal growth factor (EGF) induced in vivo invasion, in vivo motility, intravasation and metastasis. Non-tumor bearing mice deficient for Mena also showed defects in mammary gland terminal end bud formation and branching. Deficiency of Mena decreases metastasis by slowing tumor progression and reducing tumor cell invasion and intravasation. Mena
Energy Technology Data Exchange (ETDEWEB)
Thompson, James R [ORNL; Sinclair IV, John W [ORNL; Christen, David K [ORNL; Zhang, Yifei [ORNL; Zuev, Yuri L [ORNL; Cantoni, Claudia [ORNL; Chen, Y [SuperPower Incorporated, Schenectady, New York; Selvamanickam, V. [SuperPower Incorporated, Schenectady, New York
2010-01-01
Applications of coated conductors based on high-Tc superconductors often require detailed knowledge of their critical current density Jc as a function of magnetic field orientation as well as field strength and temperature. This work demonstrates experimental methods to obtain the angularly dependent Jc using contact-free magnetic measurements, and qualifies those methods using several well defined conditions. The studies complement traditional transport techniques and are readily extended to conditions of field and temperature where the current density is very large and transport methods become difficult. Results on representative materials are presented.
International Nuclear Information System (INIS)
Fendrick, J.L.; Iglewski, W.J.
1989-01-01
Polyoma virus-transformed baby hamster kidney (pyBHK) cells were cultured in medium containing [ 32 P]orthophosphate and 105 (vol/vol) fetal bovine serum. A 32 P-labeled protein with an apparent molecular mass of 97 kDa was immunoprecipitated from cell lysates with antiserum to ADP-ribosylated elongation factor 2 (EF-2). The 32 P labeling of the protein was enhanced by culturing cells in medium containing 2% serum instead of 10% serum. The 32 P label was completely removed from the protein by treatment with snake venom phosphodiesterase and the digestion product was identified as [ 32 P]AMP, indicating the protein was mono-ADP-ribosylated. HPLC analysis of tryptic peptides of the 32 P-labeled 97-kDa protein and purified EF-2, which was ADP-ribosylated in vitro with diphtheria toxin fragment A and [ 32 P]NAD, demonstrated an identical labeled peptide in the two proteins. The data strongly suggest that EF-2 was endogenously ADP-ribosylated in pyBHK cells. Maximum incorporation of radioactivity in EF-2 occurred by 12 hr and remained constant over the subsequent 12 hr. It was estimated that 30-35% of the EF-2 was ADP-ribosylated in cells cultured in medium containing 2% serum. When 32 P-labeled cultures were incubated in medium containing unlabeled phosphate, the 32 P label was lost from the EF-2 within 30 min
Serum IgG antibodies from healthy subjects up to 100 years old react to JC polyomavirus.
Bononi, Ilaria; Mazzoni, Elisa; Pietrobon, Silvia; Manfrini, Marco; Torreggiani, Elena; Rossini, Marika; Lotito, Francesca; Guerra, Giovanni; Rizzo, Paola; Martini, Fernanda; Tognon, Mauro
2018-08-01
JC polyomavirus (JCPyV) was identified in 1971 in the brain tissue of a patient (J.C.) affected by the progressive multifocal leukoencephalopathy (PML). JCPyV encodes for the oncoproteins large T antigen (Tag) and small t-antigen (tag). These oncoproteins are responsible of the cell transformation and tumorigenesis in experimental animals. JCPyV is ubiquitous in human populations. After the primary infection, which is usually asymptomatic, JCPyV remains lifelong in the host in a latent phase. Its reactivation may occur in heathy subjects and immunocompromised patients. Upon reactivation, JCPyV could reach (i) the CNS inducing the PML, (ii) the kidney of transplant patients causing the organ rejection. Association between JCPyV, which is a small DNA tumor virus, and gliomas and colorectal carcinomas has been published. In the present investigation, we report on a new indirect ELISA with two specific synthetic peptides mimicking JCPyV VP1 immunogenic epitopes to detect specific serum IgG antibodies against JCPyV. Serum samples of healthy subjects (n = 355) ranging 2-100 years old, were analyzed by this new indirect ELISA. The linear peptides VP1 K and VP1 N resemble the natural JCPyV VP1 capsidic epitopes constituting a docking site for serum antibodies. Data from this innovative immunologic assay indicate that the overall prevalence of JCPyV-VP1 antibodies in healthy subjects is at 39%. The innovative indirect ELISA with JCPyV VP1 mimotopes seems to be a useful method to detect specific IgG antibodies against this virus, without cross-reactivity with the closely related SV40 and BKPyV polyomaviruses. © 2018 Wiley Periodicals, Inc.
Retrovirus-mediated gene transfer of a human c-fos cDNA into mouse bone marrow stromal cells.
Roux, P; Verrier, B; Klein, B; Niccolino, M; Marty, L; Alexandre, C; Piechaczyk, M
1991-11-01
A cDNA encoding a complete human c-fos protein was isolated and inserted into two different murine MoMuLV-derived recombinant retroviruses allowing expression of c-fos protein in different cell types. One c-fos-expressing retrovirus, chosen for its ability to express high levels of proteins in fibroblast-like cells, was shown to potentiate long-term cultures of mouse bone marrow stromal cells in vitro and therefore constitutes a potential tool for immortalizing such cells. Moreover, when tested in an in vitro differentiation assay, stromal cells constitutively expressing c-fos favor the granulocyte differentiation of hematopoietic precursors. Interestingly, retroviruses expressing v-src and v-abl oncogenes, included as controls in our experiments, do not produce any detectable effects, whereas those expressing polyoma virus middle T antigen facilitate long-term growth in vitro of stromal cells that favor the macrophage differentiation pathway of bone marrow stem cells. Our observation supports the idea that constitutive expression of some oncogenes, including c-fos and polyoma virus middle T antigen, may influence cytokine production by bone marrow stromal cells.
Zhang, Xianping
2015-01-13
Pnictide superconductors will be very promising for applications if wires with high critical current density Jc can allow reel-to-reel large-scale fabrication at low costs. To understand the mechanism(s) that limited Jc in flat-rolled Sr0.6K0.4Fe2As2(Sr122) tapes, microstructure analysis has been considered the most direct and efficient way. Here, we report on high-resolution microstructure imaging and analysis on Fe-sheathed flat-rolled Sr122 tapes, which have a Jc as high as 2.3 × 104 A/cm2 at 10 T and 4.2 K. The overlapping nature of the Sr122 plates was clearly observed. Transmission electron microscopy/scanning transmission electron microscopy analysis showed that, besides the cracks formed during the fabrication process, the SrO2 phase and cavities caused by the inhomogeneously dispersed Sr and K are the other important factors suppressing Jc. The wetting phase FeAs at the grain boundaries can be partially substituted by Sn in Sn-added samples. Our findings provide insights that pave the way to further enhance the critical current of the rolled 122 tapes up to the practical level.
W. Yang; E.L. Beaudoin; L. Lu; R.A. Du Pasquier (Renaud); M.J. Kuroda; R.A. Willemsen (Ralph); I.J. Koralnik; R.P. Junghans
2007-01-01
textabstractProgressive multifocal leukoencephalopathy (PML) is a deadly brain disease caused by the polyomavirus JC (JCV). The aim of this study is to develop 'designer T cells' armed with anti-JCV TCR-based chimeric immune receptors (CIRs) by gene modification for PML immunotherapy. Two T cell
Energy Technology Data Exchange (ETDEWEB)
Fendrick, J.L.; Iglewski, W.J. (Univ. of Rochester, NY (USA))
1989-01-01
Polyoma virus-transformed baby hamster kidney (pyBHK) cells were cultured in medium containing ({sup 32}P)orthophosphate and 105 (vol/vol) fetal bovine serum. A {sup 32}P-labeled protein with an apparent molecular mass of 97 kDa was immunoprecipitated from cell lysates with antiserum to ADP-ribosylated elongation factor 2 (EF-2). The {sup 32}P labeling of the protein was enhanced by culturing cells in medium containing 2% serum instead of 10% serum. The {sup 32}P label was completely removed from the protein by treatment with snake venom phosphodiesterase and the digestion product was identified as ({sup 32}P)AMP, indicating the protein was mono-ADP-ribosylated. HPLC analysis of tryptic peptides of the {sup 32}P-labeled 97-kDa protein and purified EF-2, which was ADP-ribosylated in vitro with diphtheria toxin fragment A and ({sup 32}P)NAD, demonstrated an identical labeled peptide in the two proteins. The data strongly suggest that EF-2 was endogenously ADP-ribosylated in pyBHK cells. Maximum incorporation of radioactivity in EF-2 occurred by 12 hr and remained constant over the subsequent 12 hr. It was estimated that 30-35% of the EF-2 was ADP-ribosylated in cells cultured in medium containing 2% serum. When {sup 32}P-labeled cultures were incubated in medium containing unlabeled phosphate, the {sup 32}P label was lost from the EF-2 within 30 min.
Tang, Yuehui; Qin, Shanshan; Guo, Yali; Chen, Yanbo; Wu, Pingzhi; Chen, Yaping; Li, Meiru; Jiang, Huawu; Wu, Guojiang
2016-01-01
The AP2/ERF transcription factors play crucial roles in plant growth, development and responses to biotic and abiotic stresses. A total of 119 AP2/ERF genes (JcAP2/ERFs) have been identified in the physic nut genome; they include 16 AP2, 4 RAV, 1 Soloist, and 98 ERF genes. Phylogenetic analysis indicated that physic nut AP2 genes could be divided into 3 subgroups, while ERF genes could be classed into 11 groups or 43 subgroups. The AP2/ERF genes are non-randomly distributed across the 11 linkage groups of the physic nut genome and retain many duplicates which arose from ancient duplication events. The expression patterns of several JcAP2/ERF duplicates in the physic nut showed differences among four tissues (root, stem, leaf, and seed), and 38 JcAP2/ERF genes responded to at least one abiotic stressor (drought, salinity, phosphate starvation, and nitrogen starvation) in leaves and/or roots according to analysis of digital gene expression tag data. The expression of JcERF011 was downregulated by salinity stress in physic nut roots. Overexpression of the JcERF011 gene in rice plants increased its sensitivity to salinity stress. The increased expression levels of several salt tolerance-related genes were impaired in the JcERF011-overexpressing plants under salinity stress.
Chao, Chun-Nun; Yang, Yu-Hsuan; Wu, Mu-Sheng; Chou, Ming-Chieh; Fang, Chiung-Yao; Lin, Mien-Chun; Tai, Chien-Kuo; Shen, Cheng-Huang; Chen, Pei-Lain; Chang, Deching; Wang, Meilin
2018-02-02
Glioblastoma multiforme (GBM), the most common malignant brain tumor, has a short period of survival even with recent multimodality treatment. The neurotropic JC polyomavirus (JCPyV) infects glial cells and oligodendrocytes and causes fatal progressive multifocal leukoencephalopathy in patients with AIDS. In this study, a possible gene therapy strategy for GBM using JCPyV virus-like particles (VLPs) as a gene delivery vector was investigated. We found that JCPyV VLPs were able to deliver the GFP reporter gene into tumor cells (U87-MG) for expression. In an orthotopic xenograft model, nude mice implanted with U87 cells expressing the near-infrared fluorescent protein and then treated by intratumoral injection of JCPyV VLPs carrying the thymidine kinase suicide gene, combined with ganciclovir administration, exhibited significantly prolonged survival and less tumor fluorescence during the experiment compared with controls. Furthermore, JCPyV VLPs were able to protect and deliver a suicide gene to distal subcutaneously implanted U87 cells in nude mice via blood circulation and inhibit tumor growth. These findings show that metastatic brain tumors can be targeted by JCPyV VLPs carrying a therapeutic gene, thus demonstrating the potential of JCPyV VLPs to serve as a gene therapy vector for the far highly treatment-refractory GBM.
Human glial chimeric mice reveal astrocytic dependence of JC virus infection
DEFF Research Database (Denmark)
Kondo, Yoichi; Windrem, Martha S; Zou, Lisa
2014-01-01
with humanized white matter by engrafting human glial progenitor cells (GPCs) into neonatal immunodeficient and myelin-deficient mice. Intracerebral delivery of JCV resulted in infection and subsequent demyelination of these chimeric mice. Human GPCs and astrocytes were infected more readily than...... that was chimeric for human astrocytes and GPCs. JCV effectively propagated in these mice, which indicates that astroglial infection is sufficient for JCV spread. Sequencing revealed progressive mutation of the JCV capsid protein VP1 after infection, suggesting that PML may evolve with active infection...
Jc enhancement by La-Al-O doping in Y-Ba-Cu-O films both in self-field and under magnetic field
DEFF Research Database (Denmark)
Xu, Yan; Suo, Hong-Li; Yue, Zhao
2016-01-01
a good epitaxial growth relationship with LAO. Compared with a pure YBCO film, the Jc value of a 5.0% LAO-doped sample is enhanced more than three times in self-field 77 K and seven times at 77 K and 1.5 T, respectively. These results indicate that LAO doping can effectively enhance the Jc of YBCO films...... toward YBCO. A series of YBCO films with different LAO doping contents was fabricated on LAO single-crystal substrates by metal organic deposition. We observed by X-ray diffractometer measurements and scanning electron microscopy observations that although a large amount of LAO is added, YBCO still keeps...
Contreras, Rubén H; dos Santos, Francisco P; Ducati, Lucas C; Tormena, Cláudio F
2010-12-01
Adequate analyses of canonical molecular orbitals (CMOs) can provide rather detailed information on the importance of different σ-Fermi contact (FC) coupling pathways (FC term transmitted through the σ-skeleton). Knowledge of the spatial distribution of CMOs is obtained by expanding them in terms of natural bond orbitals (NBOs). Their relative importance for transmitting the σ-FC contribution to a given spin-spin coupling constants (SSCCs) is estimated by resorting to the expression of the FC term given by the polarisation propagator formalism. In this way, it is possible to classify the effects affecting such couplings in two different ways: delocalisation interactions taking place in the neighbourhood of the coupling nuclei and 'round the ring' effects. The latter, associated with σ-ring currents, are observed to yield significant differences between the FC terms of (2)J(C2H3) and (2)J(C3H2) SSCCs which, consequently, are taken as probes to gauge the differences in σ-ring currents for the five-membered rings (furan, thiophene, selenophene and pyrrol) and also for the six-membered rings (benzene, pyridine, protonated pyridine and N-oxide pyridine) used in the present study. Copyright © 2010 John Wiley & Sons, Ltd.
Energy Technology Data Exchange (ETDEWEB)
Ranot, Mahipal; Shinde, K. P.; Oh, Y. S.; Kang, S. H.; Jang, S. H.; Hwang, D. Y.; Chung, K. C. [Korea Institute of Materials Science, Changwon (Korea, Republic of)
2017-09-15
Carbon coating approach is used to prepare carbon-doped MgB{sub 2} bulk samples using low-cost naphthalene (C{sub 10}H{sub 8}) as a carbon source. The coating of carbon (C) on boron (B) powders was achieved by direct pyrolysis of naphthalene at 120 degrees C and then the C-coated B powders were mixed well with appropriate amount of Mg by solid state reaction method. X-ray diffraction analysis revealed that there is a noticeable shift in (100) and (110) Bragg reflections towards higher angles, while no shift was observed in (002) reflections for MgB2 doped with carbon. As compared to un-doped MgB{sub 2}, a systematic enhancement in Jc(H) properties with increasing carbon doping level was observed for naphthalene-derived C-doped MgB{sub 2} samples. The substantial enhancement in Jc is most likely due to the incorporation of C into MgB{sub 2} lattice and the reduction in crystallite size, as evidenced by the increase in the FWHM values for doped samples.
Enhanced Jc's of YBa2Cu3O7-x-Ag ex situ annealed coevaporated films on LaAlO3 (100) substrates
DEFF Research Database (Denmark)
Clausen, Thomas; Ejrnæs, Mikkel; Olesen, Michael Wiinberg
1995-01-01
A 5x increase of the critical current density (J(c)) at 77 K was obtained by coating a coevaporated 500 nm thick Y, BaF2, Cu film with 50 nm Ag prior to the ex situ annealing. J(c) increased from 0.2 for uncoated samples to 1 MA/cm(2) for the Ag-coated sample without severely affecting the zero...... resistance transition temperature (T-c0). Scanning electron microscopy showed that the surface morphology was improved and that the normally observed trellislike structure was greatly reduced. By combining electron microscopy and sputter assisted Auger analysis it was found that the Ag nucleated in droplets...
Tracing Males From Different Continents by Genotyping JC Polyomavirus in DNA From Semen Samples.
Rotondo, John Charles; Candian, Tommaso; Selvatici, Rita; Mazzoni, Elisa; Bonaccorsi, Gloria; Greco, Pantaleo; Tognon, Mauro; Martini, Fernanda
2017-05-01
The human JC polyomavirus (JCPyV) is an ubiquitous viral agent infecting approximately 60% of humans. Recently, JCPyV sequences have been detected in semen samples. The aim of this investigation was to test whether semen JCPyV genotyping can be employed to trace the origin continent of males. Semen DNA samples (n = 170) from males of different Continents were investigated by PCR for the polymorphic JCPyV viral capsid protein 1 (VP1) sequences, followed by DNA sequencing. JCPyV sequences were detected with an overall prevalence of 27.6% (47/170). DNA sequencing revealed that European males carried JCPyV types 1A (71.4%), 4 (11.4%), 2B (2.9%), 2D1 (2.9%), and 3A (2.9%). Asians JCPyV type 2D1 (66.7%) and Africans JCPyV types 3A (33.3%) and 1A (33.3%). In 10.6% of males, two different JCPyV genotypes were detected, suggesting that the second JCPyV genotype was acquired in the destination country. This study indicates that the majority of semen samples found to be JCPyV-positive, were infected with the JCPyV genotype found in the geographic area of male origin. Therefore, semen JCPyV genotyping could be employed to trace the origin continent of males. Our findings could be applied to forensic investigations, in case of for instance sexual crimes. Indeed, JCPyV genotyping should enable investigators to make additional detailed profiling of the offender. J. Cell. Physiol. 232: 982-985, 2017. © 2016 Wiley Periodicals, Inc. © 2016 Wiley Periodicals, Inc.
International Nuclear Information System (INIS)
Verma, Saguna; Ziegler, Katja; Ananthula, Praveen; Co, Juliene K.G.; Frisque, Richard J.; Yanagihara, Richard; Nerurkar, Vivek R.
2006-01-01
Human polyomavirus JC (JCV) infects 80% of the population worldwide. Primary infection, typically occurring during childhood, is asymptomatic in immunocompetent individuals and results in lifelong latency and persistent infection. However, among the severely immunocompromised, JCV may cause a fatal demyelinating disease, progressive multifocal leukoencephalopathy (PML). Virus-host interactions influencing persistence and pathogenicity are not well understood, although significant regulation of JCV activity is thought to occur at the level of transcription. Regulation of the JCV early and late promoters during the lytic cycle is a complex event that requires participation of both viral and cellular factors. We have used cDNA microarray technology to analyze global alterations in gene expression in JCV-permissive primary human fetal glial cells (PHFG). Expression of more than 400 cellular genes was altered, including many that influence cell proliferation, cell communication and interferon (IFN)-mediated host defense responses. Genes in the latter category included signal transducer and activator of transcription 1 (STAT1), interferon stimulating gene 56 (ISG56), myxovirus resistance 1 (MxA), 2'5'-oligoadenylate synthetase (OAS), and cig5. The expression of these genes was further confirmed in JCV-infected PHFG cells and the human glioblastoma cell line U87MG to ensure the specificity of JCV in inducing this strong antiviral response. Results obtained by real-time RT-PCR and Western blot analyses supported the microarray data and provide temporal information related to virus-induced changes in the IFN response pathway. Our data indicate that the induction of an antiviral response may be one of the cellular factors regulating/controlling JCV replication in immunocompetent hosts and therefore constraining the development of PML
Infección por Polyoma virus en un paciente con transplante renal: A propósito de un caso
Directory of Open Access Journals (Sweden)
Reyner Loza Munarriz
2008-07-01
Full Text Available La nefropatia por polyoma virus (NVBK esta siendo reconocida como causa importante de falla del injerto, usualmente confundido con rechazo agudo. A la fecha, no se han reportado casos en el Perú. Se presenta el caso de un niño trasplantado, 17 años de edad, quien presentó elevación persistente de la creatinina sérica en el primer mes postrasplante. Fue tratado como rechazo agudo. Al no presentar mejoría se realizó biopsia renal que mostró marcado daño del epitelio tubular con necrosis parcial y desprendimiento hacia la luz tubular y la presencia de células atípicas con escaso citoplasma e inclusiones intranucleares basofilicas, hallazgos compatibles con infección por virus BK. No se evidenció signos de rechazo. Además, en el papanicolao de orina, se encontró Decoy cells. La carga viral de virus BK fue elevada en sangre y en orina. Se suspendió el tratamiento con mofetil micofenolato, se redujo la dosis de tacrolimus y se inició el tratamiento con leflunomide 40 mg/dia. Seis meses después la función renal del paciente se estabilizó, pero sin mejoría completa quedando con una depuración de creatinina de 30 ml/min/1,73 m² SC. (Rev Med Hered 2008;19:123-127
Shao, Minglong; Zhang, Xian; Rao, Zhiming; Xu, Meijuan; Yang, Taowei; Li, Hui; Xu, Zhenghong
2015-01-01
To improve the androst-1,4-diene-3,17-dione (ADD) production from phytosterol by Mycobacterium neoaurum JC-12, fructose was firstly found favorable as the initial carbon source to increase the biomass and eliminate the lag phase of M. neoaurum JC-12 in the phytosterol transformation process. Based on this phenomenon, two-stage fermentation by using fructose as the initial carbon source and feeding glucose to maintain strain metabolism was designed. By applying this strategy, the fermentation duration was decreased from 168 h to 120 h with the ADD productivity increased from 0.071 g/(L·h) to 0.108 g/(L·h). Further, three-stage fermentation by adding phytosterol to improve ADD production at the end of the two-stage fermentation was carried out and the final ADD production reached 18.6 g/L, which is the highest reported ADD production using phytosterol as substrate. Thus, this strategy provides a possible way in enhancing the ADD production in pharmaceutical industry. PMID:26352898
Directory of Open Access Journals (Sweden)
Minglong Shao
Full Text Available To improve the androst-1,4-diene-3,17-dione (ADD production from phytosterol by Mycobacterium neoaurum JC-12, fructose was firstly found favorable as the initial carbon source to increase the biomass and eliminate the lag phase of M. neoaurum JC-12 in the phytosterol transformation process. Based on this phenomenon, two-stage fermentation by using fructose as the initial carbon source and feeding glucose to maintain strain metabolism was designed. By applying this strategy, the fermentation duration was decreased from 168 h to 120 h with the ADD productivity increased from 0.071 g/(L·h to 0.108 g/(L·h. Further, three-stage fermentation by adding phytosterol to improve ADD production at the end of the two-stage fermentation was carried out and the final ADD production reached 18.6 g/L, which is the highest reported ADD production using phytosterol as substrate. Thus, this strategy provides a possible way in enhancing the ADD production in pharmaceutical industry.
La chronologie du royaume de Qatabân du Ier siècle avant J.-C. au Ier siècle après J.-C.
Directory of Open Access Journals (Sweden)
Mounir Arbach
2002-04-01
Full Text Available Les nouvelles découvertes archéologiques et épigraphiques de ces dernières années, effectuées au cours des fouilles franco-italiennes à Tamna`, l'ancienne capitale du royaume de Qatabân, permettent d'établir une nouvelle chronologie des souverains de Qatabân entre le Ier siècle avant J.-C. et le Ier siècle après J.- C.The chronology of the kingdom of Qatabân, from the 1st century BC to the 1st century AD. Archaeological and epigraphical discoveries made in recent years by the Franco-Italian excavations at Tamna`, the ancient capital of the kingdom of Qatabân, allows us to establish a new chronology for the kings of Qatabân during the 1st century BC and the 1st century AD.
A NEW METHOD FOR NON DESTRUCTIVE ESTIMATION OF Jc IN YBaCuO CERAMIC SAMPLES
Directory of Open Access Journals (Sweden)
Giancarlo Cordeiro Costa
2014-12-01
Full Text Available This work presents a new method for estimation of Jc as a bulk characteristic of YBCO blocks. The experimental magnetic interaction force between a SmCo permanent magnet and a YBCO block was compared to finite element method (FEM simulations results, allowing us to search a best fitting value to the critical current of the superconducting sample. As FEM simulations were based on Bean model , the critical current density was taken as an unknown parameter. This is a non destructive estimation method. since there is no need of breaking even a little piece of the sample for analysis.
2014-06-01
from the ODM standard. Leveraging SPARX EA’s Java application programming interface (API), the team built a tool called OWL2EA that can ingest an OWL...server MySQL creates the physical schema that enables a user to store and retrieve data conforming to the vocabulary of the JC3IEDM. 6. GENERATING AN
Paz, Sonia Patricia Castedo; Branco, Luciana; Pereira, Marina Alves de Camargo; Spessotto, Caroline; Fragoso, Yara Dadalti
2018-01-01
John Cunningham virus (JCV) is a polyoma virus that infects humans, mainly in childhood or adolescence, and presents no symptomatic manifestations. JCV can cause progressive multifocal leukoencephalopathy (PML) in immunosuppressed individuals, including those undergoing treatment for multiple sclerosis (MS) and neuromyelitis optica (NMO). PML is a severe and potentially fatal disease of the brain. The prevalence of JCV antibodies in human serum has been reported to be between 50.0 and 90.0%. The aim of the present study was to review worldwide data on populations of patients with MS and NMO in order to establish the rates of JCV seropositivity in these individuals. The present review followed the PRISMA (Preferred Reporting Items for Systematic Reviews and Meta-Analyses) guidelines and used the following search terms: "JCV" OR "JC virus" AND "multiple sclerosis" OR "MS" OR "NMO" OR "neuromyelitis optica" AND "prevalence." These terms were searched for both in smaller and in larger clusters of words. The databases searched included PubMed, MEDLINE, SciELO, LILACS, Google Scholar, and Embase. After the initial selection, 18 papers were included in the review. These articles reported the prevalence of JCV antibodies in the serum of patients with MS or NMO living in 26 countries. The systematic review identified data on 29,319 patients with MS/NMO and found that 57.1% of them (16,730 individuals) were seropositive for the anti-JCV antibody (range, 40.0 to 69.0%). The median worldwide prevalence of JCV among adults with MS or NMO was found to be 57.1%.
Haberkorn, N.; Suárez, S.; Pérez, P. D.; Troiani, H.; Granell, P.; Golmar, F.; Lee, Jae-Hun; Moon, S. H.
2017-11-01
We report the influence of crystalline defects introduced by 6 MeV 16O3+ irradiation on the critical current densities Jc and flux creep rates in 1.3 μm thick GdBa2Cu3O7-δ coated conductor produced by co-evaporation. Pristine films with pinning produced mainly by random nanoparticles with diameter close to 50 nm were irradiated with doses between 2 × 1013 cm-2 and 4 × 1014 cm-2. The irradiations were performed with the ion beam perpendicular to the surface of the samples. The Jc and the flux creep rates were analyzed for two magnetic field configurations: magnetic field applied parallel (H║c) and at 45° (H║45°) to the c-axis. The results show that at temperatures below 40 K the in-field Jc dependences can be significantly improved by irradiation. For doses of 1 × 1014 cm-2 the Jc values at μ0H = 5 T are doubled without affecting significantly the Jc at small fields. Analyzing the flux creep rates as function of the temperature in both magnetic field configurations, it can be observed that the irradiation suppresses the peak associated with double-kink relaxation and increases the flux creep rates at intermediate and high temperatures. Under 0.5 T, the flux relaxation for H‖c and H||45° in pristine films presents characteristic glassy exponents μ = 1.63 and μ = 1.45, respectively. For samples irradiated with 1 × 1014 cm-2, these values drop to μ = 1.45 and μ = 1.24, respectively
Analysis of JC virus DNA replication using a quantitative and high-throughput assay
Shin, Jong; Phelan, Paul J.; Chhum, Panharith; Bashkenova, Nazym; Yim, Sung; Parker, Robert; Gagnon, David; Gjoerup, Ole; Archambault, Jacques; Bullock, Peter A.
2015-01-01
Progressive Multifocal Leukoencephalopathy (PML) is caused by lytic replication of JC virus (JCV) in specific cells of the central nervous system. Like other polyomaviruses, JCV encodes a large T-antigen helicase needed for replication of the viral DNA. Here, we report the development of a luciferase-based, quantitative and high-throughput assay of JCV DNA replication in C33A cells, which, unlike the glial cell lines Hs 683 and U87, accumulate high levels of nuclear T-ag needed for robust replication. Using this assay, we investigated the requirement for different domains of T-ag, and for specific sequences within and flanking the viral origin, in JCV DNA replication. Beyond providing validation of the assay, these studies revealed an important stimulatory role of the transcription factor NF1 in JCV DNA replication. Finally, we show that the assay can be used for inhibitor testing, highlighting its value for the identification of antiviral drugs targeting JCV DNA replication. PMID:25155200
Directory of Open Access Journals (Sweden)
Sônia Maciel da Rosa-Osman
2011-03-01
Full Text Available Victoria amazonica (Poepp. J.C. Sowerby é uma hidrófita que ocorre nas várzeas de águas brancas e igapós da Bacia Amazônica e na Bacia do rio Paraguai. A morfologia da flor, fruto e plântula/"tirodendro" é objeto do presente trabalho. O material botânico foi coletado em Parintins e Manaus, estado do Amazonas, Brasil. A análise morfológica foi feita em material fresco e fixado em FAA 50. O desenvolvimento das plântulas foi realizado no escuro em frascos com água com teor reduzido de oxigênio. As flores possuem pedicelo longo e são hemicíclicas, diclamídeas, monoclinas e com antese vespertina. Os frutos são carnosos, indeiscentes, com pseudossincarpia. As sementes apresentam arilo que atua na dispersão pela água. As plântulas se desenvolvem em condições de hipoxia e apresentam um cotilédone exposto acicular. O "tirodendro" apresenta eofilos com heterofilia. As flores apresentam caracteres morfológicos básicos da família, a definição do tipo de fruto exige estudo ontogenético e a heterofilia é um caráter típico de plântulas/"tirodendros"de Nymphaeaceae.Victoria amazonica (Poepp. J.C. Sowerby is a hydrophyte that occurs in the white water leas and igapos of the Amazonian and Paraguay Basin. The flower, fruit and seedling/"tirodendro" morphology is the object of the present work. The botanical material was collected at Parintins and Manaus, Amazonian state, Brazil. The morphological analysis was made in both fresh and fixed material. The seedling development was accomplished in flasks with water containing little oxygen and maintained in the darkness. Flowers present long pedicel and they are hemicyclic, dichlamydeous, bisexual with vespertine anthesis. Fruits are fleshy, indehiscent with pseudo-syncarpy. Seeds present aril that acts in the water dispersion. Seedlings grow in hypoxy conditions and they present an acicular and exposed cotyledon. The "tirodendro" stage presents eophylls with heterophylly. Flowers
Phase I decontamination of the J.C. Haynes site, Newark, Ohio. Final report
International Nuclear Information System (INIS)
Emswiler, T.R.
1985-11-01
Phase I consisted of the primary decontamination, packaging, and shipment of all 241 Am-contaminated gloveboxes, vent system, and miscellaneous waste items located in the laboratory restricted area in the J.C. Haynes house. The primary goals of Phase I were to locate and account for a major quantity of 241 Am which was unaccounted for and to remove all radioactive materials and contamination posing an imminent hazard to public health and safety. All Phase I operations were conducted under a Quality Assurance (QA) Program Plan and QA procedures written specifically for this program. In addition, certain generic Battelle QA procedures were used for routine tasks. All operations were conducted under strict health physics supervision and procedures. Cognizant ORAU and US Nuclear Regulatory Commission (NRC) personnel were on site during the entire Phase I operation and provided support and approval in the daily operations. All staff members had participated in previous decontamination and decommissioning programs involving transuranic waste and completed Phase I in a well controlled, timely, and safe manner
Samén, Erik; Lu, Li; Mulder, Jan; Thorell, Jan-Olov; Damberg, Peter; Tegnebratt, Tetyana; Holmgren, Lars; Rundqvist, Helene; Stone-Elander, Sharon
2014-03-26
Vascular endothelial growth factor receptor 2 (VEGFR2) is a crucial mediator of tumour angiogenesis. High expression levels of the receptor have been correlated to poor prognosis in cancer patients. Reliable imaging biomarkers for stratifying patients for anti-angiogenic therapy could therefore be valuable for increasing treatment success rates. The aim of this study was to investigate the pharmacokinetics and angiogenesis imaging abilities of the VEGFR2-targeting positron emission tomography (PET) tracer (R)-[11C]PAQ. (R)-[11C]PAQ was evaluated in the mouse mammary tumour virus-polyoma middle T (MMTV-PyMT) model of metastatic breast cancer. Mice at different stages of disease progression were imaged with (R)-[11C]PAQ PET, and results were compared to those obtained with [18 F]FDG PET and magnetic resonance imaging. (R)-[11C]PAQ uptake levels were also compared to ex vivo immunofluorescence analysis of tumour- and angiogenesis-specific biomarkers. Additional pharmacokinetic studies were performed in rat and mouse. A heterogeneous uptake of (R)-[11C]PAQ was observed in the tumorous mammary glands. Ex vivo analysis confirmed the co-localization of areas with high radioactivity uptake and areas with elevated levels of VEGFR2. In some animals, a high focal uptake was observed in the lungs. The lung uptake correlated to metastatic and angiogenic activity, but not to uptake of [18 F]FDG PET. The pharmacokinetic studies revealed a limited metabolism and excretion during the 1-h scan and a distribution of radioactivity mainly to the liver, kidneys and lungs. In rat, a high uptake was additionally observed in adrenal and parathyroid glands. The results indicate that (R)-[11C]PAQ is a promising imaging biomarker for visualization of angiogenesis, based on VEGFR2 expression, in primary tumours and during metastasis development.
Energy Technology Data Exchange (ETDEWEB)
Larbalestier, David; Hellstron, Eric; Abraimov, Dmytro
2011-12-17
The primary thrusts of our work were to provide critical understanding of how best to enhance the current-carrying capacity of coated conductors. These include the deconstruction of Jc as a function of fim thickness, the growth of in situ films incorporating strong pinning centers and the use of a suite of position-sensitive tools that enable location and analysis of key areas where current-limiting occurs.
Shi, Xiaodong; Gu, Yuxi; Dai, Tingwei; Wu, Yang; Wu, Peng; Xu, Ying; Chen, Fang
2018-06-05
Trichomes are epidermal outgrowths of plant tissues that can secrete or store large quantities of secondary metabolites, which contribute to plant defense responses against stress. The use of bioengineering methods for regulating the development of trichomes and metabolism is a widely researched topic. In the present study, we demonstrate that JcZFP8, a C2H2 zinc finger protein gene from Jatropha curcas L., can regulate trichome development in transgenic tobacco. To understand the underlying mechanisms, we performed transcriptome profiling of overexpression JcZFP8 transgenic plants and wild-type tobacco. Based on the analysis of differentially expressed genes, we determined that genes of the plant hormone signal transduction pathway was significantly enriched, suggesting that these pathways were modulated in the transgenic plants. In addition, the transcript levels of the known trichome-related genes in Arabidopsis were not significantly changed, whereas CycB2 and MYB genes were differentially expressed in the transgenic plants. Despite tobacco and Arabidopsis have different types of trichomes, all the pathways were associated with C2H2 zinc finger protein genes. Our findings help us to understand the regulation of multicellular trichome formation and suggest a new metabolic engineering method for the improvement of plants. Copyright © 2018 Elsevier B.V. All rights reserved.
Directory of Open Access Journals (Sweden)
Sonia Patricia Castedo Paz
2018-01-01
Full Text Available OBJECTIVES John Cunningham virus (JCV is a polyoma virus that infects humans, mainly in childhood or adolescence, and presents no symptomatic manifestations. JCV can cause progressive multifocal leukoencephalopathy (PML in immunosuppressed individuals, including those undergoing treatment for multiple sclerosis (MS and neuromyelitis optica (NMO. PML is a severe and potentially fatal disease of the brain. The prevalence of JCV antibodies in human serum has been reported to be between 50.0 and 90.0%. The aim of the present study was to review worldwide data on populations of patients with MS and NMO in order to establish the rates of JCV seropositivity in these individuals. METHODS The present review followed the PRISMA (Preferred Reporting Items for Systematic Reviews and Meta-Analyses guidelines and used the following search terms: “JCV” OR “JC virus” AND “multiple sclerosis” OR “MS” OR “NMO” OR “neuromyelitis optica” AND “prevalence.” These terms were searched for both in smaller and in larger clusters of words. The databases searched included PubMed, MEDLINE, SciELO, LILACS, Google Scholar, and Embase. RESULTS After the initial selection, 18 papers were included in the review. These articles reported the prevalence of JCV antibodies in the serum of patients with MS or NMO living in 26 countries. The systematic review identified data on 29,319 patients with MS/NMO and found that 57.1% of them (16,730 individuals were seropositive for the anti-JCV antibody (range, 40.0 to 69.0%. CONCLUSIONS The median worldwide prevalence of JCV among adults with MS or NMO was found to be 57.1%.
Agarwal, Parinita; Patel, Khantika; Agarwal, Pradeep K
2018-04-01
Plants possess an innate immune system comprising of a complex network of closely regulated defense responses involving differential gene expression mediated by transcription factors (TFs). The WRKYs comprise of an important plant-specific TF family, which is involved in regulation of biotic and abiotic defenses. The overexpression of JcWRKY resulted in improved resistance in transgenic tobacco against Macrophomina phaseolina. The production of reactive oxygen species (ROS) and its detoxification through antioxidative system in the transgenics facilitates defense against Macrophomina. The enhanced catalase activity on Macrophomina infection limits the spread of infection. The transcript expression of antioxidative enzymes gene (CAT and SOD) and salicylic acid (SA) biosynthetic gene ICS1 showed upregulation during Macrophomina infection and combinatorial stress. The enhanced transcript of pathogenesis-related genes PR-1 indicates the accumulation of SA during different stresses. The PR-2 and PR-5 highlight the activation of defense responses comprising of activation of hydrolytic cleavage of glucanases and thaumatin-like proteins causing disruption of fungal cells. The ROS homeostasis in coordination with signaling molecules regulate the defense responses and inhibit fungal growth.
Directory of Open Access Journals (Sweden)
San-Yuan Chen
2017-01-01
Full Text Available The human polyomaviruses BK (BKPyV and JC (JCPyV are ubiquitous pathogens long associated with severe disease in immunocompromised individuals. BKPyV causes polyomavirus-associated nephropathy and hemorrhagic cystitis, whereas JCPyV is the causative agent of the fatal demyelinating disease progressive multifocal leukoencephalopathy. No effective therapies targeting these viruses are currently available. The goal of this study was to identify Chinese medicinal herbs with antiviral activity against BKPyV and JCPyV. We screened extracts of Chinese medicinal herbs for the ability to inhibit hemagglutination by BKPyV and JCPyV virus-like particles (VLPs and the ability to inhibit BKPyV and JCPyV binding and infection of host cells. Two of the 40 herbal extracts screened, Rhodiolae Kirliowii Radix et Rhizoma and Crataegus pinnatifida Fructus, had hemagglutination inhibition activity on BKPyV and JCPyV VLPs and further inhibited infection of the cells by BKPyV and JCPyV, as evidenced by reduced expression of viral proteins in BKPyV-infected and JCPyV-infected cells after treatment with Rhodiolae Kirliowii Radix et Rhizoma or Crataegus pinnatifida Fructus extract. The results in this work show that both Rhodiolae Kirliowii Radix et Rhizoma and Crataegus pinnatifida Fructus may be sources of potential antiviral compounds for treating BKPyV and JCPyV infections.
Directory of Open Access Journals (Sweden)
Guan Yi-fu
2009-03-01
Full Text Available Abstract Background John Cunningham virus (JCV constitutes a family of polyoma viruses, which plays important roles in the progressive multifocal leukoencephalopathy (PML and tumorigenesis. However, no bibliometric investigation has been reported to guide the researchers and potential readers. Methods Papers were collected from database Sci-expanded and Pubmed until May 22, 2008. The highly-productive authors, institutes and countries, highly-cited authors and journals were ranked. The highly-cited articles were subjected to co-citation and chronological analysis with highly-frequent MeSH words for co-occurrence analysis. Results Until now, 1785 articles about JCV were indexed in Sci-expanded and 1506 in Pubmed. The main document type was original article. USA, Japan and Italy were the largest three producers about JCV. Temple University published 128 papers and ranked the top, followed by University of Tokyo. Khalili K and Yogo Y became the core authors due to more than 20 documents produced. Journal of Neurovirology published more than 15 papers and ranked the top. Padgett BL and Berger JR were the first two highly-cited authors. Journal of Virology and Journal of Neurovirology respectively ranked to the first two highly-cited journals. These top highly-cited articles were divided into 5 aspects: (1 The correlation between JC virus and tumors; (2 Causal correlation of JCV with PML; (3 Polyoma virus infection and its related diseases in renal-allograft recipients; (4 Detection of JCV antibody, oncogene and its encoding protein; (5 Genetics and molecular biology of JCV. The MeSH/subheadings were classified into five groups: (1 JCV and virus infectious diseases; (2 JCV pathogenicity and pathological appearance of PML; (3 JCV isolation and detection; (4 Immunology of JCV and PML; (5 JCV genetics and tumors. Conclusion JCV investigation mainly focused on its isolation and detection, as well as its correlation with PML and tumors. Establishment of
CSIR Research Space (South Africa)
Ramadeen, P
2009-09-01
Full Text Available Roux [1]. Figure 13 shows the how the systems were connected during the respective exercises and operations. The computer icon represents a node. 7.2 Confederation Cup The Confederation Cup is a football tournament hosted by FIFA (The Fédération... Internationale de Football Association). It was held in South Africa in June 2009. Joint Command and Control is vital in events of this nature. JC2 includes include airspace control. The system was used as an Incident Management Tool to track and log...
Analysis of JC virus DNA replication using a quantitative and high-throughput assay
International Nuclear Information System (INIS)
Shin, Jong; Phelan, Paul J.; Chhum, Panharith; Bashkenova, Nazym; Yim, Sung; Parker, Robert; Gagnon, David; Gjoerup, Ole; Archambault, Jacques; Bullock, Peter A.
2014-01-01
Progressive Multifocal Leukoencephalopathy (PML) is caused by lytic replication of JC virus (JCV) in specific cells of the central nervous system. Like other polyomaviruses, JCV encodes a large T-antigen helicase needed for replication of the viral DNA. Here, we report the development of a luciferase-based, quantitative and high-throughput assay of JCV DNA replication in C33A cells, which, unlike the glial cell lines Hs 683 and U87, accumulate high levels of nuclear T-ag needed for robust replication. Using this assay, we investigated the requirement for different domains of T-ag, and for specific sequences within and flanking the viral origin, in JCV DNA replication. Beyond providing validation of the assay, these studies revealed an important stimulatory role of the transcription factor NF1 in JCV DNA replication. Finally, we show that the assay can be used for inhibitor testing, highlighting its value for the identification of antiviral drugs targeting JCV DNA replication. - Highlights: • Development of a high-throughput screening assay for JCV DNA replication using C33A cells. • Evidence that T-ag fails to accumulate in the nuclei of established glioma cell lines. • Evidence that NF-1 directly promotes JCV DNA replication in C33A cells. • Proof-of-concept that the HTS assay can be used to identify pharmacological inhibitor of JCV DNA replication
Analysis of JC virus DNA replication using a quantitative and high-throughput assay
Energy Technology Data Exchange (ETDEWEB)
Shin, Jong; Phelan, Paul J.; Chhum, Panharith; Bashkenova, Nazym; Yim, Sung; Parker, Robert [Department of Developmental, Molecular and Chemical Biology, Tufts University School of Medicine, Boston, MA 02111 (United States); Gagnon, David [Institut de Recherches Cliniques de Montreal (IRCM), 110 Pine Avenue West, Montreal, Quebec, Canada H2W 1R7 (Canada); Department of Biochemistry and Molecular Medicine, Université de Montréal, Montréal, Quebec (Canada); Gjoerup, Ole [Molecular Oncology Research Institute, Tufts Medical Center, Boston, MA 02111 (United States); Archambault, Jacques [Institut de Recherches Cliniques de Montreal (IRCM), 110 Pine Avenue West, Montreal, Quebec, Canada H2W 1R7 (Canada); Department of Biochemistry and Molecular Medicine, Université de Montréal, Montréal, Quebec (Canada); Bullock, Peter A., E-mail: Peter.Bullock@tufts.edu [Department of Developmental, Molecular and Chemical Biology, Tufts University School of Medicine, Boston, MA 02111 (United States)
2014-11-15
Progressive Multifocal Leukoencephalopathy (PML) is caused by lytic replication of JC virus (JCV) in specific cells of the central nervous system. Like other polyomaviruses, JCV encodes a large T-antigen helicase needed for replication of the viral DNA. Here, we report the development of a luciferase-based, quantitative and high-throughput assay of JCV DNA replication in C33A cells, which, unlike the glial cell lines Hs 683 and U87, accumulate high levels of nuclear T-ag needed for robust replication. Using this assay, we investigated the requirement for different domains of T-ag, and for specific sequences within and flanking the viral origin, in JCV DNA replication. Beyond providing validation of the assay, these studies revealed an important stimulatory role of the transcription factor NF1 in JCV DNA replication. Finally, we show that the assay can be used for inhibitor testing, highlighting its value for the identification of antiviral drugs targeting JCV DNA replication. - Highlights: • Development of a high-throughput screening assay for JCV DNA replication using C33A cells. • Evidence that T-ag fails to accumulate in the nuclei of established glioma cell lines. • Evidence that NF-1 directly promotes JCV DNA replication in C33A cells. • Proof-of-concept that the HTS assay can be used to identify pharmacological inhibitor of JCV DNA replication.
Directory of Open Access Journals (Sweden)
Lanzillo R
2014-10-01
Full Text Available Roberta Lanzillo,1 Raffaele Liuzzi,2 Luca Vallefuoco,3 Marcello Moccia,1 Luca Amato,1 Giovanni Vacca,1 Veria Vacchiano,1 Giuseppe Portella,3 Vincenzo Brescia Morra1 1Neurological Sciences Department, Federico II University, 2Institute of Biostructure and Bioimaging, National Research Council, 3Clinical Pathology Department, Federico II University, Naples, ItalyAbstract: Natalizumab-treated patients have a higher risk of developing progressive multifocal leukoencephalopathy. Exposure to John Cunningham virus (JCV is a prerequisite for PML (progressive multifocal leukoencephalopathy. To assess JCV exposure in multiple sclerosis patients, we performed a serological examination, obtained the antibody index, performed real-time polymerase chain reaction (PCR to detect JCV DNA in plasma and urine, and investigated the role of ultrasensitive C-reactive protein (usCRP as a possible biological marker of JCV reactivation. We retrospectively analyzed consecutive natalizumab-treated multiple sclerosis patients who underwent a JCV antibody test through a two-step enzyme-linked immunosorbent assay (STRATIFY test to the measure of serum usCRP levels, and to perform blood and urine JCV PCR. The studied cohort included 97 relapsing–remitting patients (60 women. Fifty-two patients (53.6% tested positive for anti-JCV antibodies. PCR showed JCV DNA in the urine of 30 out of 83 (36.1% patients and 28 out of 44 seropositive patients (63.6%, with a 6.7% false-negative rate for the STRATIFY test. Normalized optical density values were higher in urinary JCV DNA-positive patients (P<0.0001. Interestingly, the level of usCRP was higher in urinary JCV DNA-positive patients and correlated to the number of DNA copies in urine (P=0.028. As expected, patients' age correlated with JCV seropositivity and with JC viruria (P=0.02 and P=0.001, respectively. JC viruria was significantly correlated with a high JCV antibody index and high serum usCRP levels. We suggest that PCR and
Progressive Multifocal Leukoencephalopathy: Recent Advances and a Neuro-Ophthalmological Review.
Sudhakar, Padmaja; Bachman, David M; Mark, Alexander S; Berger, Joseph R; Kedar, Sachin
2015-09-01
Progressive multifocal leukoencephalopathy (PML) is a severe often fatal opportunistic infection of the central nervous system caused by reactivation of a ubiquitous polyoma virus, JC virus. Although typically characterized by multifocal asymmetric subcortical white matter lesions, it may be monofocal and affect the cortical gray matter. Among the broad spectrum of clinical manifestations that occurs with PML, visual complaints are common. Combination of representative personally observed cases of PML and comprehensive review of case series of PML from 1958 through 2014. Neuro-ophthalmic signs and symptoms were reported in approximately 20%-50% of patients with PML and can be the presenting manifestation in half of these. A majority of these presentations occur from damage to cerebral visual pathways resulting in visual field defects, cortical blindness, and other disorders of visual association. Given the decreased frequency of infratentorial and cerebellar involvement, ocular motility disorders are less common. Visual complaints occur in patients with PML and are often the presenting sign. Awareness of this condition is helpful in avoiding unnecessary delays in the diagnosis of PML and management of the underlying condition. Recent guidelines have established criteria for diagnosis of PML in the high-risk patient population and strategies to mitigate the risk in these populations.
Ramaprasad, E V V; Rizvi, A; Banerjee, S; Sasikala, Ch; Ramana, Ch V
2016-11-01
Gram-stain-positive, acid-fast-positive, rapidly growing, rod-shaped bacteria (designated as strains JC290T, JC430 and JC431) were isolated from paddy cultivated soils on the Western Ghats of India. Phylogenetic analysis placed the three strains among the rapidly growing mycobacteria, being most closely related to Mycobacterium tokaiense 47503T (98.8 % 16S rRNA gene sequence similarity), Mycobacterium murale MA112/96T (98.8 %) and a few other Mycobacterium species. The level of DNA-DNA reassociation of the three strains with M. tokaiense DSM 44635T was 23.4±4 % (26.1±3 %, reciprocal analysis) and 21.4±2 % (22.1±4 %, reciprocal analysis). The three novel strains shared >99.9 % 16S rRNA gene sequence similarity and DNA-DNA reassociation values >85 %. Furthermore, phylogenetic analysis based on concatenated sequences (3071 bp) of four housekeeping genes (16S rRNA, hsp65, rpoB and sodA) revealed that strain JC290T is clearly distinct from all other Mycobacteriumspecies. The three strains had diphosphatidylglycerol, phosphatidylethanolamine, phosphatidylinositol, phosphatidylinositolmannosides, unidentified phospholipids, unidentified glycolipids and an unidentified lipid as polar lipids. The predominant isoprenoid quinone for all three strains was MK-9(H2). Fatty acids were C17 : 1ω7c, C16 : 0, C18 : 1ω9c, C16 : 1ω7c/C16 : 1ω6c and C19 : 1ω7c/C19 : 1ω6c for all the three strains. On the basis of phenotypic, chemotaxonomic and phylogenetic data, it was concluded that strains JC290T, JC430 and JC431 are members of a novel species within the genus Mycobacterium and for which the name Mycobacterium oryzae sp. nov. is proposed. The type strain is JC290T (=KCTC 39560T=LMG 28809T).
Md. Azizur Rahman; Arshad Hussain
2015-01-01
MTT assay and DAPI staining test were performed to evaluate anticancer potential and to assess apoptosis inducing effect of methanolic extract of Cordia dichotoma leaves (MECD) against human cervical cancer cell line (HeLa). Changes in MMP and intracellular ROS level were also assessed by JC-1 and DCFH-DA staining. Total phenolic contents were determined by colorimetric principle. Levels of statistical significance were determined by one-way analysis of variance followed by Dunnett’s posttest...
Kano, Fumihiro; Shepherd, Stephen V.; Hirata, Satoshi; Call, Josep
2018-01-01
Financial support came from Japan Society for Promotion of Science (JSPS) [grant numbers: KAKENHI 26885040, 16K21108 to FK, KAKENHI 26245069, 16H06301, 16H06283, JSPS-LGP-U04 to SH] and Ministry of Education, Culture, Sports, Science and Technology (MEXT) [K-CONNEX to FK], and the European Research Council [SOMICS 609819 to JC]. When viewing social scenes, humans and nonhuman primates focus on particular features, such as the models’ eyes, mouth, and action targets. Previous studies report...
Directory of Open Access Journals (Sweden)
Katsuhiko Nosho
2009-01-01
Full Text Available JC virus has a transforming gene encoding JC virus T-antigen (JCVT. JCVT may inactivate wild-type p53, cause chromosomal instability (CIN, and stabilize β-catenin. A link between JCVT and CpG island methylator phenotype (CIMP has been suggested. However, no large-scale study has examined the relations of JCVT with molecular alterations, clinical outcome, or prognosis in colon cancer. We detected JCVT expression (by immunohistochemistry in 271 (35% of 766 colorectal cancers. We quantified DNA methylation in eight CIMP-specific promoters (CACNA1G, CDKN2A, CRABP1, IGF2, MLH1, NEUROG1, RUNX3, and SOCS1 and eight other loci (CHFR, HIC1, IGFBP3, MGMT, MINT1, MINT31, p14, WRN by MethyLight. We examined loss of heterozygosity in 2p, 5q, 17q, and 18q. JCVT was significantly associated with p53 expression (P < .0001, p21 loss (P < .0001, CIN (≥2 chromosomal segments with LOH; P < .0001, nuclear β-catenin (P = .006, LINE-1 hypomethylation (P = .002, and inversely with CIMP-high (P = .0005 and microsatellite instability (MSI (P < .0001, but not with PIK3CA mutation. In multivariate logistic regression analysis, the associations of JCVT with p53 [adjusted odds ratio (OR, 8.45; P < .0001], CIN (adjusted OR, 2.53; P = .003, cyclin D1 (adjusted OR, 1.57; P = .02, LINE-1 hypomethylation (adjusted OR, 1.97 for a 30% decline as a unit; P = .03, BRAF mutation (adjusted OR, 2.20; P = .04, and family history of colorectal cancer (adjusted OR, 0.64; P = .04 remained statistically significant. However, JCVT was no longer significantly associated with CIMP, MSI, β-catenin, or cyclooxygenase-2 expression in multivariate analysis. JCVT was unrelated with patient survival. In conclusion, JCVT expression in colorectal cancer is independently associated with p53 expression and CIN, which may lead to uncontrolled cell proliferation.
Polz-Gruszka, Dorota; Morshed, Kamal; Jarzyński, Adrian; Polz-Dacewicz, Małgorzata
2015-01-01
The aim of this study was to analyze the prevalence of BK virus, Human Papillomavirus and Epstein-Barr virus in oropharyngeal cancer, and to test our hypothesis that BKV/HPV/EBV co-infection plays a role in oropharyngeal squamous cell carcinoma. The correlation between viral infection, OSCC, anatomic location, pre-treatment staging, evidence of metastases to lymph nodes, and grading was also investigated. The examination samples were collected from 62 patients from paraffin tissue blocks. Males (90.3%) with, smoking (83.9%) and alcohol abuse (67.7%) problems prevailed in the studied group. G2 histological type was recognized in 80.6% cases. T4 (77.4%) and N2 (56.5%) traits occurred in the majority of patients. No cases of metastasis were observed (M0 100%). HPV - 24.2%, EBV - 27.4% and BKV 17.7% were detected in the studied samples. We observed co-infection EBV/BKV in 8% of cases, HPV/BKV in 4.8%, and HPV/EBV in 9% cases. Only in two cases co-infection of all three viruses was found.
Oxygen tension level and human viral infections
Energy Technology Data Exchange (ETDEWEB)
Morinet, Frédéric, E-mail: frederic.morinet@sls.aphp.fr [Centre des Innovations Thérapeutiques en Oncologie et Hématologie (CITOH), CHU Saint-Louis, Paris (France); Université Denis Diderot, Sorbonne Paris Cité Paris, Paris (France); Casetti, Luana [Institut Cochin INSERM U1016, Paris (France); François, Jean-Hugues; Capron, Claude [Institut Cochin INSERM U1016, Paris (France); Laboratoire d' Hématologie, Hôpital Ambroise Paré, Boulogne (France); Université de Versailles Saint-Quentin en Yvelynes, Versailles (France); Pillet, Sylvie [Laboratoire de Bactériologie-Virologie-Hygiène, CHU de Saint-Etienne, Saint-Etienne (France); Université de Lyon et Université de Saint-Etienne, Jean Monnet, GIMAP EA3064, F-42023 Saint-Etienne, Lyon (France)
2013-09-15
The role of oxygen tension level is a well-known phenomenon that has been studied in oncology and radiotherapy since about 60 years. Oxygen tension may inhibit or stimulate propagation of viruses in vitro as well as in vivo. In turn modulating oxygen metabolism may constitute a novel approach to treat viral infections as an adjuvant therapy. The major transcription factor which regulates oxygen tension level is hypoxia-inducible factor-1 alpha (HIF-1α). Down-regulating the expression of HIF-1α is a possible method in the treatment of chronic viral infection such as human immunodeficiency virus infection, chronic hepatitis B and C viral infections and Kaposi sarcoma in addition to classic chemotherapy. The aim of this review is to supply an updating concerning the influence of oxygen tension level in human viral infections and to evoke possible new therapeutic strategies regarding this environmental condition. - Highlights: • Oxygen tension level regulates viral replication in vitro and possibly in vivo. • Hypoxia-inducible factor 1 (HIF-1α) is the principal factor involved in Oxygen tension level. • HIF-1α upregulates gene expression for example of HIV, JC and Kaposi sarcoma viruses. • In addition to classical chemotherapy inhibition of HIF-1α may constitute a new track to treat human viral infections.
Directory of Open Access Journals (Sweden)
Adriano Victor Lopes da Silva
2009-01-01
Full Text Available The objective of this work was to use a multivariate statistical method as an alternative to estimate the green biomass of the main bamboo rod, Bambusa vulgaris Schrad. i.e.: J.C. Wendl., in the presence of multicollinearity. The data came from an experiment carried out for the Agroindustrial Excelsior S. A. (Agrimex company located in the city of Goiana - PE. Quantified by their green biomass weight, 450 bamboo rods were used and 4 independent variables measured in the rod. Initially, the presence of the multicollinearity could be verified through the correlation matrix of the independent variables and the varience inflation factors, the alternative used was the regression of the principal components based on the covariate matrix. The result indicates that, when there is an interpretation to the main components, the model shows a satisfactory data adjust, and it could be used to estimate the green biomass of the main bamboo rod.
Watts, D M; LeDuc, J W; Bailey, C L; Dalrymple, J M; Gargan, T P
1982-11-01
Serological data accumulated during the past decade indicated that a variety of feral and domestic animals of the Delaware-Maryland-Virginia (DelMarVa) Peninsula were infected with Jamestown Canyon (JC) and/or Keystone (KEY) viruses (Bunyaviridae, California serogroup). Neutralizing (N) antibody to JC virus was most prevalent in white-tailed deer, sika deer, cottontail rabbits and horses. KEY virus N antibody was detected most frequently in gray squirrels and domestic goats. N antibody indicative of past infection by one or both viruses also was found in raccoons, horses and humans. JC and/or KEY virus N antibodies were not demonstrable in sera of several other species of small mammals and reptiles. Investigations were extended to evaluate the role of domestic goats as an amplifying host of JC and KEY viruses and to assess their potential as sentinels of virus transmission. Goats maintained in the Pocomoke Cypress Swamp during the summer season of 1978, acquired N antibodies to JC and KEY viruses. Following experimental inoculation with either JC or KEY virus, all goats developed N antibody despite the absence of a demonstrable viremia in most animals. Goats proved to be effective as sentinels for monitoring the transmission of JC and KEY viruses; however, the exceptionally low titers or absence of viremia following inoculation with these viruses would seem to preclude a potential virus-amplifying role for this species. Although findings implicated primarily gray squirrels and white-tailed deer as possible amplifying hosts of KEY and JC virus, respectively, further investigations will be required to clarify their role, particularly since both viruses may be maintained entirely by transovarial transmission.
Schneidewind, Laila; Neumann, Thomas; Knoll, Florian; Zimmermann, Kathrin; Smola, Sigrun; Schmidt, Christian Andreas; Krüger, William
2017-01-01
The association of polyomaviruses BK and JC with other opportunistic infections and graft-versus-host disease (GvHD) in allogeneic stem cell transplantation is controversially discussed. We conducted a retrospective study of 64 adult patients who received their first allogeneic stem cell transplantation between March 2010 and December 2014; the follow-up time was 2 years. Acute leukemia was the most frequent underlying disease (45.3%), and conditioning included myeloablative (67.2%) and nonmyeloablative protocols (32.8%). All patients received 10 mg of alemtuzumab on day -2 (20 mg in case of mismatch) as GvHD prophylaxis. Twenty-seven patients (41.5%) developed cytomegalovirus (CMV) reactivation. BKPyV-associated hemorrhagic cystitis was diagnosed in 10 patients (15.6%). Other opportunistic infections caused by viruses or protozoa occurred rarely (reactivation, Epstein-Barr virus reactivation, human herpes virus 6, or parvovirus B19 infection requiring treatment. There was a significant correlation of BKPyV-associated hemorrhagic cystitis with toxoplasmosis (p = 0.013). Additionally, there was a significant link of simultaneous BKPyV and JCPyV viruria with toxoplasmosis (p = 0.047). BKPyV and JCPyV were not associated with GvHD, relapse, or death. We found no association of BKPyV or JCPyV with viral infections or GvHD. Only the correlation of both polyomaviruses with toxoplasmosis was significant. This is a novel and interesting finding. © 2017 S. Karger AG, Basel.
Investigating the Role of FIP200 in Mammary Carcinogenesis Using a Transgenic Mouse Model
National Research Council Canada - National Science Library
Nagy, Tamas
2007-01-01
...) deletion in mammary-specific polyoma middle-T transgenic mice. We monitored mammary carcinogenesis in positive control (FAKFlox/Flox; MMTV-PyVT) and target (FAKFlox/Flox; MMTV-Cre; MMTV-PyVT) females...
Directory of Open Access Journals (Sweden)
Sílvia Bofill-Mas
2013-01-01
Full Text Available Many different viruses are excreted by humans and animals and are frequently detected in fecal contaminated waters causing public health concerns. Classical bacterial indicator such as E. coli and enterococci could fail to predict the risk for waterborne pathogens such as viruses. Moreover, the presence and levels of bacterial indicators do not always correlate with the presence and concentration of viruses, especially when these indicators are present in low concentrations. Our research group has proposed new viral indicators and methodologies for determining the presence of fecal pollution in environmental samples as well as for tracing the origin of this fecal contamination (microbial source tracking. In this paper, we examine to what extent have these indicators been applied by the scientific community. Recently, quantitative assays for quantification of poultry and ovine viruses have also been described. Overall, quantification by qPCR of human adenoviruses and human polyomavirus JC, porcine adenoviruses, bovine polyomaviruses, chicken/turkey parvoviruses, and ovine polyomaviruses is suggested as a toolbox for the identification of human, porcine, bovine, poultry, and ovine fecal pollution in environmental samples.
Three TFL1 homologues regulate floral initiation in the biofuel plant Jatropha curcas
Li, Chaoqiong; Fu, Qiantang; Niu, Longjian; Luo, Li; Chen, Jianghua; Xu, Zeng-Fu
2017-01-01
Recent research revealed that TERMINAL FLOWER 1 (TFL1) homologues are involved in the critical developmental process of floral initiation in several plant species. In this study, the functions of three putative TFL1 homologues (JcTFL1a, JcTFL1b and JcTFL1c) in the biofuel plant Jatropha curcas were analysed using the transgenic approach. JcTFL1b and JcTFL1c, but not JcTFL1a, could complement the TFL1 function and rescue early flowering and determinate inflorescence phenotype in tfl1-14 Arabidopsis mutant, thus suggesting that JcTFL1b and JcTFL1c may be homologues of TFL1. Transgenic Jatropha overexpressing JcTFL1a, JcTFL1b or JcTFL1c showed late flowering, whereas only JcTFL1b and JcTFL1c overexpression delayed flowering in transgenic Arabidopsis. JcTFL1b-RNAi transgenic Jatropha consistently exhibited moderately early flowering phenotype. JcFT and JcAP1 were significantly downregulated in transgenic Jatropha overexpressing JcTFL1a, JcTFL1b or JcTFL1c, which suggested that the late flowering phenotype of these transgenic Jatropha may result from the repressed expression of JcFT and JcAP1. Our results indicate that these three JcTFL1 genes play redundant roles in repressing flowering in Jatropha. PMID:28225036
Directory of Open Access Journals (Sweden)
Md. Azizur Rahman
2015-03-01
Full Text Available MTT assay and DAPI staining test were performed to evaluate anticancer potential and to assess apoptosis inducing effect of methanolic extract of Cordia dichotoma leaves (MECD against human cervical cancer cell line (HeLa. Changes in MMP and intracellular ROS level were also assessed by JC-1 and DCFH-DA staining. Total phenolic contents were determined by colorimetric principle. Levels of statistical significance were determined by one-way analysis of variance followed by Dunnett’s posttest. Results showed that MECD with obtained IC50 of 202 µg/mL inhibited in vitro proliferation of human cervical cancer cells and induced apoptosis indicating its promising anticancer activity as compared to the standard tamoxifen with obtained IC50 of 48 µg/mL. Total phenolic contents was found to be 176.5 mg GAE/g dried extract. It was concluded that MECD possess promising anticancer activity and induce apoptosis.
African Journals Online (AJOL)
user
Prof JC Mynhardt, Department of Psychology, UNISA ... Prof EJ North, Department of Marketing and Communication Management, University of Preto ... Prof GG Rousseau, Department of Industrial and Organizational Psychology, Nelson Mandela ... Dr M Senekal, Division of Human Nutrition, Department of Human Biology, ...
Mayer, R.E.; Bofill-Mas, S.; Egle, L.; Reischer, G.H.; Schade, M.; Fernandez-Cassi, X.; Fuchs, W.; Mach, R.L.; Lindner, G.; Kirschner, A.; Gaisbauer, M.; Piringer, H.; Blaschke, A.P.; Girones, R.; Zessner, M.; Sommer, R.; Farnleitner, A.H.
2016-01-01
This was a detailed investigation of the seasonal occurrence, dynamics, removal and resistance of human-associated genetic Bacteroidetes faecal markers (GeBaM) compared with ISO-based standard faecal indicator bacteria (SFIB), human-specific viral faecal markers and one human-associated Bacteroidetes phage in raw and treated wastewater of municipal and domestic origin. Characteristics of the selected activated sludge wastewater treatment plants (WWTPs) from Austria and Germany were studied in detail (WWTPs, n = 13, connected populations from 3 to 49000 individuals), supported by volume-proportional automated 24-h sampling and chemical water quality analysis. GeBaM were consistently detected in high concentrations in raw (median log10 8.6 marker equivalents (ME) 100 ml−1) and biologically treated wastewater samples (median log10 6.2–6.5 ME 100 ml−1), irrespective of plant size, type and time of the season (n = 53–65). GeBaM, Escherichia coli, and enterococci concentrations revealed the same range of statistical variability for raw (multiplicative standard deviations s* = 2.3–3.0) and treated wastewater (s* = 3.7–4.5), with increased variability after treatment. Clostridium perfringens spores revealed the lowest variability for raw wastewater (s* = 1.5). In raw wastewater correlations among microbiological parameters were only detectable between GeBaM, C. perfringens and JC polyomaviruses. Statistical associations amongst microbial parameters increased during wastewater treatment. Two plants with advanced treatment were also investigated, revealing a minimum log10 5.0 (10th percentile) reduction of GeBaM in the activated sludge membrane bioreactor, but no reduction of the genetic markers during UV irradiation (254 nm). This study highlights the potential of human-associated GeBaM to complement wastewater impact monitoring based on the determination of SFIB. In addition, human-specific JC polyomaviruses and adenoviruses seem to be a valuable support if
Lifescience Database Archive (English)
Full Text Available uba H, Ravel C, Seeler J, Achermann JC, McElreavey K ... TITLE ... Human male infertility...y LJ, Yan W, Lamb DJ, Matzuk MM ... TITLE ... Non-invasive genetic diagnosis of male infertility
Directory of Open Access Journals (Sweden)
G. Elías Fernández
2008-01-01
Full Text Available Los charales son peces endémicos del centro de México que han sido consumidos desde épocas prehispánicas, en la actualidad, el volumen de su captura ha disminuido por diversos motivos como la sobrepesca y la contaminación del hábitat, por lo cual es muy importante estudiar las poblaciones que quedan para conocer sus requerimientos ecológicos y alimenticios y poder plantear alternativas para su conservación. Por lo anterior, los objetivos de este trabajo fueron: determinar los grupos alimenticios que consume Chirostoma humboldtianum en el estanque JC en Soyaniquilpan, Estado de México y la variación de algunos parámetros físicos y químicos del agua. Se realizaron seis muestreos mensuales de diciembre de 2001 a mayo de 2002. Se registró la temperatura, la profundidad, la transparencia, la conductividad, la turbiedad, el pH, el oxígeno disuelto, la dureza y la alcalinidad. Los peces se capturaron con un chinchorro de 25 metros de longitud y 8 mm de abertura y fueron fijados con formalina al 10 %. El contenido alimenticio fue identificado con claves especializadas. Para determinar el porcentaje de los grupos alimenticios se utilizó el método volumétrico y de frecuencias. Se encontró que el agua es templada, turbia, con regular cantidad de oxígeno disuelto, de dureza moderada. Chirostoma humboldtianum consumió 21 tipos de organismos, destacando Keratella, Trichocerca, Asplanchna, Bosmina, además de copépodos, coríxidos y quironómidos. El método de frecuencias mostró a Cyclops y Keratella como el alimento preferencial.
African Journals Online (AJOL)
10332324
According to accounts in the literature, the Spanish Imperial Eagle was a common species in ... The financial support of the National Research Foundation of .... protection of the wild fauna species specified in Appendix II. ..... the continued relevance of the principles that emerged from these cases, in view thereof that a 7.
Xiong, Wangdan; Wei, Qian; Wu, Pingzhi; Zhang, Sheng; Li, Jun; Chen, Yaping; Li, Meiru; Jiang, Huawu; Wu, Guojiang
2017-07-01
The β-ketoacyl-acyl carrier protein synthase I (KASI) is involved in de novo fatty acid biosynthesis in many organisms. Two putative KASI genes, JcKASI-1 and JcKASI-2, were isolated from Jatropha curcas. The deduced amino acid sequences of JcKASI-1 and JcKASI-2 exhibit around 83.8% and 72.5% sequence identities with AtKASI, respectively, and both contain conserved Cys-His-Lys-His-Phe catalytic active sites. Phylogenetic analysis indicated that JcKASI-2 belongs to a clade with several KASI proteins from dicotyledonous plants. Both JcKASI genes were expressed in multiple tissues, most strongly in filling stage seeds of J. curcas. Additionally, the JcKASI-1 and JcKASI-2 proteins were both localized to the plastids. Expressing JcKASI-1 in the Arabidopsis kasI mutant rescued the mutant's phenotype and restored the fatty acid composition and oil content in seeds to wild-type, but expressing JcKASI-2 in the Arabidopsis kasI mutant resulted in only partial rescue. This implies that JcKASI-1 and JcKASI-2 exhibit partial functional redundancy and KASI genes play a universal role in regulating fatty acid biosynthesis, growth, and development in plants. Copyright © 2017 Elsevier GmbH. All rights reserved.
The mitochondrial membrane potential in human platelets: a sensitive parameter for platelet quality
Verhoeven, Arthur J.; Verhaar, Robin; Gouwerok, Eric G. W.; de Korte, Dirk
2005-01-01
BACKGROUND: Deterioration of platelet (PLT) quality during storage is accompanied by an increase in lactate production, indicating a decrease in mitochondrial function. In this study, the optimal conditions under which the fluorescent dye JC-1 can be used to detect changes in mitochondrial function
Effect of sevoflurane on human neutrophil apoptosis.
LENUS (Irish Health Repository)
Tyther, R
2012-02-03
BACKGROUND AND OBJECTIVE: Both chronic occupational exposure to volatile anaesthetic agents and acute in vitro exposure of neutrophils to isoflurane have been shown to inhibit the rate of apoptosis of human neutrophils. It is possible that inhibition of neutrophil apoptosis arises through delaying mitochondrial membrane potential collapse. We assessed mitochondrial depolarization and apoptosis in unexposed neutrophils and neutrophils exposed to sevoflurane in vivo. METHODS: A total of 20 mL venous blood was withdrawn pre- and postinduction of anaesthesia, the neutrophils isolated and maintained in culture. At 1, 12 and 24 h in culture, the percentage of neutrophil apoptosis was assessed by dual staining with annexin V-FITC and propidium iodide. Mitochondrial depolarization was measured using the dual emission styryl dye JC-1. RESULTS: Apoptosis was significantly inhibited in neutrophils exposed to sevoflurane in vivo at 24 (exposed: 38 (12)% versus control: 28 (11)%, P = 0.001), but not at 1 or 12 h, in culture. Mitochondrial depolarization was not delayed in neutrophils exposed to sevoflurane. CONCLUSIONS: The most important findings are that sevoflurane inhibits neutrophil apoptosis in vivo and that inhibition is not mediated primarily by an effect on mitochondrial depolarization.
Japanese Cedar (Cryptomeria japonica) Pollinosis in Jeju, Korea: Is It Increasing?
Lee, Jaechun; Lee, Keun Hwa; Lee, Hye Sook; Hong, Sung Chul; Kim, Jeong Hong
2015-05-01
Jeju is an island in South Korea located in a temperate climate zone. The Japanese cedar tree (JC) has become the dominant tree species while used widely to provide a windbreak for the tangerine orchard industry. An increase in pollen counts precedes atopic sensitization to pollen and pollinosis, but JC pollinosis in Jeju has never been studied. We investigated JC pollen counts, sensitization to JC pollen, and JC pollinosis. Participants were recruited among schoolchildren residing in Jeju City, the northern region (NR) and Seogwipo City, the southern region (SR) of the island. The JC pollen counts were monitored. Sensitization rates to common aeroallergens were evaluated by skin prick tests. Symptoms of pollinosis were surveyed. Among 1,225 schoolchildren (49.6% boys, median age 13 years), 566 (46.2%) were atopic. The rate of sensitization to Dermatophagoides pteronyssinus (35.8%) was highest, followed by D. farinae (26.2%), and JC pollen (17.6%). In the SR, 156 children (23.8%) were sensitized to JC pollen; this rate was significantly higher than that in the NR (59 children, 10.4%, P<0.001). A significant increment in the sensitization rate for JC pollen with increasing school level was observed only in the SR. JC pollen season in the SR started earlier and lasted longer than that in the NR. JC pollen season in Jeju was defined as extending from late January to mid-April. The prevalence of JC pollinosis was estimated to be 8.5%. The prevalence differed significantly between the NR and SR (5.3% vs 11.3%, P<0.001), mainly due to the difference in sensitization rates. JC pollen is the major outdoor allergen for early spring pollinosis in Jeju. JC pollen season is from late January to mid-April. Warmer weather during the flowering season scatters more JC pollen in the atmosphere, resulting in a higher sensitization rate in atopic individuals and, consequently, making JC pollinosis more prevalent.
Misra, Aparna; Khan, Kasim; Niranjan, Abhishek; Kumar, Vinod; Sane, Vidhu A
2017-10-01
Oils and fats are stored in endosperm during seed development in the form of triacylglycerols. Three acyltransferases: glycerol-3-phosphate acyltransferase (GPAT), lysophosphatidyl acyltransferase (LPAT) and diacylglycerol acyltransferase (DGAT) are involved in the storage lipid biosynthesis and catalyze the stepwise acylation of glycerol backbone. In this study two members of GPAT gene family (JcGPAT1 and JcGPAT2) from Jatropha seeds were identified and characterized. Sequence analysis suggested that JcGPAT1 and JcGPAT2 are homologous to Arabidopsis acyltransferase-1 (ATS1) and AtGPAT9 respectively. The sub-cellular localization studies of these two GPATs showed that JcGPAT1 localizes into plastid whereas JcGPAT2 localizes in to endoplasmic reticulum. JcGPAT1 and JcGPAT2 expressed throughout the seed development with higher expression in fully matured seed compared to immature seed. The transcript levels of JcGPAT2 were higher in comparison to JcGPAT1 in different developmental stages of seed. Over-expression of JcGPAT1 and JcGPAT2 under constitutive and seed specific promoters in Arabidopsis thaliana increased total oil content. Transgenic seeds of JcGPAT2-OE lines accumulated 43-60% more oil than control seeds whereas seeds of Arabidopsis lines over-expressing plastidial GPAT lead to only 13-20% increase in oil content. Functional characterization of GPAT homologues of Jatropha in Arabidopsis suggested that these are involved in oil biosynthesis but might have specific roles in Jatropha. Copyright © 2017 Elsevier B.V. All rights reserved.
Glutamate Receptor Aptamers and ALS
2008-01-01
2003b; 42(42):12358–66. uthman H, Magnusson G. High efficiency polyoma DNA transfection of chloroquine treated cells. Nucl Acids Res 1983;11(5):1295...by acetylcholine and its analogues at the frog muscle end-plate, J. Physiol. 369, 501-557. 20. Auerbach, A., and Sachs, F. (1984) Single-channel
Dicty_cDB: Contig-U11847-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available 00512_699( AE000512 |pid:none) Thermotoga maritima MSB8, comple... 42 0.065 JC2551( JC2551 ) tropomyosin alpha chain - axolotl...AltName: Full=Myosin heavy chai... 42 0.11 JC6199( JC6199 ) alpha-tropomyosin S-1 - axolotl &U33450_1(U33450
JC Polyomavirus Infection Is Strongly Controlled by Human Leucocyte Antigen Class II Variants
DEFF Research Database (Denmark)
Sundqvist, Emilie; Buck, Dorothea; Warnke, Clemens
2014-01-01
sequence-specific oligonucleotide (PCR-SSO) method. An initial GWAS screen displayed a strong HLA class II region signal. The HLA-DRB1*15 haplotype was strongly negatively associated to JCV sero-status in Scandinavian MS cases (OR = 0.42, p = 7×10(-15)) and controls (OR = 0.53, p = 2×10(-5)). In contrast...
Maintenance of Epithelial Stem Cells by Cbl Proteins
2013-09-01
corresponding authors). • Mohibi S, Gurumurthy CB, Nag A, Wang J, Mirza S, Mian Y, Quinn M, Katafiasz B, Eudy J, Pandey S, Guda C, Naramura M, Band H...MMTV-polyoma middle T transgenic mice. Cancer Res 67: 167–177. doi:10.1158/0008-5472.CAN-06-3782. 41. Li G, Robinson GW, Lesche R, Martinez-Diaz H
An ortholog of LEAFY in Jatropha curcas regulates flowering time and floral organ development.
Tang, Mingyong; Tao, Yan-Bin; Fu, Qiantang; Song, Yaling; Niu, Longjian; Xu, Zeng-Fu
2016-11-21
Jatropha curcas seeds are an excellent biofuel feedstock, but seed yields of Jatropha are limited by its poor flowering and fruiting ability. Thus, identifying genes controlling flowering is critical for genetic improvement of seed yield. We isolated the JcLFY, a Jatropha ortholog of Arabidopsis thaliana LEAFY (LFY), and identified JcLFY function by overexpressing it in Arabidopsis and Jatropha. JcLFY is expressed in Jatropha inflorescence buds, flower buds, and carpels, with highest expression in the early developmental stage of flower buds. JcLFY overexpression induced early flowering, solitary flowers, and terminal flowers in Arabidopsis, and also rescued the delayed flowering phenotype of lfy-15, a LFY loss-of-function Arabidopsis mutant. Microarray and qPCR analysis revealed several flower identity and flower organ development genes were upregulated in JcLFY-overexpressing Arabidopsis. JcLFY overexpression in Jatropha also induced early flowering. Significant changes in inflorescence structure, floral organs, and fruit shape occurred in JcLFY co-suppressed plants in which expression of several flower identity and floral organ development genes were changed. This suggests JcLFY is involved in regulating flower identity, floral organ patterns, and fruit shape, although JcLFY function in Jatropha floral meristem determination is not as strong as that of Arabidopsis.
Engineering of High-Toughness Carbon Nanotubes Hierarchically Laminated Composites
2012-01-27
Bernsmann, F.; Ersen, O.; Voegel, J.-C.; Jan, E.; Kotov, N. A.; Ball, V. Melanin -Containing Films: Growth from Dopamine Solutions versus Layer-by-Layer...Chen, Wei; Doty, Chris; Xu, Chuanlai; Kotov, Nicholas A.. Smart Electronic Yarns and Wearable Fabrics for Human Biomonitoring made by Carbon Nanotube
Anna Pantelia
2013-01-01
29 October 2013 - Former Director-General of IAEA H. Blix on the occasion of the Thorium Energy Conference at CERN with Chair of the ThEC13 Organization Committee E. Lillestol and Author of the book “Atome Vert” (Green Atom) J.-C. de Mestral; in the LHC tunnel at Point 1 with Technology Department, Machine Protection & Electrical Integrity Group, Performance Evaluation Section Member A. Verweij.
Shillington, D. J.; Ferrini, V. L.; MacLeod, C. J.; Teagle, D. A.; Gillis, K. M.; Cazenave, P. W.; Hurst, S. D.; Scientific Party, J.
2008-12-01
In January-February 2008, new geophysical and geological data were acquired in Hess Deep using the RRS James Cook and the British ROV Isis. Hess Deep provides a tectonic window into oceanic crust emplaced by fast seafloor spreading at the East Pacific Rise, thereby offering the opportunity to test competing hypotheses for oceanic crustal accretion. The goal of this cruise was to collect datasets that can constrain the structure and composition of the lower crustal section exposed in the south-facing slope of the Intrarift Ridge just north of the Deep, and thus provide insights into the emplacement of gabbroic lower crust at fast spreading rates. Additionally, the acquired datasets provide site survey data for IODP Proposal 551-Full. The following datasets were acquired during JC021: 1) regional multibeam bathymetry survey complemented with sub-bottom profiler (SBP) data (in selected areas), 2) two micro-bathymetry surveys, and 3) seafloor rock samples acquired with an ROV. Here we present grids of regional multibeam and microbathymetry data following post-cruise processing. Regional multibeam bathymetry were acquired using the hull-mounted Kongsberg Simrad EM120 system (12 kHz). These data provide new coverage of the northern flank of the rift as far east as 100°W, which show that it comprises of a series of 50- to 100-km-long en echelon segments. Both E-W and NE-SW striking features are observed in the immediate vicinity of the Deep, including in a newly covered region to the SW of the rift tip. Such features might arise due to the rotation of the Galapagos microplate(s), as proposed by other authors. The ROV Isis acquired micro-bathymetry data in two areas using a Simrad SM2000 (200 kHz) multibeam sonar. Data were acquired at a nominal altitude of ~100 m and speed of 0.3 kts to facilitate high-resolution mapping of seabed features and also permit coverage of two relatively large areas. Swath widths were ~200- 350 m depending on noise and seabed characteristics
Czech Academy of Sciences Publication Activity Database
Diotti, R.A.; Mancini, N.; Clementi, N.; Sautto, G.; Moreno, G.J.; Criscuolo, E.; Cappalletti, F.; Man, Petr; Forest, E.; Remy, L.; Giannecchini, S.; Clementi, M.; Burioni, R.
2014-01-01
Roč. 108, č. 2 (2014), s. 94-103 ISSN 0166-3542 Institutional support: RVO:61388971 Keywords : natalizumab * JC virus * multiple sclerosis Subject RIV: EE - Microbiology, Virology Impact factor: 3.938, year: 2014
International Nuclear Information System (INIS)
Kwon, Hyuk; Min, Byung Joo; Lee, Eui Jin; You, Byung Hoon
2006-01-01
According to the recent report by the OECD/NEA, there is a large imbalance between supply and demand of human resource in nuclear field. In the U.S., according to survey of Nuclear Engineering Department Heads Organization (NEDHO), 174 graduates in B.S or M.S degree were fed to nuclear industry in year 2004. Meanwhile, the total amount of demand in nuclear industry was about 642 engineers, which was approximately three times of the supply. In case of other developed western nations, the OECD/NEA report stated that the level of imbalance is similar to that of the U.S. However, nations having nuclear power development programs such as Korea, Japan and France seem to be in a different environment of supply and demand from that of the U.S. In this study, the difference of manpower status between the U.S and Korea has been investigated and the nuclear manpower required for the future in Korea is predicted. To investigate the factors making difference between the U.S. and NPP developing countries including Korea, a quantitative manpower planning model, Markov chains model, is applied. Since the Markov chains model has the strength of analyzing an inflow or push structure, the model fits the system governed by the inflow of manpower. A macroscopic status of manpower demand on nuclear industry is calculated up to 2015 using the Job coefficient (JC) and GDP, which are derived from the Survey for Roadmap of Electric Power Industry Manpower Planning. Furthermore, the total numbers of required manpower and supplied manpower up to 2030 were predicted by JC and Markov Chains model, respectively. Whereas the employee status of nuclear industries has been annually investigated by KAIF since 1995, the following data from the 10 th survey and nuclear energy yearbooks from 1998 to 2005 are applied; (a) the status of the manpower demand of industry, (b) number of students entering, graduating and getting job in nuclear engineering
Energy Technology Data Exchange (ETDEWEB)
Kwon, Hyuk; Min, Byung Joo; Lee, Eui Jin; You, Byung Hoon [Korea Atomic Energy Research Institute, Taejon (Korea, Republic of)
2006-07-01
According to the recent report by the OECD/NEA, there is a large imbalance between supply and demand of human resource in nuclear field. In the U.S., according to survey of Nuclear Engineering Department Heads Organization (NEDHO), 174 graduates in B.S or M.S degree were fed to nuclear industry in year 2004. Meanwhile, the total amount of demand in nuclear industry was about 642 engineers, which was approximately three times of the supply. In case of other developed western nations, the OECD/NEA report stated that the level of imbalance is similar to that of the U.S. However, nations having nuclear power development programs such as Korea, Japan and France seem to be in a different environment of supply and demand from that of the U.S. In this study, the difference of manpower status between the U.S and Korea has been investigated and the nuclear manpower required for the future in Korea is predicted. To investigate the factors making difference between the U.S. and NPP developing countries including Korea, a quantitative manpower planning model, Markov chains model, is applied. Since the Markov chains model has the strength of analyzing an inflow or push structure, the model fits the system governed by the inflow of manpower. A macroscopic status of manpower demand on nuclear industry is calculated up to 2015 using the Job coefficient (JC) and GDP, which are derived from the Survey for Roadmap of Electric Power Industry Manpower Planning. Furthermore, the total numbers of required manpower and supplied manpower up to 2030 were predicted by JC and Markov Chains model, respectively. Whereas the employee status of nuclear industries has been annually investigated by KAIF since 1995, the following data from the 10{sup th} survey and nuclear energy yearbooks from 1998 to 2005 are applied; (a) the status of the manpower demand of industry, (b) number of students entering, graduating and getting job in nuclear engineering.
African Journals Online (AJOL)
Igweh, JC. Vol 3, No 1 (1998) - Articles Isolation and in-vitro oxidation of human low density lipoproteins. Abstract · Vol 6, No 1 (2001) - Articles Isradipine decreases arterial thrombogenicity in rabbits. Abstract. ISSN: 1118-2601. AJOL African Journals Online. HOW TO USE AJOL... for Researchers · for Librarians · for Authors ...
[Effects of metformin on human oral cancer KB cell proliferation and apoptosis in vitro].
Wang, Fang; Xu, Jincheng; Xia, Fei; Liu, Zhe; Zhao, Surong; Liu, Hao; Jiang, Zhiwen
2014-02-01
To investigate the effects of metformin on the proliferation and apoptosis of human oral cancer cell line KB in vitro. Human oral cancer cell line KB was exposed to different doses of metformin (0, 1.25, 2.5, 5, 10, and 20 mmol/L), and the changes in cell viability were detected using MTT assay. Colony formation of the cells was observed following an 8-day metformin exposure. The changes in mitochondrial membrane potential were measured by JC-1 assay, and PI staining was used to observe the cell apoptosis. Western blotting was employed to detect the changes in the protein expressions of GRP78 and activated caspase-3. Metformin exposure caused time- and dose-dependent suppression of KB cell proliferation, and exposure to 5 mmol/L metformin for 24, 48 and 72 h resulted in cell survival rates of 68.0%, 36.9%, and 14.5%, respectively. Metformin significantly inhibited KB cell colony formation. Exposure of the cells to increased concentrations of metformin gradually increased the apoptotic rate and decreased mitochondrial membrane potential. Metformin caused an initial up-regulation followed by a down-regulation of GRP78 expression in KB cells and increased the expression of activated caspase-3. Metformin can inhibit the proliferation and induce apoptosis of KB cells, the mechanism of which may involve the activation of the mitochondrial apoptotic pathway and endoplasmic reticulum stress.
Cai, Li; Zhang, Lu
2018-01-01
The seed oil of Jatropha curcas is considered a potential bioenergy source that could replace fossil fuels. However, the seed yield of Jatropha is low and has yet to be improved. We previously reported that exogenous cytokinin treatment increased the seed yield of Jatropha. Cytokinin levels are directly regulated by isopentenyl transferase (IPT), cytochrome P450 monooxygenase, family 735, subfamily A (CYP735A), and cytokinin oxidase/dehydrogenase (CKX). In this study, we cloned six IPT genes, one JcCYP735A gene, and seven JcCKX genes. The expression patterns of these 14 genes in various organs were determined using real-time quantitative PCR. JcIPT1 was primarily expressed in roots and seeds, JcIPT2 was expressed in roots, apical meristems, and mature leaves, JcIPT3 was expressed in stems and mature leaves, JcIPT5 was expressed in roots and mature leaves, JcIPT6 was expressed in seeds at 10 days after pollination, and JcIPT9 was expressed in mature leaves. JcCYP735A was mainly expressed in roots, flower buds, and seeds. The seven JcCKX genes also showed different expression patterns in different organs of Jatropha. In addition, CK levels were detected in flower buds and seeds at different stages of development. The concentration of N6-(Δ2-isopentenyl)-adenine (iP), iP-riboside, and trans-zeatin (tZ) increased with flower development, and the concentration of iP decreased with seed development, while that of tZ increased. We further analyzed the function of JcCYP735A using the CRISPR-Cas9 system, and found that the concentrations of tZ and tZ-riboside decreased significantly in the Jccyp735a mutants, which showed severely retarded growth. These findings will be helpful for further studies of the functions of cytokinin metabolic genes and understanding the roles of cytokinins in Jatropha growth and development. PMID:29785355
Directory of Open Access Journals (Sweden)
Li Cai
2018-05-01
Full Text Available The seed oil of Jatropha curcas is considered a potential bioenergy source that could replace fossil fuels. However, the seed yield of Jatropha is low and has yet to be improved. We previously reported that exogenous cytokinin treatment increased the seed yield of Jatropha. Cytokinin levels are directly regulated by isopentenyl transferase (IPT, cytochrome P450 monooxygenase, family 735, subfamily A (CYP735A, and cytokinin oxidase/dehydrogenase (CKX. In this study, we cloned six IPT genes, one JcCYP735A gene, and seven JcCKX genes. The expression patterns of these 14 genes in various organs were determined using real-time quantitative PCR. JcIPT1 was primarily expressed in roots and seeds, JcIPT2 was expressed in roots, apical meristems, and mature leaves, JcIPT3 was expressed in stems and mature leaves, JcIPT5 was expressed in roots and mature leaves, JcIPT6 was expressed in seeds at 10 days after pollination, and JcIPT9 was expressed in mature leaves. JcCYP735A was mainly expressed in roots, flower buds, and seeds. The seven JcCKX genes also showed different expression patterns in different organs of Jatropha. In addition, CK levels were detected in flower buds and seeds at different stages of development. The concentration of N6-(Δ2-isopentenyl-adenine (iP, iP-riboside, and trans-zeatin (tZ increased with flower development, and the concentration of iP decreased with seed development, while that of tZ increased. We further analyzed the function of JcCYP735A using the CRISPR-Cas9 system, and found that the concentrations of tZ and tZ-riboside decreased significantly in the Jccyp735a mutants, which showed severely retarded growth. These findings will be helpful for further studies of the functions of cytokinin metabolic genes and understanding the roles of cytokinins in Jatropha growth and development.
International Nuclear Information System (INIS)
Fink, J.K.; Correll, P.H.; Perry, L.K.; Brady, R.O.; Karlsson, S.
1990-01-01
Retroviral gene transfer has been used successfully to correct the glucocerebrosidase (GCase) deficiency in primary hematopoietic cells from patients with Gaucher disease. For this model of somatic gene therapy, the authors developed a high-titer, amphotropic retroviral vector designated NTG in which the human GCase gene was driven by the mutant polyoma virus enhancer/herpesvirus thymidine kinase gene (tk) promoter (Py + /Htk). NTG normalized GCase activity in transduced Gaucher fibroblasts and efficiently infected human monocytic and erythroleukemic cell lines. RNA blot-hybridization (Northern blot) analysis of these hemaptopoietic cell lines showed unexpectedly high-level expression from the Moloney murine leukemia virus long terminal repeat (Mo-MLV LTR) and levels of Py + /Htk enhancer/promoter-initiated human GCase RNA that approximated endogenous GCase RNA levels. Furthermore, NTG efficiently infected human hematopoietic progenitor cells. Detection of the provirus in approximately one-third of NTG-infected progenitor colonies that had not been selected in G418-containing medium indicates that relative resistance to G418 underestimated the actual gene transfer efficiency. Northern blot analysis of NTG-infected, progenitor-derived cells showed expression from both the Mo-MLV LTR and the Py + /Htk enhancer/promoter. NTG-transduced hematopoietic progenitor cells from patients with Gaucher disease generated progeny in which GCase activity has been normalized
Energy Technology Data Exchange (ETDEWEB)
Fink, J.K.; Correll, P.H.; Perry, L.K.; Brady, R.O.; Karlsson, S. (National Institutes of Health, Bethesda, MD (USA))
1990-03-01
Retroviral gene transfer has been used successfully to correct the glucocerebrosidase (GCase) deficiency in primary hematopoietic cells from patients with Gaucher disease. For this model of somatic gene therapy, the authors developed a high-titer, amphotropic retroviral vector designated NTG in which the human GCase gene was driven by the mutant polyoma virus enhancer/herpesvirus thymidine kinase gene (tk) promoter (Py{sup +}/Htk). NTG normalized GCase activity in transduced Gaucher fibroblasts and efficiently infected human monocytic and erythroleukemic cell lines. RNA blot-hybridization (Northern blot) analysis of these hemaptopoietic cell lines showed unexpectedly high-level expression from the Moloney murine leukemia virus long terminal repeat (Mo-MLV LTR) and levels of Py{sup +}/Htk enhancer/promoter-initiated human GCase RNA that approximated endogenous GCase RNA levels. Furthermore, NTG efficiently infected human hematopoietic progenitor cells. Detection of the provirus in approximately one-third of NTG-infected progenitor colonies that had not been selected in G418-containing medium indicates that relative resistance to G418 underestimated the actual gene transfer efficiency. Northern blot analysis of NTG-infected, progenitor-derived cells showed expression from both the Mo-MLV LTR and the Py{sup +}/Htk enhancer/promoter. NTG-transduced hematopoietic progenitor cells from patients with Gaucher disease generated progeny in which GCase activity has been normalized.
Improved current transport properties of post annealed Y1Ba2Cu3O7-x thin films using Ag doping
DEFF Research Database (Denmark)
Clausen, Thomas; Skov, Johannes; Jacobsen, Claus Schelde
1996-01-01
The influence of Ag doping on the transport properties of Y1Ba2Cu3O7–x thin films prepared by Y, BaF2, and Cu co-evaporation and optimized ex situ post annealing has been investigated. Both undoped and Ag doped films have values of Tc above 90 K, but Jc (77 K) is highly dependent on the nominal...... thickness (tnom) of the as-deposited film. For undoped films with tnom>106 A/cm2) decreases monotonically with increasing film thickness. Above 300 nm Jc (77 K) decreases rapidly to values below 5×105 A/cm2. Ag doped films with tnom>=200 nm have higher Jc (77 K) values than those of undoped films. Ag doped...... films have a maximum in Jc (77 K) around 250 nm. As for the undoped films, there is a large decrease in Jc (77 K) for Ag doped films with tnom>=300 nm. It was found that the higher values of Jc (77 K) for the Ag doped films were due to a better epitaxial growth of the YBCO compound. The low values of Jc...
Cidofovir Activity against Poxvirus Infections
Directory of Open Access Journals (Sweden)
Robert Snoeck
2010-12-01
Full Text Available Cidofovir [(S-1-(3-hydroxy-2-phosphonylmethoxypropylcytosine, HPMPC] is an acyclic nucleoside analog approved since 1996 for clinical use in the treatment of cytomegalovirus (CMV retinitis in AIDS patients. Cidofovir (CDV has broad-spectrum activity against DNA viruses, including herpes-, adeno-, polyoma-, papilloma- and poxviruses. Among poxviruses, cidofovir has shown in vitro activity against orthopox [vaccinia, variola (smallpox, cowpox, monkeypox, camelpox, ectromelia], molluscipox [molluscum contagiosum] and parapox [orf] viruses. The anti-poxvirus activity of cidofovir in vivo has been shown in different models of infection when the compound was administered either intraperitoneal, intranasal (aerosolized or topically. In humans, cidofovir has been successfully used for the treatment of recalcitrant molluscum contagiosum virus and orf virus in immunocompromised patients. CDV remains a reference compound against poxviruses and holds potential for the therapy and short-term prophylaxis of not only orthopox- but also parapox- and molluscipoxvirus infections.
Hecher, J.; Ishida, S.; Song, D.; Ogino, H.; Iyo, A.; Eisaki, H.; Nakajima, M.; Kagerbauer, D.; Eisterer, M.
2018-01-01
The phase diagram of iron-based superconductors exhibits structural transitions, electronic nematicity, and magnetic ordering, which are often accompanied by an electronic in-plane anisotropy and a sharp maximum of the superconducting critical current density (Jc) near the phase boundary of the tetragonal and the antiferromagnetic-orthorhombic phase. We utilized scanning Hall-probe microscopy to visualize the Jc of twinned and detwinned Ba (Fe1-xCox) 2As2 (x =5 %-8 % ) crystals to compare the electronic normal state properties with superconducting properties. We find that the electronic in-plane anisotropy continues into the superconducting state. The observed correlation between the electronic and the Jc anisotropy agrees qualitatively with basic models, however, the Jc anisotropy is larger than predicted from the resistivity data. Furthermore, our measurements show that the maximum of Jc at the phase boundary does not vanish when the crystals are detwinned. This shows that twin boundaries are not responsible for the large Jc, suggesting an exotic pinning mechanism.
Lichtman, Judith H; Jones, Sara B; Leifheit-Limson, Erica C; Wang, Yun; Goldstein, Larry B
2011-12-01
Ischemic stroke patients treated at Joint Commission Primary Stroke Center (JC-PSC)-certified hospitals have better outcomes. Data reflecting the impact of JC-PSC status on outcomes after hemorrhagic stroke are limited. We determined whether 30-day mortality and readmission rates after hemorrhagic stroke differed for patients treated at JC-PSC-certified versus noncertified hospitals. The study included all fee-for-service Medicare beneficiaries aged 65 years or older with a primary discharge diagnosis of subarachnoid hemorrhage (SAH) or intracerebral hemorrhage (ICH) in 2006. Covariate-adjusted logistic and Cox proportional hazards regression assessed the effect of care at a JC-PSC-certified hospital on 30-day mortality and readmission. There were 2305 SAH and 8708 ICH discharges from JC-PSC-certified hospitals and 3892 SAH and 22 564 ICH discharges from noncertified hospitals. Unadjusted in-hospital mortality (SAH: 27.5% versus 33.2%, Pmortality (SAH: 35.1% versus 44.0%, Pmortality was 34% lower (odds ratio, 0.66; 95% confidence interval, 0.58-0.76) after SAH and 14% lower (odds ratio, 0.86; 95% confidence interval, 0.80-0.92) after ICH for patients discharged from JC-PSC-certified hospitals. There was no difference in 30-day risk-adjusted readmission rates for SAH or ICH based on JC-PSC status. Patients treated at JC-PSC-certified hospitals had lower risk-adjusted mortality rates for both SAH and ICH but similar 30-day readmission rates as compared with noncertified hospitals.
International Nuclear Information System (INIS)
Maruyama, Wakae; Aoki, Yasunobu
2006-01-01
The health risk of dioxins and dioxin-like compounds to humans was analyzed quantitatively using experimental data and mathematical models. To quantify the toxicity of a mixture of three dioxin congeners, we calculated the new relative potencies (REPs) for 2,3,7,8-tetrachlorodibenzo-p-dioxin (TCDD), 1,2,3,7,8-pentachlorodibenzo-p-dioxin (PeCDD), and 2,3,4,7,8- pentachlorodibenzofuran (PeCDF), focusing on their tumor promotion activity. We applied a liver foci formation assay to female SD rats after repeated oral administration of dioxins. The REP of dioxin for a rat was determined using dioxin concentration and the number of the foci in rat liver. A physiologically based pharmacokinetic model (PBPK model) was used for interspecies extrapolation targeting on dioxin concentration in liver. Toxic dose for human was determined by back-estimation with a human PBPK model, assuming that the same concentration in the target tissue may cause the same level of effect in rats and humans, and the REP for human was determined by the toxic dose obtained. The calculated REPs for TCDD, PeCDD, and PeCDF were 1.0, 0.34, and 0.05 for rats, respectively, and the REPs for humans were almost the same as those for rats. These values were different from the toxic equivalency factors (TEFs) presented previously (Van den Berg, M., Birnbaum, L., Bosveld, A.T.C., Brunstrom, B., Cook, P., Feeley, M., Giesy, J.P., Hanberg, A., Hasegawa, R., Kennedy, S.W., Kubiak, T., Larsen, J.C., Rolaf van Leeuwen, F.X., Liem, A.K.D., Nolt, C., Peterson, R.E., Poellinger. L., Safe, S., Schrenk, D., Tillitt, D, Tysklind, M., Younes, M., Waern, F., Zacharewski, T., 1998. Toxic equivalency factors (TEFs) for PCBs, PCDDs, PCDFs for humans and wildlife. Environ. Health Perspect. 106, 775-792). The relative risk of excess liver cancer for Japanese people in general was 1.7-6.5 x 10 -7 by TCDD only, and 2.9-11 x 10 -7 by the three dioxins at the present level of contamination
Lizarondo, Lucylynn M; Grimmer-Somers, Karen; Kumar, Saravana
2011-09-23
Research evidence suggests that journal clubs (JCs) are one approach which can be used to bridge the gap between research and clinical practice. However, there are issues which potentially threaten their viability such as on-going participation or compliance with attendance, which require further exploration. The objectives of this study are: to explore the views and perspectives of allied health practitioners (AHPs) regarding the use of any type of JC in promoting evidence-based practice (EBP); to identify ways in which an innovative model of JC developed by the International Centre for Allied Health Evidence (iCAHE) might be refined. A qualitative descriptive study utilising focus group interviews with various groups of AHP was undertaken-- those who have been exposed to the iCAHE JC model and those who have no experience of the iCAHE model (although they may have had exposure to other forms of JC). Maximum variation sampling was used to recruit participants for the study. Transcripts of focus groups were coded and distilled into content-related categories. Six focus groups with 39 AHPs were facilitated. Allied health practitioners perspectives' on JCs were classified in five broad categories: utility and benefits of a JC, elements of an effective and sustainable JC, barriers to participation, incentives for participation, and opportunities for improvement in the current iCAHE JC model. Overall, JCs were seen as a forum for reflective practice and keeping up-to-date with research evidence, and a venue for learning the processes involved in critical appraisal. Limited knowledge of statistics and heavy clinical workload were reported as barriers to participation in a JC. Strategies such as mentoring, strong support from managers, and providing CPD (continuing professional development) points can potentially address these barriers. Opportunities for refinement of the current iCAHE model were raised. This study suggests that a structured model of JC such as i
Energy Technology Data Exchange (ETDEWEB)
Goncalves, Fabricio Guimaraes; Lamb, Leslie; Del Carpio-O' Donovan, Raquel, E-mail: goncalves.neuroradio@gmail.com [McGill University Health Center Montreal General Hospital (Canada)
2011-11-15
Progressive multifocal leukoencephalopathy is a neurological infectious disease caused by the John Cunningham polyoma virus (JCV), an opportunistic agent with worldwide distribution. This disease is frequently seen in immunosuppressed patients and rarely associated with systemic lupus erythematosus. In the central nervous system PML demyelinating lesions occur in the supratentorial compartment. The authors describe a rare case of PML secondary to SLE treatment with atypical presentation restricted to the posterior fossa (author)
International Nuclear Information System (INIS)
Goncalves, Fabricio Guimaraes; Lamb, Leslie; Del Carpio-O'Donovan, Raquel
2011-01-01
Progressive multifocal leukoencephalopathy is a neurological infectious disease caused by the John Cunningham polyoma virus (JCV), an opportunistic agent with worldwide distribution. This disease is frequently seen in immunosuppressed patients and rarely associated with systemic lupus erythematosus. In the central nervous system PML demyelinating lesions occur in the supratentorial compartment. The authors describe a rare case of PML secondary to SLE treatment with atypical presentation restricted to the posterior fossa (author)
Chryseobacterium salipaludis sp. nov., isolated at a wild ass sanctuary.
Divyasree, B; Suresh, G; Sasikala, Ch; Ramana, Ch V
2018-02-01
A Gram-stain-negative, rod-shaped, non-motile, aerobic bacterium was isolated from a sediment sample obtained from a wild ass sanctuary in Gujarat, India. The strain designated JC490 T was oxidase- and catalase-positive. The 16S rRNA gene sequence analysis and sequence comparison data indicated that strain JC490 T was a member of the genus Chryseobacterium and was closely related to Chryseobacterium jeonii AT1047 T (96.4 %) and with other members of the genus Chryseobacterium (<96.3 %). The DNA G+C content of strain JC490 T was 34 mol%. Strain JC490 T had phosphatidylethanolamine, two unidentified aminolipids, two unidentified phospholipids and five unidentified polar lipids. Menaquinone-6 was the only respiratory quinone found. Iso-C15 : 0, anteiso-C15 : 0 and iso-C17 : 0 3-OH were the major fatty acids of strain JC490 T . On the basis of physiological, genotypic, phylogenetic and chemotaxonomic analyses, it is concluded that strain JC490 T constitutes a novel species of the genus Chryseobacterium, for which the name Chryseobacterium salipaludis sp. nov. is proposed. The type strain is JC490 T (=KCTC 52835 T =LMG 30048 T ).
Directory of Open Access Journals (Sweden)
Martha J Harding
2010-04-01
Full Text Available Widely accessible small animal models suitable for the study of hepatitis C virus (HCV in vivo are lacking, primarily because rodent hepatocytes cannot be productively infected and because human hepatocytes are not easily engrafted in immunodeficient mice.We report here on a novel approach for human hepatocyte engraftment that involves subcutaneous implantation of primary human fetal hepatoblasts (HFH within a vascularized rat collagen type I/human fibronectin (rCI/hFN gel containing Bcl-2-transduced human umbilical vein endothelial cells (Bcl-2-HUVEC in severe combined immunodeficient X beige (SCID/bg mice. Maturing hepatic epithelial cells in HFH/Bcl-2-HUVEC co-implants displayed endocytotic activity at the basolateral surface, canalicular microvilli and apical tight junctions between adjacent cells assessed by transmission electron microscopy. Some primary HFH, but not Huh-7.5 hepatoma cells, appeared to differentiate towards a cholangiocyte lineage within the gels, based on histological appearance and cytokeratin 7 (CK7 mRNA and protein expression. Levels of human albumin and hepatic nuclear factor 4alpha (HNF4alpha mRNA expression in gel implants and plasma human albumin levels in mice engrafted with HFH and Bcl-2-HUVEC were somewhat enhanced by including murine liver-like basement membrane (mLBM components and/or hepatocyte growth factor (HGF-HUVEC within the gel matrix. Following ex vivo viral adsorption, both HFH/Bcl-2-HUVEC and Huh-7.5/Bcl-2-HUVEC co-implants sustained HCV Jc1 infection for at least 2 weeks in vivo, based on qRT-PCR and immunoelectron microscopic (IEM analyses of gel tissue.The system described here thus provides the basis for a simple and robust small animal model of HFH engraftment that is applicable to the study of HCV infections in vivo.
Ge, Yan; Yoshiie, Kiyotaka; Kuribayashi, Futoshi; Lin, Mingqun; Rikihisa, Yasuko
2005-01-01
The inhibition of neutrophil apoptosis plays a central role in human granulocytic anaplasmosis. Intracellular signalling pathways through which the obligatory intracellular bacterium Anaplasma phagocytophilum inhibits the spontaneous apoptosis of human peripheral blood neutrophils were investigated. bfl-1 mRNA levels in uninfected neutrophils after 12 h in culture were reduced to approximately 5-25% of 0 h levels, but remained high in infected neutrophils. The eukaryotic RNA synthesis inhibitor, actinomycin D, prevented the maintenance of bfl-1 mRNA levels by A. phagocytophilum. Differences in mcl-1, bax, bcl-w, bad or bak mRNA levels in infected versus uninfected neutrophils were not remarkable. By using mitochondrial fluorescent dyes, Mitotracker Red and JC-1, it was found that most uninfected neutrophils lost mitochondrial membrane potential after 10-12 h incubation, whereas A. phagocytophilum-infected neutrophils maintained high membrane potential. Caspase 3 activity and the degree of apoptosis were lower in dose-dependent manner in A. phagocytophilum-infected neutrophils at 16 h post infection, as compared to uninfected neutrophils. Anti-active caspase 3 antibody labelling showed less positively stained population in infected neutrophils compared to those in uninfected neutrophils after 12 h incubation. These results suggest that A. phagocytophilum inhibits human neutrophil apoptosis via transcriptional upregulation of bfl-1 and inhibition of mitochondria-mediated activation of caspase 3.
Afriyie, D K; Asare, G A; Bugyei, K; Lin, J; Peng, J; Hong, Z
2015-01-15
Croton membranaceus aqueous root extract (CMARE) is among the widely used phytotherapeutics in Ghana for the management of benign prostatic hyperplasia (BPH) and prostate cancer. However, the mechanism of action of CMARE remains to be elucidated. This study aimed to establish whether apoptosis is involved in the antiproliferative effect of CMARE on human BPH-1 cells. We determined the effect of treatment with 0, 1, 3, and 5 mg/mL CMARE for 24, 48, and 72 h on the viability and morphology of BPH-1 cells using the MMT assay and phase-contrast microscopy, respectively. We examined the apoptosis-inducing effects of CMARE after 48 h at the cellular level using Hoescht 33258 and JC-1 dye staining and flow cytometry analysis. We performed reverse transcription polymerase chain reaction and Western blotting to confirm the apoptotic effects of CMARE at the molecular level. CMARE induced a significant dose-dependent inhibition in the proliferation of BPH-1 cells (P BPH-1 cells may be a possible mechanism of action of CMARE.
Functional characterization of two microsomal fatty acid desaturases from Jatropha curcas L.
Wu, Pingzhi; Zhang, Sheng; Zhang, Lin; Chen, Yaping; Li, Meiru; Jiang, Huawu; Wu, Guojiang
2013-10-15
Linoleic acid (LA, C18:2) and α-linolenic acid (ALA, C18:3) are polyunsaturated fatty acids (PUFAs) and major storage compounds in plant seed oils. Microsomal ω-6 and ω-3 fatty acid (FA) desaturases catalyze the synthesis of seed oil LA and ALA, respectively. Jatropha curcas L. seed oils contain large proportions of LA, but very little ALA. In this study, two microsomal desaturase genes, named JcFAD2 and JcFAD3, were isolated from J. curcas. Both deduced amino acid sequences possessed eight histidines shown to be essential for desaturases activity, and contained motif in the C-terminal for endoplasmic reticulum localization. Heterologous expression in Saccharomyces cerevisiae and Arabidopsis thaliana confirmed that the isolated JcFAD2 and JcFAD3 proteins could catalyze LA and ALA synthesis, respectively. The results indicate that JcFAD2 and JcFAD3 are functional in controlling PUFA contents of seed oils and could be exploited in the genetic engineering of J. curcas, and potentially other plants. Copyright © 2013 Elsevier GmbH. All rights reserved.
Effects of cladode age on biomass yield and nutritional value of ...
African Journals Online (AJOL)
Effects of cladode age on biomass yield and nutritional value of intensively produced spineless cactus for ruminants. J.M Pinos-Rodríguez, J.C Velázquez, S.S González, S.S González, J.R Aguirre, J.C García, J.C García, G Álvarez, Y Jasso ...
Lichtman, Judith H.; Jones, Sara B.; Leifheit-Limson, Erica C.; Wang, Yun; Goldstein, Larry B.
2012-01-01
Background and Purpose Ischemic stroke patients treated at Joint Commission Primary Stroke Center (JC-PSC) certified hospitals have better outcomes. Data reflecting the impact of JC-PSC status on outcomes after hemorrhagic stroke are limited. We determined whether 30-day mortality and readmission rates after hemorrhagic stroke differed for patients treated at JC-PSC certified versus non-certified hospitals. Methods The study included all fee-for-service Medicare beneficiaries ≥65 years old with a primary discharge diagnosis of subarachnoid hemorrhage (SAH) or intracerebral hemorrhage (ICH) in 2006. Covariate-adjusted logistic and Cox proportional hazards regression assessed the effect of care at a JC-PSC certified hospital on 30-day mortality and readmission. Results There were 2,305 SAH and 8,708 ICH discharges from JC-PSC certified hospitals and 3,892 SAH and 22,564 ICH discharges from non-certified hospitals. Unadjusted in-hospital mortality (SAH: 27.5% vs. 33.2%, pmortality (SAH: 35.1% vs. 44.0%, pmortality was 34% lower (OR 0.66, 95% CI 0.58–0.76) after SAH and 14% lower (OR 0.86, 95% CI 0.80–0.92) after ICH for patients discharged from JC-PSC certified hospitals. There was no difference in 30-day risk-adjusted readmission rates for SAH or ICH based on JC-PSC status. Conclusions Patients treated at JC-PSC certified hospitals had lower risk-adjusted mortality rates for both SAH and ICH but similar 30-day readmission rates as compared with non-certified hospitals. PMID:22033986
DEFF Research Database (Denmark)
Wang, W.G.; Jensen, M.B.; Kindl, B.
2000-01-01
The spatial distribution of the critical current density (Jc) and engineering critical current density (Je) along the tape width direction was studied by a cutting technique on Bi-2223 multifilamentary tapes. In general, an increase of Jc towards the centre of the tape was measured. We attribute...... microstructure with a great amount of secondary phases. Local variation of Jc was measured within the centre segment of the tape. This indicates the influence of other factors on Jc, such as filament shape, connectivity of the filaments, and sausaging. Enhancement of Je has been pursued in which average Je of 12...
Redesigning journal club in residency.
Al Achkar, Morhaf
2016-01-01
The gap between production and implementation of knowledge is the main reason for the suboptimal quality of health care. To eliminate this gap and improve the quality of patient care, journal club (JC) in graduate medical education provides an opportunity for learning the skills of evidence-based medicine. JC, however, continues to face many challenges mainly due to poorly defined goals, inadequate preparation, and lack of interest. This article presents an innovative model to prepare and present JC based on three pillars: dialogical learning through group discussion, mentored residents as peer teachers, and including JC as part of a structured curriculum to learn evidence-based medicine. This engaging model has the potential to transform JC from a moribund session that is daunting for residents into a lively discussion to redefine clinical practice using the most current evidence.
Shifflette, Vanessa; Mitchell, Chris; Mangram, Alicia; Dunn, Ernest
2012-01-01
Journal club (JC) is a well-recognized education tool for many postgraduate medical education programs. Journal club helps residents learn critical analytic skills and keep up to date with current medical practices. To our knowledge, there is minimal evidence in the current literature detailing modern JC practices of general surgery training programs. Our study attempts to define how general surgery residency programs are implementing JC in their training process. We distributed by mail a 14-question survey to general surgery program directors within the Southwestern Surgical Congress. These surveys were redistributed 1 month after the initial attempt. The responses were collected and analyzed. Survey questions aimed to define JC practice characteristics, such as where JC is held, when JC is held, who directs JC, what journals are used, the perceived importance of JC, and average attendance. The surveys were sent to 32 program directors (PDs), which included 26 university and 6 community-based programs. We received responses from 26 (81%) PDs. Ninety-two percent of the programs have a consistent journal club (JC). Most JCs meet monthly (64%) or weekly (16%). The meeting places ranged from conference rooms (60%), faculty homes (20%), restaurants (8%), or in the hospital (12%). The meeting times were divided between morning (29%), midday (29%), and evening (42%). Most JCs lasted between 1 and 2 hours (88%), reviewed 1-4 articles (88%), and are attended by more than 60% of residents routinely (75%). Half of the programs (50%) had 3-4 faculty members present during discussion; 29% of the programs had only 1-2 faculty present. The articles were selected from more than 10 different journals. Seventy-five percent of the programs used the American Journal of Surgery and Annals of Surgery to find articles; only 13% of the programs used evidence-based reviews in surgery. PDs believe JC is very beneficial (42%), moderately beneficial (42%), or only fairly beneficial (16
PHEIFFER SE TAALPOLITIEK JC Steyn
African Journals Online (AJOL)
sigself maak tog nie Chomsky se teorie oor n aangebore taalaanleg en die konsekwensie daarvan nl. dat elke taal opgebou moet wees volgens dieselfde grondprinsipes, ongeldig nie? Taalpolitieke oortuigingskrag het hierdie argument nog minder. Sal jy in alle erns vir mense kan se: "Ons moet aanhou om die taal te praat ...
1082-39, an analogue of sorafenib, inhibited human cancer cell growth more potently than sorafenib.
Chu, Jia-Hui; Zhao, Cui-Rong; Song, Zhi-Yu; Wang, Rui-Qi; Qin, Yi-Zhuo; Li, Wen-Bao; Qu, Xian-Jun
2014-04-01
1082-39, an analogue of sorafenib, is a derivative of indazole diarylurea. We evaluated the activity of 1082-39 against human cancer cell growth. Its effects and mechanisms of action were then compared with those of sorafenib. The experiments were performed in human melanoma M21 cells. Cell viability was estimated by using the colorimetric assay. Annexin V-FITC/PI staining assay was used to recognize the apoptotic cells. Further analysis of the mitochondria membrane potential (MMP) was performed by the JC-1 fluorescence probe staining. The levels of apoptotic proteins and kinases related to cancer proliferation were determined by western blotting assay. 1082-39 possessed the activity against cancer cell proliferation with time- and dose-dependent manner. 1082-39 induced M21 cell to apoptosis, showing the increase of annexin V-FITC/PI staining cells, the MMP collapse and releasing cytochrome c from mitochondria. Western blotting analysis showed the activation of the mitochondria-mediated intrinsic pathway, showing the increase of cleaved caspase-9, cleaved caspase-3 and cleaved PARP. Statistical analysis suggested that 1082-39 possessed greater activities than sorafenib in the inhibition of M21 proliferation and induction of apoptosis. These effects of 1082-39 might arise from its activity of regulation the PI3K/Akt and Wnt/β-catenin signaling pathways. 1082-39 is a promising candidate compound which could develop as a potent anticancer agent. Copyright © 2014 Elsevier Masson SAS. All rights reserved.
The exact value of Jung constants in a class of Orlicz function spaces
Yan, Y. Q.
2005-01-01
Let $\\Phi$ be an $N$-function. Then the Jung constants of the Orlicz function spaces $L^\\Phi[0,1]$ generated by $\\Phi$, equipped with the Luxemburg and Orlicz norms, have the following exact values: \\item{(i)} if $F_\\Phi(t)=t\\varphi(t)/\\Phi(t)$ is decreasing and $1 < C_\\Phi < 2$, then $$ JC(L^{(\\Phi)}[0,1])=JC(L^\\Phi[0,1])=2^{1/C_\\Phi-1}; $$ \\item{(ii)} if $F_\\Phi(t)$ is increasing and $C_\\Phi > 2$, then $$ JC(L^{(\\Phi)}[0,1])=JC(L^\\Phi[0,1])=2^{-1/C_\\Phi}, $$ where $$C_\\Phi=\\lim_{t\\to...
International Nuclear Information System (INIS)
Duc-Toan, Nguyen; Tien-Long, Banh; Young-Suk, Kim; Dong-Won, Jung
2011-01-01
In this study, a modified Johnson-Cook (J-C) model and an innovated method to determine (J-C) material parameters are proposed to predict more correctly stress-strain curve for tensile tests in elevated temperatures. A MATLAB tool is used to determine material parameters by fitting a curve to follow Ludwick's hardening law at various elevated temperatures. Those hardening law parameters are then utilized to determine modified (J-C) model material parameters. The modified (J-C) model shows the better prediction compared to the conventional one. As the first verification, an FEM tensile test simulation based on the isotropic hardening model for boron sheet steel at elevated temperatures was carried out via a user-material subroutine, using an explicit finite element code, and compared with the measurements. The temperature decrease of all elements due to the air cooling process was then calculated when considering the modified (J-C) model and coded to VUMAT subroutine for tensile test simulation of cooling process. The modified (J-C) model showed the good agreement between the simulation results and the corresponding experiments. The second investigation was applied for V-bending spring-back prediction of magnesium alloy sheets at elevated temperatures. Here, the combination of proposed J-C model with modified hardening law considering the unusual plastic behaviour for magnesium alloy sheet was adopted for FEM simulation of V-bending spring-back prediction and shown the good comparability with corresponding experiments.
Preparation and properties of high-Tc Bi-oxide superconductors
International Nuclear Information System (INIS)
Maeda, H.
1989-01-01
Bulk superconductors of Pb-doped Bi-oxide system (BSCCO) dominated with the high-Tc phase have the critical transition temperature, Tc of 110 K, and the upper critical fields, H c2 of 140 T at OK and 60 T at 77 K. A highly dense and a highly oriented microstructure is obtained by inserting an intermediate uniaxial pressing process. The critical current density, Jc at 77 K in zero field, Jc (77K,OT) of some 5000 A/cm 2 can be easily obtained by this process, and the field dependence of Jc is also improved. Flexible high-Tc BSCCO ribbons with a Jc (77K,Ot) of 1850 A/cm 2 have been successfully prepared by the combined process of doctor blade casting, cold rolling and sintering. Aq-sheeted multifilamentary wires with 1330 filaments and tapes with 30 filaments have also been successfully fabricated and the 36-filament tape shows a Jc(77K,OT) of 1050 A/cm 2 . (Auth.). 7 refs.; 7 figs
Redesigning journal club in residency
Directory of Open Access Journals (Sweden)
Al Achkar M
2016-05-01
Full Text Available Morhaf Al Achkar Department of Family Medicine, Indiana University, Indianapolis, IN, USA Abstract: The gap between production and implementation of knowledge is the main reason for the suboptimal quality of health care. To eliminate this gap and improve the quality of patient care, journal club (JC in graduate medical education provides an opportunity for learning the skills of evidence-based medicine. JC, however, continues to face many challenges mainly due to poorly defined goals, inadequate preparation, and lack of interest. This article presents an innovative model to prepare and present JC based on three pillars: dialogical learning through group discussion, mentored residents as peer teachers, and including JC as part of a structured curriculum to learn evidence-based medicine. This engaging model has the potential to transform JC from a moribund session that is daunting for residents into a lively discussion to redefine clinical practice using the most current evidence. Keywords: journal club, residents, peer teaching, evidence-based medicine, dialogical learning
Automatic Barometric Updates from Ground-Based Navigational Aids
1990-03-12
ro fAutomatic Barometric Updates US Department from of Transportation Ground-Based Federal Aviation Administration Navigational Aids Office of Safety...tighter vertical spacing controls , particularly for operations near Terminal Control Areas (TCAs), Airport Radar Service Areas (ARSAs), military climb and...E.F., Ruth, J.C., and Williges, B.H. (1987). Speech Controls and Displays. In Salvendy, G., E. Handbook of Human Factors/Ergonomics, New York, John
Journal Club: a group of research experience
Draganov, Patricia Bover; Silva, Maria Regina Guimarães; Neves, Vanessa Ribeiro; Sanna, Maria Cristina
2018-01-01
ABSTRACT Introduction: the Journal Club (JC) is a teaching and learning strategy developed by individuals who meet to discuss scientific articles in periodicals. Objective: to describe the experience of the JC strategy at the Group for Studies and Research in Health Services Administration and Nursing Management (Gepag). Method: case studies or scientific research demonstration mode of practical experience for the understanding and justification of facts. Results: Gepag JC emerged in 2008...
Roseomonas oryzae sp. nov., isolated from paddy rhizosphere soil.
Ramaprasad, E V V; Sasikala, Ch; Ramana, Ch V
2015-10-01
A non-motile, coccus-shaped, pale-pink-pigmented bacterium, designated strain JC288T, was isolated from a paddy rhizosphere soil collected from Western Ghats, Kankumbi, Karnataka, India. Cells were found to be Gram-stain-negative, and catalase- and oxidase-positive; the major fatty acids were C16 : 0, C16 : 1ω7c/C16 : 1ω6c, C18 : 1ω7c/C18 : 1ω6c and C18 : 1 2-OH. The predominant respiratory quinone was Q-10 and the genomic DNA G+C content was 67.5 mol%. Strain JC288T contained diphosphatidylglycerol, phosphatidylglycerol, phosphatidylethanolamine, phosphatidylcholine, four unidentified aminolipids, three unidentified phospholipids, two unidentified lipids, an aminophospholipid and a glycolipid. Hydroxyspirilloxanthin was the major carotenoid of strain JC288T. 16S rRNA gene sequence comparisons indicated that strain JC288T represents a member of the genus Roseomonas within the family Acetobacteraceae of the phylum Proteobacteria. Strain JC288T shared the highest 16S rRNA gene sequence similarity with Roseomonas rhizosphaerae YW11T (97.3 %), Roseomonas aestuarii JC17T (97.1 %), Roseomonas cervicalis CIP 104027T (95.9 %) and other members of the genus Roseomonas ( < 95.5 %). The distinct genomic difference and morphological, physiological and chemotaxonomic differences from the previously described taxa support the classification of strain JC288T as a representative of a novel species of the genus Roseomonas, for which the name Roseomonas oryzae sp. nov. is proposed. The type strain is JC288T ( = KCTC 42542T = LMG 28711T).
Hua, Wan; Hu, Huiling; Chen, Fang; Tang, Lin; Peng, Tong; Wang, Zhanguo
2015-03-18
In this work, a high-speed countercurrent chromatography (HSCCC) method was established for the preparation of phorbol esters (PEs) from Jatropha curcas. n-Hexane-ethyl acetate-methanol-water (1.5:1.5:1.2:0.5, v/v) was selected as the optimum two-phase solvent system to separate and purify jatropha factor C1 (JC1) with a purity of 85.2%, as determined by HPLC, and to obtain a mixture containing four or five PEs. Subsequently, continuous semipreparative HPLC was applied to further purify JC1 (99.8% as determined by HPLC). In addition, UPLC-PDA and UPLC-MS were established and successfully used to evaluate the isolated JC1 and PE-rich crude extract. The purity of JC1 was only 87.8% by UPLC-UV. A peak (a compound highly similar to JC1) was indentified as the isomer of JC1 by comparing the characteristic UV absorption and MS spectra. Meanwhile, this strategy was also applied to analyze the PE-rich crude extract from J. curcas. It is interesting that there may be more than 15 PEs according to the same quasi-molecular ion peaks, highly similar sequence-specific fragment ions, and similar UV absorption spectrum.
Duan, Peipei; Cai, Feng; Luo, Yongting; Chen, Yangxi; Zou, Shujuan
2015-09-01
Isoenzyme c of horseradish peroxidase (HRP-C) is widely used in enzyme immunoassay combined with chemiluminescence (CL) detection. For this application, HRP-C activity measurement is usually based on luminol oxidation in the presence of hydrogen peroxide (H2O2). However, this catalysis reaction was enhancer dependent. In this study, we demonstrated that Jatropha curcas peroxidase (JcGP1) showed high efficiency in catalyzing luminol oxidation in the presence of H2O2. Compared with HRP-C, the JcGP1-induced reaction was enhancer independent, which made the enzyme-linked immunosorbent assay (ELISA) simpler. In addition, the JcGP1 catalyzed reaction showed a long-term stable CL signal. We optimized the conditions for JcGP1 catalysis and determined the favorable conditions as follows: 50 mM Tris buffer (pH 8.2) containing 10 mM H2 O2, 14 mM luminol and 0.75 M NaCl. The optimum catalysis temperature was 30°C. The detection limit of JcGP1 under optimum condition was 0.2 pM. Long-term stable CL signal combined with enhancer-independent property indicated that JcGP1 might be a valuable candidate peroxidase for clinical diagnosis and enzyme immunoassay with CL detection. Copyright © 2014 John Wiley & Sons, Ltd.
Directory of Open Access Journals (Sweden)
Sherine Ismail
2017-01-01
Full Text Available Journal clubs have been traditionally incorporated into academic training programs to enhance competency in the interpretation of literature. We designed a structured journal club (JC to improve skills in the interpretation of literature; however, we were not aware of how learners (interns, residents, clinical pharmacists, etc. would perceive it. We aimed to assess the perception of learners at different levels of pharmacy training. A cross-sectional design was used. A self-administered online survey was emailed to JC attendees from 2010–2014 at King Abdulaziz Medical City, Jeddah, Saudi Arabia. The survey questions included: introduction sessions, topic selection, JC layout, interaction with the moderator, and decision-making skills by clinical pharmacists. The response rate was 58/89 (65%; 52/54 (96% respondents believed that JC adds to their knowledge in interpreting literature. Topic selection met the core curriculum requirements for credentials exams for 16/36 (44.4%, while 16/22 (73% presenters had good to excellent interaction with the moderator. JC facilitated decision-making for 10/12 (83% of clinical pharmacists. The results suggest that clinical pharmacist-steered JC may serve as an effective tool to empower learners at different levels of pharmacy practice, with evidence-based principles for interpretation of literature and guide informed decision-making.
Dou, S. X.; Soltanian, S.; Horvat, J.; Wang, X. L.; Zhou, S. H.; Ionescu, M.; Liu, H. K.; Munroe, P.; Tomsic, M.
2002-10-01
Doping of MgB2 by nano-SiC and its potential for the improvement of flux pinning were studied for MgB2-x)(SiCx/2 with x=0, 0.2, and 0.3 and for 10 wt % nano-SiC-doped MgB2 samples. Cosubstitution of B by Si and C counterbalanced the effects of single-element doping, decreasing Tc by only 1.5 K, introducing intragrain pinning centers effective at high fields and temperatures, and significantly enhancing Jc and Hirr. Compared to the undoped sample, Jc for the 10 wt % doped sample increased by a factor of 32 at 5 K and 8 T, 42 at 20 K and 5 T, and 14 at 30 K and 2 T. At 20 K and 2 T, the Jc for the doped sample was 2.4 x105 A/cm2, which is comparable to Jc values for the best Ag/Bi-2223 tapes. At 20 K and 4 T, Jc was twice as high as for the best MgB2 thin films and an order of magnitude higher than for the best Fe/MgB2 tapes. The magnetic Jc is consistent with the transport Jc which remains at 20 000 A/cm2 even at 10 T and 5 K for the doped sample, an order of magnitude higher than the undoped one. Because of such high performance, it is anticipated that the future MgB2 conductors will be made using a formula of MgBxSiyCz instead of pure MgB2.
Directory of Open Access Journals (Sweden)
Hee-Jin Kim
2009-10-01
Full Text Available Progressive multifocal leukoencephalopathy (PML is a demyelinating disease of the central nervous system (CNS caused by JC virus infection in oligodendrocytes, especially in patients with acquired immunodeficiency syndrome (AIDS. Movement disorders associated with PML are very rare. Here, we report a case of PML in an AIDS patient who presented with a cerebellar tremor, caused by lesions in the cerebellar outflow tract. A cerebellar tremor can be a rare clinical manifestation in patients with PML.
Kim, Hee-Jin; Lee, Jae-Jung; Lee, Phil Hyu
2009-01-01
Progressive multifocal leukoencephalopathy (PML) is a demyelinating disease of the central nervous system (CNS) caused by JC virus infection in oligodendrocytes, especially in patients with acquired immunodeficiency syndrome (AIDS). Movement disorders associated with PML are very rare. Here, we report a case of PML in an AIDS patient who presented with a cerebellar tremor, caused by lesions in the cerebellar outflow tract. A cerebellar tremor can be a rare clinical manifestation in patients with PML. PMID:24868366
Energy Technology Data Exchange (ETDEWEB)
Vieira, Carlos Eduardo Delfino [Laboratório de Ecofisiologia Animal — Departamento de Ciências Fisiológicas, Universidade Estadual de Londrina, Paraná (Brazil); Costa, Patrícia Gomes [Laboratório de Microcontaminantes Orgânicos e Ecotoxicologia — Instituto de Oceanografia, Universidade Federal do Rio Grande, Rio Grande do Sul (Brazil); Lunardelli, Bruna; Fernandes de Oliveira, Luciana [Laboratório de Ecofisiologia Animal — Departamento de Ciências Fisiológicas, Universidade Estadual de Londrina, Paraná (Brazil); Costa Cabrera, Liziara da [Laboratório de Análise de Compostos Orgânicos e Metais — Escola de Química e Alimentos, Universidade Federal do Rio Grande, Rio Grande do Sul (Brazil); Risso, Wagner Ezequiel [Laboratório de Ecofisiologia Animal — Departamento de Ciências Fisiológicas, Universidade Estadual de Londrina, Paraná (Brazil); Primel, Ednei Gilberto [Laboratório de Análise de Compostos Orgânicos e Metais — Escola de Química e Alimentos, Universidade Federal do Rio Grande, Rio Grande do Sul (Brazil); and others
2016-01-15
In order to assess the quality of streams susceptible to contamination by pesticides we apply biochemical and genotoxic biomarkers in the Neotropical fish Prochilodus lineatus submitted to in situ tests. Fish were caged, for 96 h, in two streams located in areas with intensive use of pesticides, the Apertados (AP) and the Jacutinga (JC), and in a small stream (Godoy stream — GD) found inside a forest fragment adjacent to a State Park. Biochemical parameters, such as biotransformation enzymes 7-ethoxyresorufin-O-deethylase (EROD) and glutathione-S-transferase (GST), non-protein thiols (NPSH), lipoperoxidation (LPO), protein carbonylation (PCO) and acetylcholinesterase (AChE) were evaluated in various fish organs, as well as genotoxic biomarkers (damage to DNA and occurrence of micronuclei and erythrocyte nuclear abnormalities). Samples of water and sediment were collected for analysis of metals (Cu, Cr, Pb, Ni, Mn, Cd and Zn), organochloride pesticides, and triazine and glyphosate herbicides. We observed an increase in liver GST activity in fish at AP and gill GST activity in fish at JC. An increase in liver LPO was also observed in fish exposed to AP and JC. The same animals also exhibited increased DNA damage and erythrocyte nuclear abnormalities (ENAs) compared to the fish kept in GD. A number of compounds showed concentrations higher than the permitted levels, in particular, dichlorodiphenyltrichloroethane (DDT), its metabolites dichlorodiphenyldichloroethylene (DDE) and dichlorodiphenyldichloroethane (DDD), hexachlorocyclohexanes (HCH), heptachloride, diclofluanid and aldrins. These pesticides were detected at higher concentrations in water and sediment samples from AP, followed by JC and GD. The Integrated Biomarker Response Index (IBR) indicated that AP and JC (AP: 21.7 > JC: 18.5 > GD: 12.6) have the worst environmental quality. Integrated biomarker analysis revealed that the alterations observed related well with the levels of environmental contaminants
Reduced H3K27me3 expression in Merkel cell polyoma virus-positive tumors.
Busam, Klaus J; Pulitzer, Melissa P; Coit, Daniel C; Arcila, Maria; Leng, Danielle; Jungbluth, Achim A; Wiesner, Thomas
2017-06-01
Merkel cell carcinoma is a primary cutaneous neuroendocrine carcinoma, which once metastatic is difficult to treat. Recent mutation analyses of Merkel cell carcinoma revealed a low number of mutations in Merkel cell polyomavirus-associated tumors, and a high number of mutations in virus-negative combined squamous cell and neuroendocrine carcinomas of chronically sun-damaged skin. We speculated that the paucity of mutations in virus-positive Merkel cell carcinoma may reflect a pathomechanism that depends on derangements of chromatin without alterations in the DNA sequence (epigenetic dysregulation). One central epigenetic regulator is the Polycomb repressive complex 2 (PRC2), which silences genomic regions by trimethylating (me3) lysine (K) 27 of histone H3, and thereby establishes the histone mark H3K27me3. Recent experimental research data demonstrated that PRC2 loss in mice skin results in the formation of Merkel cells. Prompted by these findings, we explored a possible contribution of PRC2 loss in human Merkel cell carcinoma. We examined the immunohistochemical expression of H3K27me3 in 35 Merkel cell carcinomas with pure histological features (22 primary and 13 metastatic lesions) and in 5 combined squamous and neuroendocrine carcinomas of the skin. We found a strong reduction of H3K27me3 staining in tumors with pure histologic features and virus-positive Merkel cell carcinomas. Combined neuroendocrine carcinomas had no or only minimal loss of H3K27me3 labeling. Our findings suggest that a PRC2-mediated epigenetic deregulation may play a role in the pathogenesis of virus-positive Merkel cell carcinomas and in tumors with pure histologic features.
Kametani, F; Jiang, J; Scheuerlein, C; Malagoli, A; Di Michiel, M; Huang, Y; Miao, H; Parrell, J A; Hellstrom, E E; Larbalestier, D C
2011-01-01
Most studies of Bi2Sr2CaCu2Ox (Bi2212) show that the critical current density Jc is limited by the connectivity of the filaments, but what determines the connectivity is still elusive. Here we report on the role played by filament porosity in limiting Jc. By a microstructural investigation of wires quenched from the melt state, we find that porosity in the unreacted wire agglomerates into bubbles that segment the Bi2212 melt within the filaments into discrete sections. These bubbles do not disappear during subsequent processing because they are only partially filled by Bi2212 grains as the Bi2212 forms on cooling. Correlating the microstructure of quenched wires to their final, fully processed Jc values shows an inverse relation between Jc and bubble density. Bubbles are variable between conductors and perhaps from sample to sample, but they occur frequently and almost completely fill the filament diameter, so they exert a strongly variable but always negative effect on Jc. Bubbles reduce the continuous Bi221...
Understanding Collagen Organization in Breast Tumors to Predict and Prevent Metastasis
2015-11-01
mouse mammary tumor virus polyoma middle T (MMTV-PyMT) mice crossed with MMP13 KO mice, noted proportionately more “thin collagen fibers” (rela- tive to...mammary gland gene expression and increased tumor growth following social isolation. Cancer Prev. Res. 2, 850–861. Wohleb, E.S., Hanke, M.L., Corona , A.W...1:100 dilution of mouse anti-Collagen II (II-II6B3; Developmental Studies Hybridoma Bank, Iowa City, IA) or a mouse monoclonal anti-Collagen I ( Cat
A Brief History of Human Time. Exploring a database of " notable people "
Gergaud , Olivier; Laouenan , Morgane; Wasmer , Etienne
2017-01-01
L’article de Morgane Laouenan, Etienne Wasmer et Olivier Gergaud est le fruit d’un travail de près de deux ans réalisé au LIEPP (Laboratoire Interdisciplinaire d’Evaluation des Politiques Publiques) à Sciences Po. Les auteurs ont collecté et analysé des données de 1 243 776 personnages notables (notable people) et 7 184 575 lieux mentionnés dans leur notice Wikipedia. La base de données couvre au total un peu plus de 5000 ans d'histoire de l'Humanité de 3000 avant JC jusqu’en 2015. L’arti...
Wang, Haibo; Ao, Pingxing; Yang, Shuanglong; Zou, Zhurong; Wang, Shasha; Gong, Ming
2015-03-01
Proline dehydrogenase (ProDH) (EC 1.5.99.8) is a key enzyme in the catabolism of proline. The enzyme JcProDH and its complementary DNA (cDNA) were isolated from Jatropha curcas L., an important woody oil plant used as a raw material for biodiesels. It has been classified as a member of the Pro_dh superfamily based on multiple sequence alignment, phylogenetic characterization, and its role in proline catabolism. Its cDNA is 1674 bp in length with a complete open reading frame of 1485 bp, which encodes a polypeptide chain of 494 amino acids with a predicted molecular mass of 54 kD and a pI of 8.27. Phylogenetic analysis indicated that JcProDH showed high similarity with ProDH from other plants. Reverse transcription PCR (RT-PCR) analysis revealed that JcProDH was especially abundant in the seeds and flowers but scarcely present in the stems, roots, and leaves. In addition, the expression of JcProDH increased in leaves experiencing environmental stress such as cold (5 °C), heat (42 °C), salt (300 mM), and drought (30 % PEG6000). The JcProDH protein was successfully expressed in the yeast strain INVSc1 and showed high enzyme activity in proline catabolism. This result confirmed that the JcProDH gene negatively participated in the stress response.
Togano, Kazumasa; Gao, Zhaoshun; Matsumoto, Akiyoshi; Kumakura, Hiroaki
2013-11-01
We report that the transport critical current density Jc of ex situ powder-in-tube (PIT) processed (Ba, K)Fe2As2 (Ba-122) tapes can be significantly enhanced by applying uniaxial cold pressing at the final stage of deformation. The tapes were prepared by packing high quality precursor powder into a Ag tube, cycles of rolling and intermediate annealing, and pressing followed by the final heat treatment for sintering. The Jc values in applied magnetic fields were increased by almost one order of magnitude compared to the tapes processed without pressing, exceeding 104 A cm-2 at 4.2 K. We achieved the highest Jc (at 4.2 K and 10 T) of 2.1×104 A cm-2 among PIT-processed Fe-based wires and tapes reported so far. The Jc-H curves measured at higher temperatures maintain small field dependence up to around 20 K, suggesting that these tapes are promising for applications at higher temperatures as well as at liquid helium temperature. The microstructure investigations reveal that there are two possible causes of the large Jc enhancement by pressing: one is densification and the other is the change of crack structure. Optimization of processing parameters such as the reduction ratio of rolling and pressing is expected to yield further Jc enhancement.
Yamasaki, Hirofumi; Yamada, Hiroshi
2017-11-01
Temperature dependence of critical current density Jc(H, T) was measured in moderate magnetic fields (H ⊥ film) in two thermally co-evaporated YBa2Cu3O7-δ (YBCO) thin films (A, B) and two YBCO films (C, D) deposited using a pulsed-laser deposition method. All sample films were grown epitaxially with the c-axis perpendicular to the surface of a single-crystalline substrate. Transmission electron microscopy observation revealed that these four films contained a high density of nanoprecipitates with typical sizes of 3.6 - 5.0 nm (A), 5.0 - 7.1 nm (B), 7.0 - 10.1 nm (C) and 8.7 - 14.3 nm (D). Films A and B contained very fine nanoprecipitates, whose typical diameters Dtyp are smaller than double the estimated Ginzburg-Landau coherence length 2ξab at T = 77 K, and exhibited a steep increase of Jc with decreasing temperature. Whereas, film D, which contained relatively large nanoprecipitates (Dtyp > 2ξab at T ≤ 70 K), exhibited a gradual increase in Jc. This led to a remarkable crossing of the Jc(T) curves. The temperature dependence of Jc(H//c) under a fixed magnetic field is approximated by Jc ∼ (1 - T/Tc)m(1 + T/Tc)2 where the index m is larger for films containing finer precipitates; that is, m(A) > m(B) > m(C) > m(D). This means that finer nanoprecipitates generally cause steeper Jc increase at low temperatures, which is the origin of the observed crossing phenomenon. The experimental results are reasonably explained by several theoretical models based on the direct summation of elementary pinning forces fp calculated by core pinning interactions.
Directory of Open Access Journals (Sweden)
Juliano‐Chitue de Assunção‐Nascimento
2014-08-01
Full Text Available Las grasas lubricantes son consideradas una dispersión coloidal de un espesante en un fluido lubricante. Los aceites vegetales son ampliamente usados en muchas formulaciones de grasas. En este trabajo se determinaron las propiedades fisicoquímicas y tribológicas de una grasa lubricante fabricada con aceite vegetal de Jatropha curcas L y jabón de litio (JC1G5. Alfa tocoferol acetato y grafito fueron usados como aditivos antioxidante y de extrema presión respectivamente. La grasa JC1G5 mostró un color negro, una temperatura de goteo de 140 oC, apropiadas propiedades de corrosión al cobre y un grado de consistencia NLGI Grado1. El efecto de la lubricación de la grasa JC1G5 fue probado, empleando una máquina de cuatro bolas y un tribómetro timken. Los resultados indican que la grasa JC1G5 posee propiedades tribológicas comparables con una grasa mineral de jabón de litio.Palabras claves: grasa, jatropha curcas L, jabón de litio, propiedades fisicoquímicas, propiedades tribológicas.______________________________________________________________________________AbstractLubricating greases are considered as colloidal dispersions of a thickener in a lubricating fluid. The vegetable oils are widely used in many formulations of greases. In this paper were determined the physicochemical and tribological properties of graphite grease based on Jatropha curcas L vegetableoil and lithium soap (JC1G5. Alpha tocofherol acetate and graphite were used as antioxidant and extreme pressure additives respectively. The grease JC1G5 showed a black color, a dropping point of 140 oC, appropriate magnitude of copper corrosion and consistency NLGI Grade 1. Lubrication performance of the grease JC1G5 was tested using the 4-ball wear tester and timken tribometer tester. Results indicate that the grease JC1G5 has tribological properties comparable to that of mineral oil base lithium grease.Key words: grease, jatrophacurcas L, lithium soap, physicochemical
Prevalence of JC virus in Chinese patients with colorectal cancer.
Directory of Open Access Journals (Sweden)
Xiaozhou Mou
Full Text Available BACKGROUND: JCV is a DNA polyomavirus very well adapted to humans. Although JCV DNA has been detected in colorectal cancers (CRC, the association between JCV and CRC remains controversial. In China, the presence of JCV infection in CRC patients has not been reported. Here, we investigated JCV infection and viral DNA load in Chinese CRC patients and to determine whether the JCV DNA in peripheral blood (PB can be used as a diagnostic marker for JCV-related CRC. METHODOLOGY/PRINCIPAL FINDINGS: Tumor tissues, non-cancerous tumor-adjacent tissues and PB samples were collected from 137 CRC patients. In addition, 80 normal colorectal tissue samples from patients without CRC and PB samples from 100 healthy volunteers were also harvested as controls. JCV DNA was detected by nested PCR and glass slide-based dot blotting. Viral DNA load of positive samples were determined by quantitative real-time PCR. JCV DNA was detected in 40.9% (56/137 of CRC tissues at a viral load of 49.1 to 10.3×10(4 copies/µg DNA. Thirty-four (24.5% non-cancerous colorectal tissues (192.9 to 4.4×10(3 copies/µg DNA and 25 (18.2% PB samples (81.3 to 4.9×10(3 copies/µg DNA from CRC patients were positive for JCV. Tumor tissues had higher levels of JCV than non-cancerous tissues (P = 0.003 or PB samples (P<0.001. No correlation between the presence of JCV and demographic or medical characteristics was observed. The JCV prevalence in PB samples was significantly associated with the JCV status in tissue samples (P<0.001. Eleven (13.8% normal colorectal tissues and seven (7.0% PB samples from healthy donors were positive for JCV. CONCLUSIONS/SIGNIFICANCE: JCV infection is frequently present in colorectal tumor tissues of CRC patients. Although the association between JCV presence in PB samples and JCV status in tissue samples was identified in this study, whether PB JCV detection can serve as a marker for JCV status of CRC requires further study.
The magnetic fluid for heat transfer applications
International Nuclear Information System (INIS)
Nakatsuka, K.; Jeyadevan, B.; Neveu, S.; Koganezawa, H.
2002-01-01
Real-time visual observation of boiling water-based and ionic magnetic fluids (MFs) and heat transfer characteristics in heat pipe using ionic MF stabilized by citrate ions (JC-1) as working liquid are reported. Irrespective of the presence or absence of magnetic field water-based MF degraded during boiling. However, the degradation of JC-1 was avoided by heating the fluid in magnetic field. Furthermore, the heat transfer capacity of JC-1 heat pipe under applied magnetic field was enhanced over the no field case
Lifescience Database Archive (English)
Full Text Available rd, Robinson PN, Kini U, Taylor JC, Horn D, Kinoshita T, Krawitz PM ... TITLE ... M...LB, Brilot F, North KN, Kanzawa N, Macarthur DG, Taylor JC, Kini U, Murakami Y, Clarke NF ... TITLE ... Mutati
PathNet: A Tool for Pathway Analysis Using Topological Information
2012-09-24
potentiation (4720) 0.00 [31,32] 4 Neurotrophin signal. . . (4722) 0.01 [31,48] 4 Oocyte meiosis (4114) 0.00 NA 4 Pathways in cancer (5200) 0.71 [35-37...McKeel D, Morris JC, et al: Gene expression profiles in anatomically and functionally distinct regions of the normal aged human brain. Physiol...Background: Identification of canonical pathways through enrichment of differentially expressed genes in a given pathway is a widely used method for
Directory of Open Access Journals (Sweden)
HGJ Beukes
2014-11-01
Full Text Available This case note provides a concise and understandable version of the confusing facts in Peel v Hamon J&C Engineering (Pty Ltd, and deals with the remedy provided for in section 163 of the Companies Act (the oppression remedy. The importance of drawing a distinction between the application of this section and the orders that the Court can make to provide relief in terms of subsection (2 is explained, after which each requirement contained in subsection (1(a is analysed. With reference to the locus standi-requirement, it is indicated that the judgment is not to be regarded as authority for the contention that a shareholder or a director who wants to exercise the oppression remedy need not have been a shareholder or a director of the company at the time of the conduct. With reference to the conduct-requirement, it is indicated that it would have been more appropriate for the applicants to have made use of a remedy in terms of the law of contract. Most importantly, the result-requirement is indicated to have been ignored, as a lack of certainty that there will be a result is argued not to constitute a result. Ignoring the result-requirement is explained to have resulted in ignoring the detriment-requirement, in turn. Accordingly, it is concluded that the oppression remedy was utilised without the specified statutory criteria having been satisfied and that the applicants' interests were protected by a remedy which should not have found application under the circumstances, as this was beyond the remedy's statutorily intended reach.
Pan, Bang-Zhen; Chen, Mao-Sheng; Ni, Jun; Xu, Zeng-Fu
2014-11-17
Jatropha curcas, whose seed content is approximately 30-40% oil, is an ideal feedstock for producing biodiesel and bio-jet fuels. However, Jatropha plants have a low number of female flowers, which results in low seed yield that cannot meet the needs of the biofuel industry. Thus, increasing the number of female flowers is critical for the improvement of Jatropha seed yield. Our previous findings showed that cytokinin treatment can increase the flower number and female to male ratio and also induce bisexual flowers in Jatropha. The mechanisms underlying the influence of cytokinin on Jatropha flower development and sex determination, however, have not been clarified. This study examined the transcriptional levels of genes involved in the response to cytokinin in Jatropha inflorescence meristems at different time points after cytokinin treatment by 454 sequencing, which gave rise to a total of 294.6 Mb of transcript sequences. Up-regulated and down-regulated annotated and novel genes were identified, and the expression levels of the genes of interest were confirmed by qRT-PCR. The identified transcripts include those encoding genes involved in the biosynthesis, metabolism, and signaling of cytokinin and other plant hormones, flower development and cell division, which may be related to phenotypic changes of Jatropha in response to cytokinin treatment. Our analysis indicated that Jatropha orthologs of the floral organ identity genes known as ABCE model genes, JcAP1,2, JcPI, JcAG, and JcSEP1,2,3, were all significantly repressed, with an exception of one B-function gene JcAP3 that was shown to be up-regulated by BA treatment, indicating different mechanisms to be involved in the floral organ development of unisexual flowers of Jatropha and bisexual flowers of Arabidopsis. Several cell division-related genes, including JcCycA3;2, JcCycD3;1, JcCycD3;2 and JcTSO1, were up-regulated, which may contribute to the increased flower number after cytokinin treatment. This study
RANTES and fibroblast growth factor 2 in jawbone cavitations: triggers for systemic disease?
Directory of Open Access Journals (Sweden)
Lechner J
2013-04-01
Full Text Available Johann Lechner,1 Volker von Baehr2 1Clinic for Integrative Dentistry, Munich, Germany; 2Compartment of Immunology and Allergology on Institute for Medical Diagnostics in MVZ GbR, Berlin, Germany Background: Jawbone cavitations (JC are hollow dead spaces in jawbones with dying or dead bone marrow. These areas are defined as fatty degenerative osteonecrosis of the jawbone or neuralgia-inducing cavitational osteonecrosis and may produce facial pain. These afflictions have been linked to the immune system and chronic illnesses. Surgical debridement of JC is reported to lead to an improvement in immunological complaints, such as rheumatic, allergic, and other inflammatory diseases (ID. Little is known about the underlying cause/effect relationship. Objectives: JC bone samples were analyzed to assess the expression and quantification of immune modulators that can play a role in the pathogenesis of IDs. The study supports a potential mechanism where JC is a mediating link in IDs. Materials and methods: Samples of fatty softened bone taken from JCs were extracted from 31 patients. The specimens were analyzed by bead-based multiplex technology and tested for seven immune messengers. Results: Regulated upon activation, normal T-cell expressed, and secreted (RANTES and fibroblast growth factor (FGF-2 were found at high levels in the JCs tested. Other cytokines could not be detected at excessive levels. Discussion: The study confirms that JC is able to produce inflammatory messengers, primarily RANTES, and, secondarily, FGF-2. Both are implicated in many serious illnesses. The excessive levels of RANTES/FGF-2 in JC patients with amyotrophic lateral sclerosis, multiple sclerosis, rheumatoid arthritis, and breast cancer are compared to levels published in medical journals. Levels detected in JCs are higher than in the serum and cerebrospinal fluid of amyotrophic lateral sclerosis and multiple sclerosis patients and four-fold higher than in breast cancer
Ji, Chenhui; Xue, Guo-Fang; Lijun, Cao; Feng, Peng; Li, Dongfang; Li, Lin; Li, Guanglai; Hölscher, Christian
2016-03-01
The incretins glucagon-like peptide 1 (GLP-1) and glucose dependent insulinotropic polypeptide (GIP) are growth factors with neuroprotective properties. GLP-1 mimetics are on the market as treatments for type 2 diabetes and are well tolerated. Both GLP-1 and GIP mimetics have shown neuroprotective properties in animal models of Parkinson's and Alzheimer's disease. In addition, the GLP-1 mimetic exendin-4 has shown protective effects in a clinical trial in Parkinson's disease (PD) patients. Novel GLP-1/GIP dual-agonist peptides have been developed and are tested in diabetic patients. Here we demonstrate the neuroprotective effects of a novel dual agonist (DA-JC1) in the 1-methyl-4-phenyl-1,2,3,6-tetrahydropyridine (MPTP) mouse model of PD. MPTP was injected once-daily (20 mg/kg i.p.) for 7 days, and the dual agonist was injected 30 min later i.p. (50 nmol/kg bw). The PI3k inhibitor LY294002 (0.6 mg/kg i.v.) was co-injected in one group. DA-JC1 reduced or reversed most of the MPTP induced motor impairments in the rotarod and in a muscle strength test. The number of tyrosine hydroxylase (TH) positive neurons in the substantia nigra (SN) was reduced by MPTP and increased by DA-JC1. The ratio of anti-inflammatory Bcl-2 to pro-inflammatory BAX as well as the activation of the growth factor kinase Akt was reduced by MPTP and reversed by DA-JC1. The PI3k inhibitor had only limited effect on the DA-JC1 drug effect. Importantly, levels of the neuroprotective brain derived neurotropic factor (BDNF) were reduced by MPTP and enhanced by DA-JC1. The results demonstrate that DA-JC1 shows promise as a novel treatment for PD. Copyright © 2016. Published by Elsevier B.V.
Directory of Open Access Journals (Sweden)
Wen-Kai Hui
2018-02-01
Full Text Available Jatropha curcas L. seeds an oilseed plant with great potential for biodiesel production. However, low seed yield, which was limited by its lower female flowers, was a major drawback for its utilization. Our previous study found that the flower number and female-to-male ratio were increased by gibberellin treatment. Here, we compared the transcriptomic profiles of inflorescence meristem at different time points after gibberellic acid A3 (GA3 treatment. The present study showed that 951 differentially expressed genes were obtained in response to gibberellin treatment, compared with control samples. The 6-h time point was an important phase in the response to exogenous gibberellin. Furthermore, the plant endogenous gibberellin, auxin, ethylene, abscisic acid, and brassinolide-signaling transduction pathways were repressed, whereas the genes associated with cytokinin and jasmonic acid signaling were upregulated for 24-h time point following GA3 treatment. In addition, the floral meristem determinacy genes (JcLFY, JcSOC1 and floral organ identity genes (JcAP3, JcPI, JcSEP1-3 were significantly upregulated, but their negative regulator (JcSVP was downregulated after GA3 treatment. Moreover, the effects of phytohormone, which was induced by exogenous plant growth regulator, mainly acted on the female floral differentiation process. To the best of our knowledge, this data is the first comprehensive analysis of the underlying transcriptional response mechanism of floral differentiation following GA3 treatment in J. curcas, which helps in engineering high-yielding varieties of Jatropha.
High critical currents in heavily doped (Gd,Y)Ba2Cu3Ox superconductor tapes
Energy Technology Data Exchange (ETDEWEB)
Selvamanickam, V; Gharahcheshmeh, MH; Xu, A; Galstyan, E; Delgado, L; Cantoni, C
2015-01-19
REBa2Cu3Ox ((REBCO), RE = rare earth) superconductor tapes with moderate levels of dopants have been optimized for high critical current density in low magnetic fields at 77 K, but they do not exhibit exemplary performance in conditions of interest for practical applications, i.e., temperatures less than 50K and fields of 2-30 T. Heavy doping of REBCO tapes has been avoided by researchers thus far due to deterioration in properties. Here, we report achievement of critical current densities (J(c)) above 20 MA/cm(2) at 30 K, 3 T in heavily doped (25 mol.% Zr-added) (Gd,Y)Ba2Cu3Ox superconductor tapes, which is more than three times higher than the J(c) typically obtained in moderately doped tapes. Pinning force levels above 1000 GN/m(3) have also been attained at 20 K. A composition map of lift factor in J(c) (ratio of J(c) at 30 K, 3 T to the J(c) at 77 K, 0 T) has been developed which reveals the optimum film composition to obtain lift factors above six, which is thrice the typical value. A highly c-axis aligned BaZrO3 (BZO) nanocolumn defect density of nearly 7 x 10(11) cm(-2) as well as 2-3 nm sized particles rich in Cu and Zr have been found in the high J(c) films. (C) 2015 AIP Publishing LLC.
A generalized Jensen type mapping and its applications
Directory of Open Access Journals (Sweden)
Ali Ebadian
2015-02-01
Full Text Available Let $X$ and $Y$ be vector spaces. It is shown that a mapping $f : X \\rightarrow Y$ satisfies the functional equation (2d+1 f(\\frac{\\sum_{j=1}^{2d+1} (-1^{j+1} x_j}{2d+1} = \\sum_{j=1}^{2d+1} (-1^{j+1} f(x_j \\end{aligned} if and only if the mapping $f : X \\rightarrow Y$ is additive, and prove the Cauchy-Rassias stability of the functional equation $(0.1$ in Banach modules over a unital $C^*$-algebra, and in Poisson Banach modules over a unital Poisson $C^*$-algebra. Let $A$ and $B$ be unital $C^*$-algebras, Poisson $C^*$-algebras, Poisson $JC^*$-algebras or Lie $JC^*$-algebras. As an application, we show that every almost homomorphism $h : A \\rightarrow B$ is a homomorphism when $h((2d+1^n u y = h((2d+1^n u h(y$ or $h((2d+1^n u \\circ y = h((2d+1^n u\\circ h(y$ for all unitaries $u \\in A$, all $y \\in A$, and $n = 0, 1, 2, \\cdots$, and that every almost linear almost multiplicative mapping $h : A \\rightarrow B$ is a homomorphism when $h((2d+1 x = (2d+1 h(x$ for all $x \\in A$. Moreover, we prove the Cauchy-Rassias stability of homomorphisms in $C^*$-algebras, Poisson $C^*$-algebras, Poisson $JC^*$-algebras or Lie $JC^*$-algebras, and of Lie $JC^*$-algebra derivations in Lie $JC^*$-algebras.
Rrp1b, a new candidate susceptibility gene for breast cancer progression and metastasis.
Directory of Open Access Journals (Sweden)
Nigel P S Crawford
2007-11-01
Full Text Available A novel candidate metastasis modifier, ribosomal RNA processing 1 homolog B (Rrp1b, was identified through two independent approaches. First, yeast two-hybrid, immunoprecipitation, and functional assays demonstrated a physical and functional interaction between Rrp1b and the previous identified metastasis modifier Sipa1. In parallel, using mouse and human metastasis gene expression data it was observed that extracellular matrix (ECM genes are common components of metastasis predictive signatures, suggesting that ECM genes are either important markers or causal factors in metastasis. To investigate the relationship between ECM genes and poor prognosis in breast cancer, expression quantitative trait locus analysis of polyoma middle-T transgene-induced mammary tumor was performed. ECM gene expression was found to be consistently associated with Rrp1b expression. In vitro expression of Rrp1b significantly altered ECM gene expression, tumor growth, and dissemination in metastasis assays. Furthermore, a gene signature induced by ectopic expression of Rrp1b in tumor cells predicted survival in a human breast cancer gene expression dataset. Finally, constitutional polymorphism within RRP1B was found to be significantly associated with tumor progression in two independent breast cancer cohorts. These data suggest that RRP1B may be a novel susceptibility gene for breast cancer progression and metastasis.
Activation of the PI3K/AKT pathway in Merkel cell carcinoma.
Directory of Open Access Journals (Sweden)
Christian Hafner
Full Text Available Merkel cell carcinoma (MCC is a highly aggressive skin cancer with an increasing incidence. The understanding of the molecular carcinogenesis of MCC is limited. Here, we scrutinized the PI3K/AKT pathway, one of the major pathways activated in human cancer, in MCC. Immunohistochemical analysis of 41 tumor tissues and 9 MCC cell lines revealed high levels of AKT phosphorylation at threonine 308 in 88% of samples. Notably, the AKT phosphorylation was not correlated with the presence or absence of the Merkel cell polyoma virus (MCV. Accordingly, knock-down of the large and small T antigen by shRNA in MCV positive MCC cells did not affect phosphorylation of AKT. We also analyzed 46 MCC samples for activating PIK3CA and AKT1 mutations. Oncogenic PIK3CA mutations were found in 2/46 (4% MCCs whereas mutations in exon 4 of AKT1 were absent. MCC cell lines demonstrated a high sensitivity towards the PI3K inhibitor LY-294002. This finding together with our observation that the PI3K/AKT pathway is activated in the majority of human MCCs identifies PI3K/AKT as a potential new therapeutic target for MCC patients.
Association of Japanese cedar pollinosis and sensitization with HLA-DPB1 in the Japanese adolescent
Directory of Open Access Journals (Sweden)
Wataru Morii
2018-01-01
Conclusions: Amino acid changes in the allergen-binding pocket of HLA-DPβ1 are likely to influence pollinosis/sensitization to the allergenic peptide of JC pollen and determine the pollinosis risk for each individual exposed to JC pollen.
Directory of Open Access Journals (Sweden)
Mohamed Shehata Ali Mohamed
2015-10-01
Full Text Available Background: Spermatozoa cryopreservation is used for the management of infertility and some other medical conditions. The routinely applied cryopreservation technique depends on permeating cryoprotectants, whose toxic effects have raised the attention towards permeating cryoprotectants-free vitrification technique. Objective: To compare between the application of slow cryopreservation and vitrification on human spermatozoa. Materials and Methods: This was an experimental controlled study involving 33 human semen samples, where each sample was divided into three equal parts; fresh control, conventional slow freezing, and permeating cryoprotectants-free vitrification. Viability and mitochondrial membrane potential (MMP of control and post-thawing spermatozoa were assessed with the sperm viability kit and the JC-1 kit, respectively, using fluorescence-activated cell sorting analysis. Results: Significant reduction of the progressive motility, viability and MMP was observed by the procedure of freezing and thawing, while there was not any significant difference between both cryopreservation techniques. Cryopreservation resulted in 48% reduction of the percentage of viable spermatozoa and 54.5% rise in the percentage of dead spermatozoa. In addition, high MMP was reduced by 24% and low MMP was increased by 34.75% in response to freezing and thawing. Progressive motility of spermatozoa was correlated significantly positive with high MMP and significantly negative with low MMP in control as well as post-thawing specimens (r=0.8881/ -0.8412, 0.7461/ -0.7510 and 0.7603/ -0.7839 for control, slow and vitrification respectively, p=0.0001. Conclusion: Although both cryopreservation techniques have similar results, vitrification is faster, easier and associated with less toxicity and costs. Thus, vitrification is recommended for the clinical application.
FLUX PINNING EFFECTS IN Ag-DOPED YBCO (123 SUPERCONDUCTOR
Directory of Open Access Journals (Sweden)
Madelen Pérez
2010-07-01
Full Text Available Polycrystalline samples of Ag+-doped YBCO (123 (YBa2 (Cu1-xAgx3O7-δwith 0≤x≤0.3 were produced by solid state reaction method. The Ag- doped YBCO samples showed higher critical current densities (Jc with a Jc maximum for samples doped with x=0.05. This behavior can be assigned to an increase of pinning forces. The irreversibility temperature (Tirr, also increased in doped samples as a function of Ag content, with the highest temperature for the sample doped with x=0.05, wich correlates well with the observed Jc increasing. However, samples doped with x>0.05 displayed a decreasing of electrical properties (less Tirr, less Jc, etc. atributed to an excess of Ag in the grain boundaries which, reduces the grain sizes and increases the number of weak- links.
Directory of Open Access Journals (Sweden)
S Mansoor
2014-01-01
Full Text Available Purpose: Our goal was to identify the cellular and molecular effects of 2-ethylpyridine (2-EP, a component of cigarette smoke on human retinal pigment epithelial cells (ARPE-19 in vitro. Materials and Methods: ARPE-19 cells were exposed to varying concentrations of 2-EP. Cell viability (CV was measured by a trypan blue dye exclusion assay. Caspase-3/7 and caspase-9 activities were measured by fluorochrome assays. The production of reactive oxygen/nitrogen species (ROS/RNS was detected with a 2′,7′-dichlorodihydrofluorescein diacetate dye assay. The JC-1 assay was used to measure mitochondrial membrane potential (ΔΨm. Mitochondrial redox potential was measured using a RedoxSensor Red kit and mitochondria were evaluated with Mitotracker dye. Results: After 2-EP exposure, ARPE-19 cells showed significantly decreased CV, increased caspase-3/7 and caspase-9 activities, elevated ROS/RNS levels, decreased ΔΨm value and decreased redox fluorescence when compared with control samples. Conclusions: These results show that 2-EP treatment induced cell death by caspase-dependent apoptosis associated with an oxidative stress and mitochondrial dysfunction. These data represent a possible mechanism by which smoking contributes to age-related macular degeneration and other retinal diseases and identify mitochondria as a target for future therapeutic interventions.
Strong pinning in very fast grown reactive co-evaporated GdBa2Cu3O7 coated conductors
Directory of Open Access Journals (Sweden)
J. L. MacManus-Driscoll
2014-08-01
Full Text Available We report on compositional tuning to create excellent field-performance of Jc in “self-doped,” GdBa2Cu3O7−y (GdBCO coated conductors grown by ultrafast reactive co-evaporation. In order to give excess liquid and Gd2O3, the overall compositions were all Ba-poor and Cu-rich compared to GdBCO. The precise composition was found to be critical to the current carrying performance. The most copper-rich composition had an optimum self-field Jc of 3.2 MA cm−2. A more Gd-rich composition had the best in-field performance because of the formation of low coherence, splayed Gd2O3 nanoparticles, giving Jc (77 K, 1 T of over 1 MA cm−2 and Jc (77 K, 5 T of over 0.1 MA cm−2.
Directory of Open Access Journals (Sweden)
1990-01-01
Full Text Available Sont présentés tout dabord les quatre types céramiques définis pour la séquence Pirwa de Piruru (1600/1500 - 800/600 av. J.C.. Puis, après quelques réflexions méthodologiques à propos de la détermination de groupes céramiques pertinents, particulièrement durant le Formatif Initial, Piruru Pirwa est replacé dans le contexte culturel de la cordillère centre-andine, des changements significatifs étant constatés entre les phases Pirwa II et III. Les analyses céramologiques montrent que trois types sont importés et que le quatrième résulte dune production locale. Les variations dans lorganisation globale de lhabitat Pirwa II et Pirwa III permettent de proposer lhypothèse que lactivité céramique, cest-à-dire la production de vaisselles, pourrait, dans lexemple de Piruru, dépendre de la sédentarité. Circulación, intercambio y producción de cerámica en los Andes Centrales durante el segundo milenio a. C. En primer lugar, se presentan los cuatro tipos cerámicos definidos para la secuencia Pirwa de Piruru (1600/1500 - 800/600 a.C.. Luego, después de unas reflexiones metodológicas acerca de la determinación de grupos cerámicos pertinentes, especialmente durante el período Formativo Inicial, se sitúa Piruru Pirwa en el contexto cultural de la sierra central, notando cambios significativos entre las fases Pirwa II y Pirwa III. Los análisis ceramológicos muestran que tres tipos son importados, y que el cuarto es resultado de una producción local. Tomando en cuenta las variaciones en la organización general del asentamiento Pirwa II y Pirwa III, se plantea la hipótesis que la actividad cerámica, es decir la producción alfarera, en Piruru, podría vincularse al sedentarismo. Circulation, exchange and production of wares in the Central Highlands of Peru during the secund millenium B.C. In this paper, four ceramic types are defined and described for the Piruru Pirwa sequence (1600/1500 - 800/600 a C, and
Yokosuka, Tomoko; Goto, Hiroaki; Fujii, Hisaki; Naruto, Takuya; Takeuchi, Masanobu; Tanoshima, Reo; Kato, Hiromi; Yanagimachi, Masakatsu; Kajiwara, Ryosuke; Yokota, Shumpei
2013-12-01
The purpose of the study is to establish a simple and relatively inexpensive flow cytometric chemosensitivity assay (FCCA) for leukemia to distinguish leukemic blasts from normal leukocytes in clinical samples. We first examined whether the FCCA with the mitochondrial membrane depolarization sensor, 5, 50, 6, 60-tetrachloro-1, 10, 3, 30 tetraethyl benzimidazolo carbocyanine iodide (JC-1), could detect drug-induced apoptosis as the conventional FCCA by annexin V/7-AAD detection did and whether it was applicable in the clinical samples. Second, we compared the results of the FCCA for prednisolone (PSL) with clinical PSL response in 18 acute lymphoblastic leukemia (ALL) patients to evaluate the reliability of the JC-1 FCCA. Finally, we performed the JC-1 FCCA for bortezomib (Bor) in 25 ALL or 11 acute myeloid leukemia (AML) samples as the example of the clinical application of the FCCA. In ALL cells, the results of the JC-1 FCCA for nine anticancer drugs were well correlated with those of the conventional FCCA using anti-annexin V antibody (P < 0.001). In the clinical samples from 18 children with ALL, the results of the JC-1 FCCA for PSL were significantly correlated with the clinical PSL response (P = 0.005). In ALL samples, the sensitivity for Bor was found to be significantly correlated with the sensitivity for PSL (P = 0.005). In AML samples, the Bor sensitivity was strongly correlated with the cytarabine sensitivity (P = 0.0003). This study showed the reliability of a relatively simple and the FCCA using JC-1, and the possibility for the further clinical application.
Correlation of irradiation-induced transition temperature increases from Cv and KJc/KIc data
International Nuclear Information System (INIS)
Hiser, A.L.
1990-03-01
Reactor pressure vessel (RPV) surveillance capsules contain Charpy-V (C v ) specimens, but many do not contain fracture toughness specimens; accordingly, the radiation-induced shift (increase) in the brittle-to-ductile transition region (ΔT) is based upon the ΔT determined from notch ductility (C v ) tests. Since the ASME K Ic and K IR reference fracture toughness curves are shifted by the ΔT from C v , assurance that this ΔT does not underestimate ΔT associated with the actual irradiated fracture toughness is required to provide confidence that safety margins do not fall below assumed levels. To assess this behavior, comparisons of ΔT's defined by elastic-plastic fracture toughness and C v tests have been made using data from RPV base and weld metals in which irradiations were made under test reactor conditions. Using ''as-measure'' fracture toughness values (K Jc ), average comparisons between ΔT(C v ) and ΔT(K Jc ) are: (a) All data: ΔT(K Jc at sign 100 MPa√ bar m) = ΔT(C v at sign 41 J) +10 degree C; (b) Plates only: ΔT(K Jc at sign 100 MPa√ bar m) = ΔT(C v at sign 41 J) +15 degree C; and (c) Welds only: ΔT(K Jc at sign 100 MPa√ bar m) = ΔT(C v at sign 41 J) -1 degree C. Fluence rate is found to have no significant effect on the relationship between ΔT(C v ) and ΔT(K Jc ). 12 refs., 12 figs., 5 tabs
A test of the submentalizing hypothesis: Apes' performance in a false belief task inanimate control
Krupenye, Christopher; Kano, Fumihiro; Hirata, Satoshi; Call, Josep; Tomasello, Michael
2017-01-01
Financial support came from Ministry of Education, Culture, Sports, Science and Technology (K-CONNEX to FK), Japan Society for Promotion of Science (KAKENHI 26885040, 16K21108 to FK), JSPS (KAKENHI 26245069, 24000001 to SH), and European Research Council (Synergy grant 609819 SOMICS to JC). Much debate concerns whether any nonhuman animals share with humans the ability to infer others' mental states, such as desires and beliefs. In a recent eye-tracking false-belief task, we showed that gr...
1986-09-01
Clements UL, Lanata C, Sears, S, Honda T, Young CR, Finkelstein RA. Evaluation in humans of attenuated Vibrio cholerae El Tor Ogawa Strain Texas Star...DE, Bareett TJ, YouW (CR, Levine WM, Blake PA. Impact of epidemic cholera in a previously uninfected island population: evaluation of a new...Sack, D.A., Wells, J.G., Feeley, J.C., Sack, R.B., Creech, W.M., Kapikian, A.Z., Gangarosa, E.J. 1976. Traveler’s flarrhea in Mexico . A Prospective
2012-01-01
mined by spectrophotometer. No protein contamination was found and nuclear DNA was less than 0.01% by quantitative PCR. Real-time PCR protocols...Dhainaut JF, Opal SM, et al. Recombinant human inter- leukin 1 receptor antagonist in the treatment of patients with sepsis syndrome. Results from a...anticoagulant activated protein C. J Exp Med, 204(10):2439-2448, 2007. 32. Levy MM, Fink MP, Marshall JC, Abraham E, Angus D, Cook D, Cohen J, Opal SM
Isolation and Characterization of Chick Epiphyseal Cartilage Matrix Vesicle Proteolipid
1988-01-01
phospholipid-phosphate complexes in diseased and normal human bone. Metab. Bone Dis. Rel. Res., 4: 151- 156. 64 Boskey AL, Timchak DM, Lane JM, Posner AS. 1980...from bovine fetal alveolar bone and dog osteosarcoma. Calcif. Tissue Int., 35: 791-797. Howell DS, Pita JC, and Alvarez J. 1976. Possible role of...at Grand Forks Air Force Base, North Dakota. In June of 1985 he entered the Post- Doctoral Periodontics program at Wilford Hall USAF Medical Center
Merkel cell carcinoma with fingolimod treatment for multiple sclerosis: A case report.
Mahajan, Kedar R; Ko, Jennifer S; Tetzlaff, Michael T; Hudgens, Courtney W; Billings, Steven D; Cohen, Jeffrey A
2017-10-01
Neoplasms and reactivation of latent viruses have been observed in individuals taking fingolimod. Merkel cell carcinoma (MCC), a rare neuroendocrine skin cancer, is associated with immunosuppression and can be triggered by the oncogenic Merkel cell polyoma virus (MCPyV). We report a case of a 61-year-old man with multiple sclerosis who developed MCPyV-positive MCC 4 years after starting fingolimod. This is the second report of MCC associated with MCPyV in an individual on fingolimod. Copyright © 2017 Elsevier B.V. All rights reserved.
An unusual case of diffuse Merkel cell carcinoma successfully treated with low dose radiotherapy.
Chatzinasiou, Foteini; Papadavid, Euaggelia; Korkolopoulou, Penelope; Levidou, Georgia; Panayiotides, Ioannis; Theodoropoulos, Konstadinos; Pogka, Vasiliki; Asimakopoulos, Charalampos; Rigopoulos, Dimitrios
2015-01-01
Merkel cell carcinoma (MCC) is a rare and highly aggressive neuroendocrine carcinoma of the skin. MCC should be included in the diagnosis of a rapidly growing infiltrating mass and histology as well as laboratory investigations such as Merkel cell polyoma virus (MCPyV) detection are valuable in its diagnosis. We present an unusual case of giant MCC-positive MCPyV in a Greek woman located on the lower leg. Our patient is very unusual in terms of her extensive MCC and her rapid and complete response to radiotherapy. © 2015 Wiley Periodicals, Inc.
Dependence of critical current density on crystalline direction in thin YBCO films
DEFF Research Database (Denmark)
Paturi, P.; Peurla, M.; Raittila, J.
2005-01-01
The dependence of critical current density (J(c)) on the angle between the current direction and the (100) direction in the ab-plane of thin YBCO films deposited on (001)-SrTiO3 from natiocrystalline and microcrystalline targets is studied using magneto-optical microscopy. In the films made from...... the nanocrystalline target it is found that J(c) does not depend on the angle whereas J(c) decreases with increasing angle in the films made from the microcrystalline target. The films were characterized by detailed X-ray diffraction measurements. The findings are explained in terms of a network of planar defects...
Genome-wide analysis of the WRKY gene family in physic nut (Jatropha curcas L.).
Xiong, Wangdan; Xu, Xueqin; Zhang, Lin; Wu, Pingzhi; Chen, Yaping; Li, Meiru; Jiang, Huawu; Wu, Guojiang
2013-07-25
The WRKY proteins, which contain highly conserved WRKYGQK amino acid sequences and zinc-finger-like motifs, constitute a large family of transcription factors in plants. They participate in diverse physiological and developmental processes. WRKY genes have been identified and characterized in a number of plant species. We identified a total of 58 WRKY genes (JcWRKY) in the genome of the physic nut (Jatropha curcas L.). On the basis of their conserved WRKY domain sequences, all of the JcWRKY proteins could be assigned to one of the previously defined groups, I-III. Phylogenetic analysis of JcWRKY genes with Arabidopsis and rice WRKY genes, and separately with castor bean WRKY genes, revealed no evidence of recent gene duplication in JcWRKY gene family. Analysis of transcript abundance of JcWRKY gene products were tested in different tissues under normal growth condition. In addition, 47 WRKY genes responded to at least one abiotic stress (drought, salinity, phosphate starvation and nitrogen starvation) in individual tissues (leaf, root and/or shoot cortex). Our study provides a useful reference data set as the basis for cloning and functional analysis of physic nut WRKY genes. Copyright © 2013 Elsevier B.V. All rights reserved.
International Nuclear Information System (INIS)
Xie, Yuchao; McGill, Mitchell R.; Du, Kuo; Dorko, Kenneth; Kumer, Sean C.; Schmitt, Timothy M.; Ding, Wen-Xing; Jaeschke, Hartmut
2015-01-01
3′-Hydroxyacetanilide or N-acetyl-meta-aminophenol (AMAP) is generally regarded as a non-hepatotoxic analog of acetaminophen (APAP). Previous studies demonstrated the absence of toxicity after AMAP in mice, hamsters, primary mouse hepatocytes and several cell lines. In contrast, experiments with liver slices suggested that it may be toxic to human hepatocytes; however, the mechanism of toxicity is unclear. To explore this, we treated primary human hepatocytes (PHH) with AMAP or APAP for up to 48 h and measured several parameters to assess metabolism and injury. Although less toxic than APAP, AMAP dose-dependently triggered cell death in PHH as indicated by alanine aminotransferase (ALT) release and propidium iodide (PI) staining. Similar to APAP, AMAP also significantly depleted glutathione (GSH) in PHH and caused mitochondrial damage as indicated by glutamate dehydrogenase (GDH) release and the JC-1 assay. However, unlike APAP, AMAP treatment did not cause relevant c-jun-N-terminal kinase (JNK) activation in the cytosol or phospho-JNK translocation to mitochondria. To compare, AMAP toxicity was assessed in primary mouse hepatocytes (PMH). No cytotoxicity was observed as indicated by the lack of lactate dehydrogenase release and no PI staining. Furthermore, there was no GSH depletion or mitochondrial dysfunction after AMAP treatment in PMH. Immunoblotting for arylated proteins suggested that AMAP treatment caused extensive mitochondrial protein adduct formation in PHH but not in PMH. In conclusion, AMAP is hepatotoxic in PHH and the mechanism involves the formation of mitochondrial protein adducts and mitochondrial dysfunction. - Highlights: • AMAP induces cell death in primary human hepatocytes (PHH). • AMAP does not cause cell death in primary mouse hepatocytes (PMH). • AMAP leads to mitochondria dysfunction in PHH but not PMH. • Protein adduct formation and dysfunction in mitochondria correlate with toxicity.
Energy Technology Data Exchange (ETDEWEB)
Xie, Yuchao; McGill, Mitchell R.; Du, Kuo; Dorko, Kenneth [Department of Pharmacology, Toxicology and Therapeutics, University of Kansas Medical Center, Kansas City, KS 66160 (United States); Kumer, Sean C.; Schmitt, Timothy M. [Department of Surgery, University of Kansas Medical Center, Kansas City, KS 66160 (United States); Ding, Wen-Xing [Department of Pharmacology, Toxicology and Therapeutics, University of Kansas Medical Center, Kansas City, KS 66160 (United States); Jaeschke, Hartmut, E-mail: hjaeschke@kumc.edu [Department of Pharmacology, Toxicology and Therapeutics, University of Kansas Medical Center, Kansas City, KS 66160 (United States)
2015-12-01
3′-Hydroxyacetanilide or N-acetyl-meta-aminophenol (AMAP) is generally regarded as a non-hepatotoxic analog of acetaminophen (APAP). Previous studies demonstrated the absence of toxicity after AMAP in mice, hamsters, primary mouse hepatocytes and several cell lines. In contrast, experiments with liver slices suggested that it may be toxic to human hepatocytes; however, the mechanism of toxicity is unclear. To explore this, we treated primary human hepatocytes (PHH) with AMAP or APAP for up to 48 h and measured several parameters to assess metabolism and injury. Although less toxic than APAP, AMAP dose-dependently triggered cell death in PHH as indicated by alanine aminotransferase (ALT) release and propidium iodide (PI) staining. Similar to APAP, AMAP also significantly depleted glutathione (GSH) in PHH and caused mitochondrial damage as indicated by glutamate dehydrogenase (GDH) release and the JC-1 assay. However, unlike APAP, AMAP treatment did not cause relevant c-jun-N-terminal kinase (JNK) activation in the cytosol or phospho-JNK translocation to mitochondria. To compare, AMAP toxicity was assessed in primary mouse hepatocytes (PMH). No cytotoxicity was observed as indicated by the lack of lactate dehydrogenase release and no PI staining. Furthermore, there was no GSH depletion or mitochondrial dysfunction after AMAP treatment in PMH. Immunoblotting for arylated proteins suggested that AMAP treatment caused extensive mitochondrial protein adduct formation in PHH but not in PMH. In conclusion, AMAP is hepatotoxic in PHH and the mechanism involves the formation of mitochondrial protein adducts and mitochondrial dysfunction. - Highlights: • AMAP induces cell death in primary human hepatocytes (PHH). • AMAP does not cause cell death in primary mouse hepatocytes (PMH). • AMAP leads to mitochondria dysfunction in PHH but not PMH. • Protein adduct formation and dysfunction in mitochondria correlate with toxicity.
Muscle Activity during Unilateral Vs. Bilateral Battle Rope Exercises
DEFF Research Database (Denmark)
Calatayud, J.; Martin, F.; Colado, J. C.
2015-01-01
Calatayud, J, Martin, F, Colado, JC, Benitez, JC, Jakobsen, MD, and Andersen, LL. Muscle activity during unilateral vs. bilateral battle rope exercises. J Strength Cond Res 29(10): 2854-2859, 2015High training intensity is important for efficient strength gains. Although battle rope training is m...
Pseudo-invariant Eigen-Operator Method for Solving Field-Intensity-Dependent Jaynes-Cummings Model
International Nuclear Information System (INIS)
Yu Taxi; Fan Hongyi
2010-01-01
By using the pseudo invariant eigen-operator method we analyze the field-intensity-dependent Jaynes-Gumming (JC) model. The pseudo-invariant eigen-operator is found in terms of the supersymmetric generators. The energy-level gap of this JC Hamiltonian is derived. This approach seems concise. (general)
Czech Academy of Sciences Publication Activity Database
Nová, Jana; Mžourková, Hana
2017-01-01
Roč. 68, č. 2 (2017), s. 296-304 ISSN 0021-5597 Institutional support: RVO:68378092 Keywords : terminology * terms * lexicography * monolingual dictionary * e- dictionary * domain labels * Czech Subject RIV: AI - Linguistics OBOR OECD: Linguistics http://www.juls.savba.sk/ediela/jc/2017/2/jc17-02.pdf
Fabrication of laminated Bi-2212/Ag multifilamentary tape
Yuan, D.-W.; Majer, W. J.; Francavilla, T. L.
2000-03-01
The powder-in-tube (PIT) process has been successfully used to make long lengths of Ag-sheathed oxide superconductors. A modified PIT approach is proposed to fabricate conductors with laminated Bi-2212 configurations. Ag/Bi-2212 tapes consisting of seven laminae were produced with various thicknesses ranging from 0.38 to 0.25 mm. The use of a turkshead was found to be beneficial, yielding tapes with good dimensional integrity and consistency. Critical current density (Jc ) values greater than 105 A cm-2 (0.01 T and Bicons/Journals/Common/perp" ALT="perp" ALIGN="TOP"/> tape surface) have been attained for tapes of different thicknesses. Nonetheless, Jc was found to be related to the average thickness of individual Bi-2212 lamina. It is believed that excessive cold working accounts for the decrease in Jc with decreasing size below a threshold value. The enhancement of Jc is attributed to the high Bi-2212 grain alignment along the Ag-oxide interfaces and uniform dimensions within the laminate conductors.
maximum conversion efficiency of thermionic heat to electricity
African Journals Online (AJOL)
DJFLEX
Dushman constant ... Several attempts on the direct conversion of heat to electricity ... The net current density in the system is equal to jE – jC , which gets over the potential barrier. jE and jC are given by the Richardson-. Dushman equation as. │. ⌋.
International Nuclear Information System (INIS)
Peng, Junming; Liu, Yongchang; Ma, Zongqing; Shahriar Al Hossain, M.; Xin, Ying; Jin, Jianxun
2016-01-01
Highlights: • Usage of carbon-coated boron leads to high level of homogeneous carbon doping. • Cu addition improves MgB_2 grain connectivity, leading to higher J_c at low fields. • Cu addition reduces MgO impurity, also contributing to the improvement of J_c. - Abstract: High performance Cu doped MgB_2 bulks were prepared by an in-situ method with carbon-coated amorphous boron as precursor. It was found that the usage of carbon-coated boron in present work leads to the formation of uniformly refined MgB_2 grains, as well as a high level of homogeneous carbon doping in the MgB_2 samples, which significantly enhance the J_c in both Cu doped and undoped bulks compared to MgB_2 bulks with normal amorphous boron precursor. Moreover, minor Cu can service as activator, and thus facilitates the growth of MgB_2 grains and improves crystallinity and grain connectivity, which can bring about the excellent critical current density (J_c) at self fields and low fields (the best values are 7 × 10"5 A/cm"2 at self fields, and 1 × 10"5 A/cm"2 at 2 T, 20 K, respectively). Simultaneously, minor Cu addition can reduce the amount of MgO impurity significantly, also contributing to the improvement of J_c at low fields. Our work suggests that Cu-activated sintering combined with employment of carbon-coated amorphous boron as precursor could be a promising technique to produce practical MgB_2 bulks or wires with excellent J_c on an industrial scale.
International Nuclear Information System (INIS)
Kumakura, Hiroaki; Ye, Shujun; Matsumoto, Akiyoshi; Nitta, Ryuji
2016-01-01
We fabricated in situ powder-in-tube(PIT) MgB_2 wires using three kinds of Mg powders with particle size of ∼45 μm, ∼150 μm and 212∼600 μm. Mg particles were elongated to filamentary structure in the wires during cold drawing process. Especially, long Mg filamentary structure was obtained for large Mg particle size of 212∼600 μm. Critical current density, J_c, increased with increasing Mg particle size for 1 mm diameter wires. This is due to the development of filamentary structure of high density MgB_2 superconducting layer along the wires. This MgB_2 structure is similar to that of the internal Mg diffusion (IMD) processed MgB_2 wires. However, J_c of the wires fabricated with 212∼600 μm Mg particle size decreased and the scattering of J_c increased with decreasing wire diameter, while the J_c of the wires with ∼45 μm Mg particle was almost independent of the wire diameter. The cross sectional area reduction of the Mg particles during the wire drawing is smaller than that of the wire. When using large size Mg particle, the number of Mg filaments in the wire cross section is small. These two facts statistically lead to the larger scattering of Mg areal fraction in the wire cross section with proceeding of wire drawing process, resulting in smaller volume fraction of MgB_2 in the wire and lower J_c with larger scattering along the wire. SiC nano powder addition is effective in increasing J_c for all Mg particle sizes. (author)
Boehler, T; Schaeff, B; Hornberg, I; Waibel, B; Mohrmann, M
2009-01-01
By the end of the year 2007, pediatric hospitals in Baden-Württemberg had assigned themselves to one of three levels of perinatal care according to a checklist of the German Federal Joint Committee (F-JC) effective since January 1st, 2006. The Medical Service of Statutory Health Insurance had been assigned to prove the plausibility of that self-assessment according to quality criteria for clinical care of term and preterm newborn infants concordated by the F-JC. Between November 2007 and October 2008 31 providers were audited. Observations were documented in a checklist, reviewed and evaluated by expert auditors. For that purpose, quality criteria given by the F-JC were grouped into 7 quality categories which were weighted according to their practical relevance. In addition, a graded numeric system of evaluation was used for comparative analysis (absolute and relative benchmarking values). 3 of 23 providers fulfilled the quality criteria of the F-JC for PNC level 1 (highest level of care), 6 of 23 fulfilled them in part, and 14 of 23 did not fulfill them as judged by the auditors. Criteria for PNC level 2 were "fulfilled in part" by 2 of 6 providers and "not fulfilled" by 4. Both providers of perinatal special care ("level 3") fulfilled the quality criteria for "level 3" completely. There was no linear correlation between absolute or relative benchmarking values and assessment by expert auditors. If the criteria of the F-JC were interpreted very strictly, it would be difficult to guarantee comprehensive regional delivery of care in the state of Baden-Württemberg at the level formally requested by the F-JC for PNCs.
1990-01-01
R, Paryanonda A. Human immunoglobulin M anti- virus de lots de moustiques adultes males et femelles. Med body in the serodiagnosis of Japanese...Immun 274. Roche JC, Cordellier R, Hervy JP, et al. Isolement de 96 1984;43:429-43 1. souches de virus dengue 2 a partir de moustiques captures en...dengue chez les moustiques . C R Acad Sci Paris persisting virus. Acta Virol (Praha) 1981 ;25:352-360. 1987;304:347-350. 257. Pool WA, Brownlee A, Wilson
Molecular Cloning and Function of FAS/APO1 Associated Protein in Breast Cancer.
1996-06-01
Ariyama T, Abe T, Druck T, Ohta M, Huebner K, Yanagisawa J, Reed JC, Sato T: PTPN13, a Fas-associated protein tyrosine phosphatase, is located on...20. Yang, Q., and Tonks, N. K. (1991). Isolation of a cDNA clone encoding a human protein-tyrosine phosphatase with homology 7. Huebner, K., Druck , T...Acad. Sci. U.S.A. 91, 7477 (1994). Res. 53, 1945 (1993).(Fig. 3D ). In contrast to Jurkat cells which 13. The original description of PTP-BAS (12
Micro Computer Feedback Report for the Strategic Leader Development Inventory
1993-05-01
POS or NEG variables CALL CREATE MEM DIR ;make a memory directory JC SELS ;exat I error CALL SELECT-SCREEN ;dlsplay select screen JC SEL4 ;no flles in...get keyboaI Input CMP AL,1Bh3 ;ls I an Esc key ? JNZ SEL2 ;X not goto nrod test G-95 JMP SEL4 ;Exit SEL2: CMP AL,OOh Iskapick? JZ SEL ;I YES exit loop...position CALL READ DATE ;gat DOS daoe od 4e CALL F4ND -ERO ;kxlae OW In data ue JC SEL.5 SEL4 : CALL RELEASE MEM DIR ;release meu block CLC ;cler carry fag
Modeling flux pinning in thin undoped and BazRo3-doped YBCO films
DEFF Research Database (Denmark)
Paturi, P.; Irjala, M.; Huhtinen, H.
2009-01-01
A simple model based on distributions of twin boundaries, dislocations, and BaZrO3 nanorods is presented to describe the Jc properties of undoped and BaZrO3 (BZO)-doped YBa2Cu3Ox thin films. The model accurately describes the shape of Jc(B,T) curves of the films, when the pinning site distributions...... are taken from distributions of twin spacings and BZO nanorods from transmission electron microscope images. Thus, assuming that the model can be used for prediction of the Jc properties, we conclude that for enhancement of undoped films more crystalline defects are needed and for doped films a dopant...
Decomposing the Bragg glass and the peak effect in a Type-II superconductor
DEFF Research Database (Denmark)
Toft-Petersen, Rasmus; Abrahamsen, Asger Bech; Balog, Sandor
2018-01-01
. In Type-II superconductors, disorder generally works to pin vortices, giving zero resistivity below a critical current j(c). However, peaks have been observed in the temperature and field dependences of j(c). This peak effect is difficult to explain in terms of an ordered Abrikosov vortex lattice. Here we...
Microstructure, texture and critical current of Ag-sheathed 2223 multifilament tapes
DEFF Research Database (Denmark)
Liu, Y.L.; Wang, W.G.; Poulsen, H.F.
1999-01-01
unchanged but J(c) decreased with increasing temperature. The drop in J(c) was related to the presence of an amorphous phase and a small amount of 2201 phase, indicating that the grain connectivity has become the major current-limiting factor. The variations in the filament shape, density and alignment...
Shen, Tengming; Li, Pei; Ye, Liyang
2018-01-01
A robust and reliable heat treatment is crucial for developing superconducting magnets from several superconductors especially Bi-2212. An improper heat treatment may significantly reduce the critical current density Jc of a Bi-2212 superconducting coil, even to zero, since the Jc of Bi-2212 wires is sensitive to parameters of its heat treatment (partial melt processing). To provide an essential database for heat treating Bi-2212 coils, the dependence of Jc on heat treatment is studied systematically in 11 industrial Bi-2212 wires, revealing several common traits shared between these wires and outlier behaviors. The dependence of the Jc of Bi-2212 on heat treatment is rather complex, with many processing parameters affecting Jc, including the peak processing temperature Tp, the time at the peak temperature tp, the time in the melt tmelt, the rate at which Bi-2212 melt is initially cooled CR1, the rate at which the solidification of Bi-2212 melt occurs CR2, and the temperature Tq at which the cooling rate switches from CR1 to CR2. The role of these parameters is analyzed and clarified, in the perspective of heat treating a coil. Practical advices on heat treatment design are given. The ability of a Bi-2212 coil to follow the prescribed recipe decreases with increasing coil sizes. The size of a coil that can be properly heat treated is determined.
The prosurvival role of autophagy in Resveratrol-induced cytotoxicity in human U251 glioma cells
International Nuclear Information System (INIS)
Li, Jun; Qin, Zhenghong; Liang, Zhongqin
2009-01-01
Previous study reported that resveratrol has anti-tumor activity. In this study, we investigated the involvement of autophagy in the resveratrol-induced apoptotic death of human U251 glioma cells. The growth inhibition of U251 cells induced by resveratrol was assessed with methyl thiazolyl tetrazolium (MTT). The activation of autophagy and proapoptotic effect were characterized by monodansylcadaverine labeling and Hoechst stain, respectively. Mitochondrialtransmembrane potential (ΔΨm) was measured as a function of drug treatment using 5,5',6,6'-tetrachloro-1,1',3,3'-tetraethylbenzimidazolylcarbocyanine iodide (JC-1). The role of autophagy and apoptosis in the resveratrol-induced death of U251 cells was assessed using autophagic and caspase inhibitors. Immunofluorescence, flow cytometry, and Western blot analysis were used to study the apoptotic and autophagic mechanisms. Methyl thiazolyl tetrazolium (MTT) assays indicated that resveratrol decreased the viability of U251 cells in a dose- and time-dependent manner. Flow cytometry analysis indicated that resveratrol increased cell population at sub-G1 phase, an index of apoptosis. Furthermore, resveratrol-induced cell death was associated with a collapse of the mitochondrial membrane potential. The pan-caspase inhibitor Z-VAD-fmk suppressed resveratrol-induced U251 cell death. Resveratrol stimulated autophagy was evidenced by punctuate monodansylcadaverine(MDC) staining and microtubule-associated protein light chain 3 (LC3) immunoreactivty. Resveratrol also increased protein levels of beclin 1 and membrane form LC3 (LC3-II). Autophagy inhibitors 3-methylademine (3-MA) and bafilomycin A1 sensitized the cytotoxicity of resveratrol. Together, these findings indicate that resveratrol induces autophagy in human U251 glioma cells and autophagy suppressed resveratrol-induced apoptosis. This study thus suggests that autophagy inhibitors can increase the cytotoxicity of resveratrol to glioma cells
Marker-assisted introgression of opaque2 allele for rapid conversion ...
Indian Academy of Sciences (India)
Running title: ... develop diverse QPM varieties across different maturity groups and ..... (c) Morphological characteristics of MAS-derived inbreds: .... Kaul J., Dass S., Sekhar J.C. and Bhardwaj J.C. 2009 Maize hybrid and .... Figure captions: ..... blade; CL: cob length; CG: cob girth; NR: No. of rows; NKR: No. of kernel per row; ...
The Aged Microenvironment Influences Prostate Carcinogenesis
2008-12-01
Phenotypes Reveal Cell-Nonautonomous Functions of Oncogenic RAS and the p53 Tumor Suppressor. PLoS Biol 2008, 6:e301 31. Jeyapalan JC, Ferreira M...Sedivy JM, Herbig U: Accumulation of senescent cells in mitotic tissue of aging primates. Mech Ageing Dev 2007, 128:36-44 32. Jeyapalan JC, Sedivy JM
The Molecular Epidemiology of Malaria in Western Kenya
2002-09-01
transcriptional activation. Proc Natl Acad Sci USA 1997 94(7): 3195-9. 27. Uglialoro AM, Turbay D, Pesavento PA, Delgado JC, McKenzie FE, Gribben JG, Hartl D...Uglialoro AM, Turbay D, Pesavento PA, Delgado JC, McKenzie FE, Gribben JG, Hartl D, Yunis EJ, Goldfeld AE. Identification of three new single nucleotide
Liu, Wai-Nam; Leung, Kwok-Nam
2014-11-01
Conjugated linolenic acids (CLNAs) are a group of naturally occurring positional and geometrical isomers of the C18 polyunsaturated essential fatty acid, linolenic acid (LNA), with three conjugated double bonds (C18:3). Although previous research has demonstrated the growth-inhibitory effects of CLNA on a wide variety of cancer cell lines in vitro, their action mechanisms and therapeutic potential on human myeloid leukemia cells remain poorly understood. In the present study, we found that jacaric acid (8Z,10E,12Z-octadecatrienoic acid), a CLNA isomer which is present in jacaranda seed oil, inhibited the in vitro growth of human eosinophilic leukemia EoL-1 cells in a time- and concentration-dependent manner. Mechanistic studies showed that jacaric acid triggered cell cycle arrest of EoL-1 cells at the G0/G1 phase and induced apoptosis of the EoL-1 cells, as measured by the Cell Death Detection ELISAPLUS kit, Annexin V assay and JC-1 dye staining. Notably, the jacaric acid-treated EoL-1 cells also underwent differentiation as revealed by morphological and phenotypic analysis. Collectively, our results demonstrated the capability of jacaric acid to inhibit the growth of EoL-1 cells in vitro through triggering cell cycle arrest and by inducing apoptosis and differentiation of the leukemia cells. Therefore, jacaric acid might be developed as a potential candidate for the treatment of certain forms of myeloid leukemia with minimal toxicity and few side effects.
International Nuclear Information System (INIS)
Sokolov, M.A.; Wallin, K.; McCabe, D.E.
1996-01-01
In this study, precracked Charpy V-notch (PCVN) specimens were used to characterize the fracture toughness of unirradiated and irradiated reactor pressure vessel steels in the transition region by means of three-point static bending. Fracture toughness at cleavage instability was calculated in terms of elastic-plastic K Jc values. A statistical size correction based upon weakest-link theory was performed. The concept of a master curve was applied to analyze fracture toughness properties. Initially, size-corrected PCVN data from A 533 grade B steel, designated HSST Plate O2, were used to position the master curve and a 5% tolerance bound for K Jc data. By converting PCVN data to IT compact specimen equivalent K Jc data, the same master curve and 5% tolerance bound curve were plotted against the Electric Power Research Institute valid linear-elastic K Jc database and the ASME lower bound K Ic curve. Comparison shows that the master curve positioned by testing several PCVN specimens describes very well the massive fracture toughness database of large specimens. These results give strong support to the validity of K Jc with respect to K Ic in general and to the applicability of PCVN specimens to measure fracture toughness of reactor vessel steels in particular. Finally, irradiated PCVN specimens of other materials were tested, and the results are compared to compact specimen data. The current results show that PCVNs demonstrate very good capacity for fracture toughness characterization of reactor pressure vessel steels. It provides an opportunity for direct measurement of fracture toughness of irradiated materials by means of precracking and testing Charpy specimens from surveillance capsules. However, size limits based on constraint theory restrict the operational test temperature range for K Jc data from PCVN specimens. 13 refs., 8 figs., 1 tab
Burkholderia megalochromosomata sp. nov., isolated from grassland soil.
Baek, Inwoo; Seo, Boram; Lee, Imchang; Lee, Kihyun; Park, Sang-Cheol; Yi, Hana; Chun, Jongsik
2015-03-01
A Gram-stain negative, rod-shaped, non-spore-forming, obligate aerobic bacterial strain, JC2949(T), was isolated from grassland soil in Gwanak Mountain, Seoul, Republic of Korea. Phylogenetic analysis, based on 16S rRNA sequences, indicated that strain JC2949(T) belongs to the genus Burkholderia, showing highest sequence similarities with Burkholderia grimmiae R27(T) (98.8 %), Burkholderia cordobensis LMG 27620(T) (98.6 %), Burkholderia jiangsuensis MP-1T(T) (98.6 %), Burkholderia zhejiangensis OP-1(T) (98.5 %), Burkholderia humi LMG 22934(T) (97.5 %), Burkholderia terrestris LMG 22937(T) (97.3 %), Burkholderia telluris LMG 22936(T) (97.2 %) and Burkholderia glathei ATCC 29195(T) (97.0 %). The major fatty acids of strain JC2949(T) were C18 : 1ω7c, summed feature 3 (C16 : 1ω7c and/or C16 : 1ω6c) and C16 : 0. Its predominant polar lipids were phosphatidylethanolamine, diphosphatidylglycerol, phosphatidylglycerol and an unknown amino phospholipid. The dominant isoprenoid quinone was ubiquinone Q-8. The pairwise average nucleotide identity values between strain JC2949(T) and the genomes of 30 other species of the genus Burkholderia ranged from 73.4-90.4 %, indicating that the isolate is a novel genomic species within this genus. Based on phenotypic and chemotaxonomic comparisons, it is clear that strain JC2949(T) represents a novel species of the genus Burkholderia. We propose the name for this novel species to be Burkholderia megalochromosomata sp. nov. The type strain is JC2949(T) ( = KACC 17925(T) = JCM 19905(T)). © 2015 IUMS.
What does že jo (and že ne) mean in spoken dialogue
Czech Academy of Sciences Publication Activity Database
Komrsková, Zuzana
2017-01-01
Roč. 68, č. 2 (2017), s. 229-237 ISSN 0021-5597 R&D Projects: GA ČR GA15-01116S Institutional support: RVO:68378092 Keywords : spoken languge * spoken corpus * tag question * responze word Subject RIV: AI - Linguistics OBOR OECD: Linguistics http://www.juls.savba.sk/ediela/jc/2017/2/jc17-02.pdf
Ionic and electronic conductivity in lead-zirconate-titanate (PZT)
Boukamp, Bernard A.; Pham thi ngoc mai, P.T.N.M.; Blank, David H.A.; Bouwmeester, Henricus J.M.
2004-01-01
Accurate impedance measurements on differently sized samples of lead–zirconate–titanate (PbZr0.53Ti0.47O3, PZT) have been analyzed with a CNLS procedure, resulting in the separation of the ionic and electronic conductivities over a temperature range from f150 to 630 jC. At 603 jC the electronic
Manipulation of Auxin Response Factor 19 affects seed size in the woody perennial Jatropha curcas
Sun, Yanwei; Wang, Chunming; Wang, Ning; Jiang, Xiyuan; Mao, Huizhu; Zhu, Changxiang; Wen, Fujiang; Wang, Xianghua; Lu, Zhijun; Yue, Genhua; Xu, Zengfu; Ye, Jian
2017-01-01
Seed size is a major determinant of seed yield but few is known about the genetics controlling of seed size in plants. Phytohormones cytokinin and brassinosteroid were known to be involved in the regulation of herbaceous plant seed development. Here we identified a homolog of Auxin Response Factor 19 (JcARF19) from a woody plant Jatropha curcas and genetically demonstrated its functions in controlling seed size and seed yield. Through Virus Induced Gene Silencing (VIGS), we found that JcARF19 was a positive upstream modulator in auxin signaling and may control plant organ size in J. curcas. Importantly, transgenic overexpression of JcARF19 significantly increased seed size and seed yield in plants Arabidopsis thaliana and J. curcas, indicating the importance of auxin pathway in seed yield controlling in dicot plants. Transcripts analysis indicated that ectopic expression of JcARF19 in J. curcas upregulated auxin responsive genes encoding essential regulators in cell differentiation and cytoskeletal dynamics of seed development. Our data suggested the potential of improving seed traits by precisely engineering auxin signaling in woody perennial plants. PMID:28102350
Flux pinning and inhomogeneity in magnetic nanoparticle doped MgB2/Fe wires
Novosel, Nikolina; Pajić, Damir; Mustapić, Mislav; Babić, Emil; Shcherbakov, Andrey; Horvat, Joseph; Skoko, Željko; Zadro, Krešo
2010-06-01
The effects of magnetic nanoparticle doping on superconductivity of MgB2/Fe wires have been investigated. Fe2B and SiO2-coated Fe2B particles with average diameters 80 and 150 nm, respectively, were used as dopands. MgB2 wires with different nanoparticle contents (0, 3, 7.5, 12 wt.%) were sintered at temperature 750°C. The magnetoresistivity and critical current density Jc of wires were measured in the temperature range 2-40 K in magnetic field B doped wires decreases quite rapidly with doping level (~ 0.5 K per wt.%). This results in the reduction of the irreversibility fields Birr(T) and critical current densities Jc(B,T) in doped samples (both at low (5 K) and high temperatures (20 K)). Common scaling of Jc(B,T) curves for doped and undoped wires indicates that the main mechanism of flux pinning is the same in both types of samples. Rather curved Kramer's plots for Jc of doped wires imply considerable inhomogeneity.
YBa_2Cu_3O_{7-δ} : in pursuit of the ideal microstructure
Smith, D. S.; Suasmoro, S.; Lejeune, M.; Rabier, J.; Denanot, M. F.; Heintz, J. M.; Magro, C.; Bonnet, J. P.
1992-02-01
This paper examines the role of different factors in the microstructure of ceramic YBa2Cu3O{7-δ} with emphasis on its electrical response. In particular we discuss : 1. the effect of microstructural variations on j_c and ρ_{300}, 2. measurement of j_c, 3. the presence of minor phases and carbonates, 4. oxygen uptake and microcracks, 5. plastic deformation and related structural defects. Dans cet article, nous examinons d'une part la réponse électrique de céramiques supraconductrices massives de type YBa2Cu3O{7-δ} et d'autre part sa relation avec la microstructure. Nous présenterons successivement : 1. L'incidence de modifications microstructurales sur les valeurs de j_c et ρ_{300}, 2. les mesures expérimentales de j_c, 3. la présence de phases minoritaires et de carbonates, 4. la reprise d'oxygène et la microfissuration, 5. la déformation plastique et les défauts structuraux associés.
Enhancement of the critical current density in FeO-coated MgB2 thin films at high magnetic fields
Directory of Open Access Journals (Sweden)
Andrei E. Surdu
2011-12-01
Full Text Available The effect of depositing FeO nanoparticles with a diameter of 10 nm onto the surface of MgB2 thin films on the critical current density was studied in comparison with the case of uncoated MgB2 thin films. We calculated the superconducting critical current densities (Jc from the magnetization hysteresis (M–H curves for both sets of samples and found that the Jc value of FeO-coated films is higher at all fields and temperatures than the Jc value for uncoated films, and that it decreases to ~105 A/cm2 at B = 1 T and T = 20 K and remains approximately constant at higher fields up to 7 T.
Reactivation of BK polyomavirus in patients with multiple sclerosis receiving natalizumab therapy.
LENUS (Irish Health Repository)
Lonergan, Roisin M
2012-02-01
Natalizumab therapy in multiple sclerosis has been associated with JC polyomavirus-induced progressive multifocal leucoencephalopathy. We hypothesized that natalizumab may also lead to reactivation of BK, a related human polyomavirus capable of causing morbidity in immunosuppressed groups. Patients with relapsing remitting multiple sclerosis treated with natalizumab were prospectively monitored for reactivation of BK virus in blood and urine samples, and for evidence of associated renal dysfunction. In this cohort, JC and BK DNA in blood and urine; cytomegalovirus (CMV) DNA in blood and urine; CD4 and CD8 T-lymphocyte counts and ratios in peripheral blood; and renal function were monitored at regular intervals. BK subtyping and noncoding control region sequencing was performed on samples demonstrating reactivation. Prior to commencement of natalizumab therapy, 3 of 36 patients with multiple sclerosis (8.3%) had BK viruria and BK reactivation occurred in 12 of 54 patients (22.2%). BK viruria was transient in 7, continuous in 2 patients, and persistent viruria was associated with transient viremia. Concomitant JC and CMV viral loads were undetectable. CD4:CD8 ratios fluctuated, but absolute CD4 counts did not fall below normal limits. In four of seven patients with BK virus reactivation, transient reductions in CD4 counts were observed at onset of BK viruria: these resolved in three of four patients on resuppression of BK replication. No renal dysfunction was observed in the cohort. BK virus reactivation can occur during natalizumab therapy; however, the significance in the absence of renal dysfunction is unclear. We propose regular monitoring for BK reactivation or at least for evidence of renal dysfunction in patients receiving natalizumab.
Molecular cloning and functional analysis of the gene encoding ...
African Journals Online (AJOL)
Here we report for the first time the cloning of a full-length cDNA encoding GGPPS (Jc-GGPPS) from Jatropha curcas L. The full-length cDNA was 1414 base pair (bp), with an 1110-bp open reading frame (ORF) encoding a 370- amino-acids polypeptide. Bioinformatic analysis revealed that Jc-GGPPS is a member of the ...
BIOSPACE/DYABOLIC October 2010 Field Program, Monterey Bay, California Data Report
2011-07-20
AU Fluorometer. After first reading samples were acidified with three drops of 5% HCl (to destroy the Chlorophyll) allowing the measurement of...DBCBLFOEB CJ BB BND-)#DBE CME JC 57$%2$0=$2B EKGE JKLMCJN DBCBLMKBN CN JJ 57$%2$0=$2C ENJE JKLMBO DBCBLMKMM JE F JO 57$%2$0=$2J EFBN JKLMEKK DBCBLMKMF JC
Observations on the Role of Hydrogen in Facet Formation in Near-alpha Titanium (Preprint)
2011-05-01
AGARD - CP -185, p. 4-1 – 4-14, London: Technical Editing and Reproduction Ltd., (1976). [23] J.C. Chesnutt, A.W. Thompson and J.C. Williams: Influence... 73 ] W. Shen, W.O. Soboyejo, and A.B.O. Soboyejo: Mechanics of Materials, 36(1-2), 2004, pp. 117-140. [74] A.A. Shaniavski and A.I. Losev
Directory of Open Access Journals (Sweden)
Lizarondo Lucylynn M
2012-10-01
Full Text Available Abstract Background Although allied health is considered to be one 'unit' of healthcare providers, it comprises a range of disciplines which have different training and ways of thinking, and different tasks and methods of patient care. Very few empirical studies on evidence-based practice (EBP have directly compared allied health professionals. The objective of this study was to examine the impact of a structured model of journal club (JC, known as iCAHE (International Centre for Allied Health Evidence JC, on the EBP knowledge, skills and behaviour of the different allied health disciplines. Methods A pilot, pre-post study design using maximum variation sampling was undertaken. Recruitment was conducted in groups and practitioners such as physiotherapists, occupational therapists, speech pathologists, social workers, psychologists, nutritionists/dieticians and podiatrists were invited to participate. All participating groups received the iCAHE JC for six months. Quantitative data using the Adapted Fresno Test (McCluskey & Bishop and Evidence-based Practice Questionnaire (Upton & Upton were collected prior to the implementation of the JC, with follow-up measurements six months later. Mean percentage change and confidence intervals were calculated to compare baseline and post JC scores for all outcome measures. Results The results of this study demonstrate variability in EBP outcomes across disciplines after receiving the iCAHE JC. Only physiotherapists showed statistically significant improvements in all outcomes; speech pathologists and occupational therapists demonstrated a statistically significant increase in knowledge but not for attitude and evidence uptake; social workers and dieticians/nutritionists showed statistically significant positive changes in their knowledge, and evidence uptake but not for attitude. Conclusions There is evidence to suggest that a JC such as the iCAHE model is an effective method for improving the EBP knowledge
Energy Technology Data Exchange (ETDEWEB)
Sirenko, Oksana, E-mail: oksana.sirenko@moldev.com [Molecular Devices, LLC, Sunnyvale, CA (United States); Grimm, Fabian A. [Department of Veterinary Integrative Biosciences, Texas A& M University, College Station, TX (United States); Ryan, Kristen R. [Division of the National Toxicology Program, National Institute of Environmental Health Sciences, Research Triangle Park, NC (United States); Iwata, Yasuhiro; Chiu, Weihsueh A. [Department of Veterinary Integrative Biosciences, Texas A& M University, College Station, TX (United States); Parham, Frederick [Division of the National Toxicology Program, National Institute of Environmental Health Sciences, Research Triangle Park, NC (United States); Wignall, Jessica A. [ICF, Fairfax, VA (United States); Anson, Blake [Cellular Dynamics International, Madison, WI (United States); Cromwell, Evan F. [Protein Fluidics, Inc., Burlingame, CA (United States); Behl, Mamta [Division of the National Toxicology Program, National Institute of Environmental Health Sciences, Research Triangle Park, NC (United States); Rusyn, Ivan [Department of Veterinary Integrative Biosciences, Texas A& M University, College Station, TX (United States); Tice, Raymond R. [Division of the National Toxicology Program, National Institute of Environmental Health Sciences, Research Triangle Park, NC (United States)
2017-05-01
An important target area for addressing data gaps through in vitro screening is the detection of potential cardiotoxicants. Despite the fact that current conservative estimates relate at least 23% of all cardiovascular disease cases to environmental exposures, the identities of the causative agents remain largely uncharacterized. Here, we evaluate the feasibility of a combinatorial in vitro/in silico screening approach for functional and mechanistic cardiotoxicity profiling of environmental hazards using a library of 69 representative environmental chemicals and drugs. Human induced pluripotent stem cell-derived cardiomyocytes were exposed in concentration-response for 30 min or 24 h and effects on cardiomyocyte beating and cellular and mitochondrial toxicity were assessed by kinetic measurements of intracellular Ca{sup 2+} flux and high-content imaging using the nuclear dye Hoechst 33342, the cell viability marker Calcein AM, and the mitochondrial depolarization probe JC-10. More than half of the tested chemicals exhibited effects on cardiomyocyte beating after 30 min of exposure. In contrast, after 24 h, effects on cell beating without concomitant cytotoxicity were observed in about one third of the compounds. Concentration-response data for in vitro bioactivity phenotypes visualized using the Toxicological Prioritization Index (ToxPi) showed chemical class-specific clustering of environmental chemicals, including pesticides, flame retardants, and polycyclic aromatic hydrocarbons. For environmental chemicals with human exposure predictions, the activity-to-exposure ratios between modeled blood concentrations and in vitro bioactivity were between one and five orders of magnitude. These findings not only demonstrate that some ubiquitous environmental pollutants might have the potential at high exposure levels to alter cardiomyocyte function, but also indicate similarities in the mechanism of these effects both within and among chemicals and classes. - Highlights:
International Nuclear Information System (INIS)
Sirenko, Oksana; Grimm, Fabian A.; Ryan, Kristen R.; Iwata, Yasuhiro; Chiu, Weihsueh A.; Parham, Frederick; Wignall, Jessica A.; Anson, Blake; Cromwell, Evan F.; Behl, Mamta; Rusyn, Ivan; Tice, Raymond R.
2017-01-01
An important target area for addressing data gaps through in vitro screening is the detection of potential cardiotoxicants. Despite the fact that current conservative estimates relate at least 23% of all cardiovascular disease cases to environmental exposures, the identities of the causative agents remain largely uncharacterized. Here, we evaluate the feasibility of a combinatorial in vitro/in silico screening approach for functional and mechanistic cardiotoxicity profiling of environmental hazards using a library of 69 representative environmental chemicals and drugs. Human induced pluripotent stem cell-derived cardiomyocytes were exposed in concentration-response for 30 min or 24 h and effects on cardiomyocyte beating and cellular and mitochondrial toxicity were assessed by kinetic measurements of intracellular Ca 2+ flux and high-content imaging using the nuclear dye Hoechst 33342, the cell viability marker Calcein AM, and the mitochondrial depolarization probe JC-10. More than half of the tested chemicals exhibited effects on cardiomyocyte beating after 30 min of exposure. In contrast, after 24 h, effects on cell beating without concomitant cytotoxicity were observed in about one third of the compounds. Concentration-response data for in vitro bioactivity phenotypes visualized using the Toxicological Prioritization Index (ToxPi) showed chemical class-specific clustering of environmental chemicals, including pesticides, flame retardants, and polycyclic aromatic hydrocarbons. For environmental chemicals with human exposure predictions, the activity-to-exposure ratios between modeled blood concentrations and in vitro bioactivity were between one and five orders of magnitude. These findings not only demonstrate that some ubiquitous environmental pollutants might have the potential at high exposure levels to alter cardiomyocyte function, but also indicate similarities in the mechanism of these effects both within and among chemicals and classes. - Highlights:
Authigenic Uranium in Eastern Equatorial Pacific Sediments
Marcantonio, F.; Lyle, M. W.; Loveley, M. R.; Ibrahim, R.
2014-12-01
Authigenic U concentrations have been used as an indicator of redox state in marine sediments. Soluble U(VI) in porewaters is reduced to insoluble U(IV) under suboxic conditions setting up a diffusion gradient through which U in bottom waters is supplied to reducing sediments. Researchers have used sedimentary redox enrichment of U as a tool to identify past redox changes, which may be caused by changes in organic carbon rain rates and/or bottom water oxygen levels. Differentiating between these two explanations is important, as the former is tied to the use of authigenic U as a paleoproductivity proxy. We examined sediments from 4 sediment cores retrieved from two different localities in the Panama Basin in the eastern equatorial Pacific. Two cores were retrieved from the northern Panama basin at the Cocos Ridge, (4JC at 5° 44.7'N 85° 45.5' W, 1730 m depth; 8JC at 6° 14.0'N 86° 2.6' W, 1993 m depth), and two were retrieved from the south at the Carnegie Ridge, (11JC at 0° 41.6'S 85° 20.0' W, 2452 m depth; 17JC at 0° 10.8'S 85° 52.0' W, 2846 m depth). Using 230Th systematics and seismic profiling at each of the sites, we've identified significant sediment winnowing (4JC and 11JC) and focusing (8JC and 17JC). At all sites, we believe that changes in age-model-derived sand (i.e., >63µm) mass accumulation rates (MAR) best represent changes in rain rates. Glacial rain rates are higher than those in the Holocene by a factor of 2-3 at both sites. Peak Mn levels (>1%), the brown-to-green color transition (which likely represents the oxic/post-oxic boundary), and peak U concentrations all appear in the same order with increasing depth down core. At the Carnegie sites, where MARs are greater than those at the Cocos sites, increases in authigenic U (up to 4 ppm) occur during the mid- to late Holocene at depths of 10-15 cm. At the Cocos sites, increases in authigenic U (up to 12 ppm) occur lower in the sediment column (25-30 cm) during the late glacial. The decrease
Investigation of domain wall motion in RE-TM magnetic wire towards a current driven memory and logic
Energy Technology Data Exchange (ETDEWEB)
Awano, Hiroyuki
2015-06-01
Current driven magnetic domain wall (DW) motions of ferri-magnetic TbFeCo wires have been investigated. In the case of a Si substrate, the critical current density (Jc) of DW motion was successfully reduced to 3×10{sup 6} A/cm{sup 2}. Moreover, by using a polycarbonate (PC) substrate with a molding groove of 600 nm width, the Jc was decreased to 6×10{sup 5} A/cm{sup 2}. In order to fabricate a logic in memory, a current driven spin logics (AND, OR, NOT) have been proposed and successfully demonstrated under the condition of low Jc. These results indicate that TbFeCo nanowire is an excellent candidate for next generation power saving memory and logic.
Genome-Wide Analysis of the NAC Gene Family in Physic Nut (Jatropha curcas L.).
Wu, Zhenying; Xu, Xueqin; Xiong, Wangdan; Wu, Pingzhi; Chen, Yaping; Li, Meiru; Wu, Guojiang; Jiang, Huawu
2015-01-01
The NAC proteins (NAM, ATAF1/2 and CUC2) are plant-specific transcriptional regulators that have a conserved NAM domain in the N-terminus. They are involved in various biological processes, including both biotic and abiotic stress responses. In the present study, a total of 100 NAC genes (JcNAC) were identified in physic nut (Jatropha curcas L.). Based on phylogenetic analysis and gene structures, 83 JcNAC genes were classified as members of, or proposed to be diverged from, 39 previously predicted orthologous groups (OGs) of NAC sequences. Physic nut has a single intron-containing NAC gene subfamily that has been lost in many plants. The JcNAC genes are non-randomly distributed across the 11 linkage groups of the physic nut genome, and appear to be preferentially retained duplicates that arose from both ancient and recent duplication events. Digital gene expression analysis indicates that some of the JcNAC genes have tissue-specific expression profiles (e.g. in leaves, roots, stem cortex or seeds), and 29 genes differentially respond to abiotic stresses (drought, salinity, phosphorus deficiency and nitrogen deficiency). Our results will be helpful for further functional analysis of the NAC genes in physic nut.
Fujii, Hiroki; Iwanade, Akio; Kawada, Satoshi; Kitaguchi, Hitoshi
2018-01-01
The optimal heat treatment temperature (Topt) at which best performance in the critical current density (Jc) property at 4.2 K is obtained is influenced by the quality or reactivity of the filling powder in ex situ processed MgB2 tapes. Using a controlled fabrication process, the Topt decreases to 705-735 °C, which is lower than previously reported by more than 50 °C. The Topt decrease is effective to suppress both the decomposition of MgB2 and hence the formation of impurities such as MgB4, and the growth of crystallite size which decreases upper critical filed (Hc2). These bring about the Jc improvement and the Jc value at 4.2 K and 10 T reaches 250 A/mm2. The milling process also decreases the critical temperature (Tc) below 30 K. The milled powder is easily contaminated in air and thus, the Jc property of the contaminated tapes degrades severely. The contamination can raise the Topt by more than 50 °C, which is probably due to the increased sintering temperature required against contaminated surface layer around the grains acting as a barrier.
Liu, Guan-xin; Liao, Ning
2016-01-01
To observe the clinical efficacy of Jiakangling Capsule (JC) combined with reduction of 1311 in treatment of Graves hyperthyroidism. Totally 387 Graves hyperthyroidism patients were randomly assigned to the treatment group (200 cases) and the control group (187 cases). Patients in the treatment group took JC combined with reduction of 131I. The 131I dosage per gram of thyroid tissue was 50-80 microCi. They additionally took JC one week after taking 1311 for one consecutive month. Patients in the control group took 131 routinely as one disposable treatment. The 131I dosage per gram of thyroid tissue was 70-120 microCi, without using JC or other anti-thyroid drugs. All patients were reexamined after 24-month treatment. Whether hyperthyroidism was cured, incurred, or permanent was observed. Efficacies of thyroglobulin antibody (TGAb) and thyroid microsome antibody (TMAb) were compared between the two groups. Compared with the control group, the incurred ratio increased in the treatment group [3.2% (6/187) vs. 16.0% (32/200), P hyperthyroidism induced permanent hypothyroidism than routine 1311 treatment, especially for strong positive TGAb and TMAb patients.
Interface thermal characteristics of flip chip packages - A numerical study
International Nuclear Information System (INIS)
Kandasamy, Ravi; Mujumdar, A.S.
2009-01-01
Flip chip ball grid array (FC-BGA) packages are commonly used for high inputs/outputs (I/O) ICs; they have been proven to provide good solutions for a variety of applications to maximize thermal and electrical performance. A fundamental limitation to such devices is the thermal resistance at the top of the package, which is characterized θ JC parameter. The die-to-lid interface thermal resistance is identified as a critical issue for the thermal management of electronic packages. This paper focuses on the effect of the interface material property changes on the interface thermal resistance. The effect of package's junction to case (Theta-JC or θ JC ) thermal performance is investigated for bare die, flat lid and cup lid packages using a validated thermal model. Thermal performance of a cup or flat lid attached and bare die packages were investigated for different interface materials. Improved Theta-JC performance was observed for the large die as compared to the smaller die. Several parametric studies were carried out to understand the effects of interface bond line thickness (BLT), different die sizes, the average void size during assembly and thermal conductivity of interface materials on package thermal resistance
Burkholderia monticola sp. nov., isolated from mountain soil.
Baek, Inwoo; Seo, Boram; Lee, Imchang; Yi, Hana; Chun, Jongsik
2015-02-01
An ivory/yellow, Gram-stain-negative, short-rod-shaped, aerobic bacterial strain, designated JC2948(T), was isolated from a soil sample taken from Gwanak Mountain, Republic of Korea. 16S rRNA gene sequence analysis indicated that strain JC2948(T) belongs to the genus Burkholderia. The test strain showed highest sequence similarities to Burkholderia tropica LMG 22274(T) (97.6 %), Burkholderia acidipaludis NBRC 101816(T) (97.5 %), Burkholderia tuberum LMG 21444(T) (97.5 %), Burkholderia sprentiae LMG 27175(T) (97.4 %), Burkholderia terricola LMG 20594(T) (97.3 %) and Burkholderia diazotrophica LMG 26031(T) (97.1 %). Based on average nucleotide identity (ANI) values, the new isolate represents a novel genomic species as it shows less than 90 % ANI values with other closely related species. Also, other phylosiological and biochemical comparisons allowed the phenotypic differentiation of strain JC2948(T) from other members of the genus Burkholderia. Therefore, we suggest that this strain should be classified as the type strain of a novel species of the genus Burkholderia. The name Burkholderia monticola sp. nov. (type strain, JC2948(T) = JCM 19904(T) = KACC 17924(T)) is proposed. © 2015 IUMS.
Soares, A M S; Carvalho, L P; Melo, E J T; Costa, H P S; Vasconcelos, I M; Oliveira, J T A
2015-06-01
Toxoplasma gondii is a parasite of great medical and veterinary importance that has worldwide distribution and causes toxoplasmosis. There are few treatments available for toxoplasmosis and the search for plant extracts and compounds with anti-Toxoplasma activity is of utmost importance for the discovery of new active drugs. The objective of this study was to investigate the action of a protein extract and a protease inhibitor enriched fraction from J. curcas seed cake on developing tachyzoites of T. gondii-infected Vero cells. The protein extract (JcCE) was obtained after solubilization of the J. curcas seed cake with 100 mM sodium borate buffer, pH 10, centrifugation and dialysis of the resulting supernatant with the extracting buffer. JcCE was used for the in vitro assays of anti-Toxoplasma activity at 0.01, 0.1, 0.5, 1.5, 3.0 and 5.0 mg/ml concentration for 24 h. The results showed that JcCE reduced the percentage of infection and the number of intracellular parasites, but had no effect on the morphology of Vero cells up to 3.0 mg/mL. The cysteine protease inhibitor enriched fraction, which was obtained after chromatography of JcCE on Sephadex G-75 and presented a unique protein band following SDS-PAGE, reduced both the number of T. gondii infected cells and intracellular parasites. These results suggest that both JcCE and the cysteine protease inhibitor enriched fraction interfere with the intracellular growth of T. gondii. Copyright © 2015 Elsevier Inc. All rights reserved.
Chauhan, Nitin; Tyagi, Amit K.; Kumar, Pushpendar; Malik, Anushree
2016-01-01
The aqueous leaf extract of Jatropha curcas was used for the synthesis of silver nanoparticles (Jc-AgNps) which were further evaluated for its antibacterial potential against food borne pathogens. J. curcas leaf extract could synthesize stable silver nanoparticles (Zeta potential: -23.4 mV) with absorption band at 430 nm. Fourier transform infrared spectroscopy indicated various biological compounds responsible for capping and stabilizing Jc-AgNps in suspension, while the presence of silver was authenticated by scanning electron microscopy (SEM) equipped with energy-dispersive X-ray. Jc-AgNps were confirmed to be uniform in shape, size and behavior through dynamic light scattering, transmission electron microscopy (TEM), X-ray diffraction, SEM, and atomic force microscopy (AFM) analysis. To investigate the antibacterial activity, disk diffusion and microplate dilution assays were performed and zone of inhibition (ZOI) as well as minimum inhibitory/bactericidal concentrations (MIC/MBCs) were evaluated against selected bacterial strains. Overall results showed that Escherichia coli (ZOI: 23 mm, MBC: 0.010 mg/ml) was the most sensitive organism, whereas Staphylococcus aureus (ZOI: 14.66 mm, MBC: 0.041 mg/ml) and Salmonella enterica (ZOI: 16.66 mm, MBC: 0.041 mg/ml) were the least sensitive against Jc-AgNps. The detailed microscopic investigations using SEM, TEM, and AFM were performed to understand the antibacterial impacts of Jc-AgNps against Listeria monocytogenes. SEM and TEM analysis showed the clear deformation and disintegration of treated L. monocytogenes cells, whereas AFM established a decrease in the height and cell surface roughness (root mean square value) in the treated L. monocytogenes. PMID:27877160
The effect of taurine chloramine on human osteosarcoma cell-lines
International Nuclear Information System (INIS)
Pilz, M.
2010-01-01
Osteosarcoma is the most frequent nonhaematogenic primary malignant tumor of the bone. The rather rare tumour occurs mainly in children and adolescents. This osteogenic tumour is a high-aggressive mesenchymal neoplasm typically producing osteoid. The surgical resection of the complete tumour must be carried out with wide or radical margins to prevent recurrence. Even though the combination of surgery with chemotherapy has noticeably improved the survival rate of osteosarcoma patients, the application of anticancer drugs is still associated with significant adverse reactions, for example the common acquisition of drug-resistant phenotypes, indicating the need of new chemotherapeutical substances. Taurine is a sulfur-containing β-amino acid, which is present in high concentrations in mammalian cells and plasma, in granulocytes and lymphocytes. Large quantities of taurine are released by stimulated neutrophiles and rapidly chlorinated by the reaction with hypochlorous acid (HOCl) generating taurine monochloramine (NCT). NCT is noted to play quite a few roles in the modulation of the immune response and sizeably decreases the production of plenty proinflammatory mediators from adherent as well as non-adherent leucocytes. NCT inhibits the intracellular transcription of nitric-oxide synthase and the production of nitric oxide and switches cell death from the less advantageous necrosis to the more physiologically beneficial apoptosis. Aim of this study was to research, if different concentrations of NCT are capable to induce apoptosis in the human osteosarcoma cell lines HOS, MG-63 and SAOS-2. Therefore the cell proliferation assay EZ4U, a fluorescence staining with acridine-orange, an ELISA for the detection of DNA-fragments and a JC-1 mitochondrial FACS-analysis were performed. The results of these four independent experiments show, that NCT has a pro-apoptotic effect on these osteosarcoma cell lines. (author) [de
Journal Club: a group of research experience.
Draganov, Patricia Bover; Silva, Maria Regina Guimarães; Neves, Vanessa Ribeiro; Sanna, Maria Cristina
2018-01-01
the Journal Club (JC) is a teaching and learning strategy developed by individuals who meet to discuss scientific articles in periodicals. to describe the experience of the JC strategy at the Group for Studies and Research in Health Services Administration and Nursing Management (Gepag). case studies or scientific research demonstration mode of practical experience for the understanding and justification of facts. Gepag JC emerged in 2008 and, in 2014, was computerized with the Google Drive®, in order to increase its scope and optimize the Group›s meetings. From April to May 2014, the instrument was tested and adjusted, resulting in advancements. the advantages involved optimizing the time of meetings, facilitation of access to publications of interest to the Group and creating the database to support future research.
2000-02-01
1995. New nephron devel- opment in fish from polluted waters: a possi- ble biomarker. Ecotoxicology 4:157-68. Couch JA. 1985. Prospective study of...Carlson AR. 1998. Comparative sensitivity of five species of macrophytes and six species of algae to atrazine, metribuzin, alachlor, and meto...Stevenson JC, Jones TW, Means JC. 1985. Effects of atrazine and linuron on photosynthesis and growth of the macrophytes Potamogeton per- foliatus L
Dicty_cDB: Contig-U16435-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available tkiflilglfafllvafapsssvatvnlesdgyteaeaklie ekgekftfqtevnklmniiinslyskkeiflrelisnasdaldkirflaltnad..........................done Score E Sequences producing significant alignments: (bits) Value JC7352( JC7352 )glucose-regulated...Q228115 |pid:none) Proteomonas sulcata strain CCMP704... 288 e-121 FM992694_186( FM992694 |pid:none) Candida dubliniensi..............done Score E Sequences producing significant alignments: (bits) Value N ( AB040814 ) Dictyostelium disc...is isolate JS854 ... 296 e-144 AY942619_1( AY942619 |pid:none) Leishmania braziliensi
Han, J C; Zhang, Y J; Li, X D
2016-10-07
The retracted article is: Han JC, Zhang YJ and Li XD (2015). Association between polymorphisms in the XRCC1 gene and the risk of non-small cell lung cancer. Genet. Mol. Res. 14: 12888-12893. The GMR editorial staff was alerted about this article (received on May 3, 2015; accepted on August 18, 2015) published on October 21, 2015 (DOI: 10.4238/2015.October.21.9) that was found to be substantially similar to the publication of "Association of XRCC1 gene polymorphisms with risk of non-small cell lung cancer" (received on January 25, 2015; accepted on March 23, 2015; e-published on April 1, 2015) by Kang et al., published in the International Journal of Clinical Experimental Pathology 8 (4): 4171-4176. The authors were aware of the Kang et al.'s paper, since they cite it several times in the manuscript published in GMR. Some of the language is similar between the two manuscripts, but what is the most concerning is that several of the tables in the papers are nearly identical. Tables 2 and 3 are exactly identical between the two articles, suggesting that the publication in GMR was plagiarized from the publication in the International Journal of Clinical Experimental Pathology. The Publisher and Editor decided to retract these articles in accordance with the recommendations of the Committee on Publication Ethics (COPE). After a thorough investigation, we have strong reason to believe that the peer review process was failure and, after review and contacting the authors, the editors of Genetics and Molecular Research decided to retract the article. The authors and their institutions were advised of this serious breach of ethics.
Richter, Craig G; Thompson, William H; Bosman, Conrado A; Fries, Pascal
2015-07-01
The quantification of covariance between neuronal activities (functional connectivity) requires the observation of correlated changes and therefore multiple observations. The strength of such neuronal correlations may itself undergo moment-by-moment fluctuations, which might e.g. lead to fluctuations in single-trial metrics such as reaction time (RT), or may co-fluctuate with the correlation between activity in other brain areas. Yet, quantifying the relation between moment-by-moment co-fluctuations in neuronal correlations is precluded by the fact that neuronal correlations are not defined per single observation. The proposed solution quantifies this relation by first calculating neuronal correlations for all leave-one-out subsamples (i.e. the jackknife replications of all observations) and then correlating these values. Because the correlation is calculated between jackknife replications, we address this approach as jackknife correlation (JC). First, we demonstrate the equivalence of JC to conventional correlation for simulated paired data that are defined per observation and therefore allow the calculation of conventional correlation. While the JC recovers the conventional correlation precisely, alternative approaches, like sorting-and-binning, result in detrimental effects of the analysis parameters. We then explore the case of relating two spectral correlation metrics, like coherence, that require multiple observation epochs, where the only viable alternative analysis approaches are based on some form of epoch subdivision, which results in reduced spectral resolution and poor spectral estimators. We show that JC outperforms these approaches, particularly for short epoch lengths, without sacrificing any spectral resolution. Finally, we note that the JC can be applied to relate fluctuations in any smooth metric that is not defined on single observations. Copyright © 2015. Published by Elsevier Inc.
Rogalska, Aneta; Gajek, Arkadiusz; Szwed, Marzena; Jóźwiak, Zofia; Marczak, Agnieszka
2011-12-01
In the present study, we investigated the anticancer activity of WP 631, a new anthracycline analog, in weakly doxorubicin-resistant SKOV-3 ovarian cancer cells. We studied the time-course of apoptotic and necrotic events: the production of reactive oxygen species (ROS) and changes in the mitochondrial membrane potential in human ovarian cancer cells exposed to WP 631 in the presence and absence of an antioxidant, N-acetylcysteine (NAC). The effect of WP 631 was compared with the activity of doxorubicin (DOX), the best known first-generation anthracycline. Cytotoxic activity was determined by the MTT assay. The morphological changes characteristic of apoptosis and necrosis in drug-treated cells were analyzed by double staining with Hoechst 33258 and propidium iodide (PI) using fluorescence microscopy. The production of reactive oxygen species and changes in mitochondrial membrane potential were studied using specific fluorescence probes: DCFH2-DA and JC-1, respectively. The experiments showed that WP 631 was three times more cytotoxic than DOX in the tested cell line. It was found that the new anthracycline analog induced mainly apoptosis and, marginally, necrosis. Apoptotic cell death was associated with morphological changes and a decrease in mitochondrial membrane potential. In comparison to DOX, the novel bisanthracycline induced a significantly higher level of ROS and a greater drop in the membrane potential. The results provide direct evidence that the novel anthracycline WP 631 is considerably more cytotoxic to human SKOV-3 ovarian cancer cells than doxorubicin. The drug can produce ROS, which are immediately involved in the induction of apoptotic cell death. Copyright © 2011 Elsevier Ltd. All rights reserved.
Vortex pinning in artificially layered Ba(Fe,Co)2As2 film
Oh, M. J.; Lee, Jongmin; Seo, Sehun; Yoon, Sejun; Seo, M. S.; Park, S. Y.; Kim, Ho-Sup; Ha, Dong-Woo; Lee, Sanghan; Jo, Youn Jung
2018-06-01
Static high critical current densities (Jc) > 1 MA/cm2 with magnetic field parallel or perpendicular to c-axis were realized in Co-doped/undoped multilayerd BaFe2As2 films. We made a current bridge by FIB to allow precise measurements, and confirmed that the boundary quality using FIB was considerably better than the quality achieved using a laser. The presence of a high in-plane Jc suggested the existence of c-axis correlated vortex pinning centers. To clarify the relationship between the Jc performance and superstructures, we investigated the magnetic flux pinning mechanism using scaling theory of the volume pinning force Fp(H). The Jc(H) curves, Fp/Fp,max vs. h = H/Hirr curves, and parameters p and q depended on the characteristics of the flux pinning mechanism. It was found that the dominant pinning mechanism of Co-doped/undoped multilayerd BaFe2As2 films was Δl-pinning and the inserted undoped BaFe2As2 layers remained non-superconducting. The dominant pin geometry varied when the magnetic field direction changed. It was concluded that the artificially layered BaFe2As2 film is a 3-D superconductor due to its long correlation length compared to the thickness of the non-superconducting layer.
Efficacy of Fertilizer from Tubang-Bakod (JatrophaCurcas Linn Compost
Directory of Open Access Journals (Sweden)
Erma B. Quinay
2015-11-01
Full Text Available In order to determine the efficacy of fertilizer from Tubang-Bakod (Jatophacurcas Linn compost, an experiment was carried out in complete randomized block design based on 3 replications. Varied ratios of commercial organic fertilizer (COF and Jatropha compost (JC are 100:0, 50:50 and 0:100 and commercial inorganic fertilizers (CIF were used in planting. Parameters such as number of leaves, length of stems, size and color of leaves were determined after harvesting. The maximum number of leaves was noted in 100:0ratios of JC and COF; the lengthiest stem was noted in vegetables grown with 100:0 JC; while the largest size of leaf was noted in CIF. The color of leaves was the same for the varied ratios with a reading of 4 while the CIF has a reading of 5 in the leaf color chart. The macronutrients of JC have 2.09% N, 1.98%P and 17. 49%K.However the micronutrients of the compost were 203.66 ppm Zn, 326.27 ppmMnand 3997.30 ppmFe. These nutrients are essential for the plant growth. It was observed that potassium (K exceeded the standard for the COF which is 3.66 wt. %. K hastens maturity and increase the size and quality of vegetables.
Cure, David; Weller, Thomas; Miranda, Felix A.
2011-01-01
In this paper, a comparison between Jerusalem Cross (JC) and Square Patch (SP) based Frequency Selected Surfaces (FSS) for low profile antenna applications is presented. The comparison is aimed at understanding the performance of low profile antennas backed by high impedance surfaces. In particular, an end loaded planar open sleeve dipole (ELPOSD) antenna is examined due to the various parameters within its configuration, offering significant design flexibility and a wide operating bandwidth. Measured data of the antennas demonstrate that increasing the number of unit cells improves the fractional bandwidth. The antenna bandwidth increased from 0.8% to 1.8% and from 0.8% to 2.7% for the JC and SP structures, respectively. The number of unit cells was increased from 48 to 80 for the JC-FSS and from 24 to 48 for the SP-FSS.
Journal Club: a group of research experience
Directory of Open Access Journals (Sweden)
Patricia Bover Draganov
Full Text Available ABSTRACT Introduction: the Journal Club (JC is a teaching and learning strategy developed by individuals who meet to discuss scientific articles in periodicals. Objective: to describe the experience of the JC strategy at the Group for Studies and Research in Health Services Administration and Nursing Management (Gepag. Method: case studies or scientific research demonstration mode of practical experience for the understanding and justification of facts. Results: Gepag JC emerged in 2008 and, in 2014, was computerized with the Google Drive®, in order to increase its scope and optimize the Group›s meetings. From April to May 2014, the instrument was tested and adjusted, resulting in advancements. Final considerations: the advantages involved optimizing the time of meetings, facilitation of access to publications of interest to the Group and creating the database to support future research.
Connexins and Cadherin Cross-talk in the Pathogenesis of Prostate Cancer
2014-09-01
1627-1636. 25. Ewing CM, Ru N, Morton RA, Robinson JC, Wheelock,M.J., Johnson KR, Barrett JC, and Isaacs WB (1995) Chromosome 5 suppresses tumorigenicity...plotted the distance traveled over time for each puncta as long as the particle could be visually traced as assessed by its disappearance from the focal...plane. The distance measurement was approximated in a quasi-1 dimensional manner using the punctum’s position before its disappearance with
Progressive multifocal leukoencephalopathy. Epidemiology, clinical pictures, diagnosis and therapy
International Nuclear Information System (INIS)
Kishida, Shuji
2007-01-01
Progressive multifocal leukoencephalopathy (PML) is a demyelinating disease of the central nervous system caused by the reactivation of a ubiquitous polyomavirus JC (JCV). PML was for many years a rare disease occurring only in patients with underlying severe impaired immunity. Over the past three decades, the incidence of PML has significantly increased related to the AIDS (acquired immunodeficiency syndrome) pandemic and, more recently, to the growing use of immunosuppressive drugs. The clinical presentation of PML is variable with neurological symptoms corresponding to affected cerebral areas. Usually, the clinical outcome of patients with PML is poor with an inexorable progression to death within 6 months of symptom onset. Although PML usually requires a brain biopsy or autopsy for confirmation, radiological imaging and a demonstration of JCV-DNA in the CSF (cerebrospinal fluid) provide supportive evidence for the diagnosis. Although there is no proven effective therapy for PML, patients with HIV (human immunodeficeincy virus)-related PML may benefit significantly from HAART (highly active antiretroviral therapy). In this article the author reviews the epidemiology, especially in Japan, current challenges in the diagnosis and the treatment guidelines of patients with PML based on recent advances in the understanding of the JC virus biology. (author)
2ND Annual Report on Contract N00014-88-K-0059
1989-10-01
dogs, and adrenally insufficient humans are very fragile and do not survive this type of stress. Further studies in this lab have revealed that the...epinephrine and dopamine . Life Sci 21:625. 33) Pirkle JC, Gann DS, Allen-Rolands CF 1982 role of the pituitary in restitution of blood volume after...represent means+ SE. 17 Li z LO 0~0 0 I0 0 0r -C C a- C 0 00 00 Li LCC) 0 1 (lw/6d) HIDV Uol G6uDJ) Plasma AVP (pg/ml) 10 co C Do-+- 3 CA / 0j x N~ Q~N + 0
Issues in quantification of registered respiratory gated PET/CT in the lung
Cuplov, Vesna; Holman, Beverley F.; McClelland, Jamie; Modat, Marc; Hutton, Brian F.; Thielemans, Kris
2018-01-01
PET/CT quantification of lung tissue is limited by several difficulties: the lung density and local volume changes during respiration, the anatomical mismatch between PET and CT and the relative contributions of tissue, air and blood to the PET signal (the tissue fraction effect). Air fraction correction (AFC) has been shown to improve PET image quantification in the lungs. Methods to correct for the movement and anatomical mismatch involve respiratory gating and image registration techniques. While conventional registration methods only account for spatial mismatch, the Jacobian determinant of the deformable registration transformation field can be used to estimate local volume changes and could therefore potentially be used to correct (i.e. Jacobian Correction, JC) the PET signal for changes in concentration due to local volume changes. This work aims to investigate the relationship between variations in the lung due to respiration, specifically density, tracer concentration and local volume changes. In particular, we study the effect of AFC and JC on PET quantitation after registration of respiratory gated PET/CT patient data. Six patients suffering from lung cancer with solitary pulmonary nodules underwent 18 F-FDG PET/cine-CT. The PET data were gated into six respiratory gates using displacement gating based on a real-time position management (RPM) signal and reconstructed with matched gated CT. The PET tracer concentration and tissue density were extracted from registered gated PET and CT images before and after corrections (AFC or JC) and compared to the values from the reference images. Before correction, we observed a linear correlation between the PET tracer concentration values and density. Across all gates and patients, the maximum relative change in PET tracer concentration before (after) AFC was found to be 16.2% (4.1%) and the maximum relative change in tissue density and PET tracer concentration before (after) JC was found to be 17.1% (5.5%) and 16
Flipped classroom model for learning evidence-based medicine
Rucker, Sydney Y; Ozdogan, Zulfukar; Al Achkar, Morhaf
2017-01-01
Sydney Y Rucker,1 Zulfukar Ozdogan,1 Morhaf Al Achkar2 1School of Education, Indiana University, Bloomington, IN, 2Department of Family Medicine, School of Medicine, University of Washington, Seattle, WA, USA Abstract: Journal club (JC), as a pedagogical strategy, has long been used in graduate medical education (GME). As evidence-based medicine (EBM) becomes a mainstay in GME, traditional models of JC present a number of insufficiencies and call for novel models of instruction. A flipped cla...
1982-08-01
particularly grateful to those folks who have helped with all the others. For background and policy in Chapter I, Bud Carey ; for the facility...H Ä •H J^ <D -i J* CD JC C iH -H ^c CD JC II II o D 8 o O-H o O-H Ö-H Q »SSI D 8 •H 8 II ■k £0CC «. _1 « JQ •» JOJO •- JQ _i
Barra, Nicole G; Fan, Isabella Y; Gillen, Jenna B; Chew, Marianne; Marcinko, Katarina; Steinberg, Gregory R; Gibala, Martin J; Ashkar, Ali A
2017-12-01
High intensity interval training (HIIT) boosts natural killer (NK) cell number and activity in normal weight breast cancer patients; however, whether this occurs in obese individuals is not well established. The goal of this study was to determine whether HIIT effectively boosts NK cells as a therapeutic strategy against breast cancer in an obese mouse model and in overweight/obese women. Diet induced female C57Bl/6 obese mice were assigned to undergo HIIT for four weeks or remain sedentary. Female participants were subjected to a six weeks HIIT protocol. HIIT mice acclimatized to treadmill running were subsequently injected with 5 × 10 5 polyoma middle T (MT) breast cancer cells intravenously. NK cell number and activation were monitored using flow cytometry, and tumor burden or lipid content evaluated from histological lung and liver tissues, respectively. In both mice and humans, circulating NK cell number and activation (CD3-NK1.1+CD27+ and CD3-CD56+, respectively) markedly increased immediately after HIIT. HIIT obese mice had reduced lung tumor burden compared to controls following MT challenge, and had diminished hepatic lipid deposition despite minimal body weight loss. Our findings demonstrate that HIIT can benefit obese individuals by enhancing NK cell number and activity, reducing tumor burden, and enhancing metabolic health.
Multi-band microwave metamaterial absorber based on coplanar Jerusalem crosses
Wang, Guo-Dong; Liu, Ming-Hai; Hu, Xi-Wei; Kong, Ling-Hua; Cheng, Li-Li; Chen, Zhao-Quan
2014-01-01
The influence of the gap on the absorption performance of the conventional split ring resonator (SRR) absorber is investigated at microwave frequencies. Our simulated results reveal that the geometry of the square SRR can be equivalent to a Jerusalem cross (JC) resonator and its corresponding metamaterial absorber (MA) is changed to a JC absorber. The JC MA exhibits an experimental absorption peak of 99.1% at 8.72 GHz, which shows an excellent agreement with our simulated results. By simply assembling several JCs with slightly different geometric parameters next to each other into a unit cell, a perfect multi-band absorption can be effectively obtained. The experimental results show that the MA has four distinct and strong absorption peaks at 8.32 GHz, 9.8 GHz, 11.52 GHz and 13.24 GHz. Finally, the multi-reflection interference theory is introduced to interpret the absorption mechanism.
High-Jc YBa2Cu3O7-x-Ag superconducting thin films synthesized through a fluorine-free MOD method
DEFF Research Database (Denmark)
Tang, Xiao; Yue, Zhao; Wu, W.
2015-01-01
Obtaining a high critical current density (Jc) remains the main challenge in developing fluorine-free metal organic deposition (MOD) methods to fabricate YBCO superconducting thin films. Silver addition was used to raise the Jc values in this research work. By reacting with propionic acid...... and ammonia, AgNO3 was initially mixed with YBCO carboxylate precursors dissolved in methanol. High-temperature in situ XRD measurements on the YBCO-Ag powders revealed that silver addition lowers the incongruent melting temperature of YBCO to 760°C and resulted in a smooth surface morphology of the YBCO...... films at a temperature as low as 760°C. Grain growth and intergranular conductivity were also found to be improved by silver doping. After annealing under optimized conditions, a high Jc of 4.6MA/cm2 was obtained in a YBCO-Ag thin film with 10 wt% Ag....
Critical Current Properties in Longitudinal Magnetic Field of YBCO Superconductor with APC
Kido, R.; Kiuchi, M.; Otabe, E. S.; Matsushita, T.; Jha, A. K.; Matsumoto, K.
The critical current density (Jc) properties of the Artificial Pinning Center (APC) introduced YBa2Cu3O7 (YBCO) films in the longitudinal magnetic field were measured. Y2O3 or Y2BaCuO5 (Y211) was introduced as APCs to YBCO, and YBCO films with APC were fabricated on SrTiO3 single crystal substrate. The sizes of Y2O3 and Y211 were 5-10 nm and 10-20 nm, respectively. As a result, Jc enhancement in the longitudinal magnetic field was observed in Y2O3 introduced YBCO films. However, it was not observed in Y211 introduced YBCO films. Therefore, it was considered that Jc properties in the longitudinal magnetic field were affected by introducing of small size APC, and it was necessary that APC does not disturb the current pathway in the superconductor.
Investigating interoperability between JC3IEDM and HLA
CSIR Research Space (South Africa)
Uys, DC
2009-07-01
Full Text Available in table 3. The rest of the entities are de ned as data types that can be present in the attributes of the objects (see table 4). To handle the inheritance, a new data-type is de ned for every entity in the inheri- tance tree. Each child entity’s data...
Heusser, L. E.; Hendy, I. L.
2015-12-01
The Younger Dryas is a well-known rapid climatic cooling that interrupted the Marine Isotope Stage (MIS) 1-2 deglacial warming of Termination 1. This cool event has been associated with ice sheet readvance, meridional overturning, circulation changes, and southward movement of the Intertropical Convergence Zone. In Southern California, the Younger Dryas has been associated with cooler SST, low marine productivity, a well-ventilated oxygen minimum zone, and a wetter climate. Similar rapid cooling events have been found at other terminations including Termination 5 at the MIS 11-12 deglaciation (~425 Ka) identified by ice rafting events in the North Atlantic. Here we present new pollen census data from a unique suite of cores taken from the sub-oxic sediments of Santa Barbara Basin (MV0508-15JC, MV0805-20JC, MV0508-33JC, 29JC and 21JC). These short cores, collected on a truncated anticline within SBB, provide the opportunity to examine the response of southern California terrestrial and marine ecosystems to rapid climate change during the MIS 11-12 deglaciation (Termination 5), which is identified by a bioturbated interval within a sequence of laminated sediments. During Termination 1, changes in Southern California precipitation are reflected in pollen- based reconstructions Southern California vegetation. The high precipitation of glacial montane-coniferous assemblages of pine (Pinus) and Juniper (Juniperus/Calocedrus) transitions into interglacial drought, as expresssed by arid oak (Quercus)/chaparral vegetation. The Younger Dryas interrupts the transition as a high-amplitude pulse in pine associated with increased Gramineae (grass). Termination 5 differs, as the high precipitation of glacial montane-coniferous assemblages do not transition into arid oak/chaparral vegetation. However, a Younger Dryas-like rapid climate event was associated with increased pine and grass.
Miura, M.; Maiorov, B.; Baily, S. A.; Haberkorn, N.; Willis, J. O.; Marken, K.; Izumi, T.; Shiohara, Y.; Civale, L.
2011-05-01
We study the field (H) and temperature (T) dependence of the critical current density (Jc) and irreversibility field (Hirr) at different field orientations in Y0.77Gd0.23Ba2Cu3Oy with randomly distributed BaZrO3 nanoparticles (YGdBCO+BZO) and YBa2Cu3Oy (YBCO) films. Both MOD films have large RE2Cu2O5 (225) nanoparticles (˜80 nm in diameter) and a high density of twin boundaries (TB). In addition, YGdBCO+BZO films have a high density of BZO nanoparticles (˜25 nm in diameter). At high temperatures (T > 40 K), the superconducting properties, such as Jc, Hirr, and flux creep rates, are greatly affected by the BZO nanoparticles, while at low temperatures the superconducting properties of both the YBCO and YGdBCO+BZO films show similar field and temperature dependencies. In particular, while the Jc of YBCO films follow a power-law dependence (∝H-α) at all measured T, this dependence is only followed at low T for YGdBCO+BZO films. As a function of T, the YGdBCO+BZO film shows Jc(T,0.01T)~[1-(T/Tc)2]n with n ˜ 1.24 ± 0.05, which points to “δTc pinning.” We analyze the role of different types of defects in the different temperature regimes and find that the strong pinning of the BZO nanoparticles yields a higher Hirr and improved Jc along the c axis and at intermediate orientations at high T. The mixed pinning landscapes due to the presence of disorder of various dimensionalities have an important role in the improvement of in-field properties.
Energy Technology Data Exchange (ETDEWEB)
Rigos, C.F.; Tedesco, A.C.; Ciancaglini, P. [Universidade de Sao Paulo (USP), Ribeirao Preto, SP (Brazil). Faculdade de Filosofia, Ciencias e Letras. Dept. de Quimica; Santos, H.L. [Universidade Federal de Sao Joao Del Rei (UFSJ), MG (Brazil)
2008-07-01
Full text: The mechanism of laser irradiation action on living cells is not yet understood. The role of membrane ATPases as possible targets has been analyzed. In our group we have been working with Na,K-ATPase. This enzyme is a member of the P-type family of active cation transport proteins. Thus, the aim of the present work was to investigate the effect of low-energy laser irradiation (685 nm, 35 mW) on the ATPase activity of different forms of the Na,K-ATPase. Membrane-bound and solubilized (ab)2 form of Na,K-ATPase was obtained from the rabbit kidney and DPPC:DPPE-proteoliposomes were prepared by the co-solubilization method. Irradiations were carried out at 685 nm. The ATPase activity of the membrane fraction was not altered with exposition to irradiation doses between 4 and 24 J/c m2. With irradiation doses ranging from 32 to 40 J/c m2, a 28% increase on the ATPase activity was observed while when using up to 50 J/c m2 no additional enhancement was observed. When bio stimulation was done using the purified or the reconstituted enzyme, an increase of about 36-40% on the ATPase activity was observed using only 4-8 J/c m2. With irradiation above these values (24 J/c m2) no additional increase in the activity appeared. These studies revealed that the bio stimulation of ATPase activity from different forms of the Na,K -ATPase is dose dependent in different ranges of irradiation exposure. The stimulation promoted by visible laser doses was modulated and the process was reverted after 2 h for the enzyme present in the membrane and after about 5 h for the solubilized or the reconstituted in DPPC:DPPE-liposomes.
International Nuclear Information System (INIS)
Rigos, C.F.; Tedesco, A.C.; Ciancaglini, P.
2008-01-01
Full text: The mechanism of laser irradiation action on living cells is not yet understood. The role of membrane ATPases as possible targets has been analyzed. In our group we have been working with Na,K-ATPase. This enzyme is a member of the P-type family of active cation transport proteins. Thus, the aim of the present work was to investigate the effect of low-energy laser irradiation (685 nm, 35 mW) on the ATPase activity of different forms of the Na,K-ATPase. Membrane-bound and solubilized (ab)2 form of Na,K-ATPase was obtained from the rabbit kidney and DPPC:DPPE-proteoliposomes were prepared by the co-solubilization method. Irradiations were carried out at 685 nm. The ATPase activity of the membrane fraction was not altered with exposition to irradiation doses between 4 and 24 J/c m2. With irradiation doses ranging from 32 to 40 J/c m2, a 28% increase on the ATPase activity was observed while when using up to 50 J/c m2 no additional enhancement was observed. When bio stimulation was done using the purified or the reconstituted enzyme, an increase of about 36-40% on the ATPase activity was observed using only 4-8 J/c m2. With irradiation above these values (24 J/c m2) no additional increase in the activity appeared. These studies revealed that the bio stimulation of ATPase activity from different forms of the Na,K -ATPase is dose dependent in different ranges of irradiation exposure. The stimulation promoted by visible laser doses was modulated and the process was reverted after 2 h for the enzyme present in the membrane and after about 5 h for the solubilized or the reconstituted in DPPC:DPPE-liposomes
Development of Nb3Sn strands for ITER in Japan
International Nuclear Information System (INIS)
Isono, T.; Nunoya, Y.; Matsui, K.; Nabara, Y.; Koizumi, N.; Takahashi, Y.; Okuno, K.
2007-01-01
Nb 3 Sn strands for ITER Toroidal Field (TF) coils and Central Solenoids (CS) are required to have both high current density (Jc) and low hysteresis loss. The required Jc at 12 T, 4.2 K and no external strain is lager than 700 A/mm 2 for bronze processed strand and lager than 800 A/mm 2 for internal tin processed one at 12 T, 4.2 K and no external strain. Upper limit of hysteresis loss is 1,000 mJ/cm 3 at 4.2 K and a cycle of ±3 T. Outer diameter is 0.82 mm and 0.83 mm for TF coils and CS, respectively. Area ratio of copper to non copper is one and outer surface is Cr plated. Japan will procure 25% of Nb 3 Sn for ITER TF coils and 100% for ITER CS. There are four Nb 3 Sn strand suppliers in Japan; three of them use bronze process and the other uses internal tin process. For bronze processed strand, increase Jc was achieved by using bronze with high tin content of 15 to 16%. To keep productivity while using the harder bronze with high tin content, Nb is used for barrier in place of Ta. The material is expected to have better adhesion to other materials such as bronze and copper. For internal tin process, size of modules, each of which has a tin rod and a lot of Nb filaments embedded in a copper cylinder, is reduced, while total amount of tin increase in order to satisfy both required high Jc and low hysteresis loss. Each supplier fabricated a strand of more than 0.1 ton for TF coils and succeeded to develop a strand satisfying the ITER requirements of Jc and hysteresis loss. (authors)
Directory of Open Access Journals (Sweden)
Marija Karapandzova
2014-12-01
Full Text Available Chemical characterization of three Juniperus species: J. foetidisima (JF, J. excelsa (JE and J. communis (JC from Macedonian flora enclosed determination of yield and essential oil composition of the oils obtained by hydro-distillation of dried leaves and determination of the content of total phenols and total flavonoids in dried plant material. GC/FID/MS analysis showed mainly monoterpene profile of the JC oil and combined monoterpene/sesquiterpene profile of JF and JE oils. Sesquiterpene cedrol was found as an important constituent of the JF and JE, thus the JF oil was characterized by three main components (a-pinene, limonene and cedrol, in amount up to 67.63%, 27.11% and 33.91%, respectively and JE oil by four components (a-pinene, sabinene, cis-thujone and cedrol, in amount up to 33.83%, 29.49%, 26.20% and 24.44%, respectively. The JC oil was free of cedrol, but contained relatively large sesquiterpene fraction (sesquiterpene hydrocarbons and oxygen containing sesquiterpenes in amounts up to 28.64% and 13.57%, respectively. The JC oil was characterized by three monoterpene components (a-pinene, sabinene and terpinen-4-ol, presented up to 28.68%, 16.27% and 12.16%, respectively. The content of total phenols determined by Folin-Ciocalteu method ranged from 96.18-122.91 mg GAE/g dw (water extraction while the content of total flavonoids ranged from 2.05-11.91 mg CE/g dw (ethanol extraction. Both water and ethanol extracts possessed radical scavenging activity against DPPH radical. Water extracts were more powerful with % of inhibition of DPPH ranging up to 64.52%, 67.40% and 78.23% for water extract (10 mg/ml of JF, JE and JC, respectively. Obtained results showed correlation with the content of total phenols.
A "candidate-interactome" aggregate analysis of genome-wide association data in multiple sclerosis
DEFF Research Database (Denmark)
Mechelli, Rosella; Umeton, Renato; Policano, Claudia
2013-01-01
of genes whose products are known to physically interact with environmental factors that may be relevant for disease pathogenesis) analysis of genome-wide association data in multiple sclerosis. We looked for statistical enrichment of associations among interactomes that, at the current state of knowledge......, may be representative of gene-environment interactions of potential, uncertain or unlikely relevance for multiple sclerosis pathogenesis: Epstein-Barr virus, human immunodeficiency virus, hepatitis B virus, hepatitis C virus, cytomegalovirus, HHV8-Kaposi sarcoma, H1N1-influenza, JC virus, human innate...... immunity interactome for type I interferon, autoimmune regulator, vitamin D receptor, aryl hydrocarbon receptor and a panel of proteins targeted by 70 innate immune-modulating viral open reading frames from 30 viral species. Interactomes were either obtained from the literature or were manually curated...
Composite ceramic superconducting wires for electric motor applications
Halloran, John W.
1990-07-01
Several types of HTSC wire have been produced and two types of HTSC motors are being built. Hundreds of meters of Ag- clad wire were fabricated from YBa2Cu3O(7-x) (Y-123) and Bi2Ca2Sr2Cu3O10 (BiSCCO). The dc homopolar motor coils are not yet completed, but multiple turns of wire have been wound on the coil bobbins to characterize the superconducting properties of coiled wire. Multifilamentary conductors were fabricated as cables and coils. The sintered polycrystalline wire has self-field critical current densities (Jc) as high as 2800 A/sq cm, but the Jc falls rapidly with magnetic field. To improve Jc, sintered YBCO wire is melt textured with a continuous process which has produced textures wire up to 0.5 meters long with 77K transport Jc above 11, 770 A/sq cm2 in self field and 2100 A/sq cm2 at 1 telsa. The Emerson Electric dc homopolar HTSC motor has been fabricated and run with conventional copper coils. A novel class of potential very powerful superconducting motors have been designed to use trapped flux in melt textures Y-123 as magnet replicas in an new type of permanent magnet motor. The stator element and part of the rotor of the first prototype machine exist, and the HTSC magnet replica segments are being fabricated.
Security in RFID and sensor networks
Kitsos, Paris
2009-01-01
Security in RFIDMulti-Tag RFID Systems, L. Bolotnyy and G. RobinsAttacking RFID Systems, P. Peris-Lopez, J.C. Hernandez-Castro, J.M. Estevez-Tapiador, and A. RibagordaRFID Relay Attacks: System Analysis,Modeling, and Implementation, A. Lima, A. Miri, and M. NevinsPhysical Privacy and Security in RFID Systems, L. Bolotnyy and G. RobinsAuthentication Protocols in RFID Systems, G. Pantelic, S. Bojanic, and V. TomaševicLightweight Cryptography for Low-Cost RFID Tags, P. Peris-Lopez, J.C.
Connexins and Cadherin Crosstalk in the Pathogenesis of Prostate Cancer
2015-09-01
Ru N, Morton RA, Robinson JC, Wheelock,M.J., Johnson KR, Barrett JC, and Isaacs WB (1995) Chromosome 5 suppresses tumorigenicity of PC3 prostate...individually tracking the movement and disappearance of puncta at cell-cell contact areas, we found that most Cx32220-EGFP puncta moved and disappeared within...10 min, whereas most Cx32-WT-EGFP gap junction puncta moved slowly and did not disappear even up to 2 h (Fig. 10, supplemental Movies S1 and S2). For
2007-10-01
Environmental, Inc. Discussions were documented by rapporteurs, including Mr. Andy Martin, USACE ERDC-EL; Ms. Alicia Shepard, HydroGeoLogic, Inc.; and...1290. Jenkins, T.F., J.C. Pennington, G. Ampleman, S. Thiboutot, M.R. Walsh, E. Diaz , K.M. Dontsova, A.D. Hewitt, M.E. Walsh, S.R. Bigl, S. Taylor...Ampleman, S. Thiboutot, J.M. Brannon, A.D. Hewitt, J. Lewis, S. Brochu, E. Diaz , M.R. Walsh, M.E. Walsh, S. Taylor, J.C. Lynch, J. Clausen, T.A
Feng, Yi; Wang, Yonghua; Jiang, Chengrui; Fang, Zishui; Zhang, Zhiqiang; Lin, Xiaoying; Sun, Liwei; Jiang, Weiying
2017-07-15
Nicotinamide participates in energy metabolism and influences cellular redox status and modulates multiple pathways related with both cellular survival and death. Recent studies have shown that it induced proliferation inhibition and apoptosis in many cancer cells. However, little is known about the effects of nicotinamide on human cervical cancer cells. We aimed to evaluate the effects of the indicated concentrations nicotinamide on cell proliferation, apoptosis and redox-related parameters in HeLa cells and investigated the apoptotic mechanism. After the treatment of the indicated concentrations nicotinamide, HeLa cell proliferation was evaluated by the CCK-8 assay and the production of ROS (reactive oxygen species) was measured using 2',7'-Dichlorofluorescin diacetate. The apoptotic effect was confirmed by observing the cellular and nuclear morphologies with fluorescence microscope and apoptotic rate of HeLa cell apoptosis was measured by flow cytometry using Annexin-V method. Moreover, we examined the mitochondrial membrane potential by JC-1 method and measured the expression of apoptosis related genes using qRT-PCR and immunoblotting. Nicotinamide restrained the HeLa cell proliferation and significantly increased the accumulation of ROS and depletion of GSH at relatively high concentrations. Furthermore, nicotinamide promoted HeLa cell apoptosis via the intrinsic mitochondrial apoptotic pathway. Our study revealed that nicotinamide induced the apoptosis through oxidative stress and intrinsic mitochondrial apoptotic pathways in HeLa cell. The results emerge that nicotinamide may be an inexpensive, safe and promising therapeutic agent or a neoadjuvant chemotherapy for cervical cancer patients, as well useful to find new drugs for cervical cancer therapy. Copyright © 2017 Elsevier Inc. All rights reserved.
Magnesium diboride(MgB2) wires for applications
International Nuclear Information System (INIS)
Patel, Dipak; Kim, Jung Ho
2016-01-01
Field and temperature dependence of the critical current density, Jc, were measured for both un-doped and carbon doped MgB 2 /Nb/Monel wires manufactured by Hyper Tech Research, Inc. In particular, carbon incorporation into the MgB 2 structure using malic acid additive and a chemical solution method can be advantageous because of the highly uniform mixing between the carbon and boron powders. At 4.2 K and 10 T, Jc was estimated to be 25,000 - 25,300 Acm -2 for the wire sintered at 600 degrees C for 4 hours. The irreversibility field, Birr, of the malic acid doped wire was approximately 21.0 - 21.8 T, as obtained from a linear extrapolation of the J-B characteristic. Interestingly enough, the Jc of the malic acid doped sample exceeds 10 5 Acm -2 at 6 T and 4.2 K, which is comparable to that of commercial Nb-Ti wires
Magnesium diboride(MgB{sub 2}) wires for applications
Energy Technology Data Exchange (ETDEWEB)
Patel, Dipak; Kim, Jung Ho [Institute for Superconducting and Electronic Materials, Australian Institute for Innovative Materials, University of Wollongong, North Wollongong (Australia)
2016-03-15
Field and temperature dependence of the critical current density, Jc, were measured for both un-doped and carbon doped MgB{sub 2}/Nb/Monel wires manufactured by Hyper Tech Research, Inc. In particular, carbon incorporation into the MgB{sub 2} structure using malic acid additive and a chemical solution method can be advantageous because of the highly uniform mixing between the carbon and boron powders. At 4.2 K and 10 T, Jc was estimated to be 25,000 - 25,300 Acm{sup -2} for the wire sintered at 600 degrees C for 4 hours. The irreversibility field, Birr, of the malic acid doped wire was approximately 21.0 - 21.8 T, as obtained from a linear extrapolation of the J-B characteristic. Interestingly enough, the Jc of the malic acid doped sample exceeds 10{sup 5} Acm{sup -2} at 6 T and 4.2 K, which is comparable to that of commercial Nb-Ti wires.
Flipped classroom model for learning evidence-based medicine.
Rucker, Sydney Y; Ozdogan, Zulfukar; Al Achkar, Morhaf
2017-01-01
Journal club (JC), as a pedagogical strategy, has long been used in graduate medical education (GME). As evidence-based medicine (EBM) becomes a mainstay in GME, traditional models of JC present a number of insufficiencies and call for novel models of instruction. A flipped classroom model appears to be an ideal strategy to meet the demands to connect evidence to practice while creating engaged, culturally competent, and technologically literate physicians. In this article, we describe a novel model of flipped classroom in JC. We present the flow of learning activities during the online and face-to-face instruction, and then we highlight specific considerations for implementing a flipped classroom model. We show that implementing a flipped classroom model to teach EBM in a residency program not only is possible but also may constitute improved learning opportunity for residents. Follow-up work is needed to evaluate the effectiveness of this model on both learning and clinical practice.
Zhang, Yuanyuan; Liu, Zhe; Zhang, Qianwen; Chao, Zhenhua; Zhang, Pei; Xia, Fei; Jiang, Chenchen; Liu, Hao; Jiang, Zhiwen
2013-09-01
To study the effect of glycolysis inhibitor 3-bromopyruvate (3-BrPA) in inducing apoptosis of human breast carcinoma cells SK-BR-3 and the possible mechanism. MTT assay was used to detect the growth inhibition induced by 3-BrPA in breast cancer cells SK-BR-3. The apoptotic cells were detected by flow cytometry with propidium iodide (PI). ATP levels in the cells were detected by ATP assay kit, and DHE fluorescent probe technique was used to determine superoxide anion levels; the mitochondrial membrane potential was assessed using JC-1 staining assay. MTT assay showed that the proliferation of SK-BR-3 cells was inhibited by 3-BrPA in a time- and concentration-dependent manner. Exposure to 80, 160, and 320 µmol·L(-1) 3-BrPA for 24 h resulted in cell apoptosis rates of 6.7%, 22.3%, and 79.6%, respectively, and the intracellular ATP levels of SK-BR-3 cells treated with 80, 160, 320 µmol·L(-1) 3-BrPA for 5 h were 87.7%, 60.6%, and 23.7% of the control levels. 3-BrPA at 160 µmol·L(-1) increased reactive oxygen levels and lowered mitochondrial membrane potential of SK-BR-3 cells. 3-BrPA can inhibit cell proliferation, reduce the mitochondrial membrane potential and induce apoptosis in SK-BR-3 cells, the mechanism of which may involve a reduced ATP level by inhibiting glycolysis and increasing the reactive oxygen level in the cells.
Fisetin induces apoptosis through mitochondrial apoptosis pathway in human uveal melanoma cells.
Wang, Kai; Hu, Dan-Ning; Lin, Hui-Wen; Yang, Wei-En; Hsieh, Yi-Hsien; Chien, Hsiang-Wen; Yang, Shun-Fa
2018-05-01
Fisetin, a diatery flavonoid, been reported that possess anticancer effects in various cancers. The purpose of the study was to investigate the antitumor effects of fisetin in cultured uveal melanoma cell lines and compared with normal retinal pigment epithelial (RPE) cells. MTT assay was used for evaluating cytotoxic effects of fisetin. Flow cytometry study was used for the determination of apoptosis. JC-1 fluorescent reader was used to determine mitochondrial transmembrane potential changes. The results shown that fisetin dose-dependently decreased the cell viability of uveal melanoma cells but not influenced the cell viability of RPE cells. Apoptosis of uveal melanoma cells was induced by fisetin efficiently. Fisetin inhibited antiapoptotic Bcl-2 family proteins and damaged the mitochondrial transmembrane potential. The levels of proapoptotic Bcl-2 proteins, cytochrome c, and various caspase activities were increased by fisetin. In conclusion, fisetin induces apoptosis of uveal melanoma cells selectively and may be a promising agent to be explored for the treatment of uveal melanoma. © 2018 Wiley Periodicals, Inc.
Application of foraminifers in ecotoxicology: Retrospect, perspect and prospect
Digital Repository Service at National Institute of Oceanography (India)
Nigam, R.; Saraswat, R.; Panchang, R.
:112-123; 1964a. Bandy, O.; Ingle Jr., J.C.; Resig, J.M. Foraminifera, Los Angeles County outfall area, California. Limnol. Oceanogra. 9:124-137; 1964b. Bandy, O.; Ingle Jr., J.C.; Resig, J.M. Modification of foraminiferal trends, Hyperion Outfall, California.... Micropal. 10:109-113; 1991. Stott, L.D.; Hayden, T.P.; Griffith, J. Benthic foraminifera at the Los Angeles county Whites Point outfall revisited. J. Foram. Res. 26:357-368; 1996. Stouff, V.; Geslin, E.; Debenay, J.-P.; Lesourd, M. Origin...
Imaging manifestations of progressive multifocal leukoencephalopathy
International Nuclear Information System (INIS)
Shah, R.; Bag, A.K.; Chapman, P.R.; Cure, J.K.
2010-01-01
Progressive multifocal leukoencephalopathy (PML) is a demyelinating disease caused by reactivation of JC virus in immunosuppressed patients. The diagnosis is usually suggested on imaging and confirmed by cerebrospinal fluid polymerase chain reaction (PCR) for JC virus DNA. In this article, we review the imaging manifestations of PML on computed tomography (CT), magnetic resonance imaging (MRI), diffusion-weighted imaging (DWI), diffusion tensor imaging (DTI), MR spectroscopy, single photon-emission computed tomography (SPECT) and positron-emission tomography (PET), and outline the role of imaging in follow-up and prognostication.
Progressive multifocal leucoencephalopathy in a patient with idiopathic CD4+ lymphocytopenia.
LENUS (Irish Health Repository)
Moloney, F
2012-03-01
Progressive multifocal leucoencephalopathy (PML) is an opportunistic, demyelinating neurological disease caused by reactivation of the JC polyomavirus. PML occurs almost exclusively in immunosuppressed individuals, with only isolated case reports of PML occurring in patients without apparent immunosuppression. Idiopathic CD4+ lymohocytopenia (ICL) is a syndrome defined by the Centre for Disease Control and Prevention as a CD4+ count <300 cells\\/uL or <20% of total T cell count on >1 occasion, with no evidence of human immunodeficiency virus (HIV) infection, and the absence of other known immunodeficiency or therapy associated with lymphocytopenia. We describe a case of PML occurring in a patient with idiopathic CD4+ lymphocytopenia.
Human Rights, Human Needs, Human Development, Human Security
Gasper, Des
2009-01-01
Human rights, human development and human security form increasingly important, partly interconnected, partly competitive and misunderstood ethical and policy discourses. Each tries to humanize a pre-existing and unavoidable major discourse of everyday life, policy and politics; each has emerged within the United Nations world; each relies implicitly on a conceptualisation of human need; each has specific strengths. Yet mutual communication, understanding and co-operation are deficient, espec...
Loveley, M. R.; Marcantonio, F.; Lyle, M. W.; Wang, J. K.
2013-12-01
In this study, we attempt to understand how preferential sorting of fine particles during redistribution processes in the Panama Basin affects the 230Th constant-flux proxy. Fine particles likely contain greater amounts of 230Th, so that preferential sorting of fine particles may bias sediment mass accumulation rates (MARs). We examined sediments that span the past 25 kyr from two new sediment cores retrieved within about 56 km of each other in the northern part of the basin (MV1013-01-'4JC', 5° 44.699'N 85° 45.498' W, 1730 m depth; MV1014-01-'8JC', 6° 14.038'N 86° 2.613' W, 1993 m depth). Core 4JC, closer to the ridge top that bounds the basin (Cocos Ridge), has a thin sediment drape, while the deeper core 8JC, has a thicker sediment drape and lies further from the ridge top. 230Th-derived focusing factors from 4JC are similar and suggest winnowing with average values of about 0.5 and 0.6 during the Holocene and the last glacial, respectively. For 8JC, calculated average focusing factors are significantly different and suggest focusing with values of about 2 during the Holocene and 4 during the last glacial. Since the two sites are close to each other, one would expect similar rain rates and, therefore, similar 230Th-derived MARs within similar windows of time, i.e., the rain rate should not vary significantly at each site temporally. In addition, the radiocarbon-derived sand (>63μm) MARs should behave similarly since coarser particles are likely not transported by bottom currents. Sand MARs are, indeed, similar during the Holocene and the last glacial at each site. During the last glacial, however, sand MARs are about a factor of 3 higher than those during the Holocene. On the other hand, there is little variability in the 230Th-derived MARs both spatially and temporally. We interpret the discrepancies between the radiocarbon-derived sand and 230Th-derived MARs as being due to preferential sorting of fine particles during the redistribution of sediments by
Yang, Yumei; Luo, Zhu; Zhang, Mengru; Liu, Chang; Gong, Ming; Zou, Zhurong
2016-04-01
H(+)-pyrophosphatase (H(+)-PPase) is a primary pyrophosphate (PPi)-energized proton pump to generate electrochemical H(+) gradient for ATP production and substance translocations across membranes. It plays an important role in stress adaptation that was intensively substantiated by numerous transgenic plants overexpressing H(+)-PPases yet devoid of any correlated studies pointing to the elite energy plant, Jatropha curcas. Herein, we cloned the full length of J. curcas H(+)-PPase (JcVP1) complementary DNA (cDNA) by reverse transcription PCR, based on the assembled sequence of its ESTs highly matched to Hevea brasiliensis H(+)-PPase. This gene encodes a polypeptide of 765 amino acids that was predicted as a K(+)-dependent H(+)-PPase evolutionarily closest to those of other Euphorbiaceae plants. Many cis-regulatory elements relevant to environmental stresses, molecular signals, or tissue-specificity were identified by promoter prediction within the 1.5-kb region upstream of JcVP1 coding sequence. Meanwhile, the responses of JcVP1 expression to several common abiotic stresses (salt, drought, heat, cold) were characterized with a considerable accordance with the inherent stress tolerance of J. curcas. Moreover, we found that the heterologous expression of JcVP1 could significantly improve the salt tolerance in both recombinant Escherichia coli and Saccharomyces cerevisiae, and this effect could be further fortified in yeast by N-terminal addition of a vacuole-targeting signal peptide from the H(+)-PPase of Trypanosoma cruzi.
Micro Computer Feedback Report for the Strategic Leader Development Inventory; Source Code
1994-03-01
SEL5 ;exit if error CALL SELZCT SCRZEN ;display select screen JC SEL4 ;no files in directory .------- display the files NOV BX, [BarPos] ;starting...SEL2 ;if not goto next test imp SEL4 ; Ecit SEL2: CUP AL,ODh ;in it a pick ? 3Z SEL3 ;if YES exit loop ------- see if an active control key was...file CALL READCOMFIG eread file into memory JC SEL5 ;exit to main menu CALL OPEN DATA FILE ;is data arailable? SEL4 : CALL RELEASE_ _MDR ;release mom
Self-field instabilities in high-$J_{c}$ Nb$_{3}$Sn strands the effect of copper RRR
Bordini, B
2009-01-01
High critical current density (Jc) Nb$_{3}$Sn conductor is the best candidate for next generation high field (> 10 T) accelerator magnets. Although very promising, state of the art high-Jc Nb$_{3}$Sn strands suffer of magneto-thermal instabilities that can severely limit the strand performance. Recently it has been shown that at 1.9 K the self field instability is the dominating mechanism that limits the performance of strands with a low (<10) Residual Resistivity Ratio (RRR) of the stabilizing copper. At CERN several state of the art high–Jc Nb$_{3}$Sn wires have been tested at 4.2 K and 1.9 K to study the effects on strand self-field instability of: RRR and strand impregnation with stycast. To study the effect of the RRR value on magneto-thermal instabilities, a new 2-D finite element model was also developed at CERN. This model simulates the whole development of the flux jump in the strand cross section also taking into account the heat and current diffusion in the stabilizing copper. In this paper th...
Sáyago-Ayerdi, Sonia G; Mateos, Raquel; Ortiz-Basurto, Rosa I; Largo, Carlota; Serrano, José; Granado-Serrano, Ana Belén; Sarriá, Beatriz; Bravo, Laura; Tabernero, María
2014-04-01
Dietary fibre (DF) obtained from Agave tequilana, which is rich in fructans and insoluble DF, and jamaica calyces (Hibiscus sabdariffa), which is rich in DF and phenolic compounds, were assessed as new potential functional ingredients using the hypercholesterolemic animal model. Wistar rats (200-250 g) were divided into 3 groups (n=8) and fed with cholesterol-rich diets supplemented with cellulose (CC, control), agave DF (ADF) or ADF with jamaica calyces (ADF-JC). After consuming the test diets for 5 weeks, weight gain in the ADF-JC group was significantly lower than in the other groups. The ADF and ADF-JC groups had a reduced concentration of cholesterol transporters in the caecum tissue, although no changes were observed in the plasma lipid profile. Both treatments improved the redox status by reducing the malondialdehyde serum levels and protein oxidative damage, compared to the CC group. DF from A. tequilana alone, or in combination with jamaica calyces, shows promising potential as a bioactive ingredient. Copyright © 2013 Elsevier Ltd. All rights reserved.
Analysis of filler particle levels and sizes in dental alginates
Directory of Open Access Journals (Sweden)
Hugo Lemes Carlo
2010-06-01
Full Text Available The aim of this study was to determine the inorganic filler fractions and sizes of commercially alginates. The inorganic particles volumetric fractions of five alginates - Jeltrate(J, Jeltrate Plus(JP, Jeltrate Chromatic Ortho(JC, Hydrogum(H and Ezact Krom(E were accessed by weighing a previously determined mass of each material in water before and after burning samples at 450 °C for 3 hours. Unsettled materials were soaked in acetone and chloroform and sputter-coated with gold for SEM evaluation of fillers' morphology and size. The results for the volumetric inorganic particle content were (%: J - 48.33, JP - 48.33, JC - 33.79, H - 37.55 and E - 40.55. The fillers presented a circular appearance with helical form and various perforations. Hydrogum fillers looked like cylindrical, perforated sticks. The mean values for fillers size were (μm: J - 12.91, JP - 13.67, JC - 13.44, E - 14.59 and H - 9 (diameter, 8.81 (length. The results of this study revealed differences in filler characteristics that could lead to different results when testing mechanical properties.
Neutron radiographic techniques, facilities and applications
International Nuclear Information System (INIS)
Domanus, J.C.
1984-08-01
This is a collection of three papers, written for presentation on two international conferences. The first paper: ''Neutron radiography. Techniques and facilities'', written by J.P. Barton of N-Ray Engineering Co. La Jolla, CA., USA and J.C. Domanus was presented at the International Symposium on the Use and Development of Low and Medium Flux Research Reactors at the Massachusets Institute of Technology, Cambridge, Mass., USA, 16-19 October 1983. The second paper: ''Neutron radiography with the DR-1 reactor at Risoe National Laboratory'', written by J.C. Domanus, was presented at the same Symposium. The third paper: ''Defects in nuclear fuel revealed by neutron radiography'', written by J.C. Domanus is accepted for presentation on 18 October 1984 to the 3rd European Conference on Nondestructive Testing, Florence, Italy, 15-18 October 1984. While the first paper describes the principles of neutron radiographic techniques and facilities, the second one describes an example of such facility and the third gives an example of application of neutron radiography in the field of nuclear fuel. (author)
Energy Technology Data Exchange (ETDEWEB)
Polat, Ozgur [ORNL; Aytug, Tolga [ORNL; Paranthaman, Mariappan Parans [ORNL; Leonard, Keith J [ORNL; Pennycook, Stephen J [ORNL; Kim, Kyunghoon [ORNL; Cook, Sylvester W [ORNL; Thompson, James R [ORNL; Christen, David K [ORNL; Goyal, Amit [ORNL; Selvamanickam, V. [SuperPower Incorporated, Schenectady, New York; Lupini, Andrew R [ORNL; Meyer, Hendrik [ORNL; Qiu, Xiaofeng [ORNL; Xiong, X. [SuperPower Incorporated, Schenectady, New York
2011-01-01
Technological applications of high temperature superconductors (HTS) require high critical current density, Jc, under operation at high magnetic field strengths. This requires effective flux pinning by introducing artificial defects through creative processing. In this work, we generated correlated disorder for strong vortex pinning in the YBa2Cu3O7- (YBCO) films by replacing the standard LaMnO3 (LMO) cap buffer layers in ion beam assisted deposited MgO templates with LMO:MgO composite films. Such films revealed formation of two phase-separated, but at the same time vertically aligned, self-assembled composite nanostructures that extend throughout the entire thickness of the film. Measurements of magnetic-field orientation-dependent Jc of YBCO coatings deposited on these nanostructured cap layers showed correlated c-axis pinning and improved in-field Jc performance compared to those of YBCO films deposited on standard LMO buffers. The present results demonstrate feasibility of novel and potentially practical approaches in the pursuit of more efficient, economical, and high performance superconducting devices.
Dai, B.; Zhu, J.; Liu, K.; Yang, L.; Han, J.
2017-07-01
Amorphous rare earth-transitional metal (RETM) GdFeCo memory layer with RE- and TM-rich compositions was fabricated in stacks of GdFeCo (10 nm)/Cu (3 nm)/[Co(0.2 nm)/Pd(0.4 nm)]6. Their magnetic properties and spin transfer torque (STT) switching of magnetization were investigated. The maximum magneto-resistance (MR) was around 0.24% for the TM-rich Gd21.4 (Fe90Co10)78.6 memory layer and was -0.03% for the RE-rich Gd29.0 (Fe90Co10)71.0 memory layer. The critical current densities Jc to switch the GdFeCo memory layers are in the range of 1.4 × 107 A/cm2-4.5 × 107 A/cm2. The dependence of critical current density Jc and effective anisotropy constant Keff on Gd composition were also investigated. Both Jc and Keff have maximum values in the Gd composition range from 21-29 at.%, suitable for thermally assisted STT-RAM for storage density exceeding Gb/inch2.
Self Concept and Learned Helplessness in a group of teachers from Lima Metropolitana
Directory of Open Access Journals (Sweden)
Sandra Carrillo Luna
2001-06-01
Full Text Available 86 teachers from Lima Metropolitana trained by PLANCAD were assessed with the Self Perception Profile for Adult~ (Messer y Harter, 1986 and with a Learned Helplessness Scale (Macassi, 1988. Correlations between the different domains from Self Concept (SC, Learned Helplessness (LH and sorne social-demographic variables were analyzed. The result~ showed that the LH exhibits significan! and inverse correlations with sorne domains of SC such a~: lntelligence, Job Competence (JC. Sociability, Adequate Provider (AP, Physical Appearance (PA, lntimate Relationships (IR, Academic Achievement (AA and the Job Satisfaction Degree. They also showed significan! correlations between the variable age and two domains of SC: Sociability and IR; between Career Satisfaction and the SC domains of Sociability, AP, JC and IR; also between Job Satisfaction and the SC domains of lntelligence, Household Management, JC, AP, PA and IR. Finally significan! correlations were showed between Academic Achievement with the domain of Sociability. The results also showed significan! Differences between the punctuation obtained from the variables of sex, the institutions.
Strongly enhanced current densities in Sr0.6K0.4Fe2As2 + Sn superconducting tapes
Lin, He; Yao, Chao; Zhang, Xianping; Zhang, Haitao; Wang, Dongliang; Zhang, Qianjun; Ma, Yanwei; Awaji, Satoshi; Watanabe, Kazuo
2014-03-01
Improving transport current has been the primary topic for practical application of superconducting wires and tapes. However, the porous nature of powder-in-tube (PIT) processed iron-based tapes is one of the important reasons for low critical current density (Jc) values. In this work, the superconducting core density of ex-situ Sr0.6K0.4Fe2As2 + Sn tapes, prepared from optimized precursors, was significantly improved by employing a simple hot pressing as an alternative route for final sintering. The resulting samples exhibited optimal critical temperature (Tc), sharp resistive transition, small resistivity and high Vickers hardness (Hv) value. Consequently, the transport Jc reached excellent values of 5.1 × 104 A/cm2 in 10 T and 4.3 × 104 A/cm2 in 14 T at 4.2 K, respectively. Our tapes also exhibited high upper critical field Hc2 and almost field-independent Jc. These results clearly demonstrate that PIT pnictide wire conductors are very promising for high-field magnet applications.
Proteomic analysis of oil bodies in mature Jatropha curcas seeds with different lipid content.
Liu, Hui; Wang, Cuiping; Chen, Fan; Shen, Shihua
2015-01-15
To reveal the difference among three mature Jatropha curcas seeds (JcVH, variant with high lipid content; JcW, wild type and JcVL, variant with low lipid content) with different lipid content, comparative proteomics was employed to profile the changes of oil body (OB) associated protein species by using gels-based proteomic technique. Eighty-three protein species were successfully identified through LTQ-ES-MS/MS from mature JcW seeds purified OBs. Two-dimensional electrophoresis analysis of J. curcas OB associated protein species revealed they had essential interactions with other organelles and demonstrated that oleosin and caleosin were the most abundant OB structural protein species. Twenty-eight OB associated protein species showed significant difference among JcVH, JcW and JcVL according to statistical analysis. Complementary transient expression analysis revealed that calcium ion binding protein (CalBP) and glycine-rich RNA binding protein (GRP) were well targeted in OBs apart from the oleosins. This study demonstrated that ratio of lipid content to caleosins abundance was involved in the regulation of OB size, and the mutant induced by ethylmethylsulfone treatment might be related to the caleosin like protein species. These findings are important for biotechnological improvement with the aim to alter the lipid content in J. curcas seeds. The economic value of Jatropha curcas largely depends on the lipid content in seeds which are mainly stored in the special organelle called oil bodies (OBs). In consideration of the biological importance and applications of J. curcas OB in seeds, it is necessary to further explore the components and functions of J. curcas OBs. Although a previous study concerning the J. curcas OB proteome revealed oleosins were the major OB protein component and additional protein species were similar to those in other oil seed plants, these identified OB associated protein species were corresponding to the protein bands instead of protein
D.R. Gasper (Des)
2007-01-01
markdownabstractAbstract: Human rights, human development and human security form increasingly important, partly interconnected, partly competitive and misunderstood ethical and policy discourses. Each tries to humanize a pre-existing and unavoidable major discourse of everyday life, policy and
D.R. Gasper (Des)
2007-01-01
textabstractHuman rights, human development and human security form increasingly important, partly interconnected, partly competitive and misunderstood ethical and policy discourses. Each tries to humanize a pre-existing and unavoidable major discourse of everyday life, policy and politics; each
International Nuclear Information System (INIS)
Engkir Sukirman; Wisnu Ari Adi; Puji Sulisworo dan W Prasuad
1999-01-01
The influence of silver additions on the critical current density (Jc) of BPSCCO-bulk superconductor was investigated, with the aim of getting an increase of its Jc and trying to find out a correlation of Jc and structures of BPSCCO-silver composites. The BPSCCO-system superconductors with nominal composition Bi 1.84 Pb 0.34 Sr 2.00 Ca 2.03 Cu 3.06 O x (2223-phase) were synthesized by using solid state reaction method. The silver added was in the powder-AgO form varied from 0 to 30 wt % AgO. The critical current density, crystal structure, and micro-structure of BPSCCO-silver composites were characterized by means of four-point probe, x-ray diffractometer, and scanning electron microscope that is equipped with a link system energy dispersive spectrometer. It was found that silver additions to BPSCCO cause a reasonable improvement in Jc from 120 to 215 A/cm 2 , and a slight increase in Tc from 92 to 108 K, and lattice parameters of the 2223-phase from a 3.811(3) to 3.820(2) A, and from c = 37.08(3) to 37.15(2) A, with the optimum value occurs at 20 wt % AgO. The AgO powders added to the BPSCCO specimens were converted to Ag 2 O and metallic Ag during the annealing process at 827degC for 96 h in air. The addition of AgO to BPSCCO system does not necessarily lead to decomposition of the 2223-phase. The AgO reacts with and suppresses the 2201-phase. (author)
Gadelha, Cibelle Gomes; Miranda, Rafael de Souza; Alencar, Nara Lídia M; Costa, José Hélio; Prisco, José Tarquinio; Gomes-Filho, Enéas
2017-05-01
Jatropha curcas is an oilseed species that is considered an excellent alternative energy source for fossil-based fuels for growing in arid and semiarid regions, where salinity is becoming a stringent problem to crop production. Our working hypothesis was that nitric oxide (NO) priming enhances salt tolerance of J. curcas during early seedling development. Under NaCl stress, seedlings arising from NO-treated seeds showed lower accumulation of Na + and Cl - than those salinized seedlings only, which was consistent with a better growth for all analyzed time points. Also, although salinity promoted a significant increase in hydrogen peroxide (H 2 O 2 ) content and membrane damage, the harmful effects were less aggressive in NO-primed seedlings. The lower oxidative damage in NO-primed stressed seedlings was attributed to operation of a powerful antioxidant system, including greater glutathione (GSH) and ascorbate (AsA) contents as well as catalase (CAT) and glutathione reductase (GR) enzyme activities in both endosperm and embryo axis. Priming with NO also was found to rapidly up-regulate the JcCAT1, JcCAT2, JcGR1 and JcGR2 gene expression in embryo axis, suggesting that NO-induced salt responses include functional and transcriptional regulations. Thus, NO almost completely abolished the deleterious salinity effects on reserve mobilization and seedling growth. In conclusion, NO priming improves salt tolerance of J. curcas during seedling establishment by inducing an effective antioxidant system and limiting toxic ion and reactive oxygen species (ROS) accumulation. Copyright © 2017 Elsevier GmbH. All rights reserved.
Directory of Open Access Journals (Sweden)
Kasim Khan
Full Text Available Drought and high salinity are environmental conditions that cause adverse effects on the growth and productivity of crops. Aquaporins are small integral membrane proteins that belong to the family of the major intrinsic proteins (MIPs, with members in animals, plants and microbes, where they facilitate the transport of water and/or small neutral solutes thereby affecting water balance. In this study we characterized two aquaporin genes namely, plasma membrane intrinsic protein (PIP2;7 and tonoplast intrinsic protein TIP1;3 from Jatropha curcas that are localised to the plasma membrane and vacuole respectively. Transgenic Arabidopsis thaliana lines over-expressing JcPIP2;7 and JcTIP1;3 under a constitutive promoter show improved germination under high salt and mannitol compared to control seeds. These transgenic plants also show increased root length under abiotic stress conditions compared to wild type Col-0 plants. Transgenic lines exposed to drought conditions by withholding water for 20 days, were able to withstand water stress and attained normal growth after re-watering unlike control plants which could not survive. Transgenic lines also had better seed yield than control under salt stress. Importantly, seed viability of transgenic plants grown under high salt concentration was 35%-45% compared to less than 5% for control seeds obtained from plants growing under salt stress. The effect of JcPIP2;7 and JcTIP1;3 on improving germination and seed viability in drought and salinity make these important candidates for genetic manipulation of plants for growth in saline soils.
Ambulatory blood pressure and tubulointerstitial injury in patients with IgA nephropathy.
Haruhara, Kotaro; Tsuboi, Nobuo; Koike, Kentaro; Kanzaki, Go; Okabayashi, Yusuke; Miyazaki, Yoichi; Kawamura, Tetsuya; Ogura, Makoto; Yokoo, Takashi
2015-12-01
Few studies have been conducted to assess the ambulatory blood pressure (ABP) in IgA nephropathy (IgAN) patients. This study aimed to determine the relationships between ABP and renal histopathological findings assessed using the Oxford classification (OC) and the Japanese classification (JC), which have recently established histopathological criteria for IgAN. This cross-sectional study included biopsy-diagnosed IgAN patients, in whom both a renal biopsy and ABP measurement were performed. The histopathological findings were assessed using the OC and the JC and were analyzed in relation to the ABP. A total of 111 IgAN patients were included. The score of interstitial fibrosis and tubular atrophy (T score) using the OC was a significantly associated factor with both the daytime and nighttime ABP values. In contrast, the other histopathological scores, including mesangial hypercellularity, endocapillary hypercellularity and segmental glomerulosclerosis, did not show significant associations with the ABP. The histological grade (H-grade) using the JC, which was based on the sum of injured glomeruli, was associated with the daytime ABP, but not with the nighttime ABP. The associations between the T score using the OC (%) and the daytime and nighttime ABP values were independent of age, gender, renal function, proteinuria and the use of antihypertensive medications, whereas the H-grade using the JC (%) did not show significant associations after adjusting for these clinical parameters. These results suggest that the T score using the OC is the most relevant renal histopathological parameter associated with abnormalities of circadian blood pressure in IgAN patients.
Validation of the Intelligibility in Context Scale for Jamaican Creole-Speaking Preschoolers.
Washington, Karla N; McDonald, Megan M; McLeod, Sharynne; Crowe, Kathryn; Devonish, Hubert
2017-08-15
To describe validation of the Intelligibility in Context Scale (ICS; McLeod, Harrison, & McCormack, 2012a) and ICS-Jamaican Creole (ICS-JC; McLeod, Harrison, & McCormack, 2012b) in a sample of typically developing 3- to 6-year-old Jamaicans. One-hundred and forty-five preschooler-parent dyads participated in the study. Parents completed the 7-item ICS (n = 145) and ICS-JC (n = 98) to rate children's speech intelligibility (5-point scale) across communication partners (parents, immediate family, extended family, friends, acquaintances, strangers). Preschoolers completed the Diagnostic Evaluation of Articulation and Phonology (DEAP; Dodd, Hua, Crosbie, Holm, & Ozanne, 2006) in English and Jamaican Creole to establish speech-sound competency. For this sample, we examined validity and reliability (interrater, test-rest, internal consistency) evidence using measures of speech-sound production: (a) percentage of consonants correct, (b) percentage of vowels correct, and (c) percentage of phonemes correct. ICS and ICS-JC ratings showed preschoolers were always (5) to usually (4) understood across communication partners (ICS, M = 4.43; ICS-JC, M = 4.50). Both tools demonstrated excellent internal consistency (α = .91), high interrater, and test-retest reliability. Significant correlations between the two tools and between each measure and language-specific percentage of consonants correct, percentage of vowels correct, and percentage of phonemes correct provided criterion-validity evidence. A positive correlation between the ICS and age further strengthened validity evidence for that measure. Both tools show promising evidence of reliability and validity in describing functional speech intelligibility for this group of typically developing Jamaican preschoolers.
Huo, Li-Jun; Ma, Xing-Hong; Yang, Zeng-Ming
2002-10-15
The purpose of this study was to assess sperm quality in extended boar semen during in vitro storage in order to determine which extender should be used and how long boar semen can be stored. Freshly ejaculated boar semen was diluted with equal volumes of Beltsville thaw solution (BTS), Androhep, KIEV or Zorlesco extenders and stored at 17 degrees C for up to 15 days. Sperm quality was evaluated by examining viability using SYBR-14/PI and Hoechst 33258 staining, mitochondrial activity using 5,5',6,6'-tetrachloro-1,1',3,3'-tetraethylbenzimidazolyl-carbocyanine iodide (JC-1) staining, acrosome intactness by Coomassie blue staining, and capacitation status by chlortetracycline (CTC) staining. There were over 50% viable spermatozoa in boar semen extended with Zorlesco and Androhep extenders on Day 13 of storage. The percentage of JC-1-stained spermatozoa was 53.8 +/- 2.1% for Zorlesco and 57.7 +/- 1.60% for Androhep extenders on Day 13 of storage. The percentage of acrosome-intact spermatozoa detected by Coomassie blue staining was higher than that in the SYBR-14PI-, Hoechst 33258-, and JC-1-stained samples in our study. The results from SYBR-14/PI, Hoechst 33258, JC-1, and Coomassie blue staining were highly correlated (r > or = 0.9461). There were less than 15% capacitated spermatozoa in the semen extended with BTS, Androhep and Zorlesco extenders during 9 days of storage. However, most viable boar spermatozoa became capacitated by Day 13 of storage. The rank order of four extenders for maintaining sperm viability and mitochondrial activity was as follows: Androhep, Zorlesco, BTS, KIEV.
Darbinyan, Armine; Major, Eugene O; Morgello, Susan; Holland, Steven; Ryschkewitsch, Caroline; Monaco, Maria Chiara; Naidich, Thomas P; Bederson, Joshua; Malaczynska, Joanna; Ye, Fei; Gordon, Ronald; Cunningham-Rundles, Charlotte; Fowkes, Mary; Tsankova, Nadejda M
2016-07-13
Human BK polyomavirus (BKV) is reactivated under conditions of immunosuppression leading most commonly to nephropathy or cystitis; its tropism for the brain is rare and poorly understood. We present a unique case of BKV-associated encephalopathy in a man with hypohidrotic ectodermal dysplasia and immunodeficiency (HED-ID) due to IKK-gamma (NEMO) mutation, who developed progressive neurological symptoms. Brain biopsy demonstrated polyomavirus infection of gray and white matter, with predominant involvement of cortex and distinct neuronal tropism, in addition to limited demyelination and oligodendroglial inclusions. Immunohistochemistry demonstrated polyoma T-antigen in neurons and glia, but expression of VP1 capsid protein only in glia. PCR analysis on both brain biopsy tissue and cerebrospinal fluid detected high levels of BKV DNA. Sequencing studies further identified novel BKV variant and disclosed unique rearrangements in the noncoding control region of the viral DNA (BKVN NCCR). Neuropathological analysis also demonstrated an unusual form of obliterative fibrosing vasculopathy in the subcortical white matter with abnormal lysosomal accumulations, possibly related to the patient's underlying ectodermal dysplasia. Our report provides the first neuropathological description of HED-ID due to NEMO mutation, and expands the diversity of neurological presentations of BKV infection in brain, underscoring the importance of its consideration in immunodeficient patients with unexplained encephalopathy. We also document novel BKVN NCCR rearrangements that may be associated with the unique neuronal tropism in this patient.
Energy Technology Data Exchange (ETDEWEB)
Watanabe, M.; Iwata, H.; Tanabe, S. [Ehime Univ., Matsuyama (Japan); Yoneda, K.; Hashimoto, T. [Japan Wildlife Research Center, Tokyo (Japan)
2004-09-15
Jungle crow (JC; Corvus macrorhynchos) is a useful bioindicator for monitoring contaminants in urban areas, because this species is residential, occupies a same habitat as human, and feeds variety of foods including domestic waste and garbage. Therefore, JCs may accumulate environmental contaminants such as polychlorinated dibenzo-p-dioxins (PCDDs), dibenzofurans (PCDFs) and coplanar polychlorinated biphenyls (Co-PCBs), which are released by human activities. Induction of cytochrome P450 (CYP) 1A is a responsive mechanism elicited by exposure to dioxinlike compounds including PCDDs/DFs and Co-PCBs. Toxicokinetic behavior of dioxin-like compounds in organisms is controlled by excretion, metabolism and absorption. These processes are, at least partly, dependent on CYP1A expression in addition to chemical structure and number of chlorine substitution of each congener. Low chlorinated congeners such as 2378-T{sub 4}CDD, 2378- T{sub 4}CDF, 12378-P{sub 5}CDD and 33'44'-PCB were easily metabolized by CYP1A1/2 in rat liver microsomes. PCDDs/DFs accumulate in hepatic tissue to a greater extent than adipose tissue in rats and mice. Recent study using transgenic CYP1A2 knockout mice demonstrated that CYP1A2 is responsible for the sequestration of 2378-T{sub 4}CDD and 23478-P{sub 5}CDF in hepatic tissue. Therefore, CYP1A is considered as a key factor responsible for toxicokinetics of dioxin-like compounds. However, there's no comprehensive data on the contribution of CYP1A to the toxicokinetics of dioxin-like congeners in wild populations. In this study, we investigated contamination levels of PCDDs/DFs and Co-PCBs in liver and breast muscle of JCs from Tokyo, Japan, and interactions of dioxin-like congeners with hepatic CYP to elucidate congener-specific toxicokinetics related to CYP expression in JC.
V3Si multifilamentary superconductor with high overall Jc
International Nuclear Information System (INIS)
Takeuchi, Takao; Inoue, Kiyoshi; Kosuge, Michio; Iijima, Yasuo; Watanabe, Kazuo
1994-01-01
V 3 Si is one of the A15-type superconducting compounds from which single crystals can be quite easily obtained due to the nature of the equilibrium phase diagram. Thus, the fundamental characteristics of A15 compounds (such as electronic structure and cubic-to-tetragonal structural transformation) have been studied with this compound. V 3 Si is, however, also promising in practical use as an alternative to Nb 3 Sn for high field magnets, since the upper critical field H c2 (4.2 K) is more than 20 T. Although the open-quotes bronze process,close quotes the established commercial process to produce Nb 3 Sn conductors, is also available for V 3 Si, the ternary section of the Cu-V-Si phase diagram indicates two diffusion paths are possible: One from the bronze with low Si content (Si 3 Si, and the other from the bronze with higher Si content to V 3 Si via V 5 Si 3 . The high Si bronze is likely to be advantageous in reducing the bronze volume fraction and hence achieving high overall critical current density J c . This is because the initially formed V 5 Si 3 is eventually converted to V 3 Si as long as the total proportion of V to Si in the composite (overall V/Si molar ratio) is kept around 3. However, long times at high temperatures are necessary for appreciable V 3 Si layer growth, thereby yielding grain growth of V 3 Si and lowering the J c of the V 3 Si compound and the overall J c accordingly. In the present study, in order to improve the overall J c , the authors have realized ∼1μm filament diameter by preparing a double-stacked Cu-8.5at.%Si/V composite. The primary bundle is sheathed with a Ta tube. The Si in the bronze inside the Ta is available only for the diffusion reaction, and the overall V/Si ratios is ∼3
JC Knobel THE BALD AND GOLDEN EAGLE PROTECTION ACT
African Journals Online (AJOL)
USC 1531) (USA); and the Environment Protection and Biodiversity ... Province); Bophuthatswana Nature Conservation Act 3 of 1973 (Northwest Province, Free State) ... scientist may find it difficult to correctly identify members of the two species ..... usually sites its nest in trees close to water, the Golden Eagle usually breeds ...
Human niche, human behaviour, human nature.
Fuentes, Agustin
2017-10-06
The concept of a 'human nature' or 'human natures' retains a central role in theorizing about the human experience. In Homo sapiens it is clear that we have a suite of capacities generated via our evolutionary past, and present, and a flexible capacity to create and sustain particular kinds of cultures and to be shaped by them. Regardless of whether we label these capacities 'human natures' or not, humans occupy a distinctive niche and an evolutionary approach to examining it is critical. At present we are faced with a few different narratives as to exactly what such an evolutionary approach entails. There is a need for a robust and dynamic theoretical toolkit in order to develop a richer, and more nuanced, understanding of the cognitively sophisticated genus Homo and the diverse sorts of niches humans constructed and occupied across the Pleistocene, Holocene, and into the Anthropocene. Here I review current evolutionary approaches to 'human nature', arguing that we benefit from re-framing our investigations via the concept of the human niche and in the context of the extended evolutionary synthesis (EES). While not a replacement of standard evolutionary approaches, this is an expansion and enhancement of our toolkit. I offer brief examples from human evolution in support of these assertions.
DEFF Research Database (Denmark)
Li, Xiao-Fen; Grivel, Jean-Claude; Abrahamsen, Asger B.
2012-01-01
We have numerically proved that the dependence of AC susceptibility χ of a E(J) power law superconducting thin disc on many parameters can be reduced to one penetration parameter h, with E the electric field and J the current density. Based on this result, we propose a way of measuring the critical...... current density Jc of superconducting thin films by AC susceptibility. Compared with the normally used method based on the peak of the imaginary part, our method uses a much larger range of the AC susceptibility curve, thus allowing determination of the temperature (T) dependence of Jc from a normally...
Craig, Timothy J.; Parnell-Turner, Ross
2018-06-01
The microseismic hypocenters plotted in our study, derived in Parnell-Turner et al. (2017), used data collected by instrumentation from the NERC Ocean-Bottom Instrumentation Facility (Minshull et al., 2005) under the auspices of NERC projects NE/J022551/1, NE/J02029X/1 and NE/J021741/1 led by Tim Reston, Christine Peirce and Christopher MacLeod, during cruises JC102 and JC109 led by Christine Peirce. The raw seismic data from the OBS deployment are available from the NERC's British Oceanographic Data Centre (https://www.bodc.ac.uk), or by contacting the NERC grant-holders directly.
Beppu, Minako; Kawamoto, Michi; Nukuzuma, Souichi; Kohara, Nobuo
2012-01-01
We describe a case of a 67-year-old man with systemic lupus erythematosus who presented with progressive left hemiplegia. Although the cerebral spinal fluid (CSF) polymerase chain reaction (PCR) for the JC virus was negative, a brain biopsy confirmed the diagnosis of progressive multifocal leukoencephalopathy (PML). The tapering of prednisone and the use of cidofovir could not arrest the disease progression. Administration of mefloquine stopped the extension of the lesion, and resulted in obvious clinical improvement. The CSF nested PCR for the JC virus also became negative. This widely used drug should be tried for the treatment of non-HIV PML.
DEFF Research Database (Denmark)
Hellmér, Maria; Stranddorf, Kasper; Seidel, Michael
2017-01-01
from two urban waste water treatment plants in Copenhagen. All samples are investigated for their viral content and the presence of pathogens by metagenomic sequencing and analyzed specifically for HAdV, JCPyV, norovirus GI and GII (NoV GI and GII) using quantitative (q)PCR. Preliminary qPCR results......, the number of identified pathogenic viral species decreases with treatment of the waste water. Further bioinformatic analyses will investigate the seasonal variations of viral composition within a sample as well as the effect of the treatment system. Updated qPCR and metagenomics data will be presented....... are therefore using metagenomics sequencing with the aim to map the viriome in different water sources. In addition we investigate the possibility to use Human Adenovirus (HAdV) or JC Polyomavirus (JCPyV) as indicator for human fecal contamination. Water has been sampled monthly throughout the treatment process...
Rao, Dan; Wu, Miaoli; Wang, Jing; Yuan, Wen; Zhu, Yujun; Cong, Feng; Xu, Fengjiao; Lian, Yuexiao; Huang, Bihong; Wu, Qiwen; Chen, Meili; Zhang, Yu; Huang, Ren; Guo, Pengju
2017-12-01
Murine parvovirus is one of the most prevalent infectious pathogens in mouse colonies. A specific primer pair targeting the VP2 gene of minute virus of mice (MVM) and mouse parvovirus (MPV) was utilized for high resolution melting (HRM) analysis. The resulting melting curves could distinguish these two virus strains and there was no detectable amplification of the other mouse pathogens which included rat parvovirus (KRV), ectromelia virus (ECT), mouse adenovirus (MAD), mouse cytomegalovirus (MCMV), polyoma virus (Poly), Helicobactor hepaticus (H. hepaticus) and Salmonella typhimurium (S. typhimurium). The detection limit of the standard was 10 copies/μL. This study showed that the PCR-HRM assay could be an alternative useful method with high specificity and sensitivity for differentiating murine parvovirus strains MVM and MPV. Copyright © 2017 Elsevier B.V. All rights reserved.
Hemorrhagic Cystitis due to BK Reactivation in a Young Female Treated for Hodgkin-Disease
Directory of Open Access Journals (Sweden)
R. Le Calloch
2011-01-01
Full Text Available Hodgkin's lymphoma is a disease with a high rate of curability under classic chemo-radiotherapy regimes. Complications due to chemotherapy could include viral reactivation due to chronic lymphopenia. BK virus (BKV is a polyoma virus belonging to the Papovaviridae family with antibody seroprevalences in healthy populations varying from 60% to 80%. Initial infections are asymptomatic usually occur in early childhood, after which the viruses remain latent in the kidneys or urothelium. Reactivation of BKV occurs in individuals with severe immunosuppression during HIV infections, transplantation or, exceptionally, after classical chemotherapy. BKV incidence is approximately 0% to 5% in immunocompetent individuals. Reactivation is associated with nephropathy and haemorrhagic cystitis. Herein, we present a case of a haemorrhagic cystitis due to BKV reactivation in a patient with Hodgkin's disease treated with chemotherapy.
Merkel Cell Carcinoma: The Past, the Present, and the Future
International Nuclear Information System (INIS)
Erovic, I.; Erovic, B. M.
2013-01-01
Since the first description of the Merkel cell carcinoma by Cyril Toker in 1972, the number of studies has significantly increased over the last 4 decades. In this review, we will illustrate the historical background of the Merkel cell carcinoma beginning with the 19th century, the first description of the Merkel cell to the finding of the CK20 as a highly specific diagnostic marker and finally to the recently detected Merkel cell polyoma virus (MCPyV). Moreover, we will highlight the beginning of adjuvant therapeutic regimens with radiotherapy and chemotherapy and discuss the diagnostic work-up including imaging and histology of patients with Merkel cell carcinoma. Another very rapidly growing and interesting field of research is the development of patients' specific and tailored targeted therapy, in particular in patients with distant metastatic disease.
Asami, Tatsuya; Katayama, Hiroyuki; Torrey, Jason Robert; Visvanathan, Chettiyappan; Furumai, Hiroaki
2016-09-15
In order to properly assess and manage the risk of infection by enteric viruses in tap water, virus removal efficiency should be evaluated quantitatively for individual processes in actual drinking water treatment plants (DWTPs); however, there have been only a few studies due to technical difficulties in quantifying low virus concentration in water samples. In this study, the removal efficiency of indigenous viruses was evaluated for coagulation-sedimentation (CS) and rapid sand filtration (RSF) processes in a DWTP in Bangkok, Thailand by measuring the concentration of viruses before and after treatment processes using real-time polymerase chain reaction (qPCR). Water samples were collected and concentrated from raw source water, after CS, and after RSF, and inhibitory substances in water samples were reduced by use of a hydrophobic resin (DAX-8). Pepper mild mottle virus (PMMoV) and JC polyomavirus (JC PyV) were found to be highly prevalent in raw waters, with concentrations of 10(2.88 ± 0.35) and 10(3.06 ± 0.42) copies/L (geometric mean ± S.D.), respectively. Step-wise removal efficiencies were calculated for individual processes, with some variation observed between wet and dry seasons. During the wet season, PMMoV was removed less by CS and more by RSF on average (0.40 log10 vs 1.26 log10, respectively), while the reverse was true for JC PyV (1.91 log10 vs 0.49 log10, respectively). Both viruses were removed similarly during the dry season, with CS removing the most virus (PMMoV, 1.61 log10 and 0.78 log10; JC PyV, 1.70 log10, and 0.59 log10; CS and RSF, respectively). These differences between seasons were potentially due to variations in raw water quality and the characteristics of the viruses themselves. These results suggest that PMMoV and JC PyV, which are more prevalent in environmental waters than the other enteric viruses evaluated in this study, could be useful in determining viral fate for the risk management of viruses in water treatment
Increasing Hermaphrodite Flowers using Plant Growth Regulators in Andromonoecious Jatropha curcas
Directory of Open Access Journals (Sweden)
DASUMIATI
2014-09-01
Full Text Available Jatropha curcas (JC is a crop with potential for use in biodiesel. Production of biodiesel requires plant seed as raw material, so the viability of JC for use in biodiesel will dependent greatly on the plant's production of flowers. Generally, this plant is monoecious, meaning it has both male and female flowers. However, very rarely JC plants may be andromonoecious. Andromonoecious specimens of JC produce hermaphrodite and male flowers in the same plant. The number of hermaphrodite flowers per inflorescence is generally low compared to the number of male flowers. The aim of this study was to increase the proportion of hermaphrodite flowers by using plant growth regulators (PGRs in andromonoecious JC. Our experiment was conducted in Randomized Block Design (RBD with 9 treatments, namely kinetin, GA3, and IAA with concentrations of 0 ppm as a control, 50 and 100 ppm of each PGRs. The treatments were applied to stem cuttings from each plant and repeated 4 times. PGRs were applied by spraying the leaves within the buds of each plant. Applications took place weekly beginning when the plants entered flower initiating phase, until inflorescence produced. Observations were conducted during the treatment period (10 weeks. Results showed that plants treated with IAA, GA3, and kinetin at 50 and 100 ppm produced increased inflorescence per plant. The increases measured were 155.4 and 92.9% of (IAA, 120.4 and 151% (GA3, 96.6 and 51.7% (kinetin respectively. In addition, we found that application and GA3 at concentrations of 50 and 100 ppm, and kinetin at 50 ppm, increased the number of hermaphrodite flowers per inflorescence by 50%, and increased the number of hermaphrodite flowers per plant by 275.6 and 183.1% (IAA, 219.5 and 254.1% (GA3, 162.9 and 103.1% (kinetin respectively. As would be expected, the number of fruit per plant increased in those specimens treated with IAA, GA3, and kinetin at 50 and 100 ppm. The increases measured were 301.7 and 167
The pathogenesis of progressive multifocal leukoencephalopathy.
Berger, Joseph R; Khalili, Kamel
2011-12-01
Interest in pathogenesis of progressive multifocal leukoencephalopathy (PML) followed the observation of the high risk for the disease in HIV infection and the recent observation of an association with a variety of newer therapeutic modalities, e.g., natalizumab, an α4β1 integrin inhibitor, and efalizumab, an anti-CD11a monoclonal antibody. Any hypothesis of PML pathogenesis must account for a number of facts. Firstly, the causative agent JC virus is ubiquitously present, yet only a vanishingly small number of infected persons develop the disease. Secondly, disorders of cell-mediated immunity increase the risk of the disease, particularly HIV infection. Impaired innate immunity is not a risk for PML, and antibodies against JC virus are not protective. Thirdly, a latent period of several months appears necessary following the administration of natalizumab and efalizumab before PML develops. Fourthly, restoration of the immune system can arrest the PML. It is possible that infection with JC virus occurs with a form of the virus shed in the urine of as many as 40% of all adults and present in sewage worldwide. Once acquired, perhaps through an oropharyngeal route, it may replicate and disseminate. A neurotropic form of JC virus that replicates in glial tissues causes PML when immunosurveillance is impaired. There are many unanswered questions with respect to PML pathogenesis. How is virus acquired? What tissues are infected? What is the origin of the neurotropic form? When does virus enter brain? What is the role of central nervous system immunosurveillance? The lack of an animal model has made answering these questions challenging. © Discovery Medicine
A new shielding calculation method for X-ray computed tomography regarding scattered radiation.
Watanabe, Hiroshi; Noto, Kimiya; Shohji, Tomokazu; Ogawa, Yasuyoshi; Fujibuchi, Toshioh; Yamaguchi, Ichiro; Hiraki, Hitoshi; Kida, Tetsuo; Sasanuma, Kazutoshi; Katsunuma, Yasushi; Nakano, Takurou; Horitsugi, Genki; Hosono, Makoto
2017-06-01
The goal of this study is to develop a more appropriate shielding calculation method for computed tomography (CT) in comparison with the Japanese conventional (JC) method and the National Council on Radiation Protection and Measurements (NCRP)-dose length product (DLP) method. Scattered dose distributions were measured in a CT room with 18 scanners (16 scanners in the case of the JC method) for one week during routine clinical use. The radiation doses were calculated for the same period using the JC and NCRP-DLP methods. The mean (NCRP-DLP-calculated dose)/(measured dose) ratios in each direction ranged from 1.7 ± 0.6 to 55 ± 24 (mean ± standard deviation). The NCRP-DLP method underestimated the dose at 3.4% in fewer shielding directions without the gantry and a subject, and the minimum (NCRP-DLP-calculated dose)/(measured dose) ratio was 0.6. The reduction factors were 0.036 ± 0.014 and 0.24 ± 0.061 for the gantry and couch directions, respectively. The (JC-calculated dose)/(measured dose) ratios ranged from 11 ± 8.7 to 404 ± 340. The air kerma scatter factor κ is expected to be twice as high as that calculated with the NCRP-DLP method and the reduction factors are expected to be 0.1 and 0.4 for the gantry and couch directions, respectively. We, therefore, propose a more appropriate method, the Japanese-DLP method, which resolves the issues of possible underestimation of the scattered radiation and overestimation of the reduction factors in the gantry and couch directions.
Grajales-Nishimura, José Manuel; Ramos-Arias, Mario Alfredo; Solari, Luigi; Murillo-Muñetón, Gustavo; Centeno-García, Elena; Schaaf, Peter; Torres-Vargas, Ricardo
2018-04-01
The Juchatengo complex (JC) suite is located between the Proterozoic Oaxacan complex to the north and the Xolapa complex to the south, and was amalgamated by late Paleozoic magmatism. It consists of mafic and sedimentary rocks that have oceanic affinities, with internal pseudostratigraphic, structural and metamorphic characteristics, which resemble a typical upper-level ophiolite assemblage. New U-Pb zircon and previous hornblende K-Ar analyses yield ages of ca. 291-313 Ma (U-Pb) for plagiogranites and ca. 282-277 Ma for tonalites intruding the entire sequence, including pelagic sediments at the top, with a maximum deposition age of ca. 278 Ma and noteworthy local provenance. These data constrain the age of the JC to the Late Pennsylvanian-Early Permian period. Hf isotopic analyses obtained from zircons in the JC plagiogranite and tonalite show that they come from a similar primitive mantle source (176Hf/177Hf: 0.282539-0.283091; ƐHf(t): + 3.2 to + 15.0). ƐHf(t) values from near 0 to - 2.8 in the tonalites indicate a contribution from the continental crust. Trace elements and REE patterns in whole rock and zircons point to a primitive mantle source for differentiated mafic, plagiogranite dykes and tonalitic plutons. Geochronological and geochemical data address the generation of new oceanic crust above the subduction zone, probably in a backarc setting. In this tectonic scenario, the JC ophiolite originated due to the convergence of the paleo-Pacific plate below the already integrated Oaxacan and Acatlán complexes in western Pangea. The dextral displacement places the deformation in a transtensional regime during the late Paleozoic age.
Nb3Sn accelerator magnet development around the world
Energy Technology Data Exchange (ETDEWEB)
Michael J. Lamm
2003-06-23
During the past 30 years superconducting magnet systems have enabled accelerators to achieve energies and luminosities that would have been impractical if not impossible with resistive magnets. By far, NbTi has been the preferred conductor for this application because of its ductility and insensitivity of Jc to mechanical strain. This is despite the fact that Nb{sub 3}Sn has a more favorable Jc vs. B dependence and can operate at much higher temperatures. Unfortunately, NbTi conductor is reaching the limit of it usefulness for high field applications. Despite incremental increases in Jc and operation at superfluid temperatures, magnets are limited to approximately a 10 T field. Improvements in conductor performance combined with future requirements for accelerator magnets to have bore fields greater than 10 T or operate in areas of large beam-induced heat loads now make Nb{sub 3}Sn look attractive. Thus, laboratories in several countries are actively engaged in programs to develop Nb{sub 3}Sn accelerator magnets for future accelerator applications. A summary of this important research activity is presented along with a brief history of Nb{sub 3}Sn accelerator magnet development and a discussion of requirements for future accelerator magnets.
Liu, Yongchang; Lan, Feng; Ma, Zongqing; Chen, Ning; Li, Huijun; Barua, Shaon; Patel, Dipak; Shahriar, M.; Hossain, Al; Acar, S.; Kim, Jung Ho; Xue Dou, Shi
2015-05-01
High performance MgB2 bulks using carbon-coated amorphous boron as a boron precursor were fabricated by Cu-activated sintering at low temperature (600 °C, below the Mg melting point). Dense nano-MgB2 grains with a high level of homogeneous carbon doping were formed in these MgB2 samples. This type of microstructure can provide a stronger flux pinning force, together with depressed volatility and oxidation of Mg owing to the low-temperature Cu-activated sintering, leading to a significant improvement of critical current density (Jc) in the as-prepared samples. In particular, the value of Jc for the carbon-coated (Mg1.1B2)Cu0.05 sample prepared here is even above 1 × 105 A cm-2 at 20 K, 2 T. The results herein suggest that the combination of low-temperature Cu-activated sintering and employment of carbon-coated amorphous boron as a precursor could be a promising technique for the industrial production of practical MgB2 bulks or wires with excellent Jc, as the carbon-coated amorphous boron powder can be produced commercially at low cost, while the addition of Cu is very convenient and inexpensive.
Wang, Gang; Sun, Yanwei; Xu, Ruirui; Qu, Jing; Tee, Chuansia; Jiang, Xiyuan; Ye, Jian
2014-04-01
Jatropha curcas mosaic disease (JcMD) is a newly emerging disease that has been reported in Africa and India. Here, we report the complete nucleotide sequence of a new Indian cassava mosaic virus isolate (ICMV-SG) from Singapore. Infection of ICMV-SG showed more severe JcMD in Jatropha curcas and Nicotiana benthamiana than the other ICMV isolates reported previously, though ICMV-SG shares high sequence identity with the other ICMV isolates. Agroinfectious DNA-A alone sufficiently induced systemic symptoms in N. benthamiana, but not in J. curcas. Results from agroinfection assays showed that systemic infection of ICMV-SG in J. curcas required both DNA-A and DNA-B components.
Energy Technology Data Exchange (ETDEWEB)
de Oliveira, Jefferson S.; Leite, Polyanna M.; de Souza, Lincoln B.; Mello, Vinicius M.; Rubim, Joel C.; Suarez, Paulo A.Z. [Laboratorio de Materiais e Combustiveis, Instituto de Quimica, Universidade de Brasilia, C.P. 4478, 70919-970 Brasilia, DF (Brazil); Silva, Eid C.; Meneghetti, Simoni M.P. [Instituto de Quimica e Biotecnologia, Universidade Federal de Alagoas, Av. Lourival de Melo Mota, s/n, Cidade Universitaria, 57072-970 Maceio-AL (Brazil)
2009-03-15
In this work two genus of the Jatropha family: the Jatropha gossypiifolia (JG) and Jatropha curcas L. (JC) were studied in order to delimitate their potential as raw material for biodiesel production. The oil content in wild seeds and some physical-chemical properties of the oils and the biodiesel obtained from them were evaluated. The studied physical-chemical properties of the JC and JG biodiesel are in acceptable range for use as biodiesel in diesel engines, showing a promising economic exploitation of these raw materials in semi-arid regions. However, further agronomic studies are needed in order to improve the seed production and the crude oil properties. (author)
Transport current anisotropy in oriented grained bulk YBa2Cu3O(x) superconductor
International Nuclear Information System (INIS)
Selvamanickam, V.; Salama, K.
1990-01-01
The anisotropy in transport current density has been studied on bulk YBa2Cu3O(x) superconductor. The transport current density measurements were performed on oriented grained YBa2Cu3O(x) superconductor with the current aligned at different angles to the a-b plane. The angular dependence of Jc shows a rapid drop when the transport current is misaligned from the a-b plane at small angles and then a slow decrease at higher angles. An anisotropy ratio of about 25 is observed at 77 K and zero field between the Jc along a-b plane and that perpendicular to the plane. 15 refs
Movement coordination in applied human-human and human-robot interaction
DEFF Research Database (Denmark)
Schubö, Anna; Vesper, Cordula; Wiesbeck, Mathey
2007-01-01
and describing human-human interaction in terms of goal-oriented movement coordination is considered an important and necessary step for designing and describing human-robot interaction. In the present scenario, trajectories of hand and finger movements were recorded while two human participants performed......The present paper describes a scenario for examining mechanisms of movement coordination in humans and robots. It is assumed that coordination can best be achieved when behavioral rules that shape movement execution in humans are also considered for human-robot interaction. Investigating...... coordination were affected. Implications for human-robot interaction are discussed....
Athinarayanan, Jegan; Alshatwi, Ali A; Periasamy, Vaiyapuri S; Al-Warthan, Abdulrahman A
2015-02-01
Titanium dioxide (E171) and silicon dioxide (E551) are common additives found in food products, personal-care products, and many other consumer products used in daily life. Recent studies have reported that these food additives (manufactured E171 and E551) contain nanosized particles of less than 100 nm. However, the particle size distribution and morphology of added TiO2 and SiO2 particles are not typically stated on the package label. Furthermore, there is an increasing debate regarding health and safety concerns related to the use of synthetic food additives containing nanosized ingredients in consumer products. In this study, we identified the size and morphology of TiO2 and SiO2 particles in commercially available food products by using transmission electron microscope (TEM). In addition, the in vitro toxicological effects of E171 and E551 on human mesenchymal stem cells (hMSCs), an adult stem cell-based model, were assessed using the MTT assay and a flow cytometry-based JC-1 assay. Our TEM results confirmed the presence of nanoscale ingredients in food products, and the in vitro toxicology results indicated that the nanoscale E171 and E551 ingredients induced dose-dependent cytotoxicity, changes in cellular morphology, and the loss of mitochondrial trans-membrane potential in hMSCs. These preliminary results clearly demonstrated that the nanoscale E171 and E551 particles had adverse effects on hMSCs by inducing oxidative stress-mediated cell death. Accordingly, further studies are needed to identify the specific pathway involved, with an emphasis on differential gene expression in hMSCs. © 2015 Institute of Food Technologists®
Diotti, Roberta Antonia; Mancini, Nicasio; Clementi, Nicola; Sautto, Giuseppe; Moreno, Guisella Janett; Criscuolo, Elena; Cappelletti, Francesca; Man, Petr; Forest, Eric; Remy, Louise; Giannecchini, Simone; Clementi, Massimo; Burioni, Roberto
2014-08-01
JC virus (JCPyV) has gained novel clinical importance as cause of progressive multifocal leukoencephalopathy (PML), a rare demyelinating disease recently associated to immunomodulatory drugs, such as natalizumab used in multiple sclerosis (MS) cases. Little is known about the mechanisms leading to PML, and this makes the need of PML risk stratification among natalizumab-treated patients very compelling. Clinical and laboratory-based risk-stratification markers have been proposed, one of these is represented by the JCPyV-seropositive status, which includes about 54% of MS patients. We recently proposed to investigate the possible protective role of neutralizing humoral immune response in preventing JCPyV reactivation. In this proof-of-concept study, by cloning the first human monoclonal antibody (GRE1) directed against a neutralizing epitope on JCPyV/VP1, we optimized a robust anti-JCPyV neutralization assay. This allowed us to evaluate the neutralizing activity in JCPyV-positive sera from MS patients, demonstrating the lack of correlation between the level of anti-JCPyV antibody and anti-JCPyV neutralizing activity. Relevant consequences may derive from future clinical studies induced by these findings; indeed the study of the serum anti-JCPyV neutralizing activity could allow not only a better risk stratification of the patients during natalizumab treatment, but also a better understanding of the pathophysiological mechanisms leading to PML, highlighting the contribution of peripheral versus central nervous system JCPyV reactivation. Noteworthy, the availability of GRE1 could allow the design of novel immunoprophylactic strategies during the immunomodulatory treatment. Copyright © 2014 Elsevier B.V. All rights reserved.
Mahotka, C; Hansen-Hagge, T E; Bartram, C R
1995-10-01
Human acute lymphoblastic leukemia cell lines represent valuable tools to investigate distinct steps of the complex regulatory pathways underlying T cell receptor recombination and expression. A case in point are V delta 2D delta 3 and subsequent V delta 2D delta 3J alpha rearrangements observed in human leukemic pre-B cells as well as in normal lymphopoiesis. The functional expression of these unusual (VD) delta (JC) alpha hybrids is almost exclusively prevented by alternative splicing events. In this report we show that alternative splicing at cryptic splice donor sites within V elements is not a unique feature of hybrid TCR delta/alpha transcripts. Among seven V alpha families analyzed by RT-PCR, alternatively spliced products were observed in TCR alpha recombinations containing V alpha 1 or V alpha 14 elements. In contrast to normal peripheral blood cells and thymocytes, the leukemia cell line JM expressing functional V alpha 1J alpha 3C alpha transcripts lacked evidence of aberrant TCR alpha RNA species.
Human Face as human single identity
Warnars, Spits
2014-01-01
Human face as a physical human recognition can be used as a unique identity for computer to recognize human by transforming human face with face algorithm as simple text number which can be primary key for human. Human face as single identity for human will be done by making a huge and large world centre human face database, where the human face around the world will be recorded from time to time and from generation to generation. Architecture database will be divided become human face image ...
Ling, Paul D.; Lednicky, John A.; Keitel, Wendy A.; Poston, David G.; White, Zoe S.; Peng, RongSheng; Liu, Zhensheng; Mehta, Satish K.; Pierson, Duane L.; Rooney, Cliona M.;
2003-01-01
Humans are infected with viruses that establish long-term persistent infections. To address whether immunocompetent individuals control virus reactivation globally or independently and to identify patterns of sporadic reactivation, we monitored herpesviruses and polyomaviruses in 30 adults, over 14 months. Epstein-Barr virus (EBV) DNA was quantitated in saliva and peripheral blood mononuclear cells (PBMCs), cytomegalovirus (CMV) was assayed in urine, and JC virus (JCV) and BK virus (BKV) DNAs were assayed in urine and PBMCs. All individuals shed EBV in saliva, whereas 67% had >or=1 blood sample positive for EBV. Levels of EBV varied widely. CMV shedding occurred infrequently but occurred more commonly in younger individuals (Por=40 years old (P.50). Thus, adults independently control persistent viruses, which display discordant, sporadic reactivations.
Directory of Open Access Journals (Sweden)
Angel Esteban
2003-02-01
Full Text Available Abstract: The known solvent dependence of 1J(Cc,Hf and 2J(C1,Hf couplings in acetaldehyde is studied from a theoretical viewpoint based on the density functional theory approach where the dielectric solvent effect is taken into account with the polarizable continuum model. The four terms of scalar couplings, Fermi contact, paramagnetic spin orbital, diamagnetic spin orbital and spin dipolar, are calculated but the solvent effect analysis is restricted to the first term since for both couplings it is by far the dominant contribution. Experimental trends of Δ1J(Cc,Hf and Δ2J(C1,Hf Vs ε (the solvent dielectric constant are correctly reproduced although they are somewhat underestimated. Specific interactions between solute and solvent molecules are studied for dimethylsulfoxide, DMSO, solutions considering two different one-to-one molecular complexes between acetaldehyde and DMSO. They are determined by interactions of type C=O---H---C and S=O---H---C, and the effects of such interactions on 1J(Cc,Hf and 2J(C1,Hf couplings are analyzed. Even though only in a semiquantitative way, it is shown that the effect of such interactions on the solvent effects, of Δ1J(Cc,Hf and Δ2J(C1,Hf, tend to improve the agreement between calculated and experimental values. These results seem to indicate that a continuum dielectric model has not enough flexibility for describing quantitatively solvent effects on spin-spin couplings. Apparently, even for relatively weak hydrogen bonding, the contribution from “direct†interactions is of the same order of magnitude as the “dielectric†effect.
Engineering low phorbol ester Jatropha curcas seed by intercepting casbene biosynthesis.
Li, Chunhong; Ng, Ailing; Xie, Lifen; Mao, Huizhu; Qiu, Chengxiang; Srinivasan, Ramachandran; Yin, Zhongchao; Hong, Yan
2016-01-01
Casbene is a precursor to phorbol esters and down-regulating casbene synthase effectively reduces phorbol ester biosynthesis. Seed-specific reduction of phorbol ester (PE) helps develop Jatropha seed cake for animal nutrition. Phorbol esters (PEs) are diterpenoids present in some Euphorbiaceae family members like Jatropha curcas L. (Jatropha), a tropical shrub yielding high-quality oil suitable as feedstock for biodiesel and bio jet fuel. Jatropha seed contains up to 40 % of oil and can produce oil together with cake containing high-quality proteins. However, skin-irritating and cancer-promoting PEs make Jatropha cake meal unsuitable for animal nutrition and also raise some safety and environmental concerns on its planting and processing. Two casbene synthase gene (JcCASA163 and JcCASD168) homologues were cloned from Jatropha genome and both genes were highly expressed during seed development. In vitro functional analysis proved casbene synthase activity of JcCASA163 in converting geranylgeranyl diphosphate into casbene which has been speculated to be the precursor to PEs. A seed-specific promoter driving inverted repeats for RNAi interference targeting at either JcCASA163 or both genes could effectively down-regulate casbene synthase gene expression with concurrent marked reduction of PE level (by as much as 85 %) in seeds with no pleiotropic effects observed. Such engineered low PE in seed was heritable and co-segregated with the transgene. Our work implicated casbene synthase in Jatropha PE biosynthesis and provided evidence for casbene being the precursor for PEs. The success in reducing seed PE content through down-regulation of casbene synthase demonstrates the feasibility of intercepting PE biosynthesis in Jatropha seed to help address safety concerns on Jatropha plantation and seed processing and facilitate use of its seed protein for animal nutrition.
Liu, Linfei; Wang, Wei; Yao, Yanjie; Wu, Xiang; Lu, Saidan; Li, Yijie
2018-05-01
Improvement in the in-filed transport properties of REBa2Cu3O7-δ (RE = rare earth elements, REBCO) coated conductor is needed to meet the performance requirements for various practical applications, which can be accomplished by introducing artificial pinning centers (APCs), such as second phase dopant. However, with increasing dopant level the critical current density Jc at 77 K in zero applied magnetic field decreases. In this paper, in order to improve Jc we propose a seed layer technique. 5 mol% BaHfO3 (BHO) doped Y0.5Gd0.5Ba2Cu3O7-δ (YGBCO) epilayer with an inserted seed layer was grown on CeO2 buffered ion beam assisted deposition MgO (IBAD-MgO) tape by pulsed laser deposition. The effect of the conditions employed to prepare the seed layer, including tape moving speed and chemical composition, on the quality of 5 mol% BHO doped YGBCO epilayer was systematically investigated by X-ray diffraction (XRD) measurements and scanning electron microscopy (SEM) observations. It was found that all the samples with seed layer have higher Jc (77 K, self-field) than the 5 mol% BHO doped YGBCO film without seed layer. The seed layer could inhibit deterioration of the Jc at 77 K and self-filed. Especially, the self-seed layer (5 mol% BHO doped YGBCO seed layer) was more effective in improving the crystal quality, surface morphology and superconducting performance. At 4.2 K, the 5 mol% BHO doped YGBCO film with 4 nm thick self-seed layer had a very high flux pinning force density Fp of 860 GN/m3 for B//c under a 9 T field, and more importantly, the peak of the Fp curve was not observed.
International Nuclear Information System (INIS)
Wada, Hitoshi; Takeuchi, Takao; Kuroda, Tsuneo
2000-01-01
To evaluate the stability of superconductors, we constructed a measurement system of the critical current density Jr property as function of temperature, magnetic strength, azimuth of magnetic field and distortion. LabView program automatically controlled the magnetic field, temperature, rotational displacement, load, multimeter and sample source in the system. The superconducting critical surface of Nb 3 Al wire was prepared by two methods: a low temperature diffusion method and a phase transformation method. Nb 3 Al prepared by two methods proved the temperature scaling law of magnetic pinning force density and parameters for fitting the pinning model were introduced. The tailing of Jc-T curve at the high temperature side was generated by pinning property of magnetic flux line. On measurement of AC magnetic susceptibility, a primary stack (JR filament) of RIT Nb 3 Al wire prepared by phase transformation connected electrically and the size corresponded to the effective core size, so that, large n value was shown in spite of high temperature treatment and it showed good distortion resistance. Nb 3 Al wire prepared by low temperature diffusion method indicated large anisotropy of Bc 2 and Jc in the rectangular wire. On V 3 Ga, the temperature scaling law of magnetic field was not established and it was observed the effective grain boundary pinning at the low magnetic field and the other pinning mechanism of which magnetic flux line synchronized in the high temperature field. The specific magnetic azimuth dependency showed in the neighborhood of the parallel magnetic field. Jc indicated the positive dependence of temperature in the peak magnetic field. Jc of Bi oxides tape conductor was measured and the results showed the magnetic field was governed by magnetic field dependence on the c axis direction. (S.Y.)
Directory of Open Access Journals (Sweden)
1993-01-01
Full Text Available BASES DE L'ECHANGE ENTRE LES SOCIETES NORD-PERUVIENNES ET SUD-EQUATORIENNES : UNE ZONE DE TRANSITION ENTRE 1500 AV. J.C. ET 600 AP. J.C. Cet article est le fruit dune tentative de coopération entre des chercheurs qui travaillent en Équateur et au Pérou, pour relier les deux aires culturelles nettement différenciées, nord-andine et centre-andine, à partir de la définition et de létude dune zone de transition, localisée entre le Río Jubones dans le sud de l'Équateur et le Río Olmos dans le nord du Pérou, entre environ 1500 av. J.C. et 600 ap. J.C. El artículo es resultado de un intento de cooperación entre investigadores que trabajan el Ecuador y el Perú para vincular las dos áreas culturales marcadamente diferenciadas, norandina y centroandina, a partir de la definición y estudio de una zona de transición, localizada entre el río Jubones, al sur de Ecuador y el Río Olmos, al norte de Perú, entre aproximadamente 1500 AC y 600 DC. BASIS OF THE EXCHANGE BETWEEN NORTH PERUVIAN AND SOUTH ECUATORIAN SOCIETIES: A TRANSITIONAL ZONE BETWEEN 1500 B.C. AND 600 A.C. This paper is a collaborative effort by researchers working in Ecuador and Peru, to explore the relationship between two clearly differentiated cultural areas (North and Central Andes on the basis of a definition and study of the prehistory transitional zone located between Río Jubones in Southern Ecuador and Río Olmos in Northern Peru between 1500 B.C. and 600 A.C.
Johnson-Cook Strength Model Constants for VascoMax 300 and 1080 Steels
International Nuclear Information System (INIS)
Cinnamon, J. D.; Palazotto, A. N.; Kennan, Z.; Brar, N. S.; Bajaj, D.
2006-01-01
High strength steels, VascoMax 300 and 1080, are characterized under tension at strain rates of ∼1/s, ∼500/s, ∼1000/s, and ∼1500/s and at high temperatures using the quasi-static and split Hopkinson bar techniques. The data on 1080 steel exhibited a typical strain hardening response, whereas Vasco-Max 300 steel showed diminishing flow stress beyond yielding because of localized necking in gauge section of the tested specimens. The tension data are analyzed to determine the Johnson-Cook (J-C) strength model constants for the two steels. The flow stress values for VascoMax are adjusted to account for necking, and the corrected J-C model is developed
Progressive multifocal leukoencephalopathy limited to the brain stem
Energy Technology Data Exchange (ETDEWEB)
Kastrup, O.; Maschke, M.; Diener, H.C. [Neurologische Universitaetsklinik, University of Essen (Germany); Wanke, I. [Department of Neuroradiology, University of Essen (Germany)
2002-03-01
Progressive multifocal leukoencephalopathy (PML) is a subacute demyelinating slow-virus encephalitis caused by the JC polyomavirus in 2-5% of patients with AIDS. MRI typically shows multiple lesions in the cerebral hemispheres. We present a rare case of rapidly evolving and lethal PML with a severe bulbar syndrome and spastic tetraparesis in a patient with AIDS. MRI showed high-signal lesions on T2-weighted images confined to the brain stem, extending from the medulla oblongata to the midbrain. JC virus polymerase chain reaction in cerebrospinal fluid was positive, and neuropathology showed the findings of PML. This case was also notable because of the rapid progression despite improved immune status with antiretroviral therapy. (orig.)
International Nuclear Information System (INIS)
Alvarez, Roberto; Domingo, Rosario; Sebastian, Miguel Angel
2011-01-01
This paper deals with the simulation of UNS A92024 aluminium alloy cutting processes. In particular, 2D and 3D Finite Element Method (FEM) simulations were carried out in order to estimate cutting forces and chip morphology during turning operations. The material is modelled with two different set of parameters for the Johnson--Cook's (J-C) constitutive equation and a failure Cockroft and Latham's model exploited considers damage. The comparison between the predicted chip morphology and principal cutting forces at varying of J-C parameters and cutting regimes with those experimentally found are presented and discussed. The paper shows the importance of damage criterion in the cutting forces, during the simulation, especially in 3D.
Human Technology and Human Affects
DEFF Research Database (Denmark)
Fausing, Bent
2009-01-01
Human Technology and Human Affects This year Samsung introduced a mobile phone with "Soul". It was made with a human touch and included itself a magical touch. Which function does technology and affects get in everyday aesthetics like this, its images and interactions included this presentation...... will ask and try to answer. The mobile phone and its devices are depicted as being able to make a unique human presence, interaction, and affect. The medium, the technology is a necessary helper to get towards this very special and lost humanity. Without the technology, no special humanity - soul....... The paper will investigate how technology, humanity, affects, and synaesthesia are presented and combined with examples from everyday aesthetics, e.g. early computer tv-commercial, net-commercial for mobile phones. Technology and affects point, is the conclusion, towards a forgotten pre-human and not he...
Role of Sentinel Lymph Node Biopsy in the Management of Merkel Cell Carcinoma
Directory of Open Access Journals (Sweden)
Eric P. Arruda
2012-01-01
Full Text Available Merkel cell carcinoma (MCC is a rare and typically aggressive form of skin cancer. It most commonly affects the elderly and has a predilection for the sun-exposed skin of the head and neck region. Other etiological factors include immune suppression, organ transplantation, and polyoma virus infection. MCC has a propensity to spread to regional lymphatics with a high locoregional recurrence rate. Since its discovery in 1972, treatment paradigms have shifted, with no consensus on optimal management strategies. Currently, standard of care includes surgical intervention to the primary and locoregional site with adjuvant radiotherapy for high-risk disease. In this paper, we discuss the history, pathology, and epidemiology of this rare disease with a focus on the evidentiary basis of treatment protocols. The use of sentinel lymph node biopsy as a management option will be the focus of this paper.
Role of Sentinel Lymph Node Biopsy in the Management of Merkel Cell Carcinoma
International Nuclear Information System (INIS)
Arruda, E.P.; Higgins, K.M.; Higgins, K. M.; Higgins, K. M.
2012-01-01
Merkel cell carcinoma (MCC) is a rare and typically aggressive form of skin cancer. It most commonly affects the elderly and has a predilection for the sun-exposed skin of the head and neck region. Other etiological factors include immune suppression, organ transplantation, and polyoma virus infection. MCC has a propensity to spread to regional lymphatics with a high locoregional recurrence rate. Since its discovery in 1972, treatment paradigms have shifted, with no consensus on optimal management strategies. Currently, standard of care includes surgical intervention to the primary and locoregional site with adjuvant radiotherapy for high-risk disease. In this paper, we discuss the history, pathology, and epidemiology of this rare disease with a focus on the evidentiary basis of treatment protocols. The use of sentinel lymph node biopsy as a management option will be the focus of this paper.
A general method to quantify quasi-equivalence in icosahedral viruses.
Damodaran, K V; Reddy, Vijay S; Johnson, John E; Brooks, Charles L
2002-12-06
A quantitative, atom-based, method is described for comparing protein subunit interfaces in icosahedral virus capsids with quasi-equivalent surface lattices. An integrated, normalized value (between 0 and 1) based on equivalent residue contacts (Q-score) is computed for every pair of subunit interactions and scores that are significantly above zero readily identify interfaces that are quasi-equivalent to each other. The method was applied to all quasi-equivalent capsid structures (T=3, 4, 7 and 13) in the Protein Data Bank and the Q-scores were interpreted in terms of their structural underpinnings. The analysis allowed classification of T=3 structures into three groups with architectures that resemble different polyhedra with icosahedral symmetry. The preference of subunits to form dimers in the T=4 human Hepatitis B virus capsid (HBV) was clearly reflected in high Q-scores of quasi-equivalent dimers. Interesting differences between the classical T=7 capsid and polyoma-like capsids were also identified. Application of the method to the outer-shell of the T=13 Blue tongue virus core (BTVC) highlighted the modest distortion between the interfaces of the general trimers and the strict trimers of VP7 subunits. Furthermore, the method identified the quasi 2-fold symmetry in the inner capsids of the BTV and reovirus cores. The results show that the Q-scores of various quasi-symmetries represent a "fingerprint" for a particular virus capsid architecture allowing particle classification into groups based on their underlying structural and geometric features.
Incidence of hepatotropic viruses in biliary atresia.
Rauschenfels, Stefan; Krassmann, Miriam; Al-Masri, Ahmed N; Verhagen, Willem; Leonhardt, Johannes; Kuebler, Joachim F; Petersen, Claus
2009-04-01
Biliary atresia (BA) is the most frequent indication for paediatric liver transplantation. We tested the hypothesis of a viral aetiology of this disease by screening liver samples of a large number of BA patients for the common human hepatotropic viruses. Moreover, we correlated our findings to the expression of Mx protein, which has been shown to be significantly up-regulated during viral infections. Seventy-four liver biopsies (taken during Kasai portoenterostomy) were tested by polymerase chain reaction (PCR) for DNA viruses (herpes simplex virus [HSV], Epstein-Barr virus [EBV], varicella zoster virus [VZV], cytomegalovirus [CMV], adenovirus, parvovirus B19 and polyoma BK) and RNA viruses (enteroviruses, rotavirus and reovirus 3). Mx protein expression was assessed by immunohistochemistry. Virus DNA/RNA was found in less than half of the biopsies (8/74 CMV, 1/74 adenovirus; 21/64 reovirus, 1/64 enterovirus). A limited number presented with double infection. Patients that had detectable viral RNA/DNA in their liver biopsies were significantly older than virus-free patients (P = 0.037). The majority (54/59) of the liver biopsies showed expression of Mx proteins in hepatocytes, bile ducts and epithelium. Our data suggest that the known hepatotropic viruses do not play a major role in the aetiology and progression of BA. Their incidence appears to be, rather, a secondary phenomenon. Nonetheless, the inflammatory response in the livers of BA patients mimics that observed during viral infections.
Basu, Gargi D; Pathangey, Latha B; Tinder, Teresa L; Lagioia, Michelle; Gendler, Sandra J; Mukherjee, Pinku
2004-11-01
Cyclooxygenase-2 (COX-2) inhibitors are rapidly emerging as a new generation of therapeutic drug in combination with chemotherapy or radiation therapy for the treatment of cancer. The mechanisms underlying its antitumor effects are not fully understood and more thorough preclinical trials are needed to determine if COX-2 inhibition represents a useful approach for prevention and/or treatment of breast cancer. The purpose of this study was to evaluate the growth inhibitory mechanism of a highly selective COX-2 inhibitor, celecoxib, in an in vivo oncogenic mouse model of spontaneous breast cancer that resembles human disease. The oncogenic mice carry the polyoma middle T antigen driven by the mouse mammary tumor virus promoter and develop primary adenocarcinomas of the breast. Results show that oral administration of celecoxib caused significant reduction in mammary tumor burden associated with increased tumor cell apoptosis and decreased proliferation in vivo. In vivo apoptosis correlated with significant decrease in activation of protein kinase B/Akt, a cell survival signaling kinase, with increased expression of the proapoptotic protein Bax and decreased expression of the antiapoptotic protein Bcl-2. In addition, celecoxib treatment reduced levels of proangiogenic factor (vascular endothelial growth factor), suggesting a role of celecoxib in suppression of angiogenesis in this model. Results from these preclinical studies will form the basis for assessing the feasibility of celecoxib therapy alone or in combination with conventional therapies for treatment and/or prevention of breast cancer.
J.C. Greeff,* C.z. Raux and G.A. Wyma
African Journals Online (AJOL)
The efficiency of meat production with regard to kilogram of lamb weaned per kilogram metabolic mass of ewes at mating of ... an ewe is the total mass of lambs marketed plus her wool ... and Merino Landsheep), lean growth and conformation.
Kerwin, Allison H; Nyholm, Spencer V
2017-04-01
Female Hawaiian bobtail squid, Euprymna scolopes, have an accessory nidamental gland (ANG) housing a bacterial consortium that is hypothesized to be environmentally transmitted and to function in the protection of eggs from fouling and infection. The composition, stability, and variability of the ANG and egg jelly coat (JC) communities were characterized and compared to the bacterial community composition of the surrounding environment using Illumina sequencing and transmission electron microscopy. The ANG bacterial community was conserved throughout hosts collected from the wild and was not affected by maintaining animals in the laboratory. The core symbiotic community was composed of Alphaproteobacteria and Opitutae (a class of Verrucomicrobia). Operational taxonomic units representing 94.5% of the average ANG abundance were found in either the seawater or sediment, which is consistent with the hypothesis of environmental transmission between generations. The bacterial composition of the JC was stable during development and mirrored that of the ANG. Bacterial communities from individual egg clutches also grouped with the ANG of the female that produced them. Collectively, these data suggest a conserved role of the ANG/JC community in host reproduction. Future directions will focus on determining the function of this symbiotic community, and how it may change during ANG development. © 2017 Society for Applied Microbiology and John Wiley & Sons Ltd.
Transport properties of different BSCCO wires
International Nuclear Information System (INIS)
Metra, P.; Gherardi, L.; Vellego, G.; Masini, R.; Zannella, S.
1990-01-01
This paper reports on two classes of solver sheathed BSCCO wires and laminates were prepared from 2223 (Pb substituted) and 2212 powders, respectively, by the powder in tube method. By suitable heat treatments (sintering and annealing below the melting temperature for 2223, melting + annealing for 2212), we obtained sample wires with Tc of ∼110 and ∼85 K respectively, comparable Jc at 77 K (∼10 3 A/cm 2 ), and dramatically different transport behavior. Measurements of critical current at different temperatures and as a function of applied magnetic field were carried out, to characterize the two classes of samples, together with other electrical testing (e.g. d.c. susceptibility) and structural analyses. The granular nature of the higher Tc BSCCO, qualitatively similar to the one of YBCO, was well documented. The melt-processed material showed no apparent granularity, but very strong field dependence of Jc at high temperature. The effect of mechanical deformation on Jc was also investigated by bending samples on different diameters before and after heat treatment. Wires and tapes with 2212 were found to be bendable on very small diameters before treatment, but also the 2223 filled samples were shown to accept significant deformation before sintering
International Nuclear Information System (INIS)
Kobayashi, H.; Yamada, Y.; Ishida, S.; Takahashi, K.; Konishi, M.; Ibi, A.; Miyata, S.; Kato, T.; Hirayama, T.; Shiohara, Y.
2006-01-01
In order to fabricate YBa2Cu3O7-x (YBCO) coated conductors with high critical current density Jc in magnetic fields, we fabricated YBCO coated conductors with artificial pinning centers by the pulsed laser deposition (PLD) method on a self epitaxial PLD-CeO2 layer and ion-beam assisted deposition (IBAD)-Gd2Zr2O7 (GZO) buffered Hastelloy tape. Artificial pinning centers were introduced by the PLD deposition using the yttria-stabilized zirconia (YSZ) oxide target (nano-dot method) and YBCO target including YSZ particles (mixed target method). In the experiments using YSZ oxide target, YSZ nano-dots were observed. They were approximately 15 nm in height and 10 nm to 70 nm in diameter. We found that the density of nano-dots was controlled by the number of laser pulses. These samples exhibited higher Jc than YBCO films in magnetic fields. Furthermore, a similar improvement of Jc was observed in the experiments using YBCO target including YSZ particles. TEM observation revealed that columnar nano-structure made of BaZrO3 was formed during YBCO deposition and it was effective for pinning. We call this new epitaxial nano-structure 'bamboo structure' from its anisotropic growth and morphology
Flipped classroom model for learning evidence-based medicine
Directory of Open Access Journals (Sweden)
Rucker SY
2017-08-01
Full Text Available Sydney Y Rucker,1 Zulfukar Ozdogan,1 Morhaf Al Achkar2 1School of Education, Indiana University, Bloomington, IN, 2Department of Family Medicine, School of Medicine, University of Washington, Seattle, WA, USA Abstract: Journal club (JC, as a pedagogical strategy, has long been used in graduate medical education (GME. As evidence-based medicine (EBM becomes a mainstay in GME, traditional models of JC present a number of insufficiencies and call for novel models of instruction. A flipped classroom model appears to be an ideal strategy to meet the demands to connect evidence to practice while creating engaged, culturally competent, and technologically literate physicians. In this article, we describe a novel model of flipped classroom in JC. We present the flow of learning activities during the online and face-to-face instruction, and then we highlight specific considerations for implementing a flipped classroom model. We show that implementing a flipped classroom model to teach EBM in a residency program not only is possible but also may constitute improved learning opportunity for residents. Follow-up work is needed to evaluate the effectiveness of this model on both learning and clinical practice. Keywords: evidence-based medicine, flipped classroom, residency education
A perspective on transition temperature and KJc data characterization
International Nuclear Information System (INIS)
McCabe, D.E.; Merkle, J.G.; Nanstad, R.K.
1992-01-01
Proper identification of transition temperature and shape of the lower-bound (K lc ) fracture toughness curve in the transition range has been a long-term objective. A past practice has been to test a large number of specimens of varying sizes, from 1/2T to 8T compacts, in expectation that size effects and statistical variability of (K jc ) could be resolved empirically. Recently, statistical and constraint-based models have been developed that purport to explain much of what has been seen. Weakest-link theory has been successfully used to predict specimen size effects for the lower part of the transition curve. Constraint-based models of β c -- β lc and J ssy (small-scale yield) also can model size effects, but these tend to conflict among themselves with regard to the prediction of full constraint K jc . All lack potential for defining the absolute lower bound of fracture toughness. Statistically based models have the benefit of quantifying data scatter characteristics and provide a basis for making lower-bound toughness estimates with assigned error estimates. The K jc , data are obtained from small specimens, the size of which is dictated by volume limitations of surveillance capsule size. A basis has been explored for establishing a lower-envelope curve from such data
The golden triangle of human dignity: human security, human development and human rights
Gaay Fortman, B. de
2004-01-01
The success or failure of processes of democratization cannot be detached from processes of development related to the aspirations of people at the grassroots. Human rights, in a more theoretical terminology, require human development in order to enhance human security.
Development of marker-free transgenic Jatropha plants with increased levels of seed oleic acid
Directory of Open Access Journals (Sweden)
Qu Jing
2012-02-01
Full Text Available Abstract Background Jatropha curcas is recognized as a new energy crop due to the presence of the high amount of oil in its seeds that can be converted into biodiesel. The quality and performance of the biodiesel depends on the chemical composition of the fatty acids present in the oil. The fatty acids profile of the oil has a direct impact on ignition quality, heat of combustion and oxidative stability. An ideal biodiesel composition should have more monounsaturated fatty acids and less polyunsaturated acids. Jatropha seed oil contains 30% to 50% polyunsaturated fatty acids (mainly linoleic acid which negatively impacts the oxidative stability and causes high rate of nitrogen oxides emission. Results The enzyme 1-acyl-2-oleoyl-sn-glycero-3-phosphocholine delta 12-desaturase (FAD2 is the key enzyme responsible for the production of linoleic acid in plants. We identified three putative delta 12 fatty acid desaturase genes in Jatropha (JcFAD2s through genome-wide analysis and downregulated the expression of one of these genes, JcFAD2-1, in a seed-specific manner by RNA interference technology. The resulting JcFAD2-1 RNA interference transgenic plants showed a dramatic increase of oleic acid (> 78% and a corresponding reduction in polyunsaturated fatty acids (Jatropha had around 37% oleic acid and 41% polyunsaturated fatty acids. This indicates that FAD2-1 is the major enzyme responsible for converting oleic acid to linoleic acid in Jatropha. Due to the changes in the fatty acids profile, the oil of the JcFAD2-1 RNA interference seed was estimated to yield a cetane number as high as 60.2, which is similar to the required cetane number for conventional premium diesel fuels (60 in Europe. The presence of high seed oleic acid did not have a negative impact on other Jatropha agronomic traits based on our preliminary data of the original plants under greenhouse conditions. Further, we developed a marker-free system to generate the transgenic Jatropha
Canning, Cynthia
1978-01-01
The faculty of Holy Names High School developed an interdisciplinary human rights program with school-wide activities focusing on three selected themes: the United Nations Universal Declaration of Human Rights, in conjunction with Human Rights Week; Food; and Women. This article outlines major program activities. (SJL)
Directory of Open Access Journals (Sweden)
Yazmin Hussin
2018-04-01
Full Text Available Extensive research has been done in the search for innovative treatments against colon adenocarcinomas; however, the incidence rate of patients remains a major cause of cancer-related deaths in Malaysia. Natural bioactive compounds such as curcumin have been substantially studied as an alternative to anticancer drug therapies and have been surmised as a potent agent but, nevertheless, remain deficient due to its poor cellular uptake. Therefore, efforts now have shifted toward mimicking curcumin to synthesize novel compounds sharing similar effects. A synthetic analog, (Z-3-hydroxy-1-(2-hydroxyphenyl-3-phenylprop-2-ene-1-one (DK1, was recently synthesized and reported to confer improved bioavailability and selectivity toward human breast cancer cells. This study, therefore, aims to assess the anticancer mechanism of DK1 in relation to the induction of in vitro cell death in selected human colon cancer cell lines. Using the3-(4,5-dimethylthiazol-2-yl-2,5-diphenyltetrazolium bromide(MTT assay, the cytotoxicity of DK1 towards HT29 and SW620 cell lines were investigated. Acridine orange/propidium iodide (AO/PI dual-staining assay and flow cytometry analyses (cell cycle analysis, Annexin/V-FITC and JC-1 assays were incorporated to determine the mode of cell death. To further determine the mechanism of cell death, quantitative real-time polymerase chain reaction (qRT-PCR and proteome profiling were conducted. Results from this study suggest that DK1 induced changes in cell morphology, leading to a decrease in cell viability and subsequent induction of apoptosis. DK1 treatment inhibited cell viability and proliferation 48 h post treatment with IC50 values of 7.5 ± 1.6 µM for HT29 cells and 14.5 ± 4.3 µM for SW620 cells, causing cell cycle arrest with increased accumulation of cell populations at the sub-G0/G1phaseof 74% and 23%, respectively. Flow cytometry analyses showed that DK1 treatment in cancer cells induced apoptosis, as indicated by DNA
Shao, Jianyin; Gouripeddi, Ramkiran; Facelli, Julio C.
2016-01-01
Shao, J., Gouripeddi, R., & Facelli, J.C. (2016). Improving Clinical Trial Cohort Definition Criteria and Enrollment with Distributional Semantic Matching (poster). Research Reproducibility 2016. Salt Lake City, UT, USA
Treulen, F; Uribe, P; Boguen, R; Villegas, J V
2016-02-01
Does induction of mitochondrial outer membrane permeabilization (MOMP) in vitro affect specific functional parameters of human spermatozoa? Our findings show that MOMP induction increases intracellular reactive oxygen species (ROS) and decreases mean sperm velocity but does not alter DNA integrity. MOMP in somatic cells is related to a variety of apoptotic traits, such as alteration of mitochondrial membrane potential (ΔΨm), and increase in ROS production and DNA fragmentation. Although the presence of these apoptotic features has been reported in spermatozoa, to date the effects of MOMP on sperm function and DNA integrity have not been analysed. The study included spermatozoa from fertile donors. Motile sperm were obtained using the swim-up method. The highly motile sperm were collected and diluted with human tubal fluid to a final cell concentration of 5 × 10(6) ml(-1). To induce MOMP, selected sperm were treated at 37°C for 4 h with a mimetic of a Bcl-2 pro-apoptotic protein, ABT-737. MOMP was evaluated by relocating of cytochrome c. In addition, the effect of ABT-737 on mitochondrial inner membrane permeabilization was assessed using the calcein-AM/cobalt chloride method. In turn, ΔΨm was evaluated with JC-1 staining, intracellular ROS production with dihydroethidium, sperm motility was analysed by computer-assisted sperm analysis and DNA fragmentation by terminal deoxynucleotidyl transferase-mediated dUTP nick-end labelling (TUNEL) assay. Measurements were performed by flow cytometry. MOMP was associated with ΔΨm dissipation (P < 0.05), increased ROS production (P < 0.05) and decreased mean sperm velocity (P < 0.05), but it was not associated with DNA fragmentation. MOMP did not induce a large increase in ROS, which could explain the negligible effect of MOMP on sperm DNA fragmentation under our experimental conditions. The study was carried out in vitro using highly motile sperm, selected by swim-up, from healthy donors. The results obtained in this
Managing the Human in Human Brands
Directory of Open Access Journals (Sweden)
Fournier Susan
2018-05-01
Full Text Available The physical and social realities, mental biases and limitations of being human differentiate human brands from others. It is their very humanness that introduces risk while generating the ability for enhanced returns. Four particular human characteristics can create imbalance or inconsistency between the person and the brand: mortality, hubris, unpredictability and social embeddedness. None of these qualities manifest in traditional non-human brands, and all of them present risks requiring active managerial attention. Rather than treating humans as brands and making humans into brands for sale in the commercial marketplace, our framework forces a focus on keeping a balance between the person and the personified object.
NATO Human View Architecture and Human Networks
Handley, Holly A. H.; Houston, Nancy P.
2010-01-01
The NATO Human View is a system architectural viewpoint that focuses on the human as part of a system. Its purpose is to capture the human requirements and to inform on how the human impacts the system design. The viewpoint contains seven static models that include different aspects of the human element, such as roles, tasks, constraints, training and metrics. It also includes a Human Dynamics component to perform simulations of the human system under design. One of the static models, termed Human Networks, focuses on the human-to-human communication patterns that occur as a result of ad hoc or deliberate team formation, especially teams distributed across space and time. Parameters of human teams that effect system performance can be captured in this model. Human centered aspects of networks, such as differences in operational tempo (sense of urgency), priorities (common goal), and team history (knowledge of the other team members), can be incorporated. The information captured in the Human Network static model can then be included in the Human Dynamics component so that the impact of distributed teams is represented in the simulation. As the NATO militaries transform to a more networked force, the Human View architecture is an important tool that can be used to make recommendations on the proper mix of technological innovations and human interactions.
Ritter, Sylvia; Helm, Alexander; Lee, Ryonfa; Pollet, Dieter; Durante, Marco
There is increasing evidence that there is an elevated risk of cardiovascular disease among atomic bomb survivors and radiotherapy patients, typically developing with a long latency. However, essentially no information is available on the potential cardiovascular risks associated with space radiation, in particular heavy ions. To address this issue, we have chosen human umbilical vein endothelial cells (HUVEC) as a model system. Cells at an early passage number were irradiated with 0.1 to 4 Gy of either 9.8 MeV/u C-ions (LET=170 keV/µm), 91 MeV/u C-ions (LET=29 keV/µm) or 250 kV X-rays. Cells were regularly subcultured up to 40 days (20 population doublings) post-irradiation. Immediately after exposure cell inactivation was deter-mined by the colony forming assay. Furthermore, at selected time-points cytogenetic damage (formation of micronuclei in binucleated cells) and the mitochondrial membrane potential ΨM (flow cytometric analysis following JC-1 staining) were assessed. Measurement of the directly induced radiation damage showed that 9.8 MeV/u and 91 MeV/u C-ions were more effective than X-rays (i.e. about 3 and 2 times, respectively) with respect to cell inactivation or the in-duction of cytogenetic damage. At the subsequent days in the irradiated cultures the number of cells with micronuclei declined to the control level (3-5Altogether our data indicate that under the applied radiation conditions the integrity of mitochondria which play a significant role in the regulation of cardiovascular cell function is not impaired. With respect to directly induced genetic damage C-ions are more effective than X-rays as observed in other cell systems. If the effectiveness of charged particles for the occurrence of late chromosomal damage in endothelial cells is higher than that of sparsely ionizing radiation needs further clarification. The data obtained up to now indicate that sophisticated cytogenetic techniques have to be applied in order to draw any firm
Productivity of Cassava, Sorghum and Groundnut Intercrop Using ...
African Journals Online (AJOL)
Productivity of Cassava, Sorghum and Groundnut Intercrop Using Poultry Manure with Chemical Fertilizer Replacement Combinations. II Ibeawuchi, CI Duruigbo, LU Ihenacho, GO Ihejirika, MO Ofor, OP Obilo, JC Obiefuna ...
Development of application technique of bulk high-Tc superconductor
International Nuclear Information System (INIS)
Hong, Kye Won; Kim, Chan Joong; Kim, Kee Baek; Kwon, Sun Chil; Won, Dong Yun; Lee, Hoh Jin; Lee, Heui Kyoon; Jang, Kun Ik; Yang, Suk Woo
1995-03-01
YBCO-Ag composite superconductors were prepared by extrusion using inorganic binder materials. In the case of the undoped 1-2-3 sample with a dia. of 2.5 mm, critical current density (Jc) was 150 A/cm 2 and current density (Ic) was 10 amps. In the case of the sample with a die. of 4.5 mm, meanwhile, Jc and Ic were 50 A/cm 2 and 32 amps, respectively. Influence of BaCeO 3 addition on magnetization characteristics of melt-textured Y-Ba-Cu-O superconductor was investigated. The variation of magnetization behavior due to the addition of BaCeO 3 is discussed on the basis of the related microstructures. 37 figs, 1 tab, 56 refs. (Author)
Higher critical current density achieved in Bi-2223 High-Tc superconductors
Directory of Open Access Journals (Sweden)
M.S. Shalaby
2016-07-01
Full Text Available Bi2Sr2Ca2Cu3Ox (Bi-2223 were prepared using a solid state reaction method at different sintering times and temperatures. Structural phase identifications have been done using X-Ray analysis and refinement by Reitveld method which proves the coexistence of Bi-2223 and Bi-2212 phases. The critical transition temperature Tc and critical current density Jc values were measured using superconducting quantum interference device magnetometer (SQUID and by the magneto-optics technique. A remarkable rapid decrease to the diamagnetic signal in the magnetization versus temperature M(T at 110 K and Jc around 1.2 × 107 A/m2 at 5 K are confirmed for the Bi-2223 compound.
Directory of Open Access Journals (Sweden)
Muhammad Ari Adriansyah
2013-05-01
Full Text Available Cookie companies are demanded to improve their product quality, product quality is one of the important things. Because with a good product quality, it will deliver purchase intention; with the intention earned by customer, it will also deliver the purchase decision process. The purpose of this research is to analyse the effect of product quality towards purchase intention and its impact on the purchase decision process. The method used in this research is descriptive-associative, with Path Analysis. Questionnaires were distributed to J&C Cookies’ consumers. The findings of this research show that the product quality gives a big influence to customer’s purchase intention and gives a big and positive impact on purchase decision process of J&C Cookies’ customers.
Energy Technology Data Exchange (ETDEWEB)
Wee, Sung Hun [ORNL; Goyal, Amit [ORNL; Specht, Eliot D [ORNL; Cantoni, Claudia [ORNL; Zuev, Yuri L [ORNL; Selvamanickam, V. [SuperPower Incorporated, Schenectady, New York; Cook, Sylvester W [ORNL
2010-01-01
We report rare earth barium tantalates, Ba2RETaO6 (BRETO, RE = rare earth elements) as a new class of additives for superior flux-pinning in YBa2Cu3O7- (YBCO) films. BRETO compounds have excellent chemical inertness to and large lattice mismatch with YBCO. This results in phase separation and strain minimization driven self-assembly of BRETO nanocolumns within YBCO films. YBCO+4 vol% Ba2GdTaO6 films show similar Tc to that of an un-doped film of ~ 88.3 K, a higher self-field Jc of 3.8 MA/cm2 at 77 K, and significantly improved in-field Jc higher by a factor of 1.5-6 over entire magnetic field and angular ranges.
Margiani, N. G.; Mumladze, G. A.; Adamia, Z. A.; Kuzanyan, A. S.; Zhghamadze, V. V.
2018-05-01
In this paper, the combined effects of B4C-doping and planetary ball milling on the phase evolution, microstructure and transport properties of Bi1.7Pb0.3Sr2Ca2Cu3Oy(B4C)x HTS with x = 0 ÷ 0.125 were studied through X-ray diffraction (XRD), scanning electron microscopy (SEM), resistivity and critical current density measurements. Obtained results have shown that B4C additive leads to the strong acceleration of high-Tc phase formation and substantial enhancement in Jc. High-energy ball milling seems to produce a more homogeneous distribution of refined doped particles in the (Bi,Pb)-2223 HTS which results in an improved intergranular flux pinning and better self-field Jc performance.
Enhancement of the irreversibility field in bulk MgB2 by TiO2 nanoparticle addition
DEFF Research Database (Denmark)
Xu, G.J.; Grivel, Jean-Claude; Abrahamsen, A.B.
2004-01-01
MgB2 samples doped with TiO2 nanoparticles were prepared and the effect of TiO2 addition on the superconducting transition temperature (T-c), irreversibility field (H-irr) and critical current density (J(c)) were investigated. It is found that the hexagonal lattice parameters a and c decrease...... with TiO2 doping. Tc decreases gradually from 38.2 to 37.8 K as the TiO2 content increases from 0 to 15 wt%. The H-irr increases at 20 K from 4.3 to 4.9 T as the TiO2 content increases from 0 to 10 wt%, and at the same temperature J(c) increases from 450 to 4250 A/cm(2) at 4.2 T. (C) 2004 Published...
Pinning of Josephson vortex chain in periodically heterogeneous junctions: theory and experiment
International Nuclear Information System (INIS)
Malomed, B.A.; Ustinov, A.V.
1989-01-01
Critical values of the density of extrinsic current of rigid Josephson vortex chain depinning in a long Josephson junction are calculated in terms of the perturbation theory. The dynamics of the chain is considered. In particular, a minimum value of the current density is estimated which permits the chain free motion through the transition on dissipation. The dependence of critical current, Jc, on external magnetic field H is measured for long Josephson junctions Nb-NbO x -Pb with artificial spatially periodic heterogeneities of dielectric barrier. For multiple values of H, the curve Jc(H) is found to display some peaks which, by the theory, are responsible for by an increase in the force of Josephson vortex chain and the heterogeneity lattice are commensurate
Humanized mouse models: Application to human diseases.
Ito, Ryoji; Takahashi, Takeshi; Ito, Mamoru
2018-05-01
Humanized mice are superior to rodents for preclinical evaluation of the efficacy and safety of drug candidates using human cells or tissues. During the past decade, humanized mouse technology has been greatly advanced by the establishment of novel platforms of genetically modified immunodeficient mice. Several human diseases can be recapitulated using humanized mice due to the improved engraftment and differentiation capacity of human cells or tissues. In this review, we discuss current advanced humanized mouse models that recapitulate human diseases including cancer, allergy, and graft-versus-host disease. © 2017 Wiley Periodicals, Inc.
Optical visualisation of thermogenesis in stimulated single-cell brown adipocytes.
Kriszt, Rókus; Arai, Satoshi; Itoh, Hideki; Lee, Michelle H; Goralczyk, Anna G; Ang, Xiu Min; Cypess, Aaron M; White, Andrew P; Shamsi, Farnaz; Xue, Ruidan; Lee, Jung Yeol; Lee, Sung-Chan; Hou, Yanyan; Kitaguchi, Tetsuya; Sudhaharan, Thankiah; Ishiwata, Shin'ichi; Lane, E Birgitte; Chang, Young-Tae; Tseng, Yu-Hua; Suzuki, Madoka; Raghunath, Michael
2017-05-03
The identification of brown adipose deposits in adults has led to significant interest in targeting this metabolically active tissue for treatment of obesity and diabetes. Improved methods for the direct measurement of heat production as the signature function of brown adipocytes (BAs), particularly at the single cell level, would be of substantial benefit to these ongoing efforts. Here, we report the first application of a small molecule-type thermosensitive fluorescent dye, ERthermAC, to monitor thermogenesis in BAs derived from murine brown fat precursors and in human brown fat cells differentiated from human neck brown preadipocytes. ERthermAC accumulated in the endoplasmic reticulum of BAs and displayed a marked change in fluorescence intensity in response to adrenergic stimulation of cells, which corresponded to temperature change. ERthermAC fluorescence intensity profiles were congruent with mitochondrial depolarisation events visualised by the JC-1 probe. Moreover, the averaged fluorescence intensity changes across a population of cells correlated well with dynamic changes such as thermal power, oxygen consumption, and extracellular acidification rates. These findings suggest ERthermAC as a promising new tool for studying thermogenic function in brown adipocytes of both murine and human origins.
Ketolide agents HMR 3004 and HMR 3647 (telithromycin) inhibit the ...
African Journals Online (AJOL)
Department of Medical Sciences, Public Health, Health Promotion, Faculty of. Health Sciences ... the development of new antiparasitic drugs effective at low concentrations. Ketolides ..... WR, Boothroyd JC, Khosla C. Chemistry and biology.
Indian Academy of Sciences (India)
Jadavpur), FNASc, FRCP (London). Date of birth: 2 November 1960. Specialization: Pharmacology, Immunology, Parasitology Address: Department of Pharmacology, Institute of PG Medical Education & Research, 244-B, Acharya JC Bose Road, ...
Energy Technology Data Exchange (ETDEWEB)
Rabe, Craig D.; Nelson, Douglas D. [Nez Perce Tribe
2008-11-17
were 120,415 HOR supplementation smolts released into Johnson Creek during the week of March 12, 2007. Life stage-specific juvenile survival from Johnson Creek to Lower Granite and McNary dams was calculated for brood year 2005 NOR and HOR supplementation juvenile Chinook salmon. Survival of NOR parr Chinook salmon migrating from Johnson Creek to Lower Granite and McNary dams was 28.2% and 16.2%. Survival of NOR presmolt Chinook salmon migrating from Johnson Creek to Lower Granite and McNary dams was 28.2% and 22.3%. Survival of NOR smolt Chinook salmon migrating from Johnson Creek to Lower Granite and McNary dams was 44.7% and 32.9%. Survival of HOR smolt Chinook salmon migrating from Johnson Creek to Lower Granite and McNary dams was 31.9% and 26.2%. Multi-year analysis on smolt to adult return rate's (SAR's) and progeny to parent ratio's (P:P's) were calculated for NOR and HOR supplementation Brood Year 2002 Chinook salmon. SAR's were calculated from Johnson Creek to Johnson Creek (JC to JC), Lower Granite Dam to Lower Granite (LGD to LGD), and Lower Granite Dam to Johnson Creek (LGD to JC); for NOR fish SAR's were 0.16%, 1.16% and 1.12%, while HOR supplementation SAR's from JC to JC, LGD to LGD and LGD to JC were 0.04%, 0.19% and 0.13%. P:P's for all returning NOR and HOR supplemented adults were under replacement levels at 0.13 and 0.65, respectively. Recruit per spawner estimates (R/S) for Brood Year 2005 adult Chinook salmon were also calculated for NOR and HOR supplemented Chinook salmon at JC and LGD. R/S estimates for NOR and HOR supplemented fish at JC were 231 and 1,745, while R/S estimates at LGD were 67 and 557. Management recommendations address (1) effectiveness of data collection methods, (2) sufficiency of data quality (statistical power) to enable management recommendations, (3) removal of uncertainty and subsequent cessation of M&E activities, and (4) sufficiency of findings for program modifications prior to
Lawrence, David
2017-07-01
Within the literature surrounding nonhuman animals on the one hand and cognitively disabled humans on the other, there is much discussion of where beings that do not satisfy the criteria for personhood fit in our moral deliberations. In the future, we may face a different but related problem: that we might create (or cause the creation of) beings that not only satisfy but exceed these criteria. The question becomes whether these are minimal criteria, or hierarchical, such that those who fulfill them to greater degree should be afforded greater consideration. This article questions the validity and necessity of drawing divisions among beings that satisfy the minimum requirements for personhood; considering how future beings-intelligent androids, synthezoids, even alternate-substrate sentiences-might fit alongside the "baseline" human. I ask whether these alternate beings ought to be considered different to us, and why this may or may not matter in terms of a notion of "human community." The film Blade Runner, concerned in large part with humanity and its key synthezoid antagonist Roy Batty, forms a framing touchstone for my discussion. Batty is stronger, faster, more resilient, and more intelligent than Homo sapiens. His exploits, far beyond the capability of normal humans, are contrasted with his frailty and transient lifespan, his aesthetic appreciation of the sights he has seen, and his burgeoning empathy. Not for nothing does his creator within the mythos term him "more human than human."
International Nuclear Information System (INIS)
Park, Ji-Won; Yang, Se Young; Kim, Dae Yong; Oh, Jae Hwan; Cho, Jae Youl; Yoo, Byong Chul; Kim, Seung Cheol; Kim, Won Ki; Hong, Jun Pyu; Kim, Kyung-Hee; Yeo, Hyun Yang; Lee, Jae Yong; Kim, M Sun; Kim, Jong Heon
2014-01-01
Resistance to 5-fluorouracil (5-FU) in patients with colorectal cancer prevents effective treatment and leads to unnecessary and burdensome chemotherapy. Therefore, prediction of 5-FU resistance is imperative. To identify the proteins linked to 5-FU resistance, two-dimensional gel electrophoresis-based proteomics was performed using the human colon cancer cell line SNU-C4R with induced 5-FU resistance. Proteins showing altered expression in SNU-C4R were identified by matrix-associated laser desorption/ionization–time-of-flight analysis, and their roles in susceptibility to 5-FU or radiation were evaluated in various cell lines by transfection of specific siRNA or creation of overexpression constructs. Changes in cellular signaling and expression of mitochondrial apoptotic factors were investigated by Western Blot analysis. A mitochondrial membrane potential probe (JC-1 dye) and a flow cytometry system were employed to determine the mitochondrial membrane potential. Finally, protein levels were determined by Western Blot analysis in tissues from 122 patients with rectal cancer to clarify whether each identified protein is a useful predictor of a chemoradiation response. We identified mitochondrial phosphoenolpyruvate carboxykinase (mPEPCK) as a candidate predictor of 5-FU resistance. PEPCK was downregulated in SNU-C4R compared with its parent cell line SNU-C4. Overexpression of mPEPCK did not significantly alter the susceptibility to either 5-FU or radiation. Suppression of mPEPCK led to a decrease in both the cellular level of phosphoenolpyruvate and the susceptibility to 5-FU and radiation. Furthermore, the cellular levels of phosphoenolpyruvate (an end product of PEPCK and a substrate of pyruvate kinase), phosphorylated AKT, and phosphorylated 4EBP1 were decreased significantly secondary to the mPEPCK suppression in SNU-C4. However, mPEPCK siRNA transfection induced changes in neither the mitochondrial membrane potential nor the expression levels of
Construction and Validation of a Scale to Measure Maslow's Concept of Self-Actualization
Jones, Kenneth Melvin; Randolph, Daniel Lee
1978-01-01
Designed to measure self-actualization as defined by Abraham Maslow, the Jones Self Actualizing Scale, as assessed in this study, possesses content validity, reliability, and a number of other positive characteristics. (JC)
Directory of Open Access Journals (Sweden)
Kohei Honda
2013-01-01
Conclusions: These results suggest that pollen count levels may correlate with the rate of sensitization for JC pollinosis, but may not affect the rate of onset among sensitized children in northeast Japan.
Consumption patterns and intra-household roles in the production ...
African Journals Online (AJOL)
Consumption patterns and intra-household roles in the production, processing and marketing of soyabeans in the Northern Agricultural Zone of Benue State, Nigeria. AE Agwu, J Ellah, E Ekweagwu, JC Iwuchukwu ...
characterisation of silica surfaces iii: characterisation of aerosil
African Journals Online (AJOL)
Preferred Customer
Department of Chemistry, University of Botswana, Private Bag 00704, Gaborone, Botswana ... engineering, chemical and drug delivery, chemical and biochemical diagnostics, nano ..... Morgan, J.C. Ph.D. Thesis, University of Bristol, UK, 1976.
Hacker NF. Vulvar and vaginal cancer. In: Hacker NF, Gambone JC, Hobel CJ, eds. Hacker and Moore's Essentials of Obstetrics and Gynecology . 6th ed. Philadelphia, PA: Elsevier; 2016:chap 40. Jhingran ...
... test; Cancer of cervix - HPV DNA test References Hacker NF. Cervical dysplasia and cancer. In: Hacker NF, Gambone JC, Hobel CJ, eds. Hacker and Moore's Essentials of Obstetrics and Gynecology . 6th ...
Inter-Plant Interaction: Ecological disturbance through PLANT Invasion
Indian Academy of Sciences (India)
First page Back Continue Last page Graphics. R. K. Kohli Ph.D. FNA, FASc, FNASc, FNAAS, FBS, FNESA. Certified Sr Ecologist, ESA, USA. JC Bose National Fellow. &. Dean Research. Panjab University, Chandigarh.
Tuning Vortex Creep in Irradiated YBa2Cu3O7-δ Coated Conductors
Eley, Serena; Kihlstrom, Karen; Holleis, Sigrid; Leroux, Maxime; Rupich, Martin; Miller, Dean; Kayani, Asghar; Welp, Ulrich; Kwok, Wai-Kwong; Civale, Leonardo
YBa2Cu3O7-δ coated conductors (CCs) show non-monotonic changes in the temperature-dependent creep rate, S (T) , due to mixed pinning landscapes comprised of twin boundaries, planar defects, point defects, and nanoparticle precipitates. Notably, in low fields, there is a conspicuous dip in S as T increases from ~20K to ~65K. The source of this dip is poorly understood. Moreover, pinning landscapes that are favorable for high critical currents, Jc, are not necessarily optimal for low S. We have found that, though oxygen irradiation introduces few-nm-sized defects that result in significant increases in Jc, it is detrimental to creep, increasing S (reducing the dip depth) for T > 20K. Understanding the source of this dip is crucial to engineering pinning landscapes that concurrently promote high Jc and low S. To this end, we study changes in S (T) as we tune the ratio of smaller (point to few-nm-sized) defects to larger nanoparticles in an oxygen-irradiated CC by annealing in O2 at 250°C to 600°C. We observe a steady decrease in S (T > 20K) with increasing annealing temperature. This suggests that pre-existing nanoparticle precipitates are likely responsible for the dip in S (T) , and underlines the fact that the effects of defects are not additive, but rather can be competitive.
Genome-wide analysis of the GRAS gene family in physic nut (Jatropha curcas L.).
Wu, Z Y; Wu, P Z; Chen, Y P; Li, M R; Wu, G J; Jiang, H W
2015-12-29
GRAS proteins play vital roles in plant growth and development. Physic nut (Jatropha curcas L.) was found to have a total of 48 GRAS family members (JcGRAS), 15 more than those found in Arabidopsis. The JcGRAS genes were divided into 12 subfamilies or 15 ancient monophyletic lineages based on the phylogenetic analysis of GRAS proteins from both flowering and lower plants. The functions of GRAS genes in 9 subfamilies have been reported previously for several plants, while the genes in the remaining 3 subfamilies were of unknown function; we named the latter families U1 to U3. No member of U3 subfamily is present in Arabidopsis and Poaceae species according to public genome sequence data. In comparison with the number of GRAS genes in Arabidopsis, more were detected in physic nut, resulting from the retention of many ancient GRAS subfamilies and the formation of tandem repeats during evolution. No evidence of recent duplication among JcGRAS genes was observed in physic nut. Based on digital gene expression data, 21 of the 48 genes exhibited differential expression in four tissues analyzed. Two members of subfamily U3 were expressed only in buds and flowers, implying that they may play specific roles. Our results provide valuable resources for future studies on the functions of GRAS proteins in physic nut.
Sarmiento, Carolina; Zalamea, Paul-Camilo; Dalling, James W; Davis, Adam S; Stump, Simon M; U'Ren, Jana M; Arnold, A Elizabeth
2017-10-24
The Janzen-Connell (JC) hypothesis provides a conceptual framework for explaining the maintenance of tree diversity in tropical forests. Its central tenet-that recruits experience high mortality near conspecifics and at high densities-assumes a degree of host specialization in interactions between plants and natural enemies. Studies confirming JC effects have focused primarily on spatial distributions of seedlings and saplings, leaving major knowledge gaps regarding the fate of seeds in soil and the specificity of the soilborne fungi that are their most important antagonists. Here we use a common garden experiment in a lowland tropical forest in Panama to show that communities of seed-infecting fungi are structured predominantly by plant species, with only minor influences of factors such as local soil type, forest characteristics, or time in soil (1-12 months). Inoculation experiments confirmed that fungi affected seed viability and germination in a host-specific manner and that effects on seed viability preceded seedling emergence. Seeds are critical components of reproduction for tropical trees, and the factors influencing their persistence, survival, and germination shape the populations of seedlings and saplings on which current perspectives regarding forest dynamics are based. Together these findings bring seed dynamics to light in the context of the JC hypothesis, implicating them directly in the processes that have emerged as critical for diversity maintenance in species-rich tropical forests.
Cao, Lijun; Li, Dongfang; Feng, Peng; Li, Lin; Xue, Guo-Fang; Li, Guanglai; Hölscher, Christian
2016-04-13
The incretins glucagon-like peptide 1 (GLP-1) and glucose-dependent insulinotropic polypeptide (GIP) are growth factors. GLP-1 mimetics are on the market as treatments for type 2 diabetes. Both GLP-1 and GIP mimetics have shown neuroprotective properties in previous studies. In addition, the GLP-1 mimetic exendin-4 has shown protective effects in a clinical trial in Parkinson's disease (PD) patients. Novel GLP-1/GIP dual-agonist peptides have been developed to treat diabetes. Here, we report the neuroprotective effects of a novel dual agonist (DA-JC1) in the 1-methyl-4-phenyl-1,2,3,6-tetrahydropyridine (MPTP) mouse model of PD. MPTP was injected once daily (20 mg/kg intraperitoneally) for 7 days and the dual agonist was coinjected once daily (50 nmol/kg intraperitoneally). We found that the drug reduced most of the MPTP-induced motor impairments in the rotarod, open-field locomotion, and muscle strength test. The number of tyrosine hydroxylase-positive neurons in the substantia nigra and striatum was reduced by MPTP and increased by DA-JC1. Synapse numbers (synaptophysin expression) were reduced in the substantia nigra and the striatum by MPTP and DA-JC1 reversed this effect. The activation of a chronic inflammation response by MPTP was considerably reduced by the dual agonist (DA) (astroglia and microglia activation). Therefore, dual agonists show promise as a novel treatment of PD.
International Nuclear Information System (INIS)
Deschanels, X.
1992-11-01
The principal goal of this work is to quantify the influence of texture of ceramic superconductors ReBaCuO (Re=Dy, Y) on their critical current density (Jc). The magnetic alignment of particles at ambient temperature is the first technique who has allowed us to produce superconducting (Meissner effect) and textured ceramics. However, these materials are very brittle because of their porosity and this makes it impossible to measure their Jc. Press-forging (or creep sintering) is the second technique who has allowed us to prepare highly textured ceramics materials which are also dense. We have studied the influence of various conditions of thermomechanical treatment (sintering time and temperature, applied load, rate of deformation, density of the material at the beginning) on the texture quality. We have shown that at 900 deg, the eutectic liquid formed by BaCuO 2 , CuO and YBa 2 Cu 3 0 7-Y various mechanisms that help explain the formation of observed texture. After the oxidation stage which requires heat treatment under controlled atmospheres, we obtain superconducting ceramics (Tc=85 K). Moreover, this study also shows that the texture can improve the Jc by 400%, to 750 A/cm 2 at 77 K in the best specimens. This low value is explained by the presence of non-superconducting secondary phases and amorphous phases at the grain boundaries. (Author). 120 refs., figs., tabs
Energy Technology Data Exchange (ETDEWEB)
Polat, Ozgur [ORNL; Sinclair IV, John W [ORNL; Zuev, Yuri L [ORNL; Thompson, James R [ORNL; Christen, David K [ORNL; Cook, Sylvester W [ORNL; Kumar, Dhananjay [ORNL; Chen, Y [SuperPower Incorporated, Schenectady, New York; Selvamanickam, V. [SuperPower Incorporated, Schenectady, New York
2011-01-01
The dependence of the critical current density Jc on temperature, magnetic field, and film thickness has been investigated in (Gd-Y)BaCu-oxide materials of 0.7, 1.4, and 2.8 m thickness. Generally, the Jc decreases with film thickness at investigated temperatures and magnetic fields. The nature and strength of the pinning centers for vortices have been identified through angular and temperature measurements, respectively. These films do not exhibit c-axis correlated vortex pinning, but do have correlated defects oriented near the ab-planes. For all film thicknesses studied, strong pinning dominates at most temperatures. The vortex dynamics were investigated through magnetic relaxation studies in the temperature range of 5 77 K in 1 T and 3 T applied magnetic fields, H || surface-normal. The creep rate S is thickness dependent at high temperatures, implying that the pinning energy is also thickness dependent. Maley analyses of the relaxation data show an inverse power law variation for the effective pinning energy Ueff ~ (J0/J) . Finally, the electric field-current density (E-J) characteristics were determined over a wide range of dissipation by combining experimental results from transport, swept field magnetometry (VSM), and Superconducting Quantum Interference Device (SQUID) magnetometry. We develop a self-consistent model of the combined experimental results, leading to an estimation of the critical current density Jc0(T) in the absence of flux creep.
Devenir un dieu. La mort d’Auguste et la naissance de la monarchie impériale
Directory of Open Access Journals (Sweden)
Frédéric HURLET
2015-03-01
Full Text Available Une des manifestations les plus remarquables de l’intelligence politique dont Auguste ?t preuve tout au long de sa vie fut d’avoir organisé dans les moindres détails ses propres funérailles. Il s’agissait d’éviter que se reproduisent à cette occasion les troubles qui avaient suivi la mort de son père adoptif Jules César le 15 mars 44 av. J.-C. et de garantir dans le même temps le succès de la première transmission dynastique du pouvoir impérial. Cet article étudie les enjeux politiques des événements des mois d’août et septembre 14 ap. J.-C. dans un ordre chronologique qui passe en revue les trois étapes suivantes : le décès d’Auguste proprement dit à travers les récits édi?ants qui lui ont été consacrés durant l’Antiquité ; le traitement de sa dépouille jusqu’au transfert de ses cendres dans son Mausolée ; sa divinisation. Le mythe d’Auguste est né en 14 ap. J.-C., au moment même où la continuité de la monarchie impériale était dé?nitivement assurée.
International Nuclear Information System (INIS)
Morhenn, V.B.; Kaye, J.A.
1979-01-01
Pre-treatment of baby hamster kidney (BHK) cells with 8-methoxypsoralen (8-MOP) plus ultraviolet (UV) light enhances the frequency of their transformation by polyoma (Py) virus. Of the doses tested, 0.5 microgram/m1 8-MOP plus 0 . 3 J/cm2 UV-light results in maximal (30-fold) stimulation of viral transformation. 8-MOP alone does not affect viral transformation and UV-light alone causes only a slight increase in the transformation frequency. Thus the drug and light act synergistically in promoting the effect. Treatment of BHK cells with drug plus light without Py infection does not lead to a transformed morphology. A drug-light combination (0 . 01 microgram/m1 8-MOP plus 1 . 2 J/cm2 UV) that inhibits cellular DNA synthesis is 75% of control at 28 hr after treatment results in a 6-fold stimulation of the transformation frequency
DEFF Research Database (Denmark)
Cramer, Elisabeth P; Glenthøj, Andreas; Häger, Mattias
2012-01-01
tumor volume, or to the number of metastases. Histology and gelatinolytic activity of the mammary tumors did not differ between wild-type and lipocalin-2-deficient mice. We conclude that NGAL/lipocalin-2 does not invariably affect the aggressiveness of breast cancers as assessed in mouse models, thus......NGAL/lipocalin-2 is a siderophore-binding protein that is highly expressed in several cancers. It is suggested to confer a proliferative advantage to cancer cells. Its expression has been correlated with aggressiveness of breast cancer as determined both in patients and in mouse breast cancer...... models. This was recently confirmed in two mouse models of spontaneous breast cancer in wild-type and lipocalin-2-deficient mice. We used a similar strategy using a different mouse strain. Lipocalin-2-deficient mice and mouse mammary tumor virus-polyoma middle T antigen (MMTV-PyMT) mice were crossed...
Which Are the Cells of Origin in Merkel Cell Carcinoma
International Nuclear Information System (INIS)
Tilling, T.; Moll, I.
2012-01-01
Merkel cell carcinoma (MCC), a highly aggressive skin tumour with increasing incidence, is associated with the newly discovered Merkel cell polyoma virus (MCPyV). Studies on MCC and MCPyV as well as other risk factors have significantly increased our knowledge of MCC pathogenesis, but the cells of origin, which could be important targets in future therapies, are still unknown. Merkel cells (MCs), the neuroendocrine cells of the skin, were believed to be at the origin of MCC due to their phenotypic similarities. However, for several reasons, for example, heterogeneous differentiation of MCCs and post mitotic character of MCs, it is not very likely that MCC develops from differentiated MCs. Skin stem cells, probably from the epidermal lineage, are more likely to be cells of origin in MCC. Future studies will have to address these questions more directly in order to identify the physiological cells which are transformed to MCC cells.
AFRREV LALIGENS: An International Journal of Language ...
African Journals Online (AJOL)
Communicative Competence and General Studies in English in Tertiary Institutions in Nigeria · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. JC Anyadiegwu, 44-51 ...
Johnston, Basil
1978-01-01
Describing the values and moral orientations associated with the Cannibal Dance Ceremony, this article emphasizes the Kwahiutl's belief in the free will to choose between good or selflessness and evil or selfishness. (JC)
Human Capital, (Human) Capabilities and Higher Education
Le Grange, L.
2011-01-01
In this article I initiate a debate into the (de)merits of human capital theory and human capability theory and discuss implications of the debate for higher education. Human capital theory holds that economic growth depends on investment in education and that economic growth is the basis for improving the quality of human life. Human capable…
The Human/Machine Humanities: A Proposal
Directory of Open Access Journals (Sweden)
Ollivier Dyens
2016-03-01
Full Text Available What does it mean to be human in the 21st century? The pull of engineering on every aspect of our lives, the impact of machines on how we represent ourselves, the influence of computers on our understanding of free-will, individuality and species, and the effect of microorganisms on our behaviour are so great that one cannot discourse on humanity and humanities without considering their entanglement with technology and with the multiple new dimensions of reality that it opens up. The future of humanities should take into account AI, bacteria, software, viruses (both organic and inorganic, hardware, machine language, parasites, big data, monitors, pixels, swarms systems and the Internet. One cannot think of humanity and humanities as distinct from technology anymore.
Gautam, Bibek; Sebastian, Mary Ann; Chen, Shihong; Shi, Jack; Haugan, Timothy; Xing, Zhongwen; Zhang, Wenrui; Huang, Jijie; Wang, Haiyan; Osofsky, Mike; Prestigiacomo, Joseph; Wu, Judy Z.
2017-07-01
An elastic strain model was applied to evaluate the rigidity of the c-axis aligned one-dimensional artificial pinning centers (1D-APCs) in YBa2Cu3O7-δ matrix films. Higher rigidity was predicted for BaZrO3 1D-APCs than that of the BaHfO3 1D-APCs. This suggests a secondary APC doping of Y2O3 in the 1D-APC/YBa2Cu3O7-δ nanocomposite films would generate a stronger perturbation to the c-axis alignment of the BaHfO3 1D-APCs and therefore a more isotropic magnetic vortex pinning landscape. In order to experimentally confirm this, we have made a comparative study of the critical current density Jc (H, θ, T) of 2 vol.% BaZrO3 + 3 vol.%Y2O3 and 2 vol.%BaHfO3 + 3 vol.%Y2O3 double-doped (DD) YBa2Cu3O7-δ films deposited at their optimal growth conditions. A much enhanced isotropic pinning was observed in the BaHfO3 DD samples. For example, at 65 K and 9.0 T, the variation of the Jc across the entire θ range from θ=0 (H//c) to θ=90 degree (H//ab) is less than 18% for BaHfO3 DD films, in contrast to about 100% for the BaZrO3 DD counterpart. In addition, lower α values from the Jc(H) ˜ H-α fitting were observed in the BaHfO3 DD films in a large θ range away from the H//c-axis. Since the two samples have comparable Jc values at H//c-axis, the improved isotropic pinning in BaHfO3 DD films confirms the theoretically predicted higher tunability of the BaHfO3 1D-APCs in APC/YBa2Cu3O7-δ nanocomposite films.
Directory of Open Access Journals (Sweden)
Kadir Muhammad
2006-08-01
Full Text Available Abstract Background Journal clubs are an internationally recognized teaching tool in many postgraduate medical education fields. In developing countries lack of funds for current print materials may have limited journal club use. But with advancing information technology trainees in developing countries increasingly have more access to high quality journals online. However, we are aware of no studies describing journal club existence and effectiveness in postgraduate medical training in Pakistan. Also we have found no published effectiveness studies of this teaching modality in Community Medicine (Public Health in any country. This study evaluated the effectiveness of Community Medicine (Public Health Resident Journal Club (CMR-JC in Aga Khan University, Pakistan using international criteria for successful journal clubs (2 years continuous existence and more than 50% attendance and examining resident and alumni satisfaction. Methods Journal club effectiveness criteria were searched using electronic search databases. Departmental records were reviewed from September1999–September 2005. Ninety percent of residents and alumni of Community Medicine Residency Programme participated voluntarily in a confidential survey. Results The CMR-JC was regularly conducted. More than 95% of residents attended. (Total residents in the CMR-Programme: 32. Twenty-seven out of 29 current residents/alumni responded to the anonymous questionnaire. Acquisition of critical appraisal skills (23 respondents and keeping up with current literature (18 respondents were the two most important objectives achieved. Respondents recommended improved faculty participation and incorporating a structured checklist for article review. Conclusion CMR-JC fulfils criteria for effective journal clubs. Residents and alumni agree CMR-JC meets its objectives. Incorporating suggested recommendations will further improve standards. The journal club learning modality should be included in
Sánchez-Mendiola, Melchor; Morales-Castillo, Daniel; Torruco-García, Uri; Varela-Ruiz, Margarita
2015-12-14
A time-honored strategy for keeping up to date in medicine and improving critical appraisal skills is the Journal Club (JC). There are several reports of its use in medicine and allied health sciences but almost no reports of JC focused on medical education. The purpose of the study is to describe and evaluate an eight years' experience with a medical education Journal Club (MEJC). We started a monthly medical education JC in 2006 at UNAM Faculty of Medicine in Mexico City. Its goal is to provide faculty with continuing professional development in medical education. A discussion guide and a published paper were sent 2 weeks before sessions. We reviewed the themes and publication types of the papers used in the sessions, and in June-July 2014 administered a retrospective post-then-pre evaluation questionnaire to current participants that had been regular attendees to the JC for more than 2 years. The retrospective post-then-pre comparisons were analyzed with Wilcoxon signed-rank test. Effect sizes were calculated for the pre-post comparisons with Cohen's r. There have been 94 MEJC sessions until July 2014. Average attendance is 20 persons, a mix of clinicians, educators, psychologists and a sociologist. The articles were published in 32 different journals, and covered several medical education themes (curriculum, faculty development, educational research methodology, learning methods, assessment, residency education). 22 Attendees answered the evaluation instrument. The MEJC had a positive evaluation from good to excellent, and there was an improvement in self-reported competencies in medical education literature critical appraisal and behaviors related to the use of evidence in educational practice, with a median effect size higher than 0.5. The evaluation instrument had a Cronbach's alpha of 0.96. A periodic Medical Education Journal Club can improve critical appraisal of the literature, and be maintained long-term using evidence-based strategies. This activity
Solid Foods: How to Get Your Baby Started
... nutritional interventions. The Journal of Allergy and Clinical Immunology: In Practice. 2013;1:29. For consumers: Seven ... allergic diseases. The Journal of Allergy and Clinical Immunology. 2013;131:78. Kiefte-de Jong JC, et ...
Genetics Home Reference: alpha-mannosidosis
... the lysosomes , which are compartments that digest and recycle materials in the cell. Within lysosomes, the enzyme ... JC, Saftig P, Fogh J, Malm D. Natural history of alpha mannosidosis a longitudinal study. Orphanet J ...
The British Empire and the English Curriculum.
Thron, E. Michael
1987-01-01
Examines the recent call for English departments to recognize literature that falls outside the British and American tradition. Suggests that we recognize English as a world language and choose books to teach accordingly. (JC)
... Maclean JC. Alcohol consumption and body weight. Health Econ . 2010;19(7):814-832. PMID: 19548203 www. ... member of Hi-Ethics and subscribes to the principles of the Health on the Net Foundation (www. ...
Lifescience Database Archive (English)
Full Text Available , Moroz SP, Hadorn HB, Sadler JE, Roscher AA ... TITLE ... Mutations in the proenteropeptidase gene are the mo...2 ... AUTHORS ... Holzinger A, Maier EM, Buck C, Mayerhofer PU, Kappler M, Haworth JC
English, Rachel A.
2011-01-01
This was a book review on:- Confronting Managerialism. How The Business Elite And Their Schools Threw Our Lives Out Of Balance. Author:- Robert R. Locke & J.C. Spender. Publisher:- Zed Books, London & New York.
Urinary tract infection - children
UTI - children; Cystitis - children; Bladder infection - children; Kidney infection - children; Pyelonephritis - children ... Craig JC. Long-term antibiotics for preventing recurrent urinary tract infection in children. Cochrane Database Syst Rev . 2011;(3):CD001534. PMID: ...
A School in Siberia: 14-Year-Olds Take University Math Course.
Bogdanovsky, Georgy
1978-01-01
Ordinary students (n=40) are participating in a Soviet experiment wherein they are taught by well-known scientists and specialists in a math-intensive course comparable to that taught at the Kiev University. (JC)
The Use of Ethnographic Methods in Educational Evaluation
Wilson, Stephen
1977-01-01
By treating a school as a subculture, the Center for New Schools hopes to use the techniques of anthropology to elucidate behavioral problems which may be keeping school members from achieving their goals. (JC)
Modulation of PML protein expression regulates JCV infection
International Nuclear Information System (INIS)
Gasparovic, Megan L.; Maginnis, Melissa S.; O'Hara, Bethany A.; Dugan, Aisling S.; Atwood, Walter J.
2009-01-01
JC virus (JCV) is a human polyomavirus that infects the majority of the human population worldwide. It is responsible for the fatal demyelinating disease Progressive Multifocal Leukoencephalopathy. JCV binds to cells using the serotonin receptor 5-HT 2A R and α(2-6)- or α(2-3)-linked sialic acid. It enters cells using clathrin-dependent endocytosis and traffics to the early endosome and possibly to the endoplasmic reticulum. Viral DNA is then delivered to the nucleus where transcription, replication, and assembly of progeny occur. We found that the early regulatory protein large T antigen accumulates in microdomains in the nucleus adjacent to ND-10 or PML domains. This observation prompted us to explore the role of these domains in JCV infection. We found that a reduction of nuclear PML enhanced virus infection and that an increase in nuclear PML reduced infection. Infection with JCV did not directly modulate nuclear levels of PML but our data indicate that a host response involving interferon beta is likely to restrict virus infection by increasing nuclear PML.
Human trafficking in Germany: strengthening victim's human rights
Follmar-Otto, Petra; Rabe, Heike
2009-01-01
The first study - "A human rights approach against human trafficking - International obligations and the status of implementation in Germany" - analyses how the prohibition of human trafficking and the resulting state obligations are anchored in human rights. The more recent specialised international agreements on human trafficking and law-making in the European Union are then presented. The emphasis is on the Council of Europe Convention, which professes to treat human trafficking in a human...
International Nuclear Information System (INIS)
Adi, Wisnu Ari; Sukirman, Engkir; Winatapura, Didin S.
2000-01-01
Technique of critical current density measurement (Jc) of HTc bulk ceramic superconductor has been performed by using linear extrapolation with four-point probes method. The measurement of critical current density HTc bulk ceramic superconductor usually causes damage in contact resistance. In order to decrease this damage factor, we introduce extrapolation method. The extrapolating data show that the critical current density Jc for YBCO (123) and BSCCO (2212) at 77 K are 10,85(6) Amp.cm - 2 and 14,46(6) Amp.cm - 2, respectively. This technique is easier, simpler, and the use of the current flow is low, so it will not damage the contact resistance of the sample. We expect that the method can give a better solution for bulk superconductor application. Key words. : superconductor, critical temperature, and critical current density
Electromagnetic Properties of (Gd, Y)Ba2Cu3Ox Superconducting Tapes With High Levels of Zr Addition
Energy Technology Data Exchange (ETDEWEB)
Liu, Y; Yao, Y; Chen, Y; Khatri, ND; Liu, J; Galtsyan, E; Lei, C; Selvamanickam, V
2013-06-01
The dependence of the critical current density (J(c)) on the orientation of applied magnetic fields was studied in Zr-doped (Gd, Y)Ba2Cu3Ox tapes fabricated by metal organic chemical vapor deposition. The in-field performance of J(c) of (Gd, Y)Ba2Cu3Ox tapes with Zr-doping levels of 7.5-30 at.% was investigated up to 5 T over a temperature range of 40-77 K. The highest critical currents (I-c) at H parallel to c and the highest values of minimum Ic in angular dependence measurements were achieved in the tapes with 20% Zr doping over a broad range of temperature and magnetic field conditions measured. The electromagnetic properties have been related to the changes in BaZrO3 content and microstructure.
Fracture toughness in metal matrix composites
Directory of Open Access Journals (Sweden)
Perez Ipiña J.E.
2000-01-01
Full Text Available Evaluations of the fracture toughness in metal matrix composites (Duralcan reinforced with 15% of Al(20(3 and SiC are presented in this work. The application of Elastic Plastic Fracture Mechanics is discussed and the obtained values are compared with the ones obtained by means of Linear Elastic Fracture Mechanics. Results show that J IC derived K JC values are higher than the corresponding values obtained by direct application of the linear elastic methodology. The effect of a heat treatment on the material fracture toughness was also evaluated in which the analyzed approaches showed, not only different toughness values, but also opposite tendencies. A second comparison of the J IC and K JC values obtained in this work with toughness values reported in the literature is presented and discussed.
Lifescience Database Archive (English)
Full Text Available scription, gene) ... AUTHORS ... van der Maarel SM, Tawil R, Tapscott SJ ... TITLE ... ...JC, Aartsma-Rus AM, Frants RR, de Visser M, Desnuelle C, Sacconi S, Filippova GN, Bakker B, Bamshad MJ, Tapscott
The Educational Administrator as "The Prince".
Ryder, Sarah
1979-01-01
Quoting from Machiavelli's "Il Principe", the author demonstrates by explication and example that what was true for fifteenth century Italy is true today and maintains that principles for successful administration are universal and timeless. (JC)
Genetics Home Reference: tarsal-carpal coalition syndrome
... Belmonte JC, Choe S. Structural basis of BMP signalling inhibition by the cystine knot protein Noggin. Nature. 2002 ... Links Data Files & API Site Map Subscribe Customer Support USA.gov Copyright Privacy Accessibility FOIA Viewers & Players ...
Lifescience Database Archive (English)
Full Text Available e syndrome with nodular heterotopia. ... JOURNAL ... Clin Genet 90:258-62 (2016) DOI:10.1111/cge.12773 ... ...Taylor JC, Kini U ... TITLE ... A de novo frameshift in HNRNPK causing a Kabuki-lik
Genetics Home Reference: IRAK-4 deficiency
... Blanco JC, Salkowski C, Zhang S, Arditi M, Gallin JI, Vogel SN. Distinct mutations in IRAK-4 confer ... Ghonaium A, Day-Good NK, Holland SM, Gallin JI, Chapel H, Speert DP, Rodriguez-Gallego C, Colino ...
National Oceanic and Atmospheric Administration, Department of Commerce — This accession contains two files of salinity/temperature/oxygen data from Long Island Sound data submitted by J.C. Ayers from Cornell University and Davids Island...
... whole tooth. This area is known as the "pulp" of the tooth. The jawbone is attached to ... JC, eds. Robbins and Cotran Pathologic Basis of Disease . 9th ed. Philadelphia, PA: Elsevier Saunders; 2015:chap ...
Attitudes Toward Parenthood Among Canadian Young People
Hobart, Charles W.
1973-01-01
A study of student attitudes toward family size, use of contraceptives, authoritarian, permissive approaches to childrearing, parental responsibilities of the husband and wife and divorce. Hypotheses concerning determinants of these attitudes are also tested. (JC)
Population based reference intervals for common blood ...
African Journals Online (AJOL)
Population based reference intervals for common blood haematological and biochemical parameters in the Akuapem north district. K.A Koram, M.M Addae, J.C Ocran, S Adu-amankwah, W.O Rogers, F.K Nkrumah ...
Indian Academy of Sciences (India)
5
Patient with Familial Norrie Disease: Bilateral Blindness and Leucocoria ..... Lin RC, Shih JC (2013) Monoamine oxidase A and A/B knockout mice display autistic-like ... spectrum in familial exudative vitreoretinopathy and Norrie disease with ...
Equilibrium and Kinetic Studies of Cu (II), Cd (II), Pb (II) and Fe (II ...
African Journals Online (AJOL)
ADOWIE PERE
from Aqueous Solution Using Cocoa (Theobroma cacao) Pod Husk. *1. OBIKE, AI;. 1. IGWE, JC;. 1. EMERUWA, CN;. 2. UWAKWE, KJ. 1 Department of Pure & Industrial Chemistry, Abia State University, Uturu, Abia State, ..... Eclectica Quimica.
Epilepsy or seizures - discharge
... and the people you work with about your seizure disorder. Driving your own car is generally safe and ... References Abou-Khalil BW, Gallagher MJ, Macdonald RL. Epilepsies. In: Daroff RB, Jankovic J, Mazziotta JC, Pomeroy ...
Diffusion-weighted imaging in patients with progressive multifocal leukoencephalopathy
Energy Technology Data Exchange (ETDEWEB)
Cosottini, M. [University of Pisa, Department of Neuroscience, Pisa (Italy); Service of Neuroradiology AO, Pisa (Italy); Tavarelli, C.; De Cori, S.; Bartolozzi, C. [University of Pisa, Department of Radiology, Pisa (Italy); Del Bono, L.; Doria, G. [Unit of Infectious Diseases AO, Pisa (Italy); Giannelli, M. [Unit of Medical Physics, Pisa (Italy); Michelassi, M.C. [Service of Neuroradiology AO, Pisa (Italy); Murri, L. [University of Pisa, Department of Neuroscience, Pisa (Italy)
2008-05-15
Progressive multifocal leukoencephalopathy (PML) is a severe demyelinating disease of the central nervous system due to JC polyoma virus infection of oligodendrocytes. PML develops in patients with impaired T-cell function as occurs in HIV, malignancy or immunosuppressive drugs users. Until now no imaging methods have been reported to correlate with clinical status. Diffusion-weighted imaging (DWI) is a robust MRI tool in investigating white matter architecture and diseases. The aim of our work was to assess diffusion abnormalities in focal white matter lesions in patients with PML and to correlate the lesion load measured with conventional MRI and DWI to clinical variables. We evaluated eight patients with a biopsy or laboratory-supported diagnosis of PML. All patients underwent MRI including conventional sequences (fluid attenuated inversion recovery-FLAIR) and DWI. Mean diffusivity (MD) maps were used to quantify diffusion on white matter lesions. Global lesion load was calculated by manually tracing lesions on FLAIR images, while total, central core and peripheral lesion loads were calculated by manually tracing lesions on DWI images. Lesion load obtained with the conventional or DWI-based methods were correlated with clinical variables such as disease duration, disease severity and survival. White matter focal lesions are characterized by a central core with low signal on DWI images and high MD (1.853 x 10{sup -3} mm2/s), surrounded by a rim of high signal intensity on DWI and lower MD (1.1 x 10{sup -3} mm2/s). The MD value of normal-appearing white matter is higher although not statistically significant (0.783 x 10{sup -3} mm2/s) with respect to control subjects (0.750 x 10{sup -3} mm2/s). Inter-rater correlations of global lesion load between FLAIR (3.96%) and DWI (3.43%) was excellent (ICC =0.87). Global lesion load on FLAIR and DWI correlates with disease duration and severity (respectively, p = 0.037, p = 0.0272 with Karnofsky scale and p = 0.0338 with
... Chernecky CC, Berger BJ, eds. Laboratory Tests and Diagnostic Procedures . 6th ed. St Louis, MO: Elsevier Saunders; 2013:533-534. Radolf JD, Tramont EC, Salazar JC. Syphilis ( Treponema pallidum ). In: Bennett JE, Dolin R, Blaser ...
Over-the-counter pain relievers
... Waltham, MA: Elsevier; 2016:236-272. Dinakar P. Principles of pain management. In: Daroff RB, Jankovic J, Mazziotta JC, Pomeroy SL, eds. Bradley's Neurology in Clinical Practice . 7th ed. Philadelphia, PA: Elsevier; 2016:chap 54.
Taking narcotics for back pain
... ncbi.nlm.nih.gov/pubmed/24480962 . Dinakar P. Principles of pain management. In: Daroff RB, Jankovic J, Mazziotta JC, Pomeroy SL, eds. Bradley's Neurology in Clinical Practice . 7th ed. Philadelphia, PA: Elsevier; 2016:chap 54. ...
Positive Stereotyping: The Cultural Relativist in the Classroom
Kleinfeld, Judith
1976-01-01
While cultural relativism has been an important corrective to the ethnocentrism of the past, teachers have often vulgarized this viewpoint to mean that no standards they hold can be applied to American Indian students. (Author/JC)
Indians in Almanacs (1793-1815)
Wenrick, Jon S.
1975-01-01
The American Indian appeared frequently in the almanac literature of 1783-1815 and was used as a source of humor, political comment, romanticism, etc, much of which contributed to the cultural conflict of the times. (JC)
Browse Title Index - African Journals Online
African Journals Online (AJOL)
), Abstract PDF. BS da Silva, GR Plácido, SR de Resende, BS Carvalho, WSG Júnnyor, MAP de Silva, JC Barros. Vol 11, No 39 (2012), Physicochemical and microbiological characterization of linolenic acid-rich oils ...
Genetics Home Reference: genetic epilepsy with febrile seizures plus
... LA, Hodgson BL, Scott D, Jenkins M, Petrou S, Sutherland GR, Scheffer IE, Berkovic SF, Macdonald RL, Mulley ... RH, Scheffer IE, Parasivam G, Barnett S, Wallace GB, Sutherland GR, Berkovic SF, Mulley JC. Generalized epilepsy with ...
Malaria parasitaemia among febrile under-five children at Nnamdi ...
African Journals Online (AJOL)
Malaria parasitaemia among febrile under-five children at Nnamdi Azikiwe University Teaching Hospital, Nnewi, South-East, Nigeria. C.E. Ezeudu, J.C. Ebenebe, J.O. Chukwuka, E.F. Ugochukwu, G.I. Amilo, O.I. Okorie ...
The Digital Humanities as a Humanities Project
Svensson, Patrik
2012-01-01
This article argues that the digital humanities can be seen as a humanities project in a time of significant change in the academy. The background is a number of scholarly, educational and technical challenges, the multiple epistemic traditions linked to the digital humanities, the potential reach of the field across and outside the humanities,…
A novel HTS magnetometer, exploiting the low jc of bulk YBCO
International Nuclear Information System (INIS)
Gallop, J.C.; Lilleyman, S.; Langham, C.D.; Radcliffe, W.J.; Stewart, M.
1989-01-01
The authors report here a novel of magnetometer which is based on the low critical magnetic field H/sub cl/ of sintered samples of the high temperature ceramic superconductor YBa/sub 2/Cu/sub 3/O/sub y/. By driving a sample of the superconductor around a magnetization hysteresis loop, at a frequency of --100 kHz, and detecting the induced voltage in a coil coupled to the sample, at the second harmonic of the drive frequency, the authors find that this voltage is linearly dependent on the aplied d.c. magnetic field in which the sample is situated. They present a model which explains the operation of this magnetometer. This device, while not as sensitive as a SQUID, has the advantage of a wider dynamic range and direct measurement of flux density, unlike a SQUID which is only capable of sensing flux density changes. When operated at 77K the prototype magnetometer has already demonstrated a sensitivity at least 10 times better than that of a commercial fluxgate magnetometer. The system also appears to provide a simple method for investigation of flux flow in these materials
J.C. van der Merwe & D. van Reenen (2016). Transformation and ...
African Journals Online (AJOL)
one man, to eat food into which one of the students had apparently urinated. ... meaning, the ideological content, of text and talk (and the attitudes and behaviours they .... undertook a critical philosophical analysis of discourses and practices that, either explicitly or implicitly, reproduce resistance towards transformation” (p.
Approximate techniques for predicting size effects on cleavage fracture toughness (Jc)
International Nuclear Information System (INIS)
Kirk, M.T.; Dodds, R.H. Jr.
1993-07-01
This investigation examines the ability of an elastic T-stress analysis coupled with modified boundary layer (MBL) solution to predict stresses ahead of a crack tip in a variety of planar geometries. The approximate stresses are used as input to estimate the effective driving force for cleavage fracture (J 0 ) using the micromechanically based approach introduced by Dodds and Anderson. Finite element analyses for a wide variety of planar cracked geometries are conducted which have elastic biaxiality parameters (β) ranging from -0.99 (very low constraint) to +2.96 (very high constraint). The magnitude and sign of β indicate the rate at which crack-tip constraint changes with increasing applied load. All results pertain to a moderately strain hardening material (strain hardening exponent (η) of 10). These analyses suggest that β is an effective indicator of both the accuracy of T-MBL estimates of J 0 and of applicability limits on evolving fracture analysis methodologies (i.e. T-MBL, J-Q, and J/J 0 ). Specifically, when 1β1>0.4 these analyses show that the T-MBL approximation of J 0 is accurate to within 20% of a detailed finite-element analysis. As ''structural type'' configurations, i.e. shallow cracks in tension, generally have 1β1>0.4, it appears that only an elastic analysis may be needed to determine reasonably accurate J 0 values for structural conditions
Mission Command and JC41: Managing Chaos in a Dynamic World
2018-04-20
doubly so, but perhaps not solely for the reasons expected. History has seen the progression of technology enable commanders and staffs to extend their...highlights the degree to which each Service embraces and codifies the mission command concept. Chapter 3 covers the history of the technologies ...Abstract Executing effective mission command has always been a challenge and in today’s technologically saturated joint operating environment is
Toward a Theory of Organizational Commitment.
1981-08-01
cH 4c C*44 PNN -4- 4.0 1 Co .0 W4 ~- CL * I- .a . 00 S 41 04 c Ai Cu U 0 CLC W . 4c . 48 4c ) 0 8 .) -it co co 1*-- 4 4 AI 41 4 C-4 cV4- 00 -D -4 4 41...0 r jC.. -4 8x 4.’ 4)4~ cu 4 4 ~4. 4) -4~f 4)41 - ca 41 v v0 .-. 0 81-4 1 4) * 0 Aj 4c rW~I P4-5/Al 452:KD:71:en Sequential by Agency 7 8u 4 5 2-883...716 : lah Sequential by State/City/FPO 78u 4 52-883 30 May 1981 LIST 7 HRM Officer in Charge Human Resource Management Detachment Naval Air Station
DEFF Research Database (Denmark)
Engsig, Frederik Neess; Hansen, Ann-Brit Eg; Omland, Lars Haukali
2009-01-01
BACKGROUND: Human immunodeficiency virus (HIV) infection predisposes to progressive multifocal leukoencephalopathy (PML). Here, we describe the incidence, presentation, and prognosis of PML in HIV-1-infected patients during the period before highly active antiretroviral therapy (HAART) (1995...... at presentation and follow-up. RESULTS: Among 4,649 patients, we identified 47 patients with PML. The incidence rates were 3.3, 1.8, and 1.3 cases per 1000 person-years at risk in 1995-1996, 1997-1999, and 2000-2006, respectively. The risk of PML was significantly associated with low CD4(+) cell count, and 47......% of cases were diagnosed by means of brain biopsy or polymerase chain reaction analysis for JC virus. The predominant neurological symptoms at presentation were coordination disturbance, cognitive defects, and limb paresis. Thirty-five patients died; the median survival time was 0.4 years (95% confidence...
International Nuclear Information System (INIS)
Embrey, D.E.
1987-01-01
Concepts and techniques of human reliability have been developed and are used mostly in probabilistic risk assessment. For this, the major application of human reliability assessment has been to identify the human errors which have a significant effect on the overall safety of the system and to quantify the probability of their occurrence. Some of the major issues within human reliability studies are reviewed and it is shown how these are applied to the assessment of human failures in systems. This is done under the following headings; models of human performance used in human reliability assessment, the nature of human error, classification of errors in man-machine systems, practical aspects, human reliability modelling in complex situations, quantification and examination of human reliability, judgement based approaches, holistic techniques and decision analytic approaches. (UK)
Technological and cost comparison of cytochrome P450 2B6 (516G ...
African Journals Online (AJOL)
milcah
2013-05-08
May 8, 2013 ... 1African Institute of Biomedical Science and Technology, P.O. Box 2294, Harare, Zimbabwe. ..... The impact of next-generation sequencing technology ... Ward BA, Gorski JC, Jones DR, Hall SD, Flockhart DA, Desta Z (2003).
ORF Alignment: NC_006677 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_006677 gi|58039331 >1hxhA 1 247 2 262 8e-39 ... pir||JC7939 xylitol dehydrogenase ...(EC 1.1.1.-) - Gluconobacter oxydans (Strain ... ATCC621) dbj|BAC16227.1| xylitol dehydrogenase ...
Letošní AGIT se soustředil na mobilní GIS aplikace
Czech Academy of Sciences Publication Activity Database
René, Miloš
č. 2 (2002), s. 30-31 ISSN 0862-996X. [Angewandte Geographische Informationsverarbeitung. Salzburg, 03.07.2002-05.07.2002] Institutional research plan: CEZ:AV0Z3046908 Keywords : GIS * handy Subject RIV: JC - Computer Hardware ; Software
Directory of Open Access Journals (Sweden)
Lindstrom RL
2015-01-01
Full Text Available Lindstrom RL, Loden JC, Walters TROn page 1736, last line of the first paragraph in the Materials and methods section, “NCT01193127” should be “NCT01579565”.Read the original article
Neurological Complications of AIDS
... JC virus, which travels to the brain, infects multiple sites, and destroys the cells that make myelin – ... the infection. Individuals may experience anxiety disorder, depressive ... vomiting, and personality changes. Not all patients show signs of the ...
"Dear Teacher, Johnny Copied."
Jackson, Louise A.; And Others
1987-01-01
Presents the problem of intentional or unintentional plagiarism on the part of young students, several possible causes for it, and offers ways teachers can help students avoid copying and understand the value of owning one's writing. (JC)
... FF, eds. Ferri's Clinical Advisor 2017 . Philadelphia, PA: Elsevier; 2017:562.e1-563.e1. Hahn D, Hodson ... JG, ed. Emergency Medicine . 2nd ed. Philadelphia, PA: Elsevier Saunders; 2013:chap 22. Jennette JC, Falk RJ, ...
Molecular cloning, characterization and functional analysis of a 3 ...
African Journals Online (AJOL)
STORAGESEVER
2009-08-04
Aug 4, 2009 ... other plant HMGRs and contained 2 transmembrane domains and a catalytic domain. The potential significance ... used as animal feed. Therefore ... Table 1. Primers used in the cloning and analysis of JcHMGR gene. Primers.
International Nuclear Information System (INIS)
Lim, M.S.; Lim, Priscilla L.K.; Gupta, Rashi; Boelsterli, Urs A.
2006-01-01
Diclofenac is a widely used nonsteroidal anti-inflammatory drug that has been associated with rare but serious hepatotoxicity. Experimental evidence indicates that diclofenac targets mitochondria and induces the permeability transition (mPT) which leads to apoptotic cell death in hepatocytes. While the downstream effector mechanisms have been well characterized, the more proximal pathways leading to the mPT are not known. The purpose of this study was to explore the role of free cytosolic calcium (Ca 2+ c ) in diclofenac-induced cell injury in immortalized human hepatocytes. We show that exposure to diclofenac caused time- and concentration-dependent cell injury, which was prevented by the specific mPT inhibitor cyclosporin A (CsA, 5 μM). At 8 h, diclofenac caused increases in [Ca 2+ ] c (Fluo-4 fluorescence), which was unaffected by CsA. Combined exposure to diclofenac/BAPTA (Ca 2+ chelator) inhibited cell injury, indicating that Ca 2+ plays a critical role in precipitating mPT. Diclofenac decreased the mitochondrial membrane potential, ΔΨ m (JC-1 fluorescence), even in the presence of CsA or BAPTA, indicating that mitochondrial depolarization was not a consequence of the mPT or elevated [Ca 2+ ] c . The CYP2C9 inhibitor sulphaphenazole (10 μM) protected from diclofenac-induced cell injury and prevented increases in [Ca 2+ ] c , while it had no effect on the dissipation of the ΔΨ m . Finally, diclofenac exposure greatly increased the mitochondria-selective superoxide levels secondary to the increases in [Ca 2+ ] c . In conclusion, these data demonstrate that diclofenac has direct depolarizing effects on mitochondria which does not lead to cell injury, while CYP2C9-mediated bioactivation causes increases in [Ca 2+ ] c , triggering the mPT and precipitating cell death
Rawat, S.; Chandra, S.; Chavan, V. M.; Sharma, S.; Warrier, M.; Chaturvedi, S.; Patel, R. J.
2014-12-01
Quasi-static (0.0033 s-1) and dynamic (103 s-1) compression experiments were performed on single crystal copper along ⟨100⟩ and ⟨110⟩ directions and best-fit parameters for the Johnson-Cook (JC) material model, which is an important input to hydrodynamic simulations for shock induced fracture, have been obtained. The deformation of single crystal copper along the ⟨110⟩ direction showed high yield strength, more strain hardening, and less strain rate sensitivity as compared to the ⟨100⟩ direction. Although the JC model at the macro-scale is easy to apply and describes a general response of material deformation, it lacks physical mechanisms that describe the influence of texture and initial orientation on the material response. Hence, a crystal plasticity model based on the theory of thermally activated motion of dislocations was used at the meso-scale, in which the evolution equations permit one to study and quantify the influence of initial orientation on the material response. Hardening parameters of the crystal plasticity model show less strain rate sensitivity along the ⟨110⟩ orientation as compared to the ⟨100⟩ orientation, as also shown by the JC model. Since the deformation process is inherently multiscale in nature, the shape changes observed in the experiments due to loading along ⟨100⟩ and ⟨110⟩ directions are also validated by molecular dynamics simulations at the nano-scale.
An aging effect and its origin in GdBCO thin films
Schlesier, K.; Huhtinen, H.; Granroth, S.; Paturi, P.
2010-06-01
An aging effect investigation was made for GdBa2Cu3O7 (GdBCO) thin films grown on SrTiO3 (001) substrates with pulsed laser deposition (PLD) method from nanograined targets. The films were cut into two pieces where one piece was coated with gold cap layer while the other was left without coating. Both pieces were kept in ambient air during the half year measurement period. Magnetization measurements as well as phase purity, lattice parameter, oxygen effect and depth structure determination with x-ray diffraction (XRD) were made in one month interval. For structure and oxygen content, x-ray photoelectron spectroscopy measurements (XPS) were done in the beginning and in the end of the period. A reduction of the critical temperature and the critical current density, Jc, was found in the gold coated GdBCO film in ambient air in course of time. A smaller decrease of Jc was detected in uncoated GdBCO. No development of impurity phase, increase of a-orientation or reduction of the pinning structure was detected in uncoated GdBCO. However, a small development of impurity phase was found in gold coated GdBCO. The diminution of Tc and Jc is concluded to originate from oxygen release. No such a phenomenon was found in YBa2Cu3O7. We conclude that gold is not a proper cap layer at least for some applications.
Santosh, M.; Naik, S. Pavan Kumar; Koblischka, M. R.
2017-07-01
In the upcoming generation, bulk high temperature superconductors (HTS) will play a crucial and a promising role in numerous industrial applications ranging from Maglev trains to magnetic resonance imaging, etc. Especially, the bulk HTS as permanent magnets are suitable due to the fact that they can trap magnetic fields being several orders of magnitude higher than those of the best hard ferromagnets. The bulk HTS LREBa2Cu3O7-δ (LREBCO or LRE-123, LRE: Y, Gd, etc.,) materials could obtain very powerful compact superconducting super-magnets, which can be operated at the cheaper liquid nitrogen temperature or below due to higher critical temperatures (i.e., ∼90 K). As a result, the new advanced technology can be utilized in a more attractive manner for a variety of technological and medical applications which have the capacity to revolutionize the field. An understanding of the magnetic field dependence of the critical current density (J c(H)) is important to develop better adapted materials. To achieve this goal, a variety of Jc (H) behaviours of bulk LREBCO samples were modelled regarding thermally activated flux motion. In essence, the Jc (H) curves follows a certain criterion where an exponential model is applied. However, to fit the complete Jc (H) curve of the LRE-123 samples an unique model is necessary to explain the behavior at low and high fields. The modelling of the various superconducting materials could be understood in terms of the pinning mechanisms.
Evaluation of o-cresol removal using PVA-cryogel-immobilised ...
African Journals Online (AJOL)
2014-02-06
Feb 6, 2014 ... In general, the common techniques for immobilisation of biomass in a polyvinyl ..... PETRUCCIOLI M, DUARTE J and FEDERICI F (2000) High-rate aero- ... WEBER Jr. WJ and MORRIS JC (1963) Kinetics of adsorption on car-.
Psychoanalytic Criticism and Teaching Shakespeare.
Wheeler, Richard P.
1987-01-01
Presents a brief overview of previous psychoanalytically based theories of Shakespeare's plays, particularly "Hamlet," and defends the notion of introducing undergraduates to psychoanalytically based criticism because of the insights it may give students into their own lives. (JC)
Indian Academy of Sciences (India)
2013-01-17
Jan 17, 2013 ... health centres and the university hospital. People having ..... Cutler R, Murtaugh MA and Cary JC 2011 Oral clefts and maternal biomarkers of ... Health and. Nutrition Examination Survey (NHANES III). J. Nutr. 133. 2643–2649.
Effects of AdR-siPTEN on learning capability, memory and ...
African Journals Online (AJOL)
USER
2010-07-12
Jul 12, 2010 ... protein expression of a phosphatase and tensin homolog deleted on chromosome 10 (PTEN), ... disease (AD) and refers to a step-wise deterioration in cognitive ..... Pappas BA, de la Torre JC, Davidson CM (1996).Chronic ...
Various scoring systems for predicting mortality in Intensive Care Unit
African Journals Online (AJOL)
2015-12-07
Dec 7, 2015 ... Mortality rate was higher in patients admitted from wards other than surgery ... evaluate the predictability of various severity of illness scores, and ..... Livingston BM, MacKirdy FN, Howie JC, Jones R, Norrie JD. Assessment of.
Preparation and characterization of Ag-added Bi1⋅84Pb0 ...
Indian Academy of Sciences (India)
Unknown
microscopy (SEM), electrical transport and a.c. susceptibility techniques. The tube ... high current conductor is high Jc. However, non-textured, porous structure with ... contact resistance studies on Ag added (0–25 wt%) Bi-. 2223 bulk tubes ...
Effect of Ca doping on thermally activated flux flow in the ...
Indian Academy of Sciences (India)
Administrator
attracted much attention.10,11 Resistivity measurements under magnetic fields ... The flux line dynamics can be divided into three regimes (i) flux flow, J > Jc; .... energy dissipation occurs when the driving Lorentz force is increased with the ...
Cytotoxic property of surfactant-cobalt(III) complexes on a human breast cancer cell line.
Kumar, Rajendran Senthil; Riyasdeen, Anvarbatcha; Dinesh, Mohanakrishnan; Paul, Christo Preethy; Srinag, Suresh; Krishnamurthy, Hanumanthappa; Arunachalam, Sankaralingam; Akbarsha, Mohammad Abdulkadher
2011-07-01
The cancer chemotherapeutic potential of surfactant-cobalt(III) complexes, cis-[Co(bpy)(2)(C(14)H(29)NH(2))Cl](ClO(4))(2)·3 H(2)O (1) and cis-[Co(phen)(2)(C(14)H(29)NH(2))Cl](ClO(4))(2)·3 H(2)O (2) (bpy = 2,2'-bipyridine, phen = 1,10-phenanthroline) on MCF-7 breast cancer cell was determined adopting MTT assay and specific staining techniques. The complexes affected the viability of the cells significantly and the cells succumbed to apoptosis as seen in the changes in the nuclear morphology and cytoplasmic features. Since the complex 2 appeared to be more potent, further assays were carried out on the complex 2. Single-cell electrophoresis indicated DNA damage. The translocation of phosphatidyl serine and loss of mitochondrial potential was revealed by annexin V-Cy3 staining and JC-1 staining respectively. Western blot analysis revealed up-regulation of pro-apoptotic p53 and down-regulation of anti-apoptotic Bcl-2 protein. Taken together, the surfactant-cobalt(III) complex 2 would be a potential candidate for further investigation for application as a chemotherapeutic for cancers in general and estrogen receptor-positive breast cancer in particular. Copyright © 2011 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.
The Humanities, Human Rights, and the Comparative Imagination
McClennen, Sophia A.
2007-01-01
In her paper "The Humanities, Human Rights, and the Comparative Imagination" Sophia A. McClennen argues that understanding the relationship between culture and human rights depends on humanist perspectives attentive to the relationship between storytelling and identity, mass culture and ideology, text and audience, critical thinking and engaged citizenship. After briefly considering how the divide between the humanities and human rights advocates developed and how it might best be overcome, s...
Luminal epithelial cells within the mammary gland can produce basal cells upon oncogenic stress.
Hein, S M; Haricharan, S; Johnston, A N; Toneff, M J; Reddy, J P; Dong, J; Bu, W; Li, Y
2016-03-17
In the normal mammary gland, the basal epithelium is known to be bipotent and can generate either basal or luminal cells, whereas the luminal epithelium has not been demonstrated to contribute to the basal compartment in an intact and normally developed mammary gland. It is not clear whether cellular heterogeneity within a breast tumor results from transformation of bipotent basal cells or from transformation and subsequent basal conversion of the more differentiated luminal cells. Here we used a retroviral vector to express an oncogene specifically in a small number of the mammary luminal epithelial cells and tested their potential to produce basal cells during tumorigenesis. This in-vivo lineage-tracing work demonstrates that luminal cells are capable of producing basal cells on activation of either polyoma middle T antigen or ErbB2 signaling. These findings reveal the plasticity of the luminal compartment during tumorigenesis and provide an explanation for cellular heterogeneity within a cancer.
The expression of Toll-like receptors 2, 4, 5, 7 and 9 in Merkel cell carcinoma.
Jouhi, Lauri; Koljonen, Virve; Böhling, Tom; Haglund, Caj; Hagström, Jaana
2015-04-01
We sought to clarify whether the expression of toll-like receptors (TLR) in Merkel cell carcinoma (MCC) is linked to tumor and patient characteristics, especially the presence of Merkel cell polyoma virus (MCV). The study comprised of 128 patients with data on Merkel cell polyomavirus (MCV) status and clinical features were included in the study. Immunohistochemistry for TLR expression was performed on tissue microarray (TMA) slides. TLR 2, 4, 5, 7 and 9 expression was noted in most of the tumor specimens. Decreased expression of TLR 9 correlated strongly with MCV positivity. Cytoplasmic TLR 2 expression correlated with small tumor size, while nuclear TLR 2 and TLR 5 expressions with larger tumors. Increased nuclear TLR 4 expression and decreased TLR 7 expression were associated with older age. TLR 2, 4, 5, 7 and 9 appear to reflect certain clinicopathological variables and prognostic markers of MCC tumors. Copyright© 2015 International Institute of Anticancer Research (Dr. John G. Delinassios), All rights reserved.
Akiyoshi, Takeshi; Matzno, Sumio; Sakai, Mika; Okamura, Noboru; Matsuyama, Kenji
2009-12-01
We tried to clarify the cytotoxic mechanism of VK(3) using the breast cancer cell line MCF-7. Cytotoxicity was measured via intracellular esterase activity. DNA fragmentation was assessed by agarose gel electrophoresis. JC-1 staining was applied to measure mitochondrial dysfunction. Caspase activation and reactive oxidative species (ROS) generation were also measured. VK(3) exhibited cytotoxicity that caused DNA fragmentation in MCF-7 cells with an IC(50) of 14.2 microM. JC-1 staining revealed that VK(3) caused mitochondrial dysfunction including a disappearance of mitochondrial membrane potential. Additional investigation showed that the mitochondrial damage was induced by the generation of ROS and the subsequent activation of caspase-7 and -9. Our findings demonstrate that VK(3)-induced apoptosis is selectively initiated by the mitochondria-related pathway and might be useful in breast cancer chemotherapy.
International Nuclear Information System (INIS)
McCabe, D.E.; Sokolov, M.A.; Nanstad, R.K.
1997-01-01
The primary objective of the Heavy-Section Steel Irradiation (HSSI) Program Tenth Irradiation Series was to develop a fracture mechanics evaluation of weld metal WF-70, which was taken from the beltline and nozzle course girth weld joints of the Midland Reactor vessel. This material became available when Consumers Power Company of Midland, Michigan, decided to abort plans to operate their nuclear power plant. WF-70 is classified as a low upper-shelf steel primarily due to the Linde 80 flux that was used in the submerged-arc welding process. The master curve concept is introduced to model the transition range fracture toughness when the toughness is quantified in terms of K Jc values. K Jc is an elastic-plastic stress intensity factor calculated by conversion from J c ; i.e., J-integral at onset of cleavage instability
Irradiation effects in low T$_{c}$ superconductors
Flükiger, René
2009-01-01
The effects of neutron irradiation on the superconducting parameters Tc, Bc2 and Jc of Nb3Sn are reviewed in view of the determination of the radiation limit in the LHC upgrade magnets. The variation of Jc in binary as well as in Ti and Ta alloyed Nb3Sn wires is presented. The coexisting defect mechanisms in irradiated Nb3Sn type compounds are briefly presented and a model is discussed explaining the site exchange mechanism which leads to a decrease of atomic ordering after irradiation. Based on calculations of F. Cerutti and coworkers (CERN), the neutron fluence at the inner winding of the quadrupole Q2a is estimated to values below 1018 neutrons /cm2 for a life time of 10 years, which is within the safety margin with respect to the critical current density and Bc2.
Sanchez-Quintana, Ana; Breña-Atienza, Joaquín; Marrero-Santos, Carmen; Alvarez-Acosta, Luis
2013-08-05
We describe a case of progressive multifocal leucoencephalopathy (PML) in a 39-year-old patient diagnosed with chronic lymphocytic leukaemia (CLL) who underwent two allogenic matched-sibling stem cell transplantations. PML was confirmed just after the first transplantation with cerebral MRI and by PCR in the cerebrospinal fluid. After immunosuppression withdrawal and cidofovir treatment, he achieved a reversal of clinical symptoms, John Cunningham (JC) virus positivity and MRI lesions regression. He remained asymptomatic for 5 years with no signs of infection activity, even though he received three new chemotherapy regimens due to a CLL relapse. However, after the second stem cell transplantation, new neurological symptoms began and a reactivation of the JC virus infection was detected. This time, treatment with mefloquine was started, but he experienced a progressive neurological deterioration and died 1 month after the symptoms began.
Strong Flux Pinning of Nano-Sized Ysz Particles in Ybco Films Prepared by Mod Method
Ye, S.; Suo, H. L.; Liu, M.; Tang, X.; Wu, Z. P.; Zhao, Y.; Zhou, M. L.
The YBCO films with doped YSZ nanoparticles have been prepared successfully by metal organic doepositon method using trifluoroacetates (TFA-MOD) through dissolving Zr organic salt into the YBCO precursor solution. The doped films have well in-plane and out-plane textures detected by both XRD Φ-scan and ω-scan. The YSZ nanoparticles with the size of about 5 ~ 15 nm were observed on the surface of the YBCO films using both FE-SEM and TEM. By comparing the superconducting properties, it was found that the doped YBCO films had lower Tc than that of undoped YBCO films. However, as increasing the applied magnetic field, Jc of the doped YBCO films were much better than that of undoped one. The Jc was as higher as 2.5 times than that of undoped YBCO film at 77 K and 1 T applied field.
Fracture toughness determination of the pressure vessel steel A508 Cl 2 between 100 and 350 degree C
International Nuclear Information System (INIS)
Rao, S.
1980-09-01
The fracture toughness of the pressure vessel steel A508 was determined in the temperature range 100 - 350 degree C. The J-integral method with crack growth resistance curves, the so-called R-curves, was used. The results show that the steel does not have an 'upper-shelf' and the fracture toughness, K sub (JC), decreases with increasing temperature to a minimum around 300 degree C and an increase above it. These results are compared to those obtained previously on an other pressure vessel steel A533B which has essentially the same temperature dependence. The results were also analysed using the Tearing modulus, T. The conclusion iw that the crack growth resistance and the crack initiation resistance (K sub (JC)) show a significant decrease around the operating temperatures as compared to 100 degree C. (author)
Human-centered Computing: Toward a Human Revolution
Jaimes, Alejandro; Gatica-Perez, Daniel; Sebe, Nicu; Huang, Thomas S.
2007-01-01
Human-centered computing studies the design, development, and deployment of mixed-initiative human-computer systems. HCC is emerging from the convergence of multiple disciplines that are concerned both with understanding human beings and with the design of computational artifacts.
International Nuclear Information System (INIS)
Yang, Seong Hwan; Park, Bum; Gang, Yeong Sik; Gal, Won Mo; Baek, Seung Ryeol; Choe, Jeong Hwa; Kim, Dae Sung
2006-07-01
This book mentions human engineering, which deals with introduction of human engineering, Man-Machine system like system design, and analysis and evaluation of Man-Machine system, data processing and data input, display, system control of man, human mistake and reliability, human measurement and design of working place, human working, hand tool and manual material handling, condition of working circumstance, working management, working analysis, motion analysis working measurement, and working improvement and design in human engineering.
Simulating human behavior for national security human interactions.
Energy Technology Data Exchange (ETDEWEB)
Bernard, Michael Lewis; Hart, Dereck H.; Verzi, Stephen J.; Glickman, Matthew R.; Wolfenbarger, Paul R.; Xavier, Patrick Gordon
2007-01-01
This 3-year research and development effort focused on what we believe is a significant technical gap in existing modeling and simulation capabilities: the representation of plausible human cognition and behaviors within a dynamic, simulated environment. Specifically, the intent of the ''Simulating Human Behavior for National Security Human Interactions'' project was to demonstrate initial simulated human modeling capability that realistically represents intra- and inter-group interaction behaviors between simulated humans and human-controlled avatars as they respond to their environment. Significant process was made towards simulating human behaviors through the development of a framework that produces realistic characteristics and movement. The simulated humans were created from models designed to be psychologically plausible by being based on robust psychological research and theory. Progress was also made towards enhancing Sandia National Laboratories existing cognitive models to support culturally plausible behaviors that are important in representing group interactions. These models were implemented in the modular, interoperable, and commercially supported Umbra{reg_sign} simulation framework.
Lifescience Database Archive (English)
Full Text Available ... AUTHORS ... Lehman RA, Stears JC, Wesenberg RL, Nusbaum ED ... TITLE ... Familial osteosclerosis with abnormal...rder NOTCH3 [HSA:4854] [KO:K20995] ... ICD-10: Q87.5 MeSH: C537878 OMIM: 130720 PMID:830893 (description)
On Dramatic Instruction: Towards a Taxonomy of Methods.
Courtney, Richard
1987-01-01
Examines the many possible methods used by instructors who work with dramatic action: in educational drama, drama therapy, social drama, and theater. Discusses an emergent taxonomy whereby instructors choose either spontaneous/formal, overt/covert/, or intrinsic/extrinsic methods. (JC)