Human-inspired feedback synergies for environmental interaction with a dexterous robotic hand

International Nuclear Information System (INIS)

Kent, Benjamin A; Engeberg, Erik D

2014-01-01

Effortless control of the human hand is mediated by the physical and neural couplings inherent in the structure of the hand. This concept was explored for environmental interaction tasks with the human hand, and a novel human-inspired feedback synergy (HFS) controller was developed for a robotic hand which synchronized position and force feedback signals to mimic observed human hand motions. This was achieved by first recording the finger joint motion profiles of human test subjects, where it was observed that the subjects would extend their fingers to maintain a natural hand posture when interacting with different surfaces. The resulting human joint angle data were used as inspiration to develop the HFS controller for the anthropomorphic robotic hand, which incorporated finger abduction and force feedback in the control laws for finger extension. Experimental results showed that by projecting a broader view of the tasks at hand to each specific joint, the HFS controller produced hand motion profiles that closely mimic the observed human responses and allowed the robotic manipulator to interact with the surfaces while maintaining a natural hand posture. Additionally, the HFS controller enabled the robotic hand to autonomously traverse vertical step discontinuities without prior knowledge of the environment, visual feedback, or traditional trajectory planning techniques. (paper)

77 FR 38490 - Safety Zone; Mentor Harbor Yachting Club Fireworks, Lake Erie, Mentor, OH

Science.gov (United States)

2012-06-28

...-AA00 Safety Zone; Mentor Harbor Yachting Club Fireworks, Lake Erie, Mentor, OH AGENCY: Coast Guard, DHS... Erie, Mentor, OH. This safety zone is intended to restrict vessels from a portion of Lake Erie during the Mentor Harbor Yachting Club fireworks display. This temporary safety zone is necessary to protect...

Inspections of Hand Washing Supplies and Hand Sanitizer in Public Schools

Science.gov (United States)

Ramos, Mary M.; Blea, Mary; Trujillo, Rebecca; Greenberg, Cynthia

2010-01-01

Hand washing and hand antisepsis are proven infection control measures in the school setting, yet barriers such as lack of soap, paper towels, and hand sanitizer can hinder compliance. This pilot study measured the prevalence of hand cleaning supplies in public schools. Ten school districts (93 schools) participated in school nurse inspections. In…

78 FR 34575 - Safety Zone; Bay Swim VI, Presque Isle Bay, Erie, PA

Science.gov (United States)

2013-06-10

... June 22, 2013, a large scale swimming event will be held on Presque Isle Bay near the Erie Yacht Club...'48.82'' W and extend in a straight line 1,000 feet wide to the Erie Yacht Club at position 42[deg]07... wide to the Erie Yacht Club at position 42[deg]07'21.74'' N, 80[deg]07'58.30'' W. (NAD 83) (b...

Ohio Lake Erie Commission Homepage

Science.gov (United States)

management of Lake Erie: including, water quality protection, fisheries management, wetlands restoration over 365 projects since 1993. Projects have focused on an array of issues critical to the effective quality of its waters and ecosystem, and to promote economic development of the region by ensuring the

Right-handed fossil humans.

Science.gov (United States)

Lozano, Marina; Estalrrich, Almudena; Bondioli, Luca; Fiore, Ivana; Bermúdez de Castro, José-Maria; Arsuaga, Juan Luis; Carbonell, Eudald; Rosas, Antonio; Frayer, David W

2017-11-01

Fossil hominids often processed material held between their upper and lower teeth. Pulling with one hand and cutting with the other, they occasionally left impact cut marks on the lip (labial) surface of their incisors and canines. From these actions, it possible to determine the dominant hand used. The frequency of these oblique striations in an array of fossil hominins documents the typically modern pattern of 9 right- to 1 left-hander. This ratio among living Homo sapiens differs from that among chimpanzees and bonobos and more distant primate relatives. Together, all studies of living people affirm that dominant right-handedness is a uniquely modern human trait. The same pattern extends deep into our past. Thus far, the majority of inferred right-handed fossils come from Europe, but a single maxilla from a Homo habilis, OH-65, shows a predominance of right oblique scratches, thus extending right-handedness into the early Pleistocene of Africa. Other studies show right-handedness in more recent African, Chinese, and Levantine fossils, but the sample compiled for non-European fossil specimens remains small. Fossil specimens from Sima del los Huesos and a variety of European Neandertal sites are predominately right-handed. We argue the 9:1 handedness ratio in Neandertals and the earlier inhabitants of Europe constitutes evidence for a modern pattern of handedness well before the appearance of modern Homo sapiens. © 2017 Wiley Periodicals, Inc.

A natural human hand model

NARCIS (Netherlands)

Van Nierop, O.A.; Van der Helm, A.; Overbeeke, K.J.; Djajadiningrat, T.J.P.

2007-01-01

We present a skeletal linked model of the human hand that has natural motion. We show how this can be achieved by introducing a new biology-based joint axis that simulates natural joint motion and a set of constraints that reduce an estimated 150 possible motions to twelve. The model is based on

78 FR 59649 - Approval of Subzone Status, Hardinger Transfer Co., Erie and Grove City, Pennsylvania

Science.gov (United States)

2013-09-27

..., Hardinger Transfer Co., Erie and Grove City, Pennsylvania On July 24, 2013, the Executive Secretary of the Foreign-Trade Zones (FTZ) Board docketed an application submitted by the Erie Western Pennsylvania Port..., on behalf of Hardinger Transfer Co., in Erie and Grove City, Pennsylvania. The application was...

Evaluation of different strains of eri silkworms ( Samia cynthia ricini B ...

African Journals Online (AJOL)

Eri silkworms, Samia cynthia ricini B., is one of the silkworm races under utilization in Ethiopia. However, it has several strains with wide variation in their commercial traits and selection and utilization of best suited strains of this eri silkworm race that adapt to different agro-ecologies will help to increase silk productivity and ...

Centre-surround organization of fast sensorimotor integration in human motor hand area

DEFF Research Database (Denmark)

Dubbioso, Raffaele; Raffin, Estelle; Karabanov, Anke

2017-01-01

Using the short-latency afferent inhibition (SAI) paradigm, transcranial magnetic stimulation (TMS) of the primary motor hand area (M1HAND) can probe how sensory input from limbs modulates corticomotor output in humans. Here we applied a novel TMS mapping approach to chart the spatial representat......Using the short-latency afferent inhibition (SAI) paradigm, transcranial magnetic stimulation (TMS) of the primary motor hand area (M1HAND) can probe how sensory input from limbs modulates corticomotor output in humans. Here we applied a novel TMS mapping approach to chart the spatial...... in M1HAND. Like homotopic SAI, heterotopic SAF was somatotopically expressed in M1HAND. Together, the results provide first-time evidence that fast sensorimotor integration involves centre-inhibition and surround-facilitation in human M1HAND....

Durable Tactile Glove for Human or Robot Hand

Science.gov (United States)

Butzer, Melissa; Diftler, Myron A.; Huber, Eric

2010-01-01

A glove containing force sensors has been built as a prototype of tactile sensor arrays to be worn on human hands and anthropomorphic robot hands. The force sensors of this glove are mounted inside, in protective pockets; as a result of this and other design features, the present glove is more durable than earlier models.

Human computer interaction using hand gestures

CERN Document Server

Premaratne, Prashan

2014-01-01

Human computer interaction (HCI) plays a vital role in bridging the 'Digital Divide', bringing people closer to consumer electronics control in the 'lounge'. Keyboards and mouse or remotes do alienate old and new generations alike from control interfaces. Hand Gesture Recognition systems bring hope of connecting people with machines in a natural way. This will lead to consumers being able to use their hands naturally to communicate with any electronic equipment in their 'lounge.' This monograph will include the state of the art hand gesture recognition approaches and how they evolved from their inception. The author would also detail his research in this area for the past 8 years and how the future might turn out to be using HCI. This monograph will serve as a valuable guide for researchers (who would endeavour into) in the world of HCI.

Population models of burrowing mayfly recolonization in Western Lake Erie

Science.gov (United States)

Madenjian, C.P.; Schloesser, D.W.; Krieger, K.A.

1998-01-01

Burrowing mayflies, Hexagenia spp. (H. limbata and H. rigida), began recolonizing western Lake Erie during the 1990s. Survey data for mayfly nymph densities indicated that the population experienced exponential growth between 1991 and 1997. To predict the time to full recovery of the mayfly population, we fitted logistic models, ranging in carrying capacity from 600 to 2000 nymphs/m2, to these survey data. Based on the fitted logistic curves, we forecast that the mayfly population in western Lake Erie would achieve full recovery between years 1998 and 2000, depending on the carrying capacity of the western basin. Additionally, we estimated the mortality rate of nymphs in western Lake Erie during 1994 and then applied an age-based matrix model to the mayfly population. The results of the matrix population modeling corroborated the exponential growth model application in that both methods yielded an estimate of the population growth rate, r, in excess of 0.8 yr-1. This was the first evidence that mayfly populations are capable of recolonizing large aquatic ecosystems at rates comparable with those observed in much smaller lentic ecosystems. Our model predictions should prove valuable to managers of power plant facilities along the western basin in planning for mayfly emergences and to managers of the yellow perch (Perca flavescens) fishery in western Lake Erie.

27 CFR 9.83 - Lake Erie.

Science.gov (United States)

2010-04-01

... on the islands of Lake Erie across the States of New York, Pennsylvania, and Ohio. The beginning... approximately one mile north of Rock Creek, Ohio. (7) The boundary proceeds southwestward, then westward, then... is reached which is due north of the easternmost point of Kelleys Island. (9) The boundary then...

Dosimetry of hands and human factor

International Nuclear Information System (INIS)

Harr, R.

2008-12-01

The human factor in facilities where open radioactive sources are managed it can be controlled through the use of the ring dosimetry, however, that these devices only provide qualitative information that is not extrapolated to legislative limits. lt is present the case analysis of hands dosimetry of female person with responsibility for professional standards and a very high profile with ratings that allow her to have a high level of knowledge of the basic standards, and because with an attitude and a culture rooted of radiation protection, among other qualities. Their records reveal a trend in which monthly doses are below the 7 mSv, and only occasionally are between 7 and 12 mSv per month and hand. The other case correspond to a technician, trained in radiological techniques, also with a high profile, with two courses for occupationally exposed personnel more than 10 annual retraining, and work experience of over 10 years as occupationally exposed personnel, in which knowledge of standards and because of the entrenched culture of radiation protection and their interest degree in the care of their exposure is still in a phase half, in this case also shows a trend in the monthly dose where found registers between 7 and 11 mSv per month and hand. The third case is of a second technician with less experience and most basic knowledge, his dose register not show a real trend, sometimes be found reads of irregular values as if the dosimeter is not used and some other times as if misused by exposing to purpose (was observed at least one reading above the monthly 30 mSv). By way of conclusion, it is noted that the hands dosimetry is a useful tool to monitor transactions through the data compilation susceptible to analysis with variations which can be placed in the context of the human factor. (Author)

Historical Sediment Budget (1860s to Present) for the United States Shoreline of Lake Erie

Science.gov (United States)

2016-08-01

Soil Classification polygons with 1 km reaches. Each polygon has a 2- to 4-digit classification code indicating the dominant soil type...1988). Photograph shows high quantity of shale plates in soil column (USACE 2004). ................ 125 Figure A-1. New York shore stratigraphy... USLS 1935, NGVD29, USLS 1903, Mean Level of Lake Erie (1860–1875) (Toledo-Conneaut), Mean Lake Level of Lake Erie (1860–1875) (Erie-Buffalo), and Mean

Water resources of the Lake Erie shore region in Pennsylvania

Science.gov (United States)

Mangan, John William; Van Tuyl, Donald W.; White, Walter F.

1952-01-01

An abundant supply of water is available to the Lake Erie Shore region in Pennsylvania. Lake i£rie furnishes an almost inexhaustible supply of water of satisfactory chemical quality. Small quantities of water are available from small streams in the area and from the ground. A satisfactory water supply is one of the factors that affect the economic growth of a region. Cities and towns must have adequate amounts of pure water for human consumption. Industries must have suitable water ih sufficient quantities for all purposes. In order to assure. success and economy, the development of water resources should be based on adequate knowledge of the quantity and quality of the water. As a nation, we can not afford to run the risk of dissipating our resources, especially in times of national emergency, by building projects that are not founded on sound engineering and adequate water-resources information. The purpose of this report is to summarize and interpret all available water-resources information for the Lake Erie Shore region in Pennsylvania. The report will be useful for initial guidance in the location or expansion of water facilities for defense and nondefense industries and the municipalities upon which they are dependent. It will also be useful in evaluating the adequacy of the Geological Survey's part of the basic research necessary to plan the orderly development of the water resources of the Lake Erie Shore region. Most of the data contained inthis report have been obtained'by the U. S. Geological Survey in cooperation with the Pennsylvania Department of Forests and Waters, the Pennsylvania Department of Internal Affairs, and the Pennsylvania State Planning Board, Department of Commerce. The Pennsylv~nia Department of Health furnished information on water pollution. The report was prepared in the Water Resources Division of the U. S. Geological Survey b:y John W. Mangan (Surface Water). Donald W. VanTuyl (Ground Water). and Walter F. White, Jr. (Quality of

GC-MS analysis of polybrominated diphenyl ethers in Lake Erie

Science.gov (United States)

Vagula, Mary C.; Vartak, Marissa; Tallmadge, Weslene

2012-06-01

Lake Erie is one of the five great lakes of North America. It is the shallowest, the warmest, and the most biologically productive of the Great Lakes producing more fish than all of the other four lakes combined. It is also a source of drinking water for 11 million people and a recreational asset. On the flipside, it is also very vulnerable and troubled with environmental challenges because it has the smallest water volume, but the greatest pressures from the human settlement. One of the many issues faced by the Lake is pollution. It receives larger loads of many pollutants than any other Great Lake. Even with the best pollution controls many pesticides and organohalogens continue to enter the lake. Polybrominated diphenyl ethers (PBDEs) are a class of flame-retardants that have been used in a variety of consumer products since the 1970s. They are added to many commercial and household products such as computers, foam mattresses, carpets, etc. Being largely non-polar and chemically stable, these chemicals are extremely lipophilic and resist degradation in the environment, thus giving them a high affinity for their bioaccumulation. Due to these properties PBDEs have become ubiquitous environmental contaminants. These compounds are reported to be endocrine disruptors and could cause oxidative damage. This report presents the sample preparation protocol, the GC-MS analysis of PBDEs in Lake Erie sediment samples.

Color-Removal by Microorganisms Isolated from Human Hands

Directory of Open Access Journals (Sweden)

Tsukasa Ito

2013-08-01

Full Text Available Microorganisms are essential for human life. Microorganisms decompose the carbon compounds in dead animals and plants and convert them into carbon dioxide. Intestinal bacteria assist in food digestion. Some vitamins are produced by bacteria that live in the intestines. Sewage and industrial wastewater are treated by activated sludge composed of microbial communities. All of these are due to the ability of microbes to produce many enzymes that can degrade chemicals. How do teachers make students understand that microorganisms are always associated with humans, and that microorganisms have the ability to degrade chemicals? The presence of microorganisms on humans can be shown by incubating agar plates after they are touched by the hands of students. The ability of microorganisms to degrade chemicals can be shown by an analytical measurement of the degradation of chemicals. When the chemicals are dyes (colorants in water, microbial activity on degradation of dyes can be demonstrated by observing a decreasing degree of color as a result of the enzymatic activity (e.g., azoreductase. Dyes are widely used in the textile, food, and cosmetic industries. They are generally resistant to conventional biological wastewater treatment systems such as the activated sludge process (4. The discharge of wastewater containing dye pollutes surface water. The ability of microorganisms to decolorize and degrade dyes has been widely investigated to use for bioremediation purposes (5. The goal of this tip is to understand the presence of bacteria on human skin and the ability of bacteria to degrade colorant chemicals (decolorization. In this tip, students first cultivate and isolate bacteria on their hands, and then examine potential decolorization activity of each bacterium by observing the degree of color of the liquid in tubes in which bacteria isolated from students’ hands were inoculated. Decolorization activity of bacterial isolates from human skin has been

Targets set to reduce Lake Erie algae

Science.gov (United States)

Evans, Mary

2016-01-01

In February 2016, the Great Lakes Executive Committee, which oversees the implementation of the Great Lakes Water Quality Agreement (GLWQA) between the U.S. and Canada, approved phosphorus loading targets for Lake Erie to reduce the size of harmful algal blooms (HABs), reduce the presence of the low oxygen zone in the central basin, and protect nearshore water quality. The targets are set with respect to the nutrient loads calculated for 2008. To reduce the impacts of HABs on Lake Erie a target was set of a 40 percent reduction in total and soluble reactive phosphorus loads in the spring from two Canadian rivers and several Michigan and Ohio rivers, especially the Maumee River (https://binational.net/2016/02/22/ finalptargets-ciblesfinalesdep/). States and the province of Ontario are already developing Domestic Action Plans to accomplish the reductions and scientists are developing research and monitoring plans to assess progress.

Simulation of irradiation X in human hand

International Nuclear Information System (INIS)

Amaya Falcon, F.

2001-01-01

Use of the Monte Carlo code MCNP to simulate a human hand irradiation with radiation X of radio diagnosis energy, in order to find the best range of energy to obtain a radiography with the smallest dose and the biggest contrast [es

Meetings and Events about Western Lake Erie Basin

Science.gov (United States)

Western Lake Erie Basin, near Toledo (Ohio), Louisiana of the Urban Waters Federal Partnership (UWFP) reconnects urban communities with their waterways by improving coordination among federal agencies and collaborating with community-led efforts

Real-Time Hand Position Sensing Technology Based on Human Body Electrostatics

Directory of Open Access Journals (Sweden)

Kai Tang

2018-05-01

Full Text Available Non-contact human-computer interactions (HCI based on hand gestures have been widely investigated. Here, we present a novel method to locate the real-time position of the hand using the electrostatics of the human body. This method has many advantages, including a delay of less than one millisecond, low cost, and does not require a camera or wearable devices. A formula is first created to sense array signals with five spherical electrodes. Next, a solving algorithm for the real-time measured hand position is introduced and solving equations for three-dimensional coordinates of hand position are obtained. A non-contact real-time hand position sensing system was established to perform verification experiments, and the principle error of the algorithm and the systematic noise were also analyzed. The results show that this novel technology can determine the dynamic parameters of hand movements with good robustness to meet the requirements of complicated HCI.

42 CFR 93.204 - Contract.

Science.gov (United States)

2010-10-01

... 42 Public Health 1 2010-10-01 2010-10-01 false Contract. 93.204 Section 93.204 Public Health PUBLIC HEALTH SERVICE, DEPARTMENT OF HEALTH AND HUMAN SERVICES HEALTH ASSESSMENTS AND HEALTH EFFECTS... MISCONDUCT Definitions § 93.204 Contract. Contract means an acquisition instrument awarded under the HHS...

33 CFR 162.132 - Connecting waters from Lake Huron to Lake Erie; communications rules.

Science.gov (United States)

2010-07-01

... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Connecting waters from Lake Huron to Lake Erie; communications rules. 162.132 Section 162.132 Navigation and Navigable Waters COAST... NAVIGATION REGULATIONS § 162.132 Connecting waters from Lake Huron to Lake Erie; communications rules. (a...

33 CFR 162.140 - Connecting waters from Lake Huron to Lake Erie; miscellaneous rules.

Science.gov (United States)

2010-07-01

... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Connecting waters from Lake Huron to Lake Erie; miscellaneous rules. 162.140 Section 162.140 Navigation and Navigable Waters COAST... NAVIGATION REGULATIONS § 162.140 Connecting waters from Lake Huron to Lake Erie; miscellaneous rules. (a...

FERC approves process for Lake Erie link: Project meets significant regulatory milestone

International Nuclear Information System (INIS)

Anon

2002-01-01

The Federal Electric Regulatory Commission (FERC) of the United States has issued an order to TransEnergie US Ltd., and Hydro One Inc., authorizing the sale of transmission rights for the proposed Lake Erie link. This project will consists of bi-directional high voltage direct current facilities connecting the transmission grids of Ontario, Canada and the United States. The sale is authorized to proceed via a non-discriminatory 'open season' process. The project will consist of buried underwater cables under Lake Erie connecting the transmission systems near Simcoe, Ontario with those in the US at either, or both, of Springfield, Pennsylvania, and Ashtabula, Ohio. The project will provide an increase in transmission capability of up to 975 MW between the electric control areas of the Ontario Independent Electricity Market Operator, the East Central Area Reliability Coordination Agreement in Ohio and the Pennsylvania-New Jersey-Maryland Interconnection. The Lake Erie Link will be financially supported by those consumers who see value in the associated transmission rights, rather than through the regulated rates paid by transmission customers in general. The article provides an overview of the background of the Lake Erie Link, the cable system, the converter station, and the potential economic benefits

Occurrence of zebra mussels in near-shore areas of western Lake Erie

Science.gov (United States)

Custer, Christine M.; Custer, T.W.

1997-01-01

Zebra mussels (Dreissena polymorpha) invaded the Great Lakes in the mid-1980s and quickly reached high densities. The objective of this study was to determine current consumption of zebra mussels by waterfowl in the Great Lakes region. Feeding Lesser Scaups (Aythya affinis), Greater Scaups (A. marila), Canvasbacks (A. valisineria), Redheads (A. americana), Buffleheads (Bucephala albeola) and Common Goldeneyes (B. clangula) were collected in western Lake Erie and in Lake St. Clair between fall and spring, 1992-1993 to determine food habits. All 10 Redheads, 97% of Lesser Scaups, 83% of Goldeneyes, 60% of Buffleheads and 9% of Canvasbacks contained one or more zebra mussels in their upper gastrointestinal tracts. The aggregate percent of zebra mussels in the diet of Lesser Scaups was higher in Lake Erie (98.6%) than in Lake St. Clair (54.4%). Zebra mussels, (aggregate percent) dominated the diet of Common Goldeneyes (79.2%) but not in Buffleheads (23.5%), Redheads (21%) or Canvasbacks (9%). Lesser Scaups from Lake Erie fed on larger zebra mussels ( = 10.7 i?? 0.66 mm SE) than did Lesser Scaups from Lake St. Clair ( = 4.4 i?? 0.22 mm). Lesser Scaups, Buffleheads and Common Goldeneyes from Lake Erie consumed zebra mussels of similar size.

Measuring empathy for human and robot hand pain using electroencephalography.

Science.gov (United States)

Suzuki, Yutaka; Galli, Lisa; Ikeda, Ayaka; Itakura, Shoji; Kitazaki, Michiteru

2015-11-03

This study provides the first physiological evidence of humans' ability to empathize with robot pain and highlights the difference in empathy for humans and robots. We performed electroencephalography in 15 healthy adults who observed either human- or robot-hand pictures in painful or non-painful situations such as a finger cut by a knife. We found that the descending phase of the P3 component was larger for the painful stimuli than the non-painful stimuli, regardless of whether the hand belonged to a human or robot. In contrast, the ascending phase of the P3 component at the frontal-central electrodes was increased by painful human stimuli but not painful robot stimuli, though the interaction of ANOVA was not significant, but marginal. These results suggest that we empathize with humanoid robots in late top-down processing similarly to human others. However, the beginning of the top-down process of empathy is weaker for robots than for humans.

Bathymetry of Lake Erie and Lake Saint Clair

Data.gov (United States)

National Oceanic and Atmospheric Administration, Department of Commerce — Bathymetry of Lake Erie and Lake Saint Clair has been compiled as a component of a NOAA project to rescue Great Lakes lake floor geological and geophysical data and...

33 CFR 162.130 - Connecting waters from Lake Huron to Lake Erie; general rules.

Science.gov (United States)

2010-07-01

... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Connecting waters from Lake Huron to Lake Erie; general rules. 162.130 Section 162.130 Navigation and Navigable Waters COAST GUARD... REGULATIONS § 162.130 Connecting waters from Lake Huron to Lake Erie; general rules. (a) Purpose. The...

A preliminary study of the Hg flux from selected Ohio watersheds to Lake Erie

International Nuclear Information System (INIS)

Fitzgibbon, T.O.; Berry Lyons, W.; Gardner, Christopher B.; Carey, Anne E.

2008-01-01

New measurements of riverine dissolved and particulate Hg fluxes into Lake Erie from 12 northern Ohio watersheds have been determined from samples collected in April 2002 and analyzed using ultra-clean techniques with cold-vapor atomic fluorescence spectrometry. Total Hg concentrations ranged through 2.5-18.5 ng L -1 , with a mean of 10.4 ng L -1 with most Hg in particulate form. Dissolved Hg concentrations ranged through 0.8-4.3 ng L -1 , with a mean of 2.5 ng L -1 . Highest total Hg concentrations were observed in western rivers with primarily agricultural land use and eastern rivers with mixed land use in their watersheds. Total suspended solid concentrations ranged through 10-180 mg L -1 with particulate Hg concentrations ranging through 47-170 ng g -1 , with a mean of 99 ng g -1 . Particulate Hg was similar to published data for central Lake Erie bottom sediments but much lower than for bottom sediments in western Lake Erie. Total Hg concentrations were positively correlated with suspended sediment concentrations and negatively with dissolved NO 3 - concentrations. The total estimated annual Hg fluxes from these rivers into Lake Erie is estimated to be 85 kg, but because only one event was sampled during high flow conditions, this may be an overestimate. This is much lower than previous published estimates of riverine Hg input into Lake Erie

33 CFR 162.134 - Connecting waters from Lake Huron to Lake Erie; traffic rules.

Science.gov (United States)

2010-07-01

... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Connecting waters from Lake Huron to Lake Erie; traffic rules. 162.134 Section 162.134 Navigation and Navigable Waters COAST GUARD... REGULATIONS § 162.134 Connecting waters from Lake Huron to Lake Erie; traffic rules. (a) Detroit River. The...

33 CFR 162.138 - Connecting waters from Lake Huron to Lake Erie; speed rules.

Science.gov (United States)

2010-07-01

... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Connecting waters from Lake Huron to Lake Erie; speed rules. 162.138 Section 162.138 Navigation and Navigable Waters COAST GUARD... REGULATIONS § 162.138 Connecting waters from Lake Huron to Lake Erie; speed rules. (a) Maximum speed limit for...

33 CFR 162.136 - Connecting waters from Lake Huron to Lake Erie; anchorage grounds.

Science.gov (United States)

2010-07-01

... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Connecting waters from Lake Huron to Lake Erie; anchorage grounds. 162.136 Section 162.136 Navigation and Navigable Waters COAST GUARD... REGULATIONS § 162.136 Connecting waters from Lake Huron to Lake Erie; anchorage grounds. (a) In the Detroit...

Eri silkworm: a source of edible oil with a high content of α-linolenic acid and of significant nutritional value.

Science.gov (United States)

Longvah, Thingnganing; Manghtya, Korra; Qadri, Syed S Y H

2012-07-01

The study was undertaken to provide value addition to spent eri silkworm as an alternative source of edible oil for the food and feed industry by carrying out a short-term nutritional and toxicological evaluation of eri silkworm pupae oil using Wistar NIN rats. Growth performance of rats fed either sunflower oil (Control) or eri silkworm pupae oil (Experimental) was comparable. Histopathological examination of the various tissues showed no signs of toxicity even after feeding the eri silkworm oil for 18 weeks. Serum cholesterol and triglyceride was significantly reduced (P oil. The study showed that eri silkworm pupae oil is safe and nutritionally equivalent to commonly used vegetable oils. Eri silkworm pupae can be harvested to provide a cost effective alternative edible oil that can be used to nutritional advantage in the food and feed industry. Therefore eri silkworm and its host plants offer an excellent example of multiple product crops and of sustainable agricultural practice with excellent opportunity for economic and nutritional benefits. Copyright © 2012 Society of Chemical Industry.

Quantity of ethanol absorption after excessive hand disinfection using three commercially available hand rubs is minimal and below toxic levels for humans

Directory of Open Access Journals (Sweden)

Toma Cyril D

2007-10-01

Full Text Available Abstract Background Despite the increasing promotion of alcohol-based hand rubs and the worldwide use of ethanol-based hand rubs in hospitals only few studies have specifically addressed the issue of ethanol absorption when repeatedly applied to human skin. The aim of this study was to assess if ethanol absorption occurs during hygienic and surgical hand disinfection using three different alcohol-based hand-rubs, and to quantify absorption levels in humans. Methods Twelve volunteers applied three hand-rubs containing 95% (hand-rub A, 85% (hand-rub B and 55% ethanol (hand-rub C; all w/w. For hygienic hand disinfection, 4 mL were applied 20 times for 30 s, with 1 minute break between applications. For surgical hand disinfection, 20 mL of each hand rub was applied to hands and arms up to the level of the elbow 10 times for 3 minutes, with a break of 5 minutes between applications. Blood concentrations of ethanol and acetaldehyde were determined immediately prior and up to 90 minutes after application using head space gas chromatography. Results The median of absorbed ethanol after hygienic hand disinfection was 1365 mg (A, 630 mg (B, and 358 mg (C. The proportion of absorbed ethanol was 2.3% (A, 1.1% (B, and 0.9% (C. After surgical hand disinfection, the median of absorbed ethanol was 1067 mg (A, 1542 mg (B, and 477 mg (C. The proportion of absorbed ethanol was 0.7% (A, 1.1% (B, and 0.5% (C. The highest median acetaldehyde concentration after 20 hygienic hand disinfections was 0.57 mg/L (hand-rub C, after 30 min, after 10 surgical hand disinfections 3.99 mg/L (hand-rub A, after 20 minutes. Conclusion The overall dermal and pulmonary absorption of ethanol was below toxic levels in humans and allows the conclusion that the use of the evaluated ethanol-based hand-rubs is safe.

76 FR 50680 - Endangered and Threatened Wildlife and Plants; Removal of the Lake Erie Watersnake (Nerodia...

Science.gov (United States)

2011-08-16

... as a home range. In the winter, Lake Erie watersnakes hibernate below the frost level, in cracks or... undertaken on each island property to avoid injury and harm to the Lake Erie watersnake during typical land...

EthoHand: A dexterous robotic hand with ball-joint thumb enables complex in-hand object manipulation

OpenAIRE

Konnaris, C; Gavriel, C; Thomik, AAC; Aldo Faisal, A

2016-01-01

Our dexterous hand is a fundmanetal human feature that distinguishes us from other animals by enabling us to go beyond grasping to support sophisticated in-hand object manipulation. Our aim was the design of a dexterous anthropomorphic robotic hand that matches the human hand's 24 degrees of freedom, under-actuated by seven motors. With the ability to replicate human hand movements in a naturalistic manner including in-hand object manipulation. Therefore, we focused on the development of a no...

The Human Octopus: controlling supernumerary hands with the help of virtual reality

OpenAIRE

Aru, Jaan; Vasser, Madis; Zafra, Raul; Kulu, Sander

2016-01-01

We investigated the "human octopus" phenomenon where subjects controlled virtual supernumerary hands through hand tracking technology and virtual reality. Four experiments were developed to study how subjects (n=10) operate with different number and behaviour of supernumerary hands. The behaviours involved inserting movement delays to the virtual hands and adjusting their movement scale or position. It was found that having more hands to operate with does not necessarily mean higher success r...

Assessing Vulnerability of Lake Erie Landscapes to Soil Erosion: Modelled and Measured Approaches

Science.gov (United States)

Joosse, P.; Laamrani, A.; Feisthauer, N.; Li, S.

2017-12-01

Loss of soil from agricultural landscapes to Lake Erie via water erosion is a key transport mechanism for phosphorus bound to soil particles. Agriculture is the dominant land use in the Canadian side of the Lake Erie basin with approximately 75% of the 2.3 million hectares under crop or livestock production. The variable geography and diversity of agricultural production systems and management practices makes estimating risk of soil erosion from agricultural landscapes in the Canadian Lake Erie basin challenging. Risk of soil erosion depends on a combination of factors including the extent to which soil remains bare, which differs with crop type and management. Two different approaches of estimating the vulnerability of landscapes to soil erosion will be compared among Soil Landscapes of Canada in the Lake Erie basin: a modelling approach incorporating farm census and soil survey data, represented by the 2011 Agriculture and Agri-Food Canada Agri-Environmental Indicator for Soil Erosion Risk; and, a measured approach using remotely sensed data that quantifies the magnitude of bare and covered soil across the basin. Results from both approaches will be compared by scaling the national level (1:1 million) Soil Erosion Risk Indicator and the remotely sensed data (30x30 m resolution) to the quaternary watershed level.

76 FR 55564 - Safety Zone; Revolution 3 Triathlon, Sandusky Bay, Lake Erie, Cedar Point, OH

Science.gov (United States)

2011-09-08

...-AA00 Safety Zone; Revolution 3 Triathlon, Sandusky Bay, Lake Erie, Cedar Point, OH AGENCY: Coast Guard... Erie during the Revolution 3 Triathlon. This temporary safety zone is necessary to protect participants..., between 9 a.m. and 5 p.m., Monday through Friday, except Federal holidays. FOR FURTHER INFORMATION CONTACT...

75 FR 55477 - Safety Zone; Revolution 3 Triathlon, Lake Erie & Sandusky Bay, Cedar Point, OH

Science.gov (United States)

2010-09-13

...-AA00 Safety Zone; Revolution 3 Triathlon, Lake Erie & Sandusky Bay, Cedar Point, OH AGENCY: Coast Guard... portions of the Lake Erie during the Revolution 3 Cedar Point Triathlon. The temporary safety zone is... 5 p.m., Monday through Friday, except Federal holidays. FOR FURTHER INFORMATION CONTACT: If you have...

Genome sequences of lower Great Lakes Microcystis sp. reveal strain-specific genes that are present and expressed in western Lake Erie blooms.

Directory of Open Access Journals (Sweden)

Kevin Anthony Meyer

Full Text Available Blooms of the potentially toxic cyanobacterium Microcystis are increasing worldwide. In the Laurentian Great Lakes they pose major socioeconomic, ecological, and human health threats, particularly in western Lake Erie. However, the interpretation of "omics" data is constrained by the highly variable genome of Microcystis and the small number of reference genome sequences from strains isolated from the Great Lakes. To address this, we sequenced two Microcystis isolates from Lake Erie (Microcystis aeruginosa LE3 and M. wesenbergii LE013-01 and one from upstream Lake St. Clair (M. cf aeruginosa LSC13-02, and compared these data to the genomes of seventeen Microcystis spp. from across the globe as well as one metagenome and seven metatranscriptomes from a 2014 Lake Erie Microcystis bloom. For the publically available strains analyzed, the core genome is ~1900 genes, representing ~11% of total genes in the pan-genome and ~45% of each strain's genome. The flexible genome content was related to Microcystis subclades defined by phylogenetic analysis of both housekeeping genes and total core genes. To our knowledge this is the first evidence that the flexible genome is linked to the core genome of the Microcystis species complex. The majority of strain-specific genes were present and expressed in bloom communities in Lake Erie. Roughly 8% of these genes from the lower Great Lakes are involved in genome plasticity (rapid gain, loss, or rearrangement of genes and resistance to foreign genetic elements (such as CRISPR-Cas systems. Intriguingly, strain-specific genes from Microcystis cultured from around the world were also present and expressed in the Lake Erie blooms, suggesting that the Microcystis pangenome is truly global. The presence and expression of flexible genes, including strain-specific genes, suggests that strain-level genomic diversity may be important in maintaining Microcystis abundance during bloom events.

Lessons Learned from Stakeholder-Driven Modeling in the Western Lake Erie Basin

Science.gov (United States)

Muenich, R. L.; Read, J.; Vaccaro, L.; Kalcic, M. M.; Scavia, D.

2017-12-01

Lake Erie's history includes a great environmental success story. Recognizing the impact of high phosphorus loads from point sources, the United States and Canada 1972 Great Lakes Water Quality Agreement set load reduction targets to reduce algae blooms and hypoxia. The Lake responded quickly to those reductions and it was declared a success. However, since the mid-1990s, Lake Erie's algal blooms and hypoxia have returned, and this time with a dominant algae species that produces toxins. Return of the algal blooms and hypoxia is again driven by phosphorus loads, but this time a major source is the agriculturally-dominated Maumee River watershed that covers NW Ohio, NE Indiana, and SE Michigan, and the hypoxic extent has been shown to be driven by Maumee River loads plus those from the bi-national and multiple land-use St. Clair - Detroit River system. Stakeholders in the Lake Erie watershed have a long history of engagement with environmental policy, including modeling and monitoring efforts. This talk will focus on the application of interdisciplinary, stakeholder-driven modeling efforts aimed at understanding the primary phosphorus sources and potential pathways to reduce these sources and the resulting algal blooms and hypoxia in Lake Erie. We will discuss the challenges, such as engaging users with different goals, benefits to modeling, such as improvements in modeling data, and new research questions emerging from these modeling efforts that are driven by end-user needs.

76 FR 66710 - Erie Boulevard Hydropower, L.P.; Notice of Application Accepted for Filing, Soliciting Comments...

Science.gov (United States)

2011-10-27

... DEPARTMENT OF ENERGY Federal Energy Regulatory Commission [Project No. 5984-063] Erie Boulevard Hydropower, L.P.; Notice of Application Accepted for Filing, Soliciting Comments, Motions To Intervene, and....: 5984-063. c. Date Filed: May 10, 2011. d. Applicant: Erie Boulevard Hydropower, L.P. (dba Brookfield...

Horizontal drilling under Lake Erie

Energy Technology Data Exchange (ETDEWEB)

Meller, R.

2001-07-01

Drilling oil wells under Lake Erie calls for horizontal drilling wells to be drilled from shore out into the pay-zone under the lake. The nature and characteristics of horizontal wells as compared to vertical wells are explored. Considerations that have to be taken into account in drilling horizontal wells are explained (the degree of curvature, drilling fluid quality, geosteering in the pay-zone, steering instrumentation, measurements while drilling (MWD), logging while drilling (LWD)). The concept and reasons for extended reach wells are outlined, along with characteristic features of multilateral wells.

Lucifer's Planet: Photolytic Hazes in the Atmosphere of 51 Eri b

Science.gov (United States)

Zahnle, Kevin

2016-01-01

We use a 1D model to address photochemistry and possible haze formation in the irradiated atmosphere of 51 Eri b (2016arXiv160407388Z). The intended focus was to have been on carbon and organic hazes, but sulfur photochemistry turns out to be interesting and possibly more important. The case for organic photochemical hazes is intriguing but falls short of being compelling. If organic hazes form abundantly, they are likeliest to do so if vertical mixing in 51 Eri b is weaker than in Jupiter, and they would be found below the altitudes where methane and water are photolyzed. The more novel result is that photochemistry turns H2S into elemental sulfur, here treated as S8. In the cooler models, S8 is predicted to condense in optically significant clouds of solid sulfur particles, whilst in the warmer models S8 remains a vapor along with several other sulfur allotropes that are both visually striking and potentially observable. For 51 Eri b, the division between models with and without condensed sulfur is at an effective temperature of 700 K, which is within error its actual effective temperature; the local temperature where sulfur condenses is between 280 and 320 K. The sulfur photochemistry we discuss is quite general and ought to be found in a wide variety of worlds over a broad temperature range, both colder and hotter than the 650-750 K range studied here, and we show that products of sulfur photochemistry will be nearly as abundant on planets where the UV irradiation is orders of magnitude weaker than it is on 51 Eri b.

42 CFR 93.108 - Confidentiality.

Science.gov (United States)

2010-10-01

... 42 Public Health 1 2010-10-01 2010-10-01 false Confidentiality. 93.108 Section 93.108 Public Health PUBLIC HEALTH SERVICE, DEPARTMENT OF HEALTH AND HUMAN SERVICES HEALTH ASSESSMENTS AND HEALTH EFFECTS STUDIES OF HAZARDOUS SUBSTANCES RELEASES AND FACILITIES PUBLIC HEALTH SERVICE POLICIES ON RESEARCH...

42 CFR 93.208 - Evidence.

Science.gov (United States)

2010-10-01

... 42 Public Health 1 2010-10-01 2010-10-01 false Evidence. 93.208 Section 93.208 Public Health PUBLIC HEALTH SERVICE, DEPARTMENT OF HEALTH AND HUMAN SERVICES HEALTH ASSESSMENTS AND HEALTH EFFECTS STUDIES OF HAZARDOUS SUBSTANCES RELEASES AND FACILITIES PUBLIC HEALTH SERVICE POLICIES ON RESEARCH...

42 CFR 93.226 - Retaliation.

Science.gov (United States)

2010-10-01

... 42 Public Health 1 2010-10-01 2010-10-01 false Retaliation. 93.226 Section 93.226 Public Health PUBLIC HEALTH SERVICE, DEPARTMENT OF HEALTH AND HUMAN SERVICES HEALTH ASSESSMENTS AND HEALTH EFFECTS STUDIES OF HAZARDOUS SUBSTANCES RELEASES AND FACILITIES PUBLIC HEALTH SERVICE POLICIES ON RESEARCH...

42 CFR 93.211 - Hearing.

Science.gov (United States)

2010-10-01

... 42 Public Health 1 2010-10-01 2010-10-01 false Hearing. 93.211 Section 93.211 Public Health PUBLIC HEALTH SERVICE, DEPARTMENT OF HEALTH AND HUMAN SERVICES HEALTH ASSESSMENTS AND HEALTH EFFECTS STUDIES OF HAZARDOUS SUBSTANCES RELEASES AND FACILITIES PUBLIC HEALTH SERVICE POLICIES ON RESEARCH MISCONDUCT...

42 CFR 93.225 - Respondent.

Science.gov (United States)

2010-10-01

... 42 Public Health 1 2010-10-01 2010-10-01 false Respondent. 93.225 Section 93.225 Public Health PUBLIC HEALTH SERVICE, DEPARTMENT OF HEALTH AND HUMAN SERVICES HEALTH ASSESSMENTS AND HEALTH EFFECTS STUDIES OF HAZARDOUS SUBSTANCES RELEASES AND FACILITIES PUBLIC HEALTH SERVICE POLICIES ON RESEARCH...

42 CFR 93.213 - Institution.

Science.gov (United States)

2010-10-01

... 42 Public Health 1 2010-10-01 2010-10-01 false Institution. 93.213 Section 93.213 Public Health PUBLIC HEALTH SERVICE, DEPARTMENT OF HEALTH AND HUMAN SERVICES HEALTH ASSESSMENTS AND HEALTH EFFECTS STUDIES OF HAZARDOUS SUBSTANCES RELEASES AND FACILITIES PUBLIC HEALTH SERVICE POLICIES ON RESEARCH...

42 CFR 93.212 - Inquiry.

Science.gov (United States)

2010-10-01

... 42 Public Health 1 2010-10-01 2010-10-01 false Inquiry. 93.212 Section 93.212 Public Health PUBLIC HEALTH SERVICE, DEPARTMENT OF HEALTH AND HUMAN SERVICES HEALTH ASSESSMENTS AND HEALTH EFFECTS STUDIES OF HAZARDOUS SUBSTANCES RELEASES AND FACILITIES PUBLIC HEALTH SERVICE POLICIES ON RESEARCH MISCONDUCT...

42 CFR 93.201 - Allegation.

Science.gov (United States)

2010-10-01

... 42 Public Health 1 2010-10-01 2010-10-01 false Allegation. 93.201 Section 93.201 Public Health PUBLIC HEALTH SERVICE, DEPARTMENT OF HEALTH AND HUMAN SERVICES HEALTH ASSESSMENTS AND HEALTH EFFECTS STUDIES OF HAZARDOUS SUBSTANCES RELEASES AND FACILITIES PUBLIC HEALTH SERVICE POLICIES ON RESEARCH...

42 CFR 93.215 - Investigation.

Science.gov (United States)

2010-10-01

... 42 Public Health 1 2010-10-01 2010-10-01 false Investigation. 93.215 Section 93.215 Public Health PUBLIC HEALTH SERVICE, DEPARTMENT OF HEALTH AND HUMAN SERVICES HEALTH ASSESSMENTS AND HEALTH EFFECTS STUDIES OF HAZARDOUS SUBSTANCES RELEASES AND FACILITIES PUBLIC HEALTH SERVICE POLICIES ON RESEARCH...

42 CFR 93.102 - Applicability.

Science.gov (United States)

2010-10-01

... 42 Public Health 1 2010-10-01 2010-10-01 false Applicability. 93.102 Section 93.102 Public Health PUBLIC HEALTH SERVICE, DEPARTMENT OF HEALTH AND HUMAN SERVICES HEALTH ASSESSMENTS AND HEALTH EFFECTS STUDIES OF HAZARDOUS SUBSTANCES RELEASES AND FACILITIES PUBLIC HEALTH SERVICE POLICIES ON RESEARCH...

42 CFR 93.203 - Complainant.

Science.gov (United States)

2010-10-01

... 42 Public Health 1 2010-10-01 2010-10-01 false Complainant. 93.203 Section 93.203 Public Health PUBLIC HEALTH SERVICE, DEPARTMENT OF HEALTH AND HUMAN SERVICES HEALTH ASSESSMENTS AND HEALTH EFFECTS STUDIES OF HAZARDOUS SUBSTANCES RELEASES AND FACILITIES PUBLIC HEALTH SERVICE POLICIES ON RESEARCH...

42 CFR 93.218 - Person.

Science.gov (United States)

2010-10-01

... 42 Public Health 1 2010-10-01 2010-10-01 false Person. 93.218 Section 93.218 Public Health PUBLIC HEALTH SERVICE, DEPARTMENT OF HEALTH AND HUMAN SERVICES HEALTH ASSESSMENTS AND HEALTH EFFECTS STUDIES OF HAZARDOUS SUBSTANCES RELEASES AND FACILITIES PUBLIC HEALTH SERVICE POLICIES ON RESEARCH MISCONDUCT...

42 CFR 93.216 - Notice.

Science.gov (United States)

2010-10-01

... 42 Public Health 1 2010-10-01 2010-10-01 false Notice. 93.216 Section 93.216 Public Health PUBLIC HEALTH SERVICE, DEPARTMENT OF HEALTH AND HUMAN SERVICES HEALTH ASSESSMENTS AND HEALTH EFFECTS STUDIES OF HAZARDOUS SUBSTANCES RELEASES AND FACILITIES PUBLIC HEALTH SERVICE POLICIES ON RESEARCH MISCONDUCT...

Structural Integration and Control of Peerless Human-like Prosthetic Hand

Science.gov (United States)

Dave, Ankit; Muthu, P.; Karthikraj, V.; Latha, S.

2018-04-01

Limb damage can create severe disturbance in movement and operative abilities wherein the prosthetic rehabilitation has the potential to replace function and enhance the quality of life. This paper presents a humanlike prosthetic hand using such unique design concept of hand model using artificial bones, ligaments, and tendons controlled using Arduino. Amongst various platforms available, Arduino is known for its adaptability, adoration and low cost. The design of prosthetic hand has a unique structure with all carpal, metacarpal, and phalanges which are bones of the hand. These bones are attached to each other following the pattern of human hand using the polymeric rubber as a functioning ligament. Furthermore, this structure of finger is driven by tendons attached to all fingers and passes through the ligaments working as pulley resulting in more degrees of freedom. The motor can twitch the tendons to achieve the action of fingers. Thus the servos, controlled by an Arduino, are used to regulate the movement mechanism of the prosthetic hand.

Human-like Compliance for Dexterous Robot Hands

Science.gov (United States)

Jau, Bruno M.

1995-01-01

This paper describes the Active Electromechanical Compliance (AEC) system that was developed for the Jau-JPL anthropomorphic robot. The AEC system imitates the functionality of the human muscle's secondary function, which is to control the joint's stiffness: AEC is implemented through servo controlling the joint drive train's stiffness. The control strategy, controlling compliant joints in teleoperation, is described. It enables automatic hybrid position and force control through utilizing sensory feedback from joint and compliance sensors. This compliant control strategy is adaptable for autonomous robot control as well. Active compliance enables dual arm manipulations, human-like soft grasping by the robot hand, and opens the way to many new robotics applications.

Environmental review of natural gas production in Lake Erie

International Nuclear Information System (INIS)

O'Shea, K.

2002-01-01

The water of Lake Erie is used as a source of drinking water for Ontario, New York, Pennsylvania, Ohio and Michigan. An environmental review has been conducted to determine the impact of drilling operations on the overall ecology of the lake. Since 1913, 2000 natural gas wells have been drilled in Lake Erie, of which 550 currently produce gas and account for 75 per cent of Ontario's total gas production. 180 wells are shut-in or suspended and the remaining wells have been abandoned. The gas wells are connected to onshore production facilities by approximately 1,600 km of small diameter pipelines that lie buried near shore or on top of the lake bed. Nearly 90 per cent of the in-lake infrastructure is in water depths of more than 20 metres. Talisman Energy is actively involved with the Canadian Coast Guard, the Department of Fisheries and Oceans, and the Ministry of Natural Resources to ensure cooperation between regulators and off-shore personnel. The environmental assessment of natural gas production in Lake Erie included a review of regulatory and best management practices, a biophysical overview of the lake, and a review of drilling practices, well completions, handling of waste streams, materials management, operations inspections, wastewater discharge, air emissions, and oil spills. It was revealed that for most drilling programs, cuttings are washed and discharged to the Lake. Ongoing testing will determine the impact that this practice has on benthic populations. The drill muds used for drilling operations are water based, environmentally friendly, and re-used between well locations. For completion programs, all well activities are closed circuit operations. Wells are abandoned through plugging with cement, removing wellheads and casing below the lake bottom. There has been a reported volume of about 23,000 litres of spilled product from 1990 to 2001, of which 68 per cent has come from 3 industrial companies that operate near Lake Erie. The offshore gas

42 CFR 93.101 - Purpose.

Science.gov (United States)

2010-10-01

... 42 Public Health 1 2010-10-01 2010-10-01 false Purpose. 93.101 Section 93.101 Public Health PUBLIC HEALTH SERVICE, DEPARTMENT OF HEALTH AND HUMAN SERVICES HEALTH ASSESSMENTS AND HEALTH EFFECTS STUDIES OF HAZARDOUS SUBSTANCES RELEASES AND FACILITIES PUBLIC HEALTH SERVICE POLICIES ON RESEARCH MISCONDUCT General...

Variable Thumb Moment Arm Modeling and Thumb-Tip Force Production of a Human-Like Robotic Hand.

Science.gov (United States)

Niehues, Taylor D; Deshpande, Ashish D

2017-10-01

The anatomically correct testbed (ACT) hand mechanically simulates the musculoskeletal structure of the fingers and thumb of the human hand. In this work, we analyze the muscle moment arms (MAs) and thumb-tip force vectors in the ACT thumb in order to compare the ACT thumb's mechanical structure to the human thumb. Motion data are used to determine joint angle-dependent MA models, and thumb-tip three-dimensional (3D) force vectors are experimentally analyzed when forces are applied to individual muscles. Results are presented for both a nominal ACT thumb model designed to match human MAs and an adjusted model that more closely replicates human-like thumb-tip forces. The results confirm that the ACT thumb is capable of faithfully representing human musculoskeletal structure and muscle functionality. Using the ACT hand as a physical simulation platform allows us to gain a better understanding of the underlying biomechanical and neuromuscular properties of the human hand to ultimately inform the design and control of robotic and prosthetic hands.

Simulation of X-ray irradiation on human hand

International Nuclear Information System (INIS)

Amaya, Fabiola; Montoya, Modesto

2001-01-01

Using the Monte Carlo code MCNP we simulate a human hand X-rays irradiation with radiodiagnostic energies to find the better range energy to make radiographs with the lowest dose and an optimal contrast. We calculate bone doses by considering a soft tissue - water - and calcium bone hand, which is irradiated with a million of X-rays photons from a punctual source. These photons are directed inside a conic angle on the hand. Afterwards, we simulate elements which normally compose bones (C, H, O, N, Mg, P, Ca, and S). We estimate bone dose considering: a) bone material (water, calcium and bone tissue); b) bone thickness (0.01; 0.1; 0.5; 1.0; 1.5 and 3.0 cm); and c) source-hand distance (30, 50, 70 and 90 cm). We calculate photon transmission percent through soft tissue and bone tissue and the statistics from the number of photons that reach the radiographic film after passing through soft tissue or bone tissue for our geometric configuration. We found that we can obtain a good image contrast by using X-rays with energies in the range of 20 to 40 keV. (author)

PHOTOLYTIC HAZES IN THE ATMOSPHERE OF 51 ERI B

Energy Technology Data Exchange (ETDEWEB)

Zahnle, K.; Marley, M. S. [NASA Ames Research Center, Moffett Field, CA 94035 (United States); Morley, C. V. [Department of Astronomy and Astrophysics, University of California, Santa Cruz, CA 95064 (United States); Moses, J. I., E-mail: Kevin.J.Zahnle@NASA.gov, E-mail: kzahnle@mail.arc.NASA.gov, E-mail: Mark.S.Marley@NASA.gov, E-mail: cmorley@ucolick.org, E-mail: jmoses@spacescience.org [Space Science Institute, 4750 Walnut Street, Suite 205, Boulder, CO 80301 (United States)

2016-06-20

We use a 1D model to address photochemistry and possible haze formation in the irradiated warm Jupiter, 51 Eridani b. The intended focus was to be carbon, but sulfur photochemistry turns out to be important. The case for organic photochemical hazes is intriguing but falls short of being compelling. If organic hazes form, they are likeliest to do so if vertical mixing in 51 Eri b is weaker than in Jupiter, and they would be found below the altitudes where methane and water are photolyzed. The more novel result is that photochemistry turns H{sub 2}S into elemental sulfur, here treated as S{sub 8}. In the cooler models, S{sub 8} is predicted to condense in optically thick clouds of solid sulfur particles, while in the warmer models S{sub 8} remains a vapor along with several other sulfur allotropes that are both visually striking and potentially observable. For 51 Eri b, the division between models with and without condensed sulfur is at an effective temperature of 700 K, which is within error its actual effective temperature; the local temperature where sulfur condenses is between 280 and 320 K. The sulfur photochemistry we have discussed is quite general and ought to be found in a wide variety of worlds over a broad temperature range, both colder and hotter than the 650–750 K range studied here, and we show that products of sulfur photochemistry will be nearly as abundant on planets where the UV irradiation is orders of magnitude weaker than it is on 51 Eri b.

78 FR 68044 - Erie Boulevard Hydropower, L.P.; Notice of Scoping Meetings and Environmental Site Review and...

Science.gov (United States)

2013-11-13

... DEPARTMENT OF ENERGY Federal Energy Regulatory Commission [Project No. 7320-042] Erie Boulevard Hydropower, L.P.; Notice of Scoping Meetings and Environmental Site Review and Soliciting Scoping Comments.... Date filed: July 1, 2013. d. Applicant: Erie Boulevard Hydropower, L.P. e. Name of Project: Chasm...

Human left ventral premotor cortex mediates matching of hand posture to object use.

Directory of Open Access Journals (Sweden)

Guy Vingerhoets

Full Text Available Visuomotor transformations for grasping have been associated with a fronto-parietal network in the monkey brain. The human homologue of the parietal monkey region (AIP has been identified as the anterior part of the intraparietal sulcus (aIPS, whereas the putative human equivalent of the monkey frontal region (F5 is located in the ventral part of the premotor cortex (vPMC. Results from animal studies suggest that monkey F5 is involved in the selection of appropriate hand postures relative to the constraints of the task. In humans, the functional roles of aIPS and vPMC appear to be more complex and the relative contribution of each region to grasp selection remains uncertain. The present study aimed to identify modulation in brain areas sensitive to the difficulty level of tool object - hand posture matching. Seventeen healthy right handed participants underwent fMRI while observing pictures of familiar tool objects followed by pictures of hand postures. The task was to decide whether the hand posture matched the functional use of the previously shown object. Conditions were manipulated for level of difficulty. Compared to a picture matching control task, the tool object - hand posture matching conditions conjointly showed increased modulation in several left hemispheric regions of the superior and inferior parietal lobules (including aIPS, the middle occipital gyrus, and the inferior temporal gyrus. Comparison of hard versus easy conditions selectively modulated the left inferior frontal gyrus with peak activity located in its opercular part (Brodmann area (BA 44. We suggest that in the human brain, vPMC/BA44 is involved in the matching of hand posture configurations in accordance with visual and functional demands.

Robotic hand project

OpenAIRE

Karaçizmeli, Cengiz; Çakır, Gökçe; Tükel, Dilek

2014-01-01

In this work, the mechatronic based robotic hand is controlled by the position data taken from the glove which has flex sensors mounted to capture finger bending of the human hand. The angular movement of human hand’s fingers are perceived and processed by a microcontroller, and the robotic hand is controlled by actuating servo motors. It has seen that robotic hand can simulate the movement of the human hand that put on the glove, during tests have done. This robotic hand can be used not only...

Zebra mussels invade Lake Erie muds

Science.gov (United States)

Berkman, Paul Arthur; Haltuch, Melissa A.; Tichich, Emily; Garton, David W.; Kennedy, Gregory W.; Gannon, John E.; Mackey, Scudder D.; Fuller, Jonathan A.; Liebenthal, Dale L.

1998-01-01

Zebra mussels (Dreissena polymorpha) originated in western Russia but have now become widespread in Europe and North America. They are widely known for their conspicuous invasion of rocks and other hard substrates in North American and European watersheds. We have found beds of zebra mussels directly colonizing sand and mud sediments each year across hundreds of square kilometres of North America's Lake Erie. This transformation of sedimentary habitats into mussel beds represents an unforeseen change in the invasive capacity of this species.

Thermodynamic assessments of the Ag-Er and Er-Y systems

International Nuclear Information System (INIS)

Wang, S.L.; Wang, C.P.; Liu, X.J.; Tang, A.T.; Pan, F.S.; Ishida, K.

2010-01-01

The phase diagrams and thermodynamic properties in the Ag-Er and Er-Y binary systems have been assessed by using the CALPHAD (Calculation of Phase Diagrams) method on the basis of the experimental data including the thermodynamic properties and phase equilibria. The Gibbs free energies of the liquid, bcc, fcc, and hcp phases were described by the subregular solution model with the Redlich-Kister equation, and those of intermetallic compounds (Ag 2 Er and AgEr phases) were treated as stoichiometric compounds, and Ag 51 Er 14 phase was modeled by the sublattice model in the Ag-Er binary system. The thermodynamic parameters of the Ag-Er and Er-Y binary systems were obtained, and an agreement between the calculated results and experimental data was obtained for each binary system.

75 FR 28070 - Notice of Information Collection; (10-053).

Science.gov (United States)

2010-05-19

..., motivation and efficacy, and career pathways, as it relates to NASA's Summer of Innovation. These outcomes...) Pilot. OMB Number: 2700-XXXX. Type of Review: New. Affected Public: Individuals or Households. Estimated... NATIONAL AERONAUTICS AND SPACE ADMINISTRATION Notice of Information Collection; (10-053). AGENCY...

78 FR 62348 - Erie Boulevard Hydropower, L.P.; Notice of Application Accepted for Filing and Soliciting Motions...

Science.gov (United States)

2013-10-18

... DEPARTMENT OF ENERGY Federal Energy Regulatory Commission [Project No. 7320-042] Erie Boulevard Hydropower, L.P.; Notice of Application Accepted for Filing and Soliciting Motions To Intervene and Protests.... Date filed: July 1, 2013. d. Applicant: Erie Boulevard Hydropower, L.P. e. Name of Project: Chasm...

Single treatment with ethanol hand rub is ineffective against human rhinovirus--hand washing with soap and water removes the virus efficiently.

Science.gov (United States)

Savolainen-Kopra, Carita; Korpela, Terttu; Simonen-Tikka, Marja-Leena; Amiryousefi, Ali; Ziegler, Thedi; Roivainen, Merja; Hovi, Tapani

2012-03-01

Ethanol-containing hand rubs are used frequently as a substitute for hand washing with water and soap. However, not all viruses are inactivated by a short term rubbing with alcohol. The capacity of a single round of instructed and controlled hand cleaning with water and soap or ethanol-containing hand rub, respectively, was tested for removal of human rhinovirus administered onto the skin of healthy volunteers on the back of the hands. Hand washing with soap and water appeared to be much more efficient for removing rhinoviruses from skin than rubbing hands with an ethanol-containing disinfectant. After washing with soap and water the virus was detected in 3/9 (33.3%) test persons from the left hand and 1/9 (11.1%) cases from the right hand, whereas the virus was detected invariably by real-time RT-PCR from both hands after cleaning with alcohol hand rub (P-value soap can clean efficiently hands contaminated with the virus responsible for an extensive share of common cold episodes. Copyright © 2012 Wiley Periodicals, Inc.

Understanding Human Hand Gestures for Learning Robot Pick-and-Place Tasks

Directory of Open Access Journals (Sweden)

Hsien-I Lin

2015-05-01

Full Text Available Programming robots by human demonstration is an intuitive approach, especially by gestures. Because robot pick-and-place tasks are widely used in industrial factories, this paper proposes a framework to learn robot pick-and-place tasks by understanding human hand gestures. The proposed framework is composed of the module of gesture recognition and the module of robot behaviour control. For the module of gesture recognition, transport empty (TE, transport loaded (TL, grasp (G, and release (RL from Gilbreth's therbligs are the hand gestures to be recognized. A convolution neural network (CNN is adopted to recognize these gestures from a camera image. To achieve the robust performance, the skin model by a Gaussian mixture model (GMM is used to filter out non-skin colours of an image, and the calibration of position and orientation is applied to obtain the neutral hand pose before the training and testing of the CNN. For the module of robot behaviour control, the corresponding robot motion primitives to TE, TL, G, and RL, respectively, are implemented in the robot. To manage the primitives in the robot system, a behaviour-based programming platform based on the Extensible Agent Behavior Specification Language (XABSL is adopted. Because the XABSL provides the flexibility and re-usability of the robot primitives, the hand motion sequence from the module of gesture recognition can be easily used in the XABSL programming platform to implement the robot pick-and-place tasks. The experimental evaluation of seven subjects performing seven hand gestures showed that the average recognition rate was 95.96%. Moreover, by the XABSL programming platform, the experiment showed the cube-stacking task was easily programmed by human demonstration.

Recognizing the Operating Hand and the Hand-Changing Process for User Interface Adjustment on Smartphones.

Science.gov (United States)

Guo, Hansong; Huang, He; Huang, Liusheng; Sun, Yu-E

2016-08-20

As the size of smartphone touchscreens has become larger and larger in recent years, operability with a single hand is getting worse, especially for female users. We envision that user experience can be significantly improved if smartphones are able to recognize the current operating hand, detect the hand-changing process and then adjust the user interfaces subsequently. In this paper, we proposed, implemented and evaluated two novel systems. The first one leverages the user-generated touchscreen traces to recognize the current operating hand, and the second one utilizes the accelerometer and gyroscope data of all kinds of activities in the user's daily life to detect the hand-changing process. These two systems are based on two supervised classifiers constructed from a series of refined touchscreen trace, accelerometer and gyroscope features. As opposed to existing solutions that all require users to select the current operating hand or confirm the hand-changing process manually, our systems follow much more convenient and practical methods and allow users to change the operating hand frequently without any harm to the user experience. We conduct extensive experiments on Samsung Galaxy S4 smartphones, and the evaluation results demonstrate that our proposed systems can recognize the current operating hand and detect the hand-changing process with 94.1% and 93.9% precision and 94.1% and 93.7% True Positive Rates (TPR) respectively, when deciding with a single touchscreen trace or accelerometer-gyroscope data segment, and the False Positive Rates (FPR) are as low as 2.6% and 0.7% accordingly. These two systems can either work completely independently and achieve pretty high accuracies or work jointly to further improve the recognition accuracy.

Fisheries research and monitoring activities of the Lake Erie Biological Station, 2014

Science.gov (United States)

Bodamer Scarbro, Betsy L.; Edwards, William; Gawne, Carrie; Kocovsky, Patrick M.; Kraus, Richard T.; Rogers, Mark W.; Stewart, Taylor

2015-01-01

In 2014, the USGS LEBS successfully completed large vessel surveys in all three of Lake Erie’s basins. Lake Erie Biological Station’s primary vessel surveys included the Western Basin Forage Fish Assessment and East Harbor Forage Fish Assessment as well as contributing to the cooperative multi-agency Central Basin Hydroacoustics Assessment, the Eastern Basin Coldwater Community Assessment, and LTLA (see FTG, CWTG, and FTG reports, respectively). Results from the surveys contribute to Lake Erie Committee Task Group data needs and analyses of trends in Lake Erie’s fish communities. The cruise survey schedule in 2014 was greatly increased by LEBS’s participation in the Lake Erie CSMI, which consisted of up-to two weeks of additional sampling per month from April to October. CSMI is a bi-national effort that occurs at Lake Erie every five years with the purpose of addressing data and knowledge gaps necessary to management agencies and the Lake Erie LaMP. LEBS deepwater science capabilities also provided a platform for data collection by Lake Erie investigators from multiple agencies and universities including: the USGS GLSC, ODW, KSU, OSU, UM, PU, UT, and the USNRL. Samples from this survey are being processed and a separate report of the findings will be made available in a separate document. Our 2014 vessel operations were initiated in mid-April, as soon after ice-out as possible, and continued into early December. During this time, crews of the R/V Muskie and R/V Bowfin deployed 196 bottom trawls covering 48.5 km of lake-bottom, nearly 6 km of gillnet, collected data from 60 hydroacoustics transects, 285 lower trophic (i.e., zooplankton and benthos) samples, and 330 water quality measures (e.g., temperature profiles, water samples). Thus, 2014 was an intensive year of field activity. Our June and September bottom trawl surveys in the Western Basin were numerically dominated by Emerald Shiner, White Perch, and Yellow Perch; however, Freshwater Drum were

42 CFR 93.221 - PHS support.

Science.gov (United States)

2010-10-01

... 42 Public Health 1 2010-10-01 2010-10-01 false PHS support. 93.221 Section 93.221 Public Health PUBLIC HEALTH SERVICE, DEPARTMENT OF HEALTH AND HUMAN SERVICES HEALTH ASSESSMENTS AND HEALTH EFFECTS STUDIES OF HAZARDOUS SUBSTANCES RELEASES AND FACILITIES PUBLIC HEALTH SERVICE POLICIES ON RESEARCH...

42 CFR 93.100 - General policy.

Science.gov (United States)

2010-10-01

... 42 Public Health 1 2010-10-01 2010-10-01 false General policy. 93.100 Section 93.100 Public Health PUBLIC HEALTH SERVICE, DEPARTMENT OF HEALTH AND HUMAN SERVICES HEALTH ASSESSMENTS AND HEALTH EFFECTS STUDIES OF HAZARDOUS SUBSTANCES RELEASES AND FACILITIES PUBLIC HEALTH SERVICE POLICIES ON RESEARCH...

42 CFR 93.202 - Charge letter.

Science.gov (United States)

2010-10-01

... 42 Public Health 1 2010-10-01 2010-10-01 false Charge letter. 93.202 Section 93.202 Public Health PUBLIC HEALTH SERVICE, DEPARTMENT OF HEALTH AND HUMAN SERVICES HEALTH ASSESSMENTS AND HEALTH EFFECTS STUDIES OF HAZARDOUS SUBSTANCES RELEASES AND FACILITIES PUBLIC HEALTH SERVICE POLICIES ON RESEARCH...

42 CFR 93.209 - Funding component.

Science.gov (United States)

2010-10-01

... 42 Public Health 1 2010-10-01 2010-10-01 false Funding component. 93.209 Section 93.209 Public Health PUBLIC HEALTH SERVICE, DEPARTMENT OF HEALTH AND HUMAN SERVICES HEALTH ASSESSMENTS AND HEALTH EFFECTS STUDIES OF HAZARDOUS SUBSTANCES RELEASES AND FACILITIES PUBLIC HEALTH SERVICE POLICIES ON RESEARCH...

42 CFR 93.105 - Time limitations.

Science.gov (United States)

2010-10-01

... 42 Public Health 1 2010-10-01 2010-10-01 false Time limitations. 93.105 Section 93.105 Public Health PUBLIC HEALTH SERVICE, DEPARTMENT OF HEALTH AND HUMAN SERVICES HEALTH ASSESSMENTS AND HEALTH EFFECTS STUDIES OF HAZARDOUS SUBSTANCES RELEASES AND FACILITIES PUBLIC HEALTH SERVICE POLICIES ON RESEARCH...

42 CFR 93.50 - Special terms.

Science.gov (United States)

2010-10-01

... 42 Public Health 1 2010-10-01 2010-10-01 false Special terms. 93.50 Section 93.50 Public Health PUBLIC HEALTH SERVICE, DEPARTMENT OF HEALTH AND HUMAN SERVICES HEALTH ASSESSMENTS AND HEALTH EFFECTS STUDIES OF HAZARDOUS SUBSTANCES RELEASES AND FACILITIES PUBLIC HEALTH SERVICE POLICIES ON RESEARCH...

42 CFR 93.103 - Research misconduct.

Science.gov (United States)

2010-10-01

... 42 Public Health 1 2010-10-01 2010-10-01 false Research misconduct. 93.103 Section 93.103 Public Health PUBLIC HEALTH SERVICE, DEPARTMENT OF HEALTH AND HUMAN SERVICES HEALTH ASSESSMENTS AND HEALTH EFFECTS STUDIES OF HAZARDOUS SUBSTANCES RELEASES AND FACILITIES PUBLIC HEALTH SERVICE POLICIES ON RESEARCH...

42 CFR 93.224 - Research record.

Science.gov (United States)

2010-10-01

... 42 Public Health 1 2010-10-01 2010-10-01 false Research record. 93.224 Section 93.224 Public Health PUBLIC HEALTH SERVICE, DEPARTMENT OF HEALTH AND HUMAN SERVICES HEALTH ASSESSMENTS AND HEALTH EFFECTS STUDIES OF HAZARDOUS SUBSTANCES RELEASES AND FACILITIES PUBLIC HEALTH SERVICE POLICIES ON RESEARCH...

Effects of layer sequence and postdeposition annealing temperature on performance of La2O3 and HfO2 multilayer composite oxides on In0.53Ga0.47As for MOS capacitor application

Science.gov (United States)

Wu, Wen-Hao; Lin, Yueh-Chin; Chuang, Ting-Wei; Chen, Yu-Chen; Hou, Tzu-Ching; Yao, Jing-Neng; Chang, Po-Chun; Iwai, Hiroshi; Kakushima, Kuniyuki; Chang, Edward Yi

2014-03-01

In this paper, we report on high-k composite oxides that are formed by depositing multiple layers of HfO2 and La2O3 on In0.53Ga0.47As for MOS device application. Both multilayer HfO2 (0.8 nm)/La2O3 (0.8 nm)/In0.53Ga0.47As and La2O3 (0.8 nm)/HfO2 (0.8 nm)/In0.53Ga0.47As MOS structures were investigated. The effects of oxide thickness and postdeposition annealing (PDA) temperature on the interface properties of the composite oxide MOS capacitors were studied. It was found that a low CET of 1.41 nm at 1 kHz was achieved using three-layer composite oxides. On the other hand, a small frequency dispersion of 2.8% and an excellent Dit of 7.0 × 1011 cm-2·eV-1 can be achieved using multiple layers of La2O3 (0.8 nm) and HfO2 (0.8 nm) on the In0.53Ga0.47As MOS capacitor with optimum thermal treatment and layer thickness.

Recognizing the Operating Hand and the Hand-Changing Process for User Interface Adjustment on Smartphones †

Science.gov (United States)

Guo, Hansong; Huang, He; Huang, Liusheng; Sun, Yu-E

2016-01-01

As the size of smartphone touchscreens has become larger and larger in recent years, operability with a single hand is getting worse, especially for female users. We envision that user experience can be significantly improved if smartphones are able to recognize the current operating hand, detect the hand-changing process and then adjust the user interfaces subsequently. In this paper, we proposed, implemented and evaluated two novel systems. The first one leverages the user-generated touchscreen traces to recognize the current operating hand, and the second one utilizes the accelerometer and gyroscope data of all kinds of activities in the user’s daily life to detect the hand-changing process. These two systems are based on two supervised classifiers constructed from a series of refined touchscreen trace, accelerometer and gyroscope features. As opposed to existing solutions that all require users to select the current operating hand or confirm the hand-changing process manually, our systems follow much more convenient and practical methods and allow users to change the operating hand frequently without any harm to the user experience. We conduct extensive experiments on Samsung Galaxy S4 smartphones, and the evaluation results demonstrate that our proposed systems can recognize the current operating hand and detect the hand-changing process with 94.1% and 93.9% precision and 94.1% and 93.7% True Positive Rates (TPR) respectively, when deciding with a single touchscreen trace or accelerometer-gyroscope data segment, and the False Positive Rates (FPR) are as low as 2.6% and 0.7% accordingly. These two systems can either work completely independently and achieve pretty high accuracies or work jointly to further improve the recognition accuracy. PMID:27556461

Recognizing the Operating Hand and the Hand-Changing Process for User Interface Adjustment on Smartphones

Directory of Open Access Journals (Sweden)

Hansong Guo

2016-08-01

Full Text Available As the size of smartphone touchscreens has become larger and larger in recent years, operability with a single hand is getting worse, especially for female users. We envision that user experience can be significantly improved if smartphones are able to recognize the current operating hand, detect the hand-changing process and then adjust the user interfaces subsequently. In this paper, we proposed, implemented and evaluated two novel systems. The first one leverages the user-generated touchscreen traces to recognize the current operating hand, and the second one utilizes the accelerometer and gyroscope data of all kinds of activities in the user’s daily life to detect the hand-changing process. These two systems are based on two supervised classifiers constructed from a series of refined touchscreen trace, accelerometer and gyroscope features. As opposed to existing solutions that all require users to select the current operating hand or confirm the hand-changing process manually, our systems follow much more convenient and practical methods and allow users to change the operating hand frequently without any harm to the user experience. We conduct extensive experiments on Samsung Galaxy S4 smartphones, and the evaluation results demonstrate that our proposed systems can recognize the current operating hand and detect the hand-changing process with 94.1% and 93.9% precision and 94.1% and 93.7% True Positive Rates (TPR respectively, when deciding with a single touchscreen trace or accelerometer-gyroscope data segment, and the False Positive Rates (FPR are as low as 2.6% and 0.7% accordingly. These two systems can either work completely independently and achieve pretty high accuracies or work jointly to further improve the recognition accuracy.

Metagenomic identification of bacterioplankton taxa and pathways involved in microcystin degradation in lake erie.

Directory of Open Access Journals (Sweden)

Xiaozhen Mou

Full Text Available Cyanobacterial harmful blooms (CyanoHABs that produce microcystins are appearing in an increasing number of freshwater ecosystems worldwide, damaging quality of water for use by human and aquatic life. Heterotrophic bacteria assemblages are thought to be important in transforming and detoxifying microcystins in natural environments. However, little is known about their taxonomic composition or pathways involved in the process. To address this knowledge gap, we compared the metagenomes of Lake Erie free-living bacterioplankton assemblages in laboratory microcosms amended with microcystins relative to unamended controls. A diverse array of bacterial phyla were responsive to elevated supply of microcystins, including Acidobacteria, Actinobacteria, Bacteroidetes, Planctomycetes, Proteobacteria of the alpha, beta, gamma, delta and epsilon subdivisions and Verrucomicrobia. At more detailed taxonomic levels, Methylophilales (mainly in genus Methylotenera and Burkholderiales (mainly in genera Bordetella, Burkholderia, Cupriavidus, Polaromonas, Ralstonia, Polynucleobacter and Variovorax of Betaproteobacteria were suggested to be more important in microcystin degradation than Sphingomonadales of Alphaproteobacteria. The latter taxa were previously thought to be major microcystin degraders. Homologs to known microcystin-degrading genes (mlr were not overrepresented in microcystin-amended metagenomes, indicating that Lake Erie bacterioplankton might employ alternative genes and/or pathways in microcystin degradation. Genes for xenobiotic metabolism were overrepresented in microcystin-amended microcosms, suggesting they are important in bacterial degradation of microcystin, a phenomenon that has been identified previously only in eukaryotic systems.

Thinking outside of the Lake: Can controls on nutrient inputs into Lake Erie benefit stream conservation in its watershed?

Science.gov (United States)

Investment in agricultural conservation practices (CPs) to address Lake Erie's re-eutrophication may offer benefits that extend beyond the lake, such as improved habitat conditions for fish communities throughout the watershed. If such conditions are not explicitly considered in Lake Erie nutrient ...

Human-Human Interaction Forces and Interlimb Coordination During Side-by-Side Walking With Hand Contact.

Science.gov (United States)

Sylos-Labini, Francesca; d'Avella, Andrea; Lacquaniti, Francesco; Ivanenko, Yury

2018-01-01

Handholding can naturally occur between two walkers. When people walk side-by-side, either with or without hand contact, they often synchronize their steps. However, despite the importance of haptic interaction in general and the natural use of hand contact between humans during walking, few studies have investigated forces arising from physical interactions. Eight pairs of adult subjects participated in this study. They walked on side-by-side treadmills at 4 km/h independently and with hand contact. Only hand contact-related sensory information was available for unintentional synchronization, while visual and auditory communication was obstructed. Subjects walked at their natural cadences or following a metronome. Limb kinematics, hand contact 3D interaction forces and EMG activity of 12 upper limb muscles were recorded. Overall, unintentional step frequency locking was observed during about 40% of time in 88% of pairs walking with hand contact. On average, the amplitude of contact arm oscillations decreased while the contralateral (free) arm oscillated in the same way as during normal walking. Interestingly, EMG activity of the shoulder muscles of the contact arm did not decrease, and their synergistic pattern remained similar. The amplitude of interaction forces and of trunk oscillations was similar for synchronized and non-synchronized steps, though the synchronized steps were characterized by significantly more regular orientations of interaction forces. Our results further support the notion that gait synchronization during natural walking is common, and that it may occur through interaction forces. Conservation of the proximal muscle activity of the contact (not oscillating) arm is consistent with neural coupling between cervical and lumbosacral pattern generation circuitries ("quadrupedal" arm-leg coordination) during human gait. Overall, the findings suggest that individuals might integrate force interaction cues to communicate and coordinate steps during

Human-Human Interaction Forces and Interlimb Coordination During Side-by-Side Walking With Hand Contact

Directory of Open Access Journals (Sweden)

Francesca Sylos-Labini

2018-03-01

Full Text Available Handholding can naturally occur between two walkers. When people walk side-by-side, either with or without hand contact, they often synchronize their steps. However, despite the importance of haptic interaction in general and the natural use of hand contact between humans during walking, few studies have investigated forces arising from physical interactions. Eight pairs of adult subjects participated in this study. They walked on side-by-side treadmills at 4 km/h independently and with hand contact. Only hand contact-related sensory information was available for unintentional synchronization, while visual and auditory communication was obstructed. Subjects walked at their natural cadences or following a metronome. Limb kinematics, hand contact 3D interaction forces and EMG activity of 12 upper limb muscles were recorded. Overall, unintentional step frequency locking was observed during about 40% of time in 88% of pairs walking with hand contact. On average, the amplitude of contact arm oscillations decreased while the contralateral (free arm oscillated in the same way as during normal walking. Interestingly, EMG activity of the shoulder muscles of the contact arm did not decrease, and their synergistic pattern remained similar. The amplitude of interaction forces and of trunk oscillations was similar for synchronized and non-synchronized steps, though the synchronized steps were characterized by significantly more regular orientations of interaction forces. Our results further support the notion that gait synchronization during natural walking is common, and that it may occur through interaction forces. Conservation of the proximal muscle activity of the contact (not oscillating arm is consistent with neural coupling between cervical and lumbosacral pattern generation circuitries (“quadrupedal” arm-leg coordination during human gait. Overall, the findings suggest that individuals might integrate force interaction cues to communicate and

Effect of gender and hand laterality on pain processing in human neonates.

Science.gov (United States)

Ozawa, Mio; Kanda, Katsuya; Hirata, Michio; Kusakawa, Isao; Suzuki, Chieko

2011-01-01

Previous studies in adults have reported that handedness and gender can affect pain perception. However, it is currently unclear when these differences emerge in human development. Therefore, we examined prefrontal responses to pain stimulation among newborns during their first acute pain experience after birth. Forty newborns at 4-6 days postnatal age were observed during clinically required blood sampling while prefrontal activation was measured with near infrared spectroscopy. Blood sampling in this study was the first experience of a procedure involving skin breaking for these infants. We divided subjects into a right-hand stimulation group (n=21) and a left-hand stimulation group (n=19), depending on whether blood was sampled from the right or the left hand. A three-way analysis of variance (ANOVA) was conducted to examine the effects of several variables on the magnitude of the oxy-Hb value in response to pain stimulus, including stimulus side (right hand or left hand), gender (male or female), recording side (right prefrontal area or left prefrontal area) and interactions between these variables. The data revealed a significant effect of stimulus side (F (1, 72)=9.892, P=0.002), showing that the right-hand stimulation induced a greater prefrontal activation than the left-hand stimulation. No significant gender difference or interactions were found. Our findings suggest that hand laterality affects pain perception even in neonates. However, gender differences in pain perception did not appear to occur during the neonatal period. Further investigations using brain-imaging techniques are required to identify laterality- or gender-related differences in pain processing in humans. Copyright © 2010 Elsevier Ireland Ltd. All rights reserved.

2008 Federal Emergency Management Agency (FEMA) New York Lidar: Erie County

Data.gov (United States)

National Oceanic and Atmospheric Administration, Department of Commerce — Using Leica Geosystems ALS50 Laser Systems, 89 flight lines with a nominal point spacing = 1.4 meters (4.59 feet) were collected over Erie County, NY (approximately...

Selection of suitable hand gestures for reliable myoelectric human computer interface.

Science.gov (United States)

Castro, Maria Claudia F; Arjunan, Sridhar P; Kumar, Dinesh K

2015-04-09

Myoelectric controlled prosthetic hand requires machine based identification of hand gestures using surface electromyogram (sEMG) recorded from the forearm muscles. This study has observed that a sub-set of the hand gestures have to be selected for an accurate automated hand gesture recognition, and reports a method to select these gestures to maximize the sensitivity and specificity. Experiments were conducted where sEMG was recorded from the muscles of the forearm while subjects performed hand gestures and then was classified off-line. The performances of ten gestures were ranked using the proposed Positive-Negative Performance Measurement Index (PNM), generated by a series of confusion matrices. When using all the ten gestures, the sensitivity and specificity was 80.0% and 97.8%. After ranking the gestures using the PNM, six gestures were selected and these gave sensitivity and specificity greater than 95% (96.5% and 99.3%); Hand open, Hand close, Little finger flexion, Ring finger flexion, Middle finger flexion and Thumb flexion. This work has shown that reliable myoelectric based human computer interface systems require careful selection of the gestures that have to be recognized and without such selection, the reliability is poor.

Predation of the zebra mussel (Dreissena polymorpha) by freshwater drum in western Lake Erie

Science.gov (United States)

French, John R. P.; Bur, Michael T.; Nalepa, Thomas F.; Schloesser, Donald W.

1992-01-01

Environmental and economic problems associated with the colonization of zebra mussels (Dreissena polymorpha) in western Lake Erie created a need to investigate control mechanisms. Predation by fishes is one potential means of control, but predation on zebra mussels by native fishes in Lake Erie is unknown. The freshwater drum (Aplodinotus grunniens) is the most likely fish predator since it is the only fish with pharyngeal teeth capable of crushing mollusk shells. In 1990, freshwater drum were collected in western Lake Erie from 9 sites near rocky reefs and 13 sites with silt or sand bottoms, and gut contents were examined. Predation on zebra mussels increased as drum size increased. Small drum (200-249 mm in length) fed mainly on dipterans, amphipods, and small fish; small zebra mussels (375 mm in length) fed almost exclusively on zebra mussels (seasons and locations combined). The smallest drum capable of crushing zebra mussel shells was 265 mm. Since freshwater drum over 375 mm feed heavily on zebra mussels, they may become a possible biological control mechanism for mussels in portions of North America.

A synergy-based hand control is encoded in human motor cortical areas

Science.gov (United States)

Leo, Andrea; Handjaras, Giacomo; Bianchi, Matteo; Marino, Hamal; Gabiccini, Marco; Guidi, Andrea; Scilingo, Enzo Pasquale; Pietrini, Pietro; Bicchi, Antonio; Santello, Marco; Ricciardi, Emiliano

2016-01-01

How the human brain controls hand movements to carry out different tasks is still debated. The concept of synergy has been proposed to indicate functional modules that may simplify the control of hand postures by simultaneously recruiting sets of muscles and joints. However, whether and to what extent synergic hand postures are encoded as such at a cortical level remains unknown. Here, we combined kinematic, electromyography, and brain activity measures obtained by functional magnetic resonance imaging while subjects performed a variety of movements towards virtual objects. Hand postural information, encoded through kinematic synergies, were represented in cortical areas devoted to hand motor control and successfully discriminated individual grasping movements, significantly outperforming alternative somatotopic or muscle-based models. Importantly, hand postural synergies were predicted by neural activation patterns within primary motor cortex. These findings support a novel cortical organization for hand movement control and open potential applications for brain-computer interfaces and neuroprostheses. DOI: http://dx.doi.org/10.7554/eLife.13420.001 PMID:26880543

75 FR 51451 - Erie Boulevard Hydropower, L.P.; Notice of Intent To File License Application, Filing of Pre...

Science.gov (United States)

2010-08-20

... Hydropower, L.P.; Notice of Intent To File License Application, Filing of Pre-Application Document, and.... Project No.: 7320-040. c. Dated Filed: June 29, 2010. d. Submitted By: Erie Boulevard Hydropower, L.P. e...: John Mudre at (202) 502-8902; or e-mail at [email protected] . j. Erie Boulevard Hydropower, L.P...

42 CFR 93.25 - Organization of this part.

Science.gov (United States)

2010-10-01

... 42 Public Health 1 2010-10-01 2010-10-01 false Organization of this part. 93.25 Section 93.25 Public Health PUBLIC HEALTH SERVICE, DEPARTMENT OF HEALTH AND HUMAN SERVICES HEALTH ASSESSMENTS AND... RESEARCH MISCONDUCT § 93.25 Organization of this part. This part is subdivided into five subparts. Each...

BOTULISM E IN LAKE ERIE: ECOLOGY AND LOWER FOOD WEB TRANSFER

Science.gov (United States)

This project will determine the environmental conditions that favor botulism Type E bacteria in Lake Erie and explore whether quagga mussels are altering bottom sediment conditions to favor C. botulinum growth. Analysis of environmental parameters, including water chemistry, alg...

The Gutenberg Health Study: measuring psychosocial factors at work and predicting health and work-related outcomes with the ERI and the COPSOQ questionnaire.

Science.gov (United States)

Nuebling, Matthias; Seidler, Andreas; Garthus-Niegel, Susan; Latza, Ute; Wagner, Mandy; Hegewald, Janice; Liebers, Falk; Jankowiak, Sylvia; Zwiener, Isabella; Wild, Philipp S; Letzel, Stephan

2013-06-04

Several instruments have been developed to assess psychosocial workload. We compared two of these instruments, the Effort-Reward Imbalance (ERI) model and the Copenhagen Psychosocial Questionnaire (COPSOQ) with regard to congruent validity and internal validity. This analysis is based on a population-based sample of the baseline examination of 2,783 employees from the Gutenberg Health Study (GHS). About half of the participants completed the ERI questionnaire (n = 1,342), the other half completed the COPSOQ (n = 1,441). First, the two samples were compared and descriptive analyses were carried out calculating mean values for both instruments in general, then separately for age, gender and main occupational groups. Second, we analyzed the relationship between ERI and COPSOQ scales on the workplace situation and on the workplace outcomes: job satisfaction, general health, burnout, satisfaction with life, by applying stepwise logistic regression analysis. For the majority of occupations, high effort as reflected by the ERI corresponded with high demands as reflected by the COPSOQ. Comparably, high reward (according to ERI) yielded a good agreement with high "influence and development" (according to COPSOQ). However, we could also find differences between ERI and COPSOQ concerning the intensity of psychosocial workload in some occupations (e.g., physicians/pharmacists or warehouse managers/warehousemen/transport workers). These differences point to differing theoretical concepts of ERI and COPSOQ. When the ability of ERI and COPSOQ was examined to determine the associations with health and work outcomes, burnout could be better predicted by the COPSOQ; this might be due to the fact that COPSOQ comprises the constructs "work-privacy conflict" and "emotional demand", which are closely related to burnout. However, methodological differences between these instruments limit their direct comparability. The ERI and COPSOQ instrument yielded similar results for most

Comparison of human and electronic observation for the measurement of compliance with hand hygiene.

Science.gov (United States)

Filho, Miguel Almeida O; Marra, Alexandre R; Magnus, Thyago Pereira; Rodrigues, Rodrigo Dias; Prado, Marcelo; de Souza Santini, Tales Roberto; da Silva Victor, Elivane; Ishibe, Eder Issao; Pavão Dos Santos, Oscar Fernando; Edmond, Michael B

2014-11-01

Monitoring of hand hygiene is an important part of the improvement of hospital quality indicators. This study was prospectively performed over a 14-week (electronic observer) period from December 3, 2013-March 9, 2014, to evaluate hand hygiene compliance in an adult step-down unit. We compared electronic handwash counters with the application of radiofrequency identification (RFID - ZigBee; i-Healthsys, São Carlos, Brazil) (electronic observer), which counts each activation of the alcohol gel dispenser to direct observation (human observer) using the iScrub application. For the overall time period of simultaneous electronic and human observation, we found that the electronic observer identified 414 hand hygiene episodes, whereas the human observers identified 448 episodes. Therefore, we found 92% (95% confidence interval [CI], 90%-95%) overall concordance (414/448), with an intraclass correlation coefficient of .87 (95% CI, 0.77-0.92). Our RFID (ZigBee) system showed good accuracy (92%) and is a useful method to monitor hand hygiene compliance. Copyright © 2014 Association for Professionals in Infection Control and Epidemiology, Inc. Published by Elsevier Inc. All rights reserved.

Using Watershed Models and Human Behavioral Analyses to identify Management Options to Reduce Lake Erie's Harmful Algal Blooms

Science.gov (United States)

Martin, J.; Wilson, R. S.; Aloysius, N.; Kalcic, M. M.; Roe, B.; Howard, G.; Irwin, E.; Zhang, W.; Liu, H.

2017-12-01

In early 2016, the United States and Canada formally agreed to reduce phosphorus inputs to Lake Erie by 40% to reduce the severity of annual Harmful Algal Blooms (HABs). These blooms have become more severe, with record events occurring in 2011 and 2015, and have compromised public safety, shut down drinking water supplies, and negatively impacted the economy of the western Lake Erie basin. Now, a key question is what management options should be pursued to reach the 40% reduction. This presentation will highlight interdisciplinary research to compare the amount and types of practices needed for this reduction to the current and projected levels of adoption. Multiple models of the Maumee watershed identified management plans and adoption rates needed to reach the reduction targets. For example, one successful scenario estimated necessary adoption rates of 50% for subsurface application of fertilizer on row crops, 58% for cover crops, and 78% for buffer strips. Current adoption is below these levels, but future projections based on farmer surveys shows these levels are possible. This information was then used to guide another round of watershed modeling analysis to evaluate scenarios that represented more realistic scenarios based on potential levels of management adoption. In general, these results show that accelerated adoption of management plans is needed compared to past adoption rates, and that some of these greater adoption levels are possible based on likely adoption rates. Increasing the perceived efficacy of the practices is one method that will support greater voluntary rates of adoption.

Esteetilis-praktiline töö kui eriõppe alternatiiv / Uffe Bjerre

Index Scriptorium Estoniae

Bjerre, Uffe

2005-01-01

Milleks tuupida lapsele pähe seda, millega ta hakkama ei saa, selle asemel et arendada õpilase tugevaid külgi? Samas ka koolipsühholoogide, eripedagoogide Tove Hvidi ja Howard Gardneri väited eriõpet vajavate laste kohta

Erie Nuclear Plant, Units 1 and 2. License application, preliminary safety analysis report, volume 1: chapter 1

International Nuclear Information System (INIS)

1977-01-01

Erie 1 and 2 reactors will be located on a site consisting of 1,740 acres in Berlin Township about 2.4 miles south of Lake Erie and 8.9 miles southeast of Sandusky, Ohio. Lake Erie will provide makeup water. The ultimate heat sink will be a 40 acre cooling reservoir shared by both units. Each unit has a proposed core thermal power level of 3,760 MW(t) and a nominal net capacity of about 1282 MW(e). Unit 1 is scheduled for commercial operation by 4/1/84 and Unit 2 by 4/1/86. Fuel will be Zircaloy-4 clad tubes containing cylindrical fuel pellets of UO 2 . B and W pressurized water reactor units to be employed are described in DOCKET-STN-50561

Minimum size limits for yellow perch (Perca flavescens) in western Lake Erie

Science.gov (United States)

Hartman, Wilbur L.; Nepszy, Stephen J.; Scholl, Russell L.

1980-01-01

During the 1960's yellow perch (Perca flavescens) of Lake Erie supported a commercial fishery that produced an average annual catch of 23 million pounds, as well as a modest sport fishery. Since 1969, the resource has seriously deteriorated. Commercial landings amounted to only 6 million pounds in 1976, and included proportionally more immature perch than in the 1960's. Moreover, no strong year classes were produced between 1965 and 1975. An interagency technical committee was appointed in 1975 by the Lake Erie Committee of the Great Lakes Fishery Commission to develop an interim management strategy that would provide for greater protection of perch in western Lake Erie, where declines have been the most severe. The committee first determined the age structure, growth and mortality rates, maturation schedule, and length-fecundity relationship for the population, and then applied Ricker-type equilibrium yield models to determine the effects of various minimum length limits on yield, production, average stock weight, potential egg deposition, and the Abrosov spawning frequency indicator (average number of spawning opportunities per female). The committee recommended increasing the minimum length limit of 5.0 inches to at least 8.5 inches. Theoretically, this change would increase the average stock weight by 36% and potential egg deposition by 44%, without significantly decreasing yield. Abrosov's spawning frequency indicator would rise from the existing 0.6 to about 1.2.

42 CFR 93.401 - Interaction with other offices and interim actions.

Science.gov (United States)

2010-10-01

... 42 Public Health 1 2010-10-01 2010-10-01 false Interaction with other offices and interim actions. 93.401 Section 93.401 Public Health PUBLIC HEALTH SERVICE, DEPARTMENT OF HEALTH AND HUMAN SERVICES... Human Services General Information § 93.401 Interaction with other offices and interim actions. (a) ORI...

First records of a European cladoceran, Bythotrephes cederstroemi, in Lakes Erie and Huron

Science.gov (United States)

Bur, Michael T.; Klarer, David M.; Krieger, Kenneth A.

1986-01-01

Adult forms of the cladoceran Bythotrephes cederstroemi Schoedler (Cercopagidae), a widespread European freshwater zooplankter, occurred in the stomachs of four common species of Lake Erie fish (yellow perch, Perca flavescens; white perch, Morone americana; white bass, M. chrysops; and walleye, Stizostedion vitreum vitreum) collected in early October 1985. The fish were collected at several stations in the nearshore open waters of the central basin between Ashtabula and Huron, Ohio. Other investigators have seen this species in other locations in Lake Erie and also in Lake Huron. The report of B. cederstroemi in Lake Huron in December 1984 appears to be the first record of this species in North America.

El idealismo en la filosofía medieval: el caso de Juan Escoto Eriúgena

OpenAIRE

Moran, Dermont

2012-01-01

Quiero sostener en este artículo (en contra de la posición de Myles Burnyeat) que el idealismo es una posibilidad filosófica genuina previa a Descartes. En efecto, podemos encontrar una versión del idealismo que supone un concepto desarrollado de subjetividad en una sofisticada versión del  Periphyseon de Escoto Eriúgena. El inmaterialismo intelectualista extremo de Eriúgena difiere del idealismo moderno en la medida en que aquél no está motivado tanto por una consideración epistemológica de ...

42 CFR 93.107 - Rule of interpretation.

Science.gov (United States)

2010-10-01

... 42 Public Health 1 2010-10-01 2010-10-01 false Rule of interpretation. 93.107 Section 93.107 Public Health PUBLIC HEALTH SERVICE, DEPARTMENT OF HEALTH AND HUMAN SERVICES HEALTH ASSESSMENTS AND HEALTH EFFECTS STUDIES OF HAZARDOUS SUBSTANCES RELEASES AND FACILITIES PUBLIC HEALTH SERVICE POLICIES ON...

Lake trout rehabilitation in Lake Erie: a case history

Science.gov (United States)

Cornelius, Floyd C.; Muth, Kenneth M.; Kenyon, Roger

1995-01-01

Native lake trout (Salvelinus namaycush) once thrived in the deep waters of eastern Lake Erie. The impact of nearly 70 years of unregulated exploitation and over 100 years of progressively severe cultural eutrophication resulted in the elimination of lake trout stocks by 1950. Early attempts to restore lake trout by stocking were unsuccessful in establishing a self-sustaining population. In the early 1980s, New York's Department of Environmental Conservation, Pennsylvania's Fish and Boat Commission, and the U.S. Fish and Wildlife Service entered into a cooperative program to rehabilitate lake trout in the eastern basin of Lake Erie. After 11 years of stocking selected strains of lake trout in U.S. waters, followed by effective sea lamprey control, lake trout appear to be successfully recolonizing their native habitat. Adult stocks have built up significantly and are expanding their range in the lake. Preliminary investigations suggest that lake trout reproductive habitat is still adequate for natural reproduction, but natural recruitment has not been documented. Future assessments will be directed toward evaluation of spawning success and tracking age-class cohorts as they move through the fishery.

42 CFR 93.227 - Secretary or HHS.

Science.gov (United States)

2010-10-01

... 42 Public Health 1 2010-10-01 2010-10-01 false Secretary or HHS. 93.227 Section 93.227 Public Health PUBLIC HEALTH SERVICE, DEPARTMENT OF HEALTH AND HUMAN SERVICES HEALTH ASSESSMENTS AND HEALTH EFFECTS STUDIES OF HAZARDOUS SUBSTANCES RELEASES AND FACILITIES PUBLIC HEALTH SERVICE POLICIES ON RESEARCH...

Patterns and sources of polychlorinated dibenzo-p-dioxins and polychlorinated dibenzofurans in surficial sediments of Lakes Erie and Ontario

International Nuclear Information System (INIS)

Shen Li; Gewurtz, Sarah B.; Reiner, Eric J.; MacPherson, Karen A.; Kolic, Terry M.; Helm, Paul A.; Brindle, Ian D.; Marvin, Chris H.

2008-01-01

This study determines spatial trends and congener patterns of 2378-substituted polychlorinated dibenzo-p-dioxins (PCDDs) and polychlorinated dibenzofurans (PCDFs) in surficial sediments of Lakes Erie and Ontario. Sediments are enriched in 2378-PCDFs in Lake Ontario, and the PCDD/F concentrations increased from shallow near-shore sediments towards deep-water depositional zone sediments. In Lake Erie, sediments were dominated by octachlorodibenzo-p-dioxin, and the highest PCDD/F concentrations were observed in the western basin and the southern shoreline of the central basin with a decrease towards the eastern basin and the northern shoreline of the central basin. Principal components analysis revealed that chemical manufacture and disposal of chemical waste along the Niagara River has been a major PCDD/F source to Lake Ontario; while PCDD/Fs in Lake Erie are from multiple sources including industrial sources along the Detroit River, major tributaries along the southern shoreline of the lake, and atmospherically-derived material from the upper lakes and connecting channels. - Lake-wide 2378-PCDD/F congener patterns are first reported in L. Erie and L. Ontario sediments

Molecular characterization of 93 genotypes of cocoa (Theobroma cacao L. with random amplified microsatellites RAMs

Directory of Open Access Journals (Sweden)

Yacenia Morillo C.

2014-12-01

Full Text Available Random amplified microsatellite (RAMs markers six were used to characterize 93 genotypes of cocoa in Tumaco (Colombia. Hundred twenty seven bands were generated. The number of polymorphic loci varied between 11 and 25 for the AG and TG primers, respectively. This study differentiated the 93 genotypes into six groups with a 0.53 similarity, 0.28 mean heterozygosity (He for the population, and 0.12±0.02 genetic differentiation coefficient or Fst. A significant level of genetic diversity was evident in the T. cacao genotypes. This resource would benefit selection programs of individual trees or plant breeding programs. The genotypes clustered in a large proportion in accordance with the collection zone. This characteristic was associated with collection zones and along the rivers in the municipality of Tumaco. The RAM technique proved to be a useful tool for the determination of genetic diversity in Theobroma species.

Associations between cyanobacteria and indices of secondary production in the western basin of Lake Erie

Science.gov (United States)

Larson, James H.; Evans, Mary Anne; Kennedy, Robert J.; Bailey, Sean; Loftin, Keith A.; Laughrey, Zachary; Femmer, Robin; Schaeffer, Jeff; Richardson, William B.; Wynne, Timothy; Nelson, J. C.; Duris, Joseph W.

2018-01-01

Large lakes provide a variety of ecological services to surrounding cities and communities. Many of these services are supported by ecological processes that are threatened by the increasing prevalence of cyanobacterial blooms which occur as aquatic ecosystems experience cultural eutrophication. Over the past 10 yr, Lake Erie experienced cyanobacterial blooms of increasing severity and frequency, which have resulted in impaired drinking water for the surrounding communities. Cyanobacterial blooms may impact ecological processes that support other services, but many of these impacts have not been documented. Secondary production (production of primary consumers) is an important process that supports economically important higher trophic levels. Cyanobacterial blooms may influence secondary production because cyanobacteria are a poor‐quality food resource and cyanotoxins may be harmful to consumers. Over 3 yr at 34 sites across the western basin of Lake Erie, we measured three indices of secondary production that focus on the dominant bivalve taxa: (1) growth of a native unionid mussel, (2) the size of young‐of‐year dreissenid mussels, and (3) the mass of colonizing animals on a Hester‐Dendy sampler. Associations between these indices and cyanobacterial data were estimated to assess whether cyanobacteria are associated with variation in secondary production in the western basin of Lake Erie. The results suggest cyanobacterial abundance alone is only weakly associated with secondary production, but that cyanotoxins have a larger effect on secondary production. Given recurring late‐summer cyanobacterial blooms, this impact on secondary production has the potential to undermine Lake Erie's ability to sustain important ecosystem services.

Invertebrate communities associated with Bangia atropurpurea and Cladophora glomerata in western Lake Erie

Science.gov (United States)

Chilton, E.W.; Lowe, R.L.; Schurr, K.M.

1986-01-01

The appearance of the marine alga Bangia atropurpurea (Rhodophyta) in Lake Erie has been followed by its rapid dispersal throughout the eulittoral zone of the lake. Bangia was extensively sampled to determine its suitability as a habitat for littoral organisms. Present data indicate that the only organisms capable of maintaining populations on Bangia filaments are larval Chironomidae. Cladophora supports a larger and more diverse community. It is concluded that the mucilaginous cell wall of Bangia provides a less stable substrate for attached or clinging organisms than does the cellulose cell wall of Cladophora. The presence of Bangia in the littoral zone of Lake Erie results in a reduction of the quantity and diversity of algal epiphytes and may negatively impact the littoral food web.

Hand Gesture Modeling and Recognition for Human and Robot Interactive Assembly Using Hidden Markov Models

Directory of Open Access Journals (Sweden)

Fei Chen

2015-04-01

Full Text Available Gesture recognition is essential for human and robot collaboration. Within an industrial hybrid assembly cell, the performance of such a system significantly affects the safety of human workers. This work presents an approach to recognizing hand gestures accurately during an assembly task while in collaboration with a robot co-worker. We have designed and developed a sensor system for measuring natural human-robot interactions. The position and rotation information of a human worker's hands and fingertips are tracked in 3D space while completing a task. A modified chain-code method is proposed to describe the motion trajectory of the measured hands and fingertips. The Hidden Markov Model (HMM method is adopted to recognize patterns via data streams and identify workers' gesture patterns and assembly intentions. The effectiveness of the proposed system is verified by experimental results. The outcome demonstrates that the proposed system is able to automatically segment the data streams and recognize the gesture patterns thus represented with a reasonable accuracy ratio.

Seiche-induced unsteady flows in the Huron-Erie Corridor: Spectral analysis of oscillations in stage and discharge in the St. Clair and Detroit Rivers

Science.gov (United States)

Jackson, P. Ryan; Contantinescu, G.; Garcia, M.; Hanes, D.

2016-01-01

Animations of highly dynamic water-surface profiles through the St. Clair and Detroit Rivers have identified transient disturbances propagating from Lakes Huron and Erie into the St. Clair and Detroit Rivers, respectively. To determine any relation to seiche and tidal oscillations on Lakes Huron and Erie, a spectral analysis was performed on stage and discharge data from the Huron-Erie Corridor. There is excellent agreement between the observed oscillations in stage and discharge in the St. Clair and Detroit Rivers and the documented frequencies of oscillations in Lakes Huron and Erie. The fundamental seiche, some higher-order seiche modes, and the semidiurnal tide from Lakes Huron and Erie are evident in the stage and discharge records at gages along the St. Clair and Detroit Rivers, respectively. Lake St. Clair appears to act as a damper in the system. If not accounted for, these oscillations may complicate monitoring, modeling, and restoration of this system.

A description of the nearshore fish communities in the Huron-Erie Corridor using multiple gear types

Science.gov (United States)

Francis, James T.; Chiotti, Justin A.; Boase, James C.; Thomas, Mike V.; Manny, Bruce A.; Roseman, Edward F.

2013-01-01

Great Lakes coastal wetlands provide a critical habitat for many fish species throughout their life cycles. Once home to one of the largest wetland complexes in the Great Lakes, coastal wetlands in the Huron–Erie Corridor (HEC) have decreased dramatically since the early 1900s. We characterized the nearshore fish communities at three different wetland complexes in the HEC using electrofishing, seines, and fyke nets. Species richness was highest in the Detroit River (63), followed by the St. Clair Delta (56), and Western Lake Erie (47). The nearshore fish communities in the Detroit River and St. Clair Delta consisted primarily of shiners, bluntnose minnow, centrarchids, and brook silverside, while the Western Lake Erie sites consisted of high proportions of non-native taxa including common carp, gizzard shad, goldfish, and white perch. Species richness estimates using individual-based rarefaction curves were higher when using electrofishing data compared to fyke nets or seine hauls at each wetland. Twelve fish species were captured exclusively during electrofishing assessments, while one species was captured exclusively in fyke nets, and none exclusively during seine hauls. Western Lake Erie wetlands were more indicative of degraded systems with lower species richness, lower proportion of turbidity intolerant species, and increased abundance of non-native taxa. This work highlights the importance of coastal wetlands in the HEC by capturing 69 different fish species utilizing these wetlands to fulfill life history requirements and provides insight when selecting gears to sample nearshore littoral areas.

Lake Erie, phosphorus and microcystin: Is it really the farmer's fault?

Science.gov (United States)

Agricultural loss of phosphorus (P) have been identified as a primary contributor to eutrophication and the associated release of toxins (i.e., mycrocystin) in Lake Erie. These losses are commonly deemed excessive by the media and the public, singling out agriculture as the culprit in spite of redu...

RGBD Video Based Human Hand Trajectory Tracking and Gesture Recognition System

Directory of Open Access Journals (Sweden)

Weihua Liu

2015-01-01

Full Text Available The task of human hand trajectory tracking and gesture trajectory recognition based on synchronized color and depth video is considered. Toward this end, in the facet of hand tracking, a joint observation model with the hand cues of skin saliency, motion and depth is integrated into particle filter in order to move particles to local peak in the likelihood. The proposed hand tracking method, namely, salient skin, motion, and depth based particle filter (SSMD-PF, is capable of improving the tracking accuracy considerably, in the context of the signer performing the gesture toward the camera device and in front of moving, cluttered backgrounds. In the facet of gesture recognition, a shape-order context descriptor on the basis of shape context is introduced, which can describe the gesture in spatiotemporal domain. The efficient shape-order context descriptor can reveal the shape relationship and embed gesture sequence order information into descriptor. Moreover, the shape-order context leads to a robust score for gesture invariant. Our approach is complemented with experimental results on the settings of the challenging hand-signed digits datasets and American sign language dataset, which corroborate the performance of the novel techniques.

Historical Documentation of Warm-Season Grasses Management at Erie National Wildlife Refuge 1989

Data.gov (United States)

Department of the Interior — The early accounts of an active grassland management program at Erie National Wildlife Refuge dates back to 1977. This report is an attempt to document the refuge’s...

Optical coherence tomography, In vivo human hand explorer, optical coherence microscope

CSIR Research Space (South Africa)

Jonathan, E

2008-07-01

Full Text Available The hand palm is an important human body part primarily for physical manipulation of the environment. For example, palmar hyperhidriotics report a low quality of life due to excessive palmar sweating disrupting normal palm use. As a body part...

Assessment of the Great Lakes Marine Renewable Energy Resources: Characterizing Lake Erie Surge, Seiche and Waves

Science.gov (United States)

Farhadzadeh, A.; Hashemi, M. R.

2016-02-01

Lake Erie, the fourth largest in surface area, smallest in volume and shallowest among the Great Lakes is approximately 400 km long and 90 km wide. Short term lake level variations are due to storm surge generated by high winds and moving pressure systems over the lake mainly in the southwest-northeast direction, along the lakes longitudinal axis. The historical wave data from three active offshore buoys shows that significant wave height can exceed 5 m in the eastern and central basins. The long-term lake level data show that storm surge can reach up to 3 m in eastern Lake Erie. Owing its shallow depth, Lake Erie frequently experiences seiching motions, the low frequency oscillations that are initiated by storm surge. The seiches whose first mode of oscillations has a period of nearly 14.2 hours can last from several hours to days. In this study, the Lake Erie potential for power generation, primarily using storm surge and seiche and also waves are assessed. Given the cyclic lake level variations due to storm-induced seiching, a concept similar to that of tidal range development is utilized to assess the potential of storm surge and seiche energy harvesting mechanisms for power generation. In addition, wave energy resources of the Lake is characterized -. To achieve these objectives, the following steps are taken : (1) Frequency of occurrence for extreme storm surge and wave events is determined using extreme value analysis such as Peak-Over-Threshold method for the long-term water level and wave data; (2) Spatial and temporal variations of wave height, storm surge and seiche are characterized. The characterization is carried out using the wave and storm surge outputs from numerical simulation of a number of historical extreme events. The coupled ADCIRC and SWAN model is utilized for the modeling; (3) Assessment of the potentials for marine renewable power generation in Lake Erie is made. The approach can be extended to the other lakes in the Great Lakes region.

Tactile mouse generating velvet hand illusion on human palm

Directory of Open Access Journals (Sweden)

Nadar Rajaei

2016-09-01

Full Text Available To enhance virtual reality (VR generated by tactile displays, we have focused on a novel tactile illusion, called the Velvet Hand Illusion (VHI. In VHI, moving two parallel wires back and forth between the two hands leads humans to perceive a velvet-like surface between their hands. In earlier studies, we revealed that the intensity of VHI could be controlled by a ratio (r/D, where r and D are the wire stroke and wire distance, respectively. According to these findings, we investigate in this study whether a common tactile display is able to produce VHI, and whether the ratio can also control VHI intensity. We prepare a dot-matrix display as a tactile display in which moving one line of the display’s pins is considered as a wire pattern. We investigate the VHI intensity with regard to changing the stroke r and the line distance D using paired comparison. Experimental results show that the VHI intensity is increased or decreased by changing r and D. We conclude that VHI can be created by the tactile display, and the intensity of VHI is controlled by changing the ratio of r/D.

Isolation, Identification and Phenotypic Characterization of Microcystin-Degrading Bacteria from Lake Erie

Science.gov (United States)

Krishnan, A.; Mou, X. J.

2015-12-01

Lake Erie, the smallest and warmest lake among the Laurentian Great Lakes, is known for its problem of eutrophication and frequent occurrence of harmful cyanobacterial blooms (CyanoHABs). One major harmful effect of CyanoHABs is the production of cyanotoxins, especially microcystins. Microcystins (MC) are a group of hepatotoxins and the predominant variant of them is MC-LR. Field measurements and lab experiments indicate that MC degradation in Lake Erie is mainly carried out by indigenous bacteria. However, our knowledge on taxa involved in this process is very limited. This study aimed to fill this knowledge gap using a culture-dependent approach. Water and surface sediment samples were collected from Lake Erie in 2014 and 2015 and enriched with MC-LR. Cells were plated on a number of culturing media. The obtained pure bacterial cultures were screened for MC degrading abilities by MT2 BIO-LOG assays and by growing cells in liquid media containing MC-LR as the sole carbon source. In the latter experiment, MC concentrations were measured using HPLC. Isolates showing positive MC degradation activities in the screening steps were designated MC+ bacteria and characterized based on their phenotypic properties, including colony pigmentation, elevation, opacity, margin, gram nature and motility. The taxonomic identity of MC+ bacteria was determined by 16S rRNA gene full-length DNA sequencing. The presence of mlrA, a gene encoding MC cleavage pathway, was detected by PCR. Our culturing efforts obtained 520 pure cultures; 44 of them were identified as MC+. These MC+ isolates showed diversity in taxonomic identities and differed in their morphology, gram nature, colony characteristics and motility. PCR amplification of mlrA gene yield negative results for all MC+ isolates, indicating that the primers that were used may not be ubiquitous enough to cover the heterogeneity of mlrA genes or, more likely, alternative degradative genes/pathways were employed by Lake Erie bacteria

Reconstructing Heat Fluxes Over Lake Erie During the Lake Effect Snow Event of November 2014

Science.gov (United States)

Fitzpatrick, L.; Fujisaki-Manome, A.; Gronewold, A.; Anderson, E. J.; Spence, C.; Chen, J.; Shao, C.; Posselt, D. J.; Wright, D. M.; Lofgren, B. M.; Schwab, D. J.

2017-12-01

The extreme North American winter storm of November 2014 triggered a record lake effect snowfall (LES) event in southwest New York. This study examined the evaporation from Lake Erie during the record lake effect snowfall event, November 17th-20th, 2014, by reconstructing heat fluxes and evaporation rates over Lake Erie using the unstructured grid, Finite-Volume Community Ocean Model (FVCOM). Nine different model runs were conducted using combinations of three different flux algorithms: the Met Flux Algorithm (COARE), a method routinely used at NOAA's Great Lakes Environmental Research Laboratory (SOLAR), and the Los Alamos Sea Ice Model (CICE); and three different meteorological forcings: the Climate Forecast System version 2 Operational Analysis (CFSv2), Interpolated observations (Interp), and the High Resolution Rapid Refresh (HRRR). A few non-FVCOM model outputs were also included in the evaporation analysis from an atmospheric reanalysis (CFSv2) and the large lake thermodynamic model (LLTM). Model-simulated water temperature and meteorological forcing data (wind direction and air temperature) were validated with buoy data at three locations in Lake Erie. The simulated sensible and latent heat fluxes were validated with the eddy covariance measurements at two offshore sites; Long Point Lighthouse in north central Lake Erie and Toledo water crib intake in western Lake Erie. The evaluation showed a significant increase in heat fluxes over three days, with the peak on the 18th of November. Snow water equivalent data from the National Snow Analyses at the National Operational Hydrologic Remote Sensing Center showed a spike in water content on the 20th of November, two days after the peak heat fluxes. The ensemble runs presented a variation in spatial pattern of evaporation, lake-wide average evaporation, and resulting cooling of the lake. Overall, the evaporation tended to be larger in deep water than shallow water near the shore. The lake-wide average evaporations

Recolonization and possible recovery of burrowing mayflies (Ephemeroptera: Ephemeridae: Hexagenia spp.) in Lake Erie of the Laurentian Great Lakes

Science.gov (United States)

Schloesser, Don W.; Krieger, Kenneth A.; Ciborowski, Jan J.H.; Corkum, Lynda D.

2000-01-01

Burrowing mayflies of the genus Hexagenia spp. were widely distributed (ca. 80% of sites) and abundant (ca. 160 nymphs/m2) in the western basin of Lake Erie of the Laurentian Great Lakes in 1929–1930, prior to a period of anoxia in the mid 1950s. Nymphs were absent or rare in the basin between 1961 and 1973–1975. In 1979–1991, nymphs were infrequently found (13–46% of sites) in low abundance (3–40 nymphs/m2) near shore (recolonized sediments of western Lake Erie and that their abundance may be similar to levels observed before their disappearance in the mid 1950s. However, prior to the mid 1950s, densities were greater in offshore than nearshore waters, but between 1979 and 1998 greater densities occurred near shore than offshore. In addition, there were two areas in the 1990s where low densities consistently occurred. Therefore, recovery of nymphs in western Lake Erie may not have been complete in 1998. At present we do not know the cause for the sudden recolonization of nymphs in large portions of western Lake Erie. Undoubtedly, pollution-abatement programs contributed to improved conditions that would have ultimately led to mayfly recovery in the future. However, the explosive growth of the exotic zebra mussel, Dreissena polymorpha, undoubtedly diverted plankton foods to bottom substrates which could have increased the speed at which Hexagenia spp. nymphs recolonized sediments in western Lake Erie in the 1990s.

Turbidity as a factor in the decline of Great Lakes fishes with special reference to Lake Erie

Science.gov (United States)

Van Oosten, John

1948-01-01

Fish live and thrive in water with turbidities that range above 400 p.p.m. and average 200 p.p.m. The waters of the Great Lakes usually are clear except in Lake Erie where the turbidities of the inshore areas averaged 37 p.p.m.; the turbidities of the offshore waters averaged less. Lake Erie waters were no clearer 50 years ago than they are now. In fact, the turbidity values are less now than they were in the earlier years; the annual average of the inshore waters dropped from 44 p.p.m. before 1930 to 32 p.p.m. in 1930 and later, and the April-May values decreased from 72 p.p.m. to 46 p.p.m. Any general decline in the Lake Erie fishes cannot be attributed to increased turbidities. Furthermore, these turbidities averaged well below 100 p.p.m. and, therefore, were too low to affect fishes adversely.

78 FR 26416 - Environmental Impact Statement: City of Buffalo, Erie County, New York

Science.gov (United States)

2013-05-06

... from the US Border Port of Entry/Peace Bridge Plaza (Plaza), in the City of Buffalo, Erie County, New... Drive, and to provide alternate access from Porter Avenue to the Plaza. Letters describing the proposed...

Eri aistijärjestelmiä aktivoivat tasapainoharjoitteluvälineet

OpenAIRE

Kytölinna, Pauliina

2017-01-01

Opinnäytetyön tarkoituksena oli selvittää tämänhetkiset näyttöön perustuvat tasapainoharjoittelukeinot sekä – välineet, jonka perusteella Satakunnan ammattikorkeakoulun fysioterapian koulutusohjelmille laaditaan tasapainovälineiden hankintasuunnitelma. Tasapainovälineiden hankintasuunnitelman näkökulmaksi valittiin tasapainoharjoittelun pienvälineet, jotka monipuolisesti aktivoivat eri aistijärjestelmiä. Kuvailevan kirjallisuuskatsauksen keinoin opinnäytetyössä selvitettiin aistijärjeste...

78 FR 60009 - Environmental Impact Statement: Erie and Genesee Counties, New York

Science.gov (United States)

2013-09-30

... and Genesee Counties, New York AGENCY: Federal Highway Administration (FHWA), DOT; New York State... counties of Erie and Genesee, New York (NYSDOT Project Identification Number: 5528.28). A Notice of Intent... CONTACT: Jonathan McDade, Division Administrator, Federal Highway Administration, New York Division, Leo W...

Experiment data report for Semiscale Mod-1 Test S-05-3 (alternate ECC injection test)

International Nuclear Information System (INIS)

Feldman, E.M.; Patton, M.L. Jr.; Sackett, K.E.

1977-03-01

Recorded test data are presented for Test S-05-3 of the Semiscale Mod-1 alternate ECC injection test series. These tests are among several Semiscale Mod-1 experiments conducted to investigate the thermal and hydraulic phenomena accompanying a hypothesized loss-of-coolant accident in a pressurized water reactor (PWR) system. Test S-05-3 was conducted from initial conditions of 2263 psia and 545 0 F to investigate the response of the Semiscale Mod-1 system to a depressurization and reflood transient following a simulated double-ended offset shear of the cold leg broken loop piping. During the test, cooling water was injected into the cold leg sides of the intact and broken loops and into the vessel upper plenum to simulate emergency core coolant injection in a PWR. For Test S-05-3, specifically the effects of upper plenum coolant injection on core thermal and system response were being investigated

Structural properties of In0.53Ga0.47As epitaxial films grown on Si (111) substrates by molecular beam epitaxy

International Nuclear Information System (INIS)

Gao, Fangliang; Wen, Lei; Zhang, Xiaona; Guan, Yunfang; Li, Jingling; Zhang, Shuguang; Li, Guoqiang

2015-01-01

In 0.53 Ga 0.47 As epitaxial films are grown on 2-inch diameter Si (111) substrates by growing a low-temperature In 0.4 Ga 0.6 As buffer layer using molecular beam epitaxy. The effect of the buffer layer thickness on the as-grown In 0.53 Ga 0.47 As films is characterized by X-ray diffraction, scanning electron microscopy, atomic force microscopy and transmission electron microscopy (TEM). It is revealed that the crystalline quality and surface morphology of as-grown In 0.53 Ga 0.47 As epilayer are strongly affected by the thickness of the In 0.4 Ga 0.6 As buffer layer. From TEM investigation, we understand that the type and the distribution of dislocations of the buffer layer and the as-grown In 0.53 Ga 0.47 As film are different. We have demonstrated that the In 0.4 Ga 0.6 As buffer layer with a thickness of 12 nm can advantageously release the lattice mismatch stress between the In 0.53 Ga 0.47 As and Si substrate, ultimately leading to a high-quality In 0.53 Ga 0.47 As epitaxial film with low surface roughness. - Highlights: • We provide a simple approach to achieve high-quality In 0.53 Ga 0.47 As films on Si. • An appropriate thickness of In 0.4 Ga 0.6 As buffer layer can release mismatch strain. • High-quality In 0.53 Ga 0.47 As film is grown on Si using 12-nm-thick buffer layer. • Smooth surface In 0.53 Ga 0.47 As film is grown on Si using 12-nm-thick buffer layer

Culture-based Identification Of Microcystin-Degrading Bacteria In the Sandusky Bay and Maumee Bay of Lake Erie

Science.gov (United States)

Ormiston, A.; Mou, X.

2012-12-01

Harmful cyanobacteria blooms (cyanoHABs) are a serious issue that affects wildlife, human health, recreation and local economics worldwide. CyanoHABs produce cyanotoxins, such as microcystins (MCs) that lead to skin irritation, illness and liver tumors. Bacterially mediated degradation of MCs plays a key role to transform these toxic substrates to less harmful metabolites in natural environments. However, only a few Sphingomonos species have been isolated for degradation of MCs and many of which are from other habitats such as water plants. This project aims to isolate and identify bacteria that can degrade MC-LR and MC-RR, two major forms of MCs found during cyanoHABs in Lake Erie. Water samples were collected from the surface of Sandusky Bay and Maumee Bay of Lake Erie and immediately filtered through 3.0 -μm-pore-size membrane filters to obtain bacterioplankton fraction. The filtrates were amended with excessive inorganic nitrogen and phosphorus compounds and incubated in the dark for a week to purposely establish a carbon-limited condition. Afterwards, enrichment microcosms were established in flasks filled with pre-incubated bacterioplankton and single MC compounds (final concentration 10 μM). Once cell growth was confirmed by flow cytometry-based cell counting, bacterial cells in enriched microcosms were transferred onto solid surfaces, i.e., GFF filter and noble agar for colony isolation. Obtained single colonies were inoculated in defined liquid media with MCs as single carbon source. DNA was extracted from each purified isolate and analyzed by restriction fragment length polymorphism analysis (RFLP). A total of 18 different RFLP banding patterns were found, indicating MC-degrading bacteria may be heterogeneous in studied water samples. 16S rRNA genes of selected bacterial isolates were PCR amplified and sequenced for taxonomic identification. Our results demonstrated that MCs can be degraded by multiple bacterial species in Lake Erie. Future directions

The Fossil Fauna of the Islands Region of Western Lake Erie.

Science.gov (United States)

Bowe, Lulu M., Comp.

The islands of western Lake Erie are rock-bound isles that abound in rocky outcrops and quarries. The rocks of these islands are of two distinct types, Silurian dolomites and Devonian limestones. The dolomites, exposed in the Bass Islands and Sister Islands are virtually devoid of fossils. Conversely, the limestones of Johnson Island, Marblehead,…

Efficacy of soap and water and alcohol-based hand-rub preparations against live H1N1 influenza virus on the hands of human volunteers.

Science.gov (United States)

Grayson, M Lindsay; Melvani, Sharmila; Druce, Julian; Barr, Ian G; Ballard, Susan A; Johnson, Paul D R; Mastorakos, Tasoula; Birch, Christopher

2009-02-01

Although pandemic and avian influenza are known to be transmitted via human hands, there are minimal data regarding the effectiveness of routine hand hygiene (HH) protocols against pandemic and avian influenza. Twenty vaccinated, antibody-positive health care workers had their hands contaminated with 1 mL of 10(7) tissue culture infectious dose (TCID)(50)/0.1 mL live human influenza A virus (H1N1; A/New Caledonia/20/99) before undertaking 1 of 5 HH protocols (no HH [control], soap and water hand washing [SW], or use of 1 of 3 alcohol-based hand rubs [61.5% ethanol gel, 70% ethanol plus 0.5% chlorhexidine solution, or 70% isopropanol plus 0.5% chlorhexidine solution]). H1N1 concentrations were assessed before and after each intervention by viral culture and real-time reverse-transcriptase polymerase chain reaction (PCR). The natural viability of H1N1 on hands for >60 min without HH was also assessed. There was an immediate reduction in culture-detectable and PCR-detectable H1N1 after brief cutaneous air drying--14 of 20 health care workers had H1N1 detected by means of culture (mean reduction, 10(3-4) TCID(50)/0.1 mL), whereas 6 of 20 had no viable H1N1 recovered; all 20 health care workers had similar changes in PCR test results. Marked antiviral efficacy was noted for all 4 HH protocols, on the basis of culture results (14 of 14 had no culturable H1N1; (P< .002) and PCR results (P< .001; cycle threshold value range, 33.3-39.4), with SW statistically superior (P< .001) to all 3 alcohol-based hand rubs, although the actual difference was only 1-100 virus copies/microL. There was minimal reduction in H1N1 after 60 min without HH. HH with SW or alcohol-based hand rub is highly effective in reducing influenza A virus on human hands, although SW is the most effective intervention. Appropriate HH may be an important public health initiative to reduce pandemic and avian influenza transmission.

Fusion of hyperspectral remote sensing data for near real-time monitoring of microcystin distribution in Lake Erie

Science.gov (United States)

Vannah, Benjamin; Chang, Ni-Bin

2013-09-01

Urban growth and agricultural production have caused an influx of nutrients into Lake Erie, leading to eutrophic zones. These conditions result in the formation of algal blooms, some of which are toxic due to the presence of Microcystis (a cyanobacteria), which produces the hepatotoxin microcystin. Microcystis has a unique advantage over its competition as a result of the invasive zebra mussel population that filters algae out of the water column except for the toxic Microcystis. The toxin threatens human health and the ecosystem, and it is a concern for water treatment plants using the lake water as a tap water source. This presentation demonstrates the prototype of a near real-time early warning system using Integrated Data Fusion techniques with the aid of both hyperspectral remote sensing data to determine spatiotemporal microcystin concentrations. The temporal resolution of MODIS is fused with the higher spatial and spectral resolution of MERIS to create synthetic images on a daily basis. As a demonstration, the spatiotemporal distributions of microcystin within western Lake Erie are reconstructed using the band data from the fused products and applied machine-learning techniques. Analysis of the results through statistical indices confirmed that the this type of algorithm has better potential to accurately estimating microcystin concentrations in the lake, which is better than current two band models and other computational intelligence models.

Assessing and addressing the re-eutrophication of Lake Erie: central basin hypoxia

Science.gov (United States)

Scavia, Donald; Allan, J. David; Arend, Kristin K.; Bartell, Steven; Beletsky, Dmitry; Bosch, Nate S.; Brandt, Stephen B.; Briland, Ruth D.; Daloğlu, Irem; DePinto, Joseph V.; Dolan, David M.; Evans, Mary Anne; Farmer, Troy M.; Goto, Daisuke; Han, Haejin; Höök, Tomas O.; Knight, Roger; Ludsin, Stuart A.; Mason, Doran; Michalak, Anna M.; Richards, R. Peter; Roberts, James J.; Rucinski, Daniel K.; Rutherford, Edward; Schwab, David J.; Sesterhenn, Timothy M.; Zhang, Hongyan; Zhou, Yuntao

2014-01-01

Relieving phosphorus loading is a key management tool for controlling Lake Erie eutrophication. During the 1960s and 1970s, increased phosphorus inputs degraded water quality and reduced central basin hypolimnetic oxygen levels which, in turn, eliminated thermal habitat vital to cold-water organisms and contributed to the extirpation of important benthic macroinvertebrate prey species for fishes. In response to load reductions initiated in 1972, Lake Erie responded quickly with reduced water-column phosphorus concentrations, phytoplankton biomass, and bottom-water hypoxia (dissolved oxygen 2) requires cutting total phosphorus loads by 46% from the 2003–2011 average or reducing dissolved reactive phosphorus loads by 78% from the 2005–2011 average. Reductions to these levels are also protective of fish habitat. We provide potential approaches for achieving those new loading targets, and suggest that recent load reduction recommendations focused on western basin cyanobacteria blooms may not be sufficient to reduce central basin hypoxia to 2000 km2.

Recent advances in biodynamics of human hand-arm system.

Science.gov (United States)

Dong, Ren G; Wu, John Z; Welcome, Daniel E

2005-07-01

The biodynamics of human hand-arm system is one of the most important foundations for the measurement, evaluation, and risk assessment of hand-transmitted vibration (HTV) exposure. This paper presents a new conceptual model relating factors influencing cause-effect relationships for HTV exposure, a new study strategy, and a comprehensive review of the recent advances in the biodynamics closely associated with HTV exposure. The review covers the following five aspects: theoretical modeling of biodynamic responses, vibration transmissibility, driving-point biodynamic responses, evaluation of anti-vibration gloves, and applied forces. This review finds that some significant advances in each of these aspects have been achieved in the recent years. Several important issues and problems in the biodynamic measurement have been identified and resolved, which has significantly helped improve the reliability and accuracy of the experimental data. The results reported in recent years suggest that, from the point of view of biodynamics, the frequency weighting specified in ISO 5349-1 (2001) overestimates the low frequency effect but underestimates the high frequency effect on the fingers and hand. The major problems, issues, and topics for further studies are also outlined in this paper. It is anticipated that the further studies of the biodynamics of the system will eventually lead to establishment of a robust vibration exposure theory. Although this review focuses on the biodynamics of the hand-arm system, the fundamental concepts and some methodologies reviewed in this paper may also be applicable for the study of whole-body vibration exposure.

Diode-pumped high power 2.7 μm Er:Y2O3 ceramic laser at room temperature

Science.gov (United States)

Wang, Li; Huang, Haitao; Shen, Deyuan; Zhang, Jian; Chen, Hao; Tang, Dingyuan

2017-09-01

Investigation of room temperature laser performance of the polycrystalline Er:Y2O3 ceramic at 2.7 μm with respect to dopant concentrations was conducted. With 7 at.% Er3+ concentration Er:Y2O3 ceramic as laser gain medium, over 2.05 W of CW output power at 2.7 μm was generated with a slope efficiency of 11.1% with respect to the absorbed LD pump power. The prospects for improvement in lasing efficiency and output power are considered.

iHand: an interactive bare-hand-based augmented reality interface on commercial mobile phones

Science.gov (United States)

Choi, Junyeong; Park, Jungsik; Park, Hanhoon; Park, Jong-Il

2013-02-01

The performance of mobile phones has rapidly improved, and they are emerging as a powerful platform. In many vision-based applications, human hands play a key role in natural interaction. However, relatively little attention has been paid to the interaction between human hands and the mobile phone. Thus, we propose a vision- and hand gesture-based interface in which the user holds a mobile phone in one hand but sees the other hand's palm through a built-in camera. The virtual contents are faithfully rendered on the user's palm through palm pose estimation, and reaction with hand and finger movements is achieved that is recognized by hand shape recognition. Since the proposed interface is based on hand gestures familiar to humans and does not require any additional sensors or markers, the user can freely interact with virtual contents anytime and anywhere without any training. We demonstrate that the proposed interface works at over 15 fps on a commercial mobile phone with a 1.2-GHz dual core processor and 1 GB RAM.

93Tc and sup(93m)Tc gamma spectra

International Nuclear Information System (INIS)

Podkopaev, Yu.N.; Zarubin, P.P.; Kobelev, V.F.; Padalko, V.Yu.; Khrisanfov, Yu.V.

1977-01-01

The sup(93,93m)Tc decay was studied. The spectra of γ-rays accompanying the decay of this nuclide were studied. 93 Tc and sup(93m)Tc were obtained in the (dn)-reaction on 92 Mo. To ensure a more reliable identification of γ-rays, the isotopic composition of the targets, the bombardment time, the energy of the bombarding deuterons (5-12 MeV) and the spectrum processing program were varied. The energies and relative intensities of the γ-rays of the 93 Tc and sup(93m)Tc decay are listed in tables together with data of other investigatxons. The results obtained largely confirm the known data. Four new transitions were added in the sup(93m)Tc spectrum namely 1046.8, 2011.8, 2182.0, and 2861.5 keV. The 2739.0 keV transition was eliminated from the 93 Tc spectrum. The appropriate changes and additions were made in the 93 Tc decay scheme, and three new levels were introduced: 2479.0, 2821.7, and 3025.8 keV. The values of log ft of some levels of 93 Tc were estimated

Recruitment of Hexagenia mayfly nymphs in western Lake Erie linked to environmental variability

Science.gov (United States)

Bridgeman, Thomas B.; Schloesser, Don W.; Krause, Ann E.

2006-01-01

After a 40-year absence caused by pollution and eutrophication, burrowing mayflies (Hexagenia spp.) recolonized western Lake Erie in the mid 1990s as water quality improved. Mayflies are an important food resource for the economically valuable yellow perch fishery and are considered to be major indicator species of the ecological condition of the lake. Since their reappearance, however, mayfly populations have suffered occasional unexplained recruitment failures. In 2002, a failure of fall recruitment followed an unusually warm summer in which western Lake Erie became temporarily stratified, resulting in low dissolved oxygen levels near the lake floor. In the present study, we examined a possible link between Hexagenia recruitment and periods of intermittent stratification for the years 1997-2002. A simple model was developed using surface temperature, wind speed, and water column data from 2003 to predict stratification. The model was then used to detect episodes of stratification in past years for which water column data are unavailable. Low or undetectable mayfly recruitment occurred in 1997 and 2002, years in which there was frequent or extended stratification between June and September. Highest mayfly reproduction in 2000 corresponded to the fewest stratified periods. These results suggest that even relatively brief periods of stratification can result in loss of larval mayfly recruitment, probably through the effects of hypoxia. A trend toward increasing frequency of hot summers in the Great Lakes region could result in recurrent loss of mayfly larvae in western Lake Erie and other shallow areas in the Great Lakes.

Nonlinear convective flow of Powell-Erying magneto nanofluid with Newtonian heating

Directory of Open Access Journals (Sweden)

Sajid Qayyum

Full Text Available Objective of present article is to describe magnetohydrodynamic (MHD non-linear convective flow of Powell-Erying nanofluid over a stretching surface. Characteristics of Newtonian heat and mass conditions in this attempt is given attention. Heat and mass transfer analysis is examined in the frame of thermal radiation and chemical reaction. Brownian motion and thermophoresis concept is introduced due to presence of nanoparticles. Nonlinear equations of momentum, energy and concentration are transformed into dimensionless expression by invoking suitable variables. The series solutions are obtained through homotopy analysis method (HAM. Impact of embedded variables on the velocity, temperature and nanoparticles concentration is graphically presented. Numerical values of skin friction coefficient, local Nusselt and Sherwood numbers are computed and analyzed. It is concluded that velocity field enhances for fluid variable while reverse situation is noticed regarding Hartman number. Temperature and heat transfer rate behave quite reverse for Prandtl number. It is also noted that the concentration and local Sherwood number have opposite behavior in the frame of Brownian motion. Keywords: Powell-Erying nanofluid, Magnetohydrodynamic (MHD, Nonlinear convection, Thermal radiation, Chemical reaction, Newtonian heat and mass conditions

Lake Erie and Lake Michigan zebra mussel settlement monitoring and implications for chlorination treatment

International Nuclear Information System (INIS)

Demoss, D.; Mendelsberg, J.I.

1992-01-01

This paper reports on the 1991 zebra mussel veliger settlement monitoring program undertaken to record and evaluate zebra mussel veliger settlement in Lake Erie and Lake Michigan. Studies by Dr. Gerald Mackie of Canada in 1990 indicated veliger settlement may be occurring primarily during short time periods every season corresponding with warmer water temperatures. Veliger settlement monitoring was performed using a plexiglass sampler apparatus. The samplers were simple in design and consisted of a 20-inch-square plexiglass base panel with thirty-six 1 inch x 3 inch clear plexiglass microscope slides attached. The results of the monitoring program indicate the existence of preferential settlement periods for veligers correlating with sustained lake water temperatures above 70 degrees F. Veliger settlement concentrations in the south basin of Lake Michigan appear to be similar to those in western Lake Erie

In a demanding task, three-handed manipulation is preferred to two-handed manipulation.

Science.gov (United States)

Abdi, Elahe; Burdet, Etienne; Bouri, Mohamed; Himidan, Sharifa; Bleuler, Hannes

2016-02-25

Equipped with a third hand under their direct control, surgeons may be able to perform certain surgical interventions alone; this would reduce the need for a human assistant and related coordination difficulties. However, does human performance improve with three hands compared to two hands? To evaluate this possibility, we carried out a behavioural study on the performance of naive adults catching objects with three virtual hands controlled by their two hands and right foot. The subjects could successfully control the virtual hands in a few trials. With this control strategy, the workspace of the hands was inversely correlated with the task velocity. The comparison of performance between the three and two hands control revealed no significant difference of success in catching falling objects and in average effort during the tasks. Subjects preferred the three handed control strategy, found it easier, with less physical and mental burden. Although the coordination of the foot with the natural hands increased trial after trial, about two minutes of practice was not sufficient to develop a sense of ownership towards the third arm.

77 FR 35860 - Safety Zone; Bay Swim V, Presque Isle Bay, Erie, PA

Science.gov (United States)

2012-06-15

... Yacht Club at position 42[deg]07'21.74'' N, 80[deg]07'58.30'' W (DATUM: NAD 83). Entry into, transiting... extend in a straight line 1,000 feet wide to the Erie Yacht Club at position 42[deg]07'21.74'' N, 80[deg...

78 FR 36662 - Safety Zone; Fairport Harbor Mardi Gras, Lake Erie, Fairport, OH

Science.gov (United States)

2013-06-19

... the Fairport Harbor Mardi Gras Fireworks display. This temporary safety zone is necessary to protect spectators and vessels from the hazards associated with a fireworks display. DATES: This rule is effective...: Temporary final rule. SUMMARY: The Coast Guard is establishing a temporary safety zone on Lake Erie...

Profiles of Wind and Turbulence in the Coastal Atmospheric Boundary Layer of Lake Erie

KAUST Repository

Wang, H; Barthelmie, R J; Crippa, P; Doubrawa, P; Pryor, S C

2014-01-01

Prediction of wind resource in coastal zones is difficult due to the complexity of flow in the coastal atmospheric boundary layer (CABL). A three week campaign was conducted over Lake Erie in May 2013 to investigate wind characteristics and improve

76 FR 65717 - Erie Boulevard Hydropower, L.P.; Notice of Availability of Environmental Assessment

Science.gov (United States)

2011-10-24

... DEPARTMENT OF ENERGY Federal Energy Regulatory Commission [Project No. 2713-082-New York] Erie Boulevard Hydropower, L.P.; Notice of Availability of Environmental Assessment In accordance with the National Environmental Policy Act of 1969 and the Federal Energy Regulatory Commission's (Commission...

Eriçó de mar: Estudi antropològic, geolingüístic i etimològic

Directory of Open Access Journals (Sweden)

Antoni Corcoll Llobet

2013-01-01

Full Text Available   Els objectius bàsics d’aquest treball monogràfic sobre l’eriçó de mar és donar a conèixer els termes genèrics i aquells que fan referència a una o unes espècies en concret d’aquest animal marí, la seva distribució geogràfica, la seva vitalitat i la motivació semàntica o l’etimologia de tots aquests significants. Així mateix, faig esment de possibles castellanismes i d’algunes peculiaritats fonètiques que afecten diversos significants de l’eriçó de mar.

Internal loading of phosphorus in western Lake Erie

Science.gov (United States)

Matisoff, Gerald; Kaltenberg, Eliza M.; Steely, Rebecca L.; Hummel, Stephanie K.; Seo, Jinyu; Gibbons, Kenneth J.; Bridgeman, Thomas B.; Seo, Youngwoo; Behbahani, Mohsen; James, William F.; Johnson, Laura; Doan, Phuong; Dittrich, Maria; Evans, Mary Anne; Chaffin, Justin D.

2016-01-01

This study applied eight techniques to obtain estimates of the diffusive flux of phosphorus (P) from bottom sediments throughout the western basin of Lake Erie. The flux was quantified from both aerobic and anaerobic incubations of whole cores; by monitoring the water encapsulated in bottom chambers; from pore water concentration profiles measured with a phosphate microelectrode, a diffusive equilibrium in thin films (DET) hydrogel, and expressed pore waters; and from mass balance and biogeochemical diagenetic models. Fluxes under aerobic conditions at summertime temperatures averaged 1.35 mg P/m2/day and displayed spatial variability on scales as small as a centimeter. Using two different temperature correction factors, the flux was adjusted to mean annual temperature yielding average annual fluxes of 0.43–0.91 mg P/m2/day and a western basin-wide total of 378–808 Mg P/year as the diffusive flux from sediments. This is 3–7% of the 11,000 Mg P/year International Joint Commission (IJC) target load for phosphorus delivery to Lake Erie from external sources. Using these average aerobic fluxes, the sediment contributes 3.0–6.3 μg P/L as a background internal contribution that represents 20–42% of the IJC Target Concentration of 15 μg P/L for the western basin. The implication is that this internal diffusive recycling of P is unlikely to trigger cyanobacterial blooms by itself but is sufficiently large to cause blooms when combined with external loads. This background flux may be also responsible for delayed response of the lake to any decrease in the external loading.

Validation of hand and foot anatomical feature measurements from smartphone images

Science.gov (United States)

Amini, Mohammad; Vasefi, Fartash; MacKinnon, Nicholas

2018-02-01

A smartphone mobile medical application, previously presented as a tool for individuals with hand arthritis to assess and monitor the progress of their disease, has been modified and expanded to include extraction of anatomical features from the hand (joint/finger width, and angulation) and foot (length, width, big toe angle, and arch height index) from smartphone camera images. Image processing algorithms and automated measurements were validated by performing tests on digital hand models, rigid plastic hand models, and real human hands and feet to determine accuracy and reproducibility compared to conventional measurement tools such as calipers, rulers, and goniometers. The mobile application was able to provide finger joint width measurements with accuracy better than 0.34 (+/-0.25) millimeters. Joint angulation measurement accuracy was better than 0.50 (+/-0.45) degrees. The automatically calculated foot length accuracy was 1.20 (+/-1.27) millimeters and the foot width accuracy was 1.93 (+/-1.92) millimeters. Hallux valgus angle (used in assessing bunions) accuracy was 1.30 (+/-1.29) degrees. Arch height index (AHI) measurements had an accuracy of 0.02 (+/-0.01). Combined with in-app documentation of symptoms, treatment, and lifestyle factors, the anatomical feature measurements can be used by both healthcare professionals and manufacturers. Applications include: diagnosing hand osteoarthritis; providing custom finger splint measurements; providing compression glove measurements for burn and lymphedema patients; determining foot dimensions for custom shoe sizing, insoles, orthotics, or foot splints; and assessing arch height index and bunion treatment effectiveness.

76 FR 46287 - Erie Boulevard Hydropower, L.P.; Notice of Availability of Environmental Assessment

Science.gov (United States)

2011-08-02

... DEPARTMENT OF ENERGY Federal Energy Regulatory Commission [Project No. 2047-049] Erie Boulevard Hydropower, L.P.; Notice of Availability of Environmental Assessment In accordance with the National Environmental Policy Act of 1969 and the Federal Energy Regulatory Commission's (Commission or FERC) regulations...

Involuntary human hand movements due to FM radio waves in a moving van.

Science.gov (United States)

Huttunen, P; Savinainen, A; Hänninen, Osmo; Myllylä, R

2011-06-01

Finland TRACT Involuntary movements of hands in a moving van on a public road were studied to clarify the possible role of frequency modulated radio waves on driving. The signals were measured in a direct 2 km test segment of an international road during repeated drives to both directions. Test subjects (n=4) had an ability to sense radio frequency field intensity variations of the environment. They were sitting in a minivan with arm movement detectors in their hands. A potentiometer was used to register the hand movements to a computer which simultaneously collected data on the amplitude of the RF signal of the local FM tower 30 km distance at a frequency of about 100 MHz. Involuntary hand movements of the test subjects correlated with electromagnetic field, i.e. FM radio wave intensity measured. They reacted also on the place of a geomagnetic anomaly crossing the road, which was found on the basis of these recordings and confirmed by the public geological maps of the area.In conclusion, RF irradiation seems to affect the human hand reflexes of sensitive persons in a moving van along a normal public road which may have significance in traffic safety.

The role of groundwater discharge fluxes on Si:P ratios in a major tributary to Lake Erie.

Science.gov (United States)

Maavara, Taylor; Slowinski, Stephanie; Rezanezhad, Fereidoun; Van Meter, Kimberly; Van Cappellen, Philippe

2018-05-01

Groundwater discharge can be a major source of nutrients to river systems. Although quantification of groundwater nitrate loading to streams is common, the dependence of surface water silicon (Si) and phosphorus (P) concentrations on groundwater sources has rarely been determined. Additionally, the ability of groundwater discharge to drive surface water Si:P ratios has not been contextualized relative to riverine inputs or in-stream transformations. In this study, we quantify the seasonal dynamics of Si and P cycles in the Grand River (GR) watershed, the largest Canadian watershed draining into Lake Erie, to test our hypothesis that regions of Si-rich groundwater discharge increase surface water Si:P ratios. Historically, both the GR and Lake Erie have been considered stoichiometrically P-limited, where the molar Si:P ratio is greater than the ~16:1 phytoplankton uptake ratio. However, recent trends suggest that eastern Lake Erie may be approaching Si-limitation. We sampled groundwater and surface water for dissolved and reactive particulate Si as well as total dissolved P for 12months within and downstream of a 50-km reach of high groundwater discharge. Our results indicate that groundwater Si:P ratios are lower than the corresponding surface water and that groundwater is a significant source of bioavailable P to surface water. Despite these observations, the watershed remains P-limited for the majority of the year, with localized periods of Si-limitation. We further find that groundwater Si:P ratios are a relatively minor driver of surface water Si:P, but that the magnitude of Si and P loads from groundwater represent a large proportion of the overall fluxes to Lake Erie. Copyright © 2017 Elsevier B.V. All rights reserved.

Bringing transcranial mapping into shape: Sulcus-aligned mapping captures motor somatotopy in human primary motor hand area

DEFF Research Database (Denmark)

Raffin, Estelle; Pellegrino, Giovanni; Di Lazzaro, Vincenzo

2015-01-01

Motor representations express some degree of somatotopy in human primary motor hand area (M1HAND), but within-M1HAND corticomotor somatotopy has been difficult to study with transcranial magnetic stimulation (TMS). Here we introduce a “linear” TMS mapping approach based on the individual shape...... of the central sulcus to obtain mediolateral corticomotor excitability profiles of the abductor digiti minimi (ADM) and first dorsal interosseus (FDI) muscles. In thirteen young volunteers, we used stereotactic neuronavigation to stimulate the right M1HAND with a small eight-shaped coil at 120% of FDI resting...

Age and growth of the lake whitefish, Coregonus clupeaformis (Mitchill), in Lake Erie

Science.gov (United States)

Van Oosten, John; Hile, Ralph

1949-01-01

Although the whitefish has by no means ranked first from the standpoint of production, it has always been an important commercial species in Lake Erie. Trends in the output of whitefish have differed in the United States and Canadian waters of the lake. The 1893–1946 average annual yield of 1,201,000 pounds in the United States was only 38.3 percent of the 1879–1890 mean of 3,133,000 pounds, whereas in Canada the more recent (1907–1946) average annual take of 1,397,000 pounds has been 5.48 times the 1871–1906 mean of 255,000 pounds. The United States fishery was centered in the western part of Lake Erie (61.5 percent of the production in Michigan and Ohio) before 1921 and in the eastern part (62.6 percent in Pennsylvania and New York) in 1921–1946. The eastern part of Lake Erie (east of Port Burwell) dominated the Canadian production in 1900–1909 (65.4 percent) and in 1922–1946 (57.2 percent) but the western end was the more productive in 1871–1899 (79.8 percent) and 1910–1921 (69.7 percent). Ages were determined and individual growth histories calculated from the examination and measurement of the scales of 3,399 Lake Erie whitefish captured off four ports (Sandusky, Lorain, and Conneaut, Ohio, and Erie, Pennsylvania) over the period, 1927–1930. The number of specimens used for the investigation of other phases of the life history varied according to the amount of data available or required. Age-group III was typically (but not invariably) dominant in random samples from gear employed for the commercial production of whitefish (trap nets, pound nets, and large-mesh gill nets). The same age group also dominated most samples of the marketable catch (that is, whitefish that equalled or exceeded the minimum legal weight of 1 3/4 pounds) taken in late summer, autumn, and early winter. Age-group IV, however, was strongest among marketable fish from trap nets in early July although the III group was dominant in the random samples from the same nets

Physiological and subjective evaluation of a human-robot object hand-over task.

Science.gov (United States)

Dehais, Frédéric; Sisbot, Emrah Akin; Alami, Rachid; Causse, Mickaël

2011-11-01

In the context of task sharing between a robot companion and its human partners, the notions of safe and compliant hardware are not enough. It is necessary to guarantee ergonomic robot motions. Therefore, we have developed Human Aware Manipulation Planner (Sisbot et al., 2010), a motion planner specifically designed for human-robot object transfer by explicitly taking into account the legibility, the safety and the physical comfort of robot motions. The main objective of this research was to define precise subjective metrics to assess our planner when a human interacts with a robot in an object hand-over task. A second objective was to obtain quantitative data to evaluate the effect of this interaction. Given the short duration, the "relative ease" of the object hand-over task and its qualitative component, classical behavioral measures based on accuracy or reaction time were unsuitable to compare our gestures. In this perspective, we selected three measurements based on the galvanic skin conductance response, the deltoid muscle activity and the ocular activity. To test our assumptions and validate our planner, an experimental set-up involving Jido, a mobile manipulator robot, and a seated human was proposed. For the purpose of the experiment, we have defined three motions that combine different levels of legibility, safety and physical comfort values. After each robot gesture the participants were asked to rate them on a three dimensional subjective scale. It has appeared that the subjective data were in favor of our reference motion. Eventually the three motions elicited different physiological and ocular responses that could be used to partially discriminate them. Copyright © 2011 Elsevier Ltd and the Ergonomics Society. All rights reserved.

Large-scale Watershed Modeling: NHDPlus Resolution with Achievable Conservation Scenarios in the Western Lake Erie Basin

Science.gov (United States)

Yen, H.; White, M. J.; Arnold, J. G.; Keitzer, S. C.; Johnson, M. V. V.; Atwood, J. D.; Daggupati, P.; Herbert, M. E.; Sowa, S. P.; Ludsin, S.; Robertson, D. M.; Srinivasan, R.; Rewa, C. A.

2016-12-01

By the substantial improvement of computer technology, large-scale watershed modeling has become practically feasible in conducting detailed investigations of hydrologic, sediment, and nutrient processes. In the Western Lake Erie Basin (WLEB), water quality issues caused by anthropogenic activities are not just interesting research subjects but, have implications related to human health and welfare, as well as ecological integrity, resistance, and resilience. In this study, the Soil and Water Assessment Tool (SWAT) and the finest resolution stream network, NHDPlus, were implemented on the WLEB to examine the interactions between achievable conservation scenarios with corresponding additional projected costs. During the calibration/validation processes, both hard (temporal) and soft (non-temporal) data were used to ensure the modeling outputs are coherent with actual watershed behavior. The results showed that widespread adoption of conservation practices intended to provide erosion control could deliver average reductions of sediment and nutrients without additional nutrient management changes. On the other hand, responses of nitrate (NO3) and dissolved inorganic phosphorus (DIP) dynamics may be different than responses of total nitrogen and total phosphorus dynamics under the same conservation practice. Model results also implied that fewer financial resources are required to achieve conservation goals if the goal is to achieve reductions in targeted watershed outputs (ex. NO3 or DIP) rather than aggregated outputs (ex. total nitrogen or total phosphorus). In addition, it was found that the model's capacity to simulate seasonal effects and responses to changing conservation adoption on a seasonal basis could provide a useful index to help alleviate additional cost through temporal targeting of conservation practices. Scientists, engineers, and stakeholders can take advantage of the work performed in this study as essential information while conducting policy

Eri prosessointien vaikutus ruusunmarjan c-vitamiinipitoisuuteen : kuumennus, paseeraus ja pakastesäilytys

OpenAIRE

Heikkilä, Raili

2007-01-01

Tämä opinnäytetyön liittyy kotimaisten ruusunmarjojen sekä tuore- ja höyrysoseiden Cvitamiinin säilymiseen eri prosessointimenetelmien ja pakkassäilytyksen aikana. Näytteinä tutkimuksessa olivat kokonaisena poimitut pakastetut ruusunmarjat, tuore pakastettu ruusunmarjasose ja kuumakäsitelty (höyrytetty) ruusunmarjasose. Tutkittavan ruusunmarjan pakastesäilytysaika oli ollut kokonaisuudessaan yksi vuosi. Tutkimus toteutettiin Haapaveden ammattiopistolla. Ruusunmarjan C- vitamiinipitoisuudet an...

Understanding the Atmosphere of 51 Eri b: Do Photochemical Hazes Cloud the Planets Spectrum?

Science.gov (United States)

Marley, Mark Scott; Zahnle, Kevin; Moses, J.; Morley, C.

2015-01-01

The first young giant planet to be discovered by the Gemini Planet Imager was the (is) approximately 2MJ planet 51 Eri b. This approximately 20 Myr old young Jupiter is the first directly imaged planet to show unmistakable methane in H band. To constrain the planet's mass, atmospheric temperature, and composition, the GPI J and H band spectra as well as some limited photometric points were compared to the predictions of substellar atmosphere models. The best fitting models reported in the discovery paper (Macintosh et al. 2015) relied upon a combination of clear and cloudy atmospheric columns to reproduce the data. However for an object as cool as 700 K, the origin of the cloud coverage is somewhat puzzling, as the global silicate and iron clouds would be expected to have sunk well below the photosphere by this effective temperature. While strong vertical mixing in these low gravity atmospheres remains a plausible explanation, we have explored whether atmospheric photochemistry, driven by the UV flux from the primary star, may yield hazes that also influence the observed spectrum of the planet. To explore this possibility we have modeled the atmospheric photochemistry of 51 Eri b using two state-of-the-art photochemical models, both capable of predicting yields of complex hydrocarbons under various atmospheric conditions. In our presentation we will summarize the modeling approach employed to characterize 51 Eri b, explaining constraints on the planet's effective temperature, gravity, and atmospheric composition and also present results of our studies of atmospheric photochemistry. We will discuss whether photochemical hazes could indeed be responsible for the particulate opacity that apparently sculpts the spectrum of the planet.

Perseveration Found in a Human Drawing Task: Six-Fingered Hands Drawn by Patients with Right Anterior Insula and Operculum Damage

Directory of Open Access Journals (Sweden)

Chiharu Niki

2014-01-01

Full Text Available Background. Perseveration has been observed in a number of behavioural contexts, including speaking, writing, and drawing. However, no previous report describes patients who show perseveration only for drawing a human figure. Objective. The present report describes a group of patients who show body awareness-related cognitive impairment during a human figure drawing task, a different presentation from previously described neuropsychological cases. Methods. Participants were 15 patients who had a frontal lobe brain tumour around the insula cortex of the right hemisphere and had subsequently undergone a neurosurgical resective operation. Participants were asked to draw a human figure in both “hands-down” and “hands-up” configurations. Results. Eight of the 15 patients drew a human figure with six fingers during the “hands-up” and the “hands-down” human figure drawing tasks (one patient drew eight fingers. A statistical analysis of potential lesion areas revealed damage to the right anterior frontal insula and operculum in this group of patients relative to the five-finger drawing group. Conclusions. Our findings reveal a newly described neuropsychological phenomenon that could reflect impairment in attention directed towards body representations.

Perseveration Found in a Human Drawing Task: Six-Fingered Hands Drawn by Patients with Right Anterior Insula and Operculum Damage

Science.gov (United States)

Niki, Chiharu; Maruyama, Takashi; Muragaki, Yoshihiro; Kumada, Takatsune

2014-01-01

Background. Perseveration has been observed in a number of behavioural contexts, including speaking, writing, and drawing. However, no previous report describes patients who show perseveration only for drawing a human figure. Objective. The present report describes a group of patients who show body awareness-related cognitive impairment during a human figure drawing task, a different presentation from previously described neuropsychological cases. Methods. Participants were 15 patients who had a frontal lobe brain tumour around the insula cortex of the right hemisphere and had subsequently undergone a neurosurgical resective operation. Participants were asked to draw a human figure in both “hands-down” and “hands-up” configurations. Results. Eight of the 15 patients drew a human figure with six fingers during the “hands-up” and the “hands-down” human figure drawing tasks (one patient drew eight fingers). A statistical analysis of potential lesion areas revealed damage to the right anterior frontal insula and operculum in this group of patients relative to the five-finger drawing group. Conclusions. Our findings reveal a newly described neuropsychological phenomenon that could reflect impairment in attention directed towards body representations. PMID:24876665

A word in the hand: action, gesture and mental representation in humans and non-human primates

Science.gov (United States)

Cartmill, Erica A.; Beilock, Sian; Goldin-Meadow, Susan

2012-01-01

The movements we make with our hands both reflect our mental processes and help to shape them. Our actions and gestures can affect our mental representations of actions and objects. In this paper, we explore the relationship between action, gesture and thought in both humans and non-human primates and discuss its role in the evolution of language. Human gesture (specifically representational gesture) may provide a unique link between action and mental representation. It is kinaesthetically close to action and is, at the same time, symbolic. Non-human primates use gesture frequently to communicate, and do so flexibly. However, their gestures mainly resemble incomplete actions and lack the representational elements that characterize much of human gesture. Differences in the mirror neuron system provide a potential explanation for non-human primates' lack of representational gestures; the monkey mirror system does not respond to representational gestures, while the human system does. In humans, gesture grounds mental representation in action, but there is no evidence for this link in other primates. We argue that gesture played an important role in the transition to symbolic thought and language in human evolution, following a cognitive leap that allowed gesture to incorporate representational elements. PMID:22106432

Evaluation of the Use of Periodicals Collection of the Higher Education Council Documentation and Online Search Center: Arts and Humanities Periodicals YÖK Dokümantasyon ve Uluslararası Bilgi Tarama Merkezi Koleksiyonundaki Sanat ve Beşeri Bilimler Konulu Süreli Yayınların Kullanım Değerlendirmesi

Directory of Open Access Journals (Sweden)

Elçin Özbudak

1995-06-01

Full Text Available Evaluation of the use perodicals collections in libraries is important as perodicals report the results of the latest scientific research and they are usually more expensive than other types of library materials. In this study we evaluate the use of Arts and Humanities periodicals in the collection of the Higher Education Council Documentation Center. Although the use of Arts and Humanities periodicals was found to be lower than, say, Biomedical periodicals collection, the number of journal titles in Arts and Humanities appears to be quite satisfactory. Some suggestions are made so as to increase the use of Arts and Humanities periodicals collection. Bilimsel araştırmalar için en güncel bilgileri veren ve maliyeti diğer materyallere göre daha fazla olan süreli yayınların ne oranda kullanıldığının araştırılması, koleksiyon değerlendirmesi açısından önemlidir. Bu amaçla, Yükseköğretim Kurulu Dokümantasyon ve Uluslararası Bilgi Tarama Merkezi süreli yayınlar koleksiyonunun genel bir değerlendirmesi yapılarak "Sanat ve Beşeri Bilimler" konulu süreli yayınların kullanımları incelenmiş, Yükseköğretim Kurulu Dokümantasyon ve Uluslararası Bilgi Tarama Merkezi 'nde önemli ve büyük bir süreli yayınlar koleksiyonu bulunduğu, "Sanat ve Beşeri Bilimler" konulu süreli yayınların da yeterli olduğu sonuçları çıkartılmıştır. "Sanat ve Beşeri Bilimler" konulu süreli yayınların kullanımlarının nispeten düşük oluşu, bu alanda çalışan araştırmacıların süreli yayınlara yeterince ilgi göstermemelerine bağlanarak, kullanımı artırmak için öneriler getirilmiştir.

Seasonal dynamics in dissolved organic matter, hydrogen peroxide, and cyanobacterial blooms in Lake Erie

Directory of Open Access Journals (Sweden)

Rose M. Cory

2016-04-01

Full Text Available Hydrogen peroxide (H2O2 has been suggested to influence cyanobacterial community structure and toxicity. However, no study has investigated H2O2 concentrations in freshwaters relative to cyanobacterial blooms when sources and sinks of H2O2 may be highly variable. For example, photochemical production of H2O2 from chromophoric dissolved organic matter (CDOM may vary over the course of the bloom with changing CDOM and UV light in the water column, while microbial sources and sinks of H2O2 may change with community biomass and composition. To assess relationships between H2O2 and harmful algal blooms dominated by toxic cyanobacteria in the western basin of Lake Erie, we measured H2O2 weekly at six stations from June – November, 2014 and 2015, with supporting physical, chemical, and biological water quality data. Nine additional stations across the western, eastern, and central basins of Lake Erie were sampled during August and October, 2015. CDOM sources were quantified from the fluorescence fraction of CDOM using parallel factor analysis (PARAFAC. CDOM concentration and source were significantly correlated with specific conductivity, demonstrating that discharge of terrestrially-derived CDOM from rivers can be tracked in the lake. Autochthonous sources of CDOM in the lake increased over the course of the blooms. Concentrations of H2O2 in Lake Erie ranged from 47 ± 16 nM to 1570 ± 16 nM (average of 371 ± 17 nM; n = 225, and were not correlated to CDOM concentration or source, UV light, or estimates of photochemical production of H2O2 by CDOM. Temporal patterns in H2O2 were more closely aligned with bloom dynamics in the lake. In 2014 and 2015, maximum concentrations of H2O2 were observed prior to peak water column respiration and chlorophyll a, coinciding with the onset of the widespread Microcystis blooms in late July. The spatial and temporal patterns in H2O2 concentrations suggested that production and decay of H2O2 from aquatic

77 FR 39638 - Safety Zone; Barbara Harder Wedding Fireworks, Lake Erie, Lake View, NY

Science.gov (United States)

2012-07-05

... environmental risk to health or risk to safety that may disproportionately affect children. 10. Indian Tribal... be held on Lake Erie near Lake View, NY. The Captain of the Port Buffalo has determined that fireworks launched proximate to a gathering of watercraft pose a significant risk to public safety and...

Ion Implantation of In_0.53Ga_0.47As

Energy Technology Data Exchange (ETDEWEB)

Almonte, Marlene Isabel [Univ. of California, Berkeley, CA (United States)

1999-05-01

Studies of the effects of implanation in In_0.53Ga_0.47As due to damage by implantation of Ne⁺ ions and to compensation by implantation of Fe⁺ ions are reported in this thesis.

An automated hand hygiene compliance system is associated with improved monitoring of hand hygiene.

Science.gov (United States)

McCalla, Saungi; Reilly, Maggie; Thomas, Rowena; McSpedon-Rai, Dawn

2017-05-01

Consistent hand hygiene is key to reducing health care-associated infections (HAIs) and assessing compliance with hand hygiene protocols is vital for hospital infection control staff. A new automated hand hygiene compliance system (HHCS) was trialed as an alternative to human observers in an intensive care unit and an intensive care stepdown unit at a hospital facility in the northeastern United States. Using a retrospective cohort design, researchers investigated whether implementation of the HHCS resulted in improved hand hygiene compliance and a reduction in common HAI rates. Pearson χ 2 tests were used to assess changes in compliance, and incidence rate ratios were used to test for significant differences in infection rates. During the study period, the HHCS collected many more hand hygiene events compared with human observers (632,404 vs 480) and ensured that the hospital met its compliance goals (95%+). Although decreases in multidrug-resistant organisms, central line-associated bloodstream infections, and catheter-associated urinary tract infection rates were observed, they represented nonsignificant differences. Human hand hygiene observers may not report accurate measures of compliance. The HHCS is a promising new tool for fine-grained assessment of hand hygiene compliance. Further study is needed to examine the association between the HHCS and HAI rate reduction. Copyright © 2017 Association for Professionals in Infection Control and Epidemiology, Inc. Published by Elsevier Inc. All rights reserved.

Anthropomorphic Robot Hand And Teaching Glove

Science.gov (United States)

Engler, Charles D., Jr.

1991-01-01

Robotic forearm-and-hand assembly manipulates objects by performing wrist and hand motions with nearly human grasping ability and dexterity. Imitates hand motions of human operator who controls robot in real time by programming via exoskeletal "teaching glove". Telemanipulator systems based on this robotic-hand concept useful where humanlike dexterity required. Underwater, high-radiation, vacuum, hot, cold, toxic, or inhospitable environments potential application sites. Particularly suited to assisting astronauts on space station in safely executing unexpected tasks requiring greater dexterity than standard gripper.

[Blast injuries of the hands in precarious health situation].

Science.gov (United States)

Allah, K C; Kossoko, H; Assi Djè Bi Djè, V; Yéo, S; Bonny, R; Richard Kadio, M

2014-06-01

The hands of "blast" resulting from the handling of unstable explosives. Their repercussion is functional and vital in trauma patients. The authors report their experience of care from the hands of blast in precarious health situation. Between 2001 and 2012, 33 hand blasts were supported in 30 injured civilians and military, received emergency, during and after armed conflict. Two women (6.7%) and 28 men (93.3%) were received, including four teenagers (13.3%) and 26 adults (86.7%). During the war, 15 officers weapon (50%) and three civilians (10%) underwent surgery, or 60% of hand injuries. In peacetime, civilians were mostly operated in 33.3% of cases, against 6.7% of cases of agents' weapon. Nineteen hands blast (57.6%) were observed during the war and 14 in peacetime, or 42.4% of cases. The average age was 25.2 years, with extremes of 12 and 50 years. Thirteen left hands (39.4%) and 20 right hands (60.6%) were operated. The lesion concerned all the anatomical structures of the hand. It was unilateral in 27 cases (81.9%) and bilateral in three cases (9.1%). Three types of hand trauma were observed and were as follows: trauma patients with injuries of the hand (18.2%), trauma of severe and isolated proximal hand or finger amputations (75.7%), and trauma of the hand without apparent seriousness (6.1%). The associated lesion was eye (one case), chest (one case), abdominal (five cases). Debridement was performed immediate emergency (93.9%) and delayed (6.1%). The treatment was surgical hemostasis, made mainly of amputations (69.7%) and regularization of digital stumps (12.1%). The repair was performed in 18.2% of cases. One death has been reported in a polytrauma patient with chest blast. Blast injuries of the hand are common in times of war in armed agents. The young people, manual workers and children are paying a heavy price in peacetime. As land mines which affect feet, instable hand grenades are left exposed in nature. In precarious health situation, instead of

Evidence that lake trout served as a buffer against sea lamprey predation on burbot in Lake Erie

Science.gov (United States)

Stapanian, M.A.; Madenjian, C.P.

2007-01-01

The population of burbot Lota lota in Lake Erie recovered during 1986–2003, mainly because of the control of sea lamprey Petromyzon marinus, which began in 1986. Burbot populations continued to grow during 1996–1998, when sea lamprey control was substantially reduced. We calculated mortality parameters for burbot in Lake Erie by estimating age at capture for 2,793 burbot caught in annual gill-net surveys of eastern Lake Erie from 1994 to 2003. Based on catch-curve analysis, annual mortality in Lake Erie during 1994–2003 was estimated as 33%. Annual mortality of the 1992 year-class of burbot was estimated as 30%. The mortality of burbot during the years of reduced sea lamprey control was not different from that during the 3 years preceding reduced control and was significantly lower than that during the entire portion of the time series in which full sea lamprey control was conducted. These results suggest that the reduction in sea lamprey control did not lead to increased burbot mortality. The catch per gill-net lift of large burbot (total length > 600 mm), the size preferred by sea lampreys, was lower than that of adult lake trout Salvelinus namaycush (age 5 and older; total length > 700 mm) before lampricide application was reduced. Although adult lake trout populations declined, the abundance of large burbot did not change during the period of reduced lampricide application. These results support a hypothesis that a healthy population of adult lake trout can serve as a buffer species, acting to reduce predation of burbot by sea lampreys when sea lamprey populations increase. Burbot attained sexual maturity at a relatively early age (3 or 4 years) and a total length (approximately 500 mm) that was smaller than the preferred prey size for sea lampreys. These characteristics and the buffering effect of the lake trout population enabled growth of the burbot population during the brief period when lamprey control was reduced.

Learning robotic eye-arm-hand coordination from human demonstration: a coupled dynamical systems approach.

Science.gov (United States)

Lukic, Luka; Santos-Victor, José; Billard, Aude

2014-04-01

We investigate the role of obstacle avoidance in visually guided reaching and grasping movements. We report on a human study in which subjects performed prehensile motion with obstacle avoidance where the position of the obstacle was systematically varied across trials. These experiments suggest that reaching with obstacle avoidance is organized in a sequential manner, where the obstacle acts as an intermediary target. Furthermore, we demonstrate that the notion of workspace travelled by the hand is embedded explicitly in a forward planning scheme, which is actively involved in detecting obstacles on the way when performing reaching. We find that the gaze proactively coordinates the pattern of eye-arm motion during obstacle avoidance. This study provides also a quantitative assessment of the coupling between the eye-arm-hand motion. We show that the coupling follows regular phase dependencies and is unaltered during obstacle avoidance. These observations provide a basis for the design of a computational model. Our controller extends the coupled dynamical systems framework and provides fast and synchronous control of the eyes, the arm and the hand within a single and compact framework, mimicking similar control system found in humans. We validate our model for visuomotor control of a humanoid robot.

Shape-estimation of human hand using polymer flex sensor and study of its application to control robot arm

International Nuclear Information System (INIS)

Lee, Jin Hyuck; Kim, Dae Hyun

2015-01-01

Ultrasonic inspection robot systems have been widely researched and developed for the real-time monitoring of structures such as power plants. However, an inspection robot that is operated in a simple pattern has limitations in its application to various structures in a plant facility because of the diverse and complicated shapes of the inspection objects. Therefore, accurate control of the robot is required to inspect complicated objects with high-precision results. This paper presents the idea that the shape and movement information of an ultrasonic inspector's hand could be profitably utilized for the accurate control of robot. In this study, a polymer flex sensor was applied to monitor the shape of a human hand. This application was designed to intuitively control an ultrasonic inspection robot. The movement and shape of the hand were estimated by applying multiple sensors. Moreover, it was successfully shown that a test robot could be intuitively controlled based on the shape of a human hand estimated using polymer flex sensors.

Shape-estimation of human hand using polymer flex sensor and study of its application to control robot arm

Energy Technology Data Exchange (ETDEWEB)

Lee, Jin Hyuck; Kim, Dae Hyun [Seoul National University of Technology, Seoul (Korea, Republic of)

2015-02-15

Ultrasonic inspection robot systems have been widely researched and developed for the real-time monitoring of structures such as power plants. However, an inspection robot that is operated in a simple pattern has limitations in its application to various structures in a plant facility because of the diverse and complicated shapes of the inspection objects. Therefore, accurate control of the robot is required to inspect complicated objects with high-precision results. This paper presents the idea that the shape and movement information of an ultrasonic inspector's hand could be profitably utilized for the accurate control of robot. In this study, a polymer flex sensor was applied to monitor the shape of a human hand. This application was designed to intuitively control an ultrasonic inspection robot. The movement and shape of the hand were estimated by applying multiple sensors. Moreover, it was successfully shown that a test robot could be intuitively controlled based on the shape of a human hand estimated using polymer flex sensors.

The hand of Homo naledi

Science.gov (United States)

Kivell, Tracy L.; Deane, Andrew S.; Tocheri, Matthew W.; Orr, Caley M.; Schmid, Peter; Hawks, John; Berger, Lee R.; Churchill, Steven E.

2015-01-01

A nearly complete right hand of an adult hominin was recovered from the Rising Star cave system, South Africa. Based on associated hominin material, the bones of this hand are attributed to Homo naledi. This hand reveals a long, robust thumb and derived wrist morphology that is shared with Neandertals and modern humans, and considered adaptive for intensified manual manipulation. However, the finger bones are longer and more curved than in most australopiths, indicating frequent use of the hand during life for strong grasping during locomotor climbing and suspension. These markedly curved digits in combination with an otherwise human-like wrist and palm indicate a significant degree of climbing, despite the derived nature of many aspects of the hand and other regions of the postcranial skeleton in H. naledi. PMID:26441219

75 FR 30319 - Endangered and Threatened Wildlife and Plants; Proposed Rule to remove the Lake Erie Watersnake...

Science.gov (United States)

2010-06-01

... frost level, in cracks or crevices in the bedrock, interstitial spaces of rocky substrates, tree roots... actions that will be undertaken on each island property to avoid injury and harm to the Lake Erie...

Regulation of CD93 cell surface expression by protein kinase C isoenzymes.

Science.gov (United States)

Ikewaki, Nobunao; Kulski, Jerzy K; Inoko, Hidetoshi

2006-01-01

Human CD93, also known as complement protein 1, q subcomponent, receptor (C1qRp), is selectively expressed by cells with a myeloid lineage, endothelial cells, platelets, and microglia and was originally reported to be involved in the complement protein 1, q subcomponent (C1q)-mediated enhancement of phagocytosis. The intracellular molecular events responsible for the regulation of its expression on the cell surface, however, have not been determined. In this study, the effect of protein kinases in the regulation of CD93 expression on the cell surface of a human monocyte-like cell line (U937), a human NK-like cell line (KHYG-1), and a human umbilical vein endothelial cell line (HUV-EC-C) was investigated using four types of protein kinase inhibitors, the classical protein kinase C (cPKC) inhibitor Go6976, the novel PKC (nPKC) inhibitor Rottlerin, the protein kinase A (PKA) inhibitor H-89 and the protein tyrosine kinase (PTK) inhibitor herbimycin A at their optimum concentrations for 24 hr. CD93 expression was analyzed using flow cytometry and glutaraldehyde-fixed cellular enzyme-linked immunoassay (EIA) techniques utilizing a CD93 monoclonal antibody (mAb), mNI-11, that was originally established in our laboratory as a CD93 detection probe. The nPKC inhibitor Rottlerin strongly down-regulated CD93 expression on the U937 cells in a dose-dependent manner, whereas the other inhibitors had little or no effect. CD93 expression was down-regulated by Go6976, but not by Rottlerin, in the KHYG-1 cells and by both Rottlerin and Go6976 in the HUV-EC-C cells. The PKC stimulator, phorbol myristate acetate (PMA), strongly up-regulated CD93 expression on the cell surface of all three cell-lines and induced interleukin-8 (IL-8) production by the U937 cells and interferon-gamma (IFN-gamma) production by the KHYG-1 cells. In addition, both Go6976 and Rottlerin inhibited the up-regulation of CD93 expression induced by PMA and IL-8 or IFN-gamma production in the respective cell

77 FR 24880 - Safety Zone; Jet Express Triathlon, Sandusky Bay, Lake Erie, Lakeside, OH

Science.gov (United States)

2012-04-26

... the Federal Register. Background and Purpose The organization Endurance Sports Productions is... safety zone would encompass all waters of Lake Erie within a direct line from 41-33'-49'' N, 082-47-8'' W to 41-33'- 25'' N, 82-48'-8'' W and 15 yards on either side of direct line. All geographic...

21 CFR 110.93 - Warehousing and distribution.

Science.gov (United States)

2010-04-01

...) FOOD FOR HUMAN CONSUMPTION CURRENT GOOD MANUFACTURING PRACTICE IN MANUFACTURING, PACKING, OR HOLDING... microbial contamination as well as against deterioration of the food and the container. ... 21 Food and Drugs 2 2010-04-01 2010-04-01 false Warehousing and distribution. 110.93 Section 110...

76 FR 12103 - Erie Boulevard Hydropower, L.P; Notice of Settlement Agreement and Soliciting Comments

Science.gov (United States)

2011-03-04

... Hydropower, L.P; Notice of Settlement Agreement and Soliciting Comments Take notice that the following... Boulevard Hydropower, L.P. e. Location: The existing multi-development project is located on the Oswegatchie... 791 (a)-825(r) h. Applicant Contact: Daniel Daoust, Erie Boulevard Hydropower, 33 West 1st Street...

77 FR 50923 - Safety Zone; Jet Express Triathlon, Sandusky Bay, Lake Erie, Lakeside, OH

Science.gov (United States)

2012-08-23

... fireworks display. B. Basis and Purpose The organization Endurance Sports Productions is sponsoring a... waters of Lake Erie within a direct line from 41[deg]33'49'' N, 082[deg]47'8'' W to 41[deg]33'25'' N, 82[deg]48'8'' W and 15 yards on either side of direct line. All geographic coordinates are North American...

A biometric authentication model using hand gesture images.

Science.gov (United States)

Fong, Simon; Zhuang, Yan; Fister, Iztok; Fister, Iztok

2013-10-30

A novel hand biometric authentication method based on measurements of the user's stationary hand gesture of hand sign language is proposed. The measurement of hand gestures could be sequentially acquired by a low-cost video camera. There could possibly be another level of contextual information, associated with these hand signs to be used in biometric authentication. As an analogue, instead of typing a password 'iloveu' in text which is relatively vulnerable over a communication network, a signer can encode a biometric password using a sequence of hand signs, 'i' , 'l' , 'o' , 'v' , 'e' , and 'u'. Subsequently the features from the hand gesture images are extracted which are integrally fuzzy in nature, to be recognized by a classification model for telling if this signer is who he claimed himself to be, by examining over his hand shape and the postures in doing those signs. It is believed that everybody has certain slight but unique behavioral characteristics in sign language, so are the different hand shape compositions. Simple and efficient image processing algorithms are used in hand sign recognition, including intensity profiling, color histogram and dimensionality analysis, coupled with several popular machine learning algorithms. Computer simulation is conducted for investigating the efficacy of this novel biometric authentication model which shows up to 93.75% recognition accuracy.

75 FR 71122 - Erie Boulevard Hydropower L.P.; Notice of Scoping Meetings and Environmental Site Review

Science.gov (United States)

2010-11-22

... DEPARTMENT OF ENERGY Federal Energy Regulatory Commission [Project No. 7518-012--New York] Erie Boulevard Hydropower L.P.; Notice of Scoping Meetings and Environmental Site Review November 15, 2010. Commission staff will be conducting two public scoping meetings and an environmental site review in support...

Early Pleistocene human hand phalanx from the Sima del Elefante (TE) cave site in Sierra de Atapuerca (Spain).

Science.gov (United States)

Lorenzo, Carlos; Pablos, Adrián; Carretero, José Miguel; Huguet, Rosa; Valverdú, Josep; Martinón-Torres, María; Arsuaga, Juan Luis; Carbonell, Eudald; Bermúdez de Castro, José María

2015-01-01

In this study, a new Early Pleistocene proximal hand phalanx (ATE9-2) from the Sima del Elefante cave site (TE - Sierra de Atapuerca, Spain), ascribed to Homo sp., is presented and comparatively described in the context of the evolution of the genus Homo. The ATE9-2 specimen is especially important because of the paucity of hand bones in the human fossil record during the Early Pleistocene. The morphological and metrical analyses of the phalanx ATE9-2 indicate that there are no essential differences between it and comparator fossil specimens for the genus Homo after 1.3 Ma (millions of years ago). Similar to Sima de los Huesos and Neandertal specimens, ATE9-2 is a robust proximal hand phalanx, probably reflecting greater overall body robusticity in these populations or a higher gracility in modern humans. The age of level TE9 from Sima del Elefante and morphological and metrical studies of ATE9-2 suggest that the morphology of the proximal hand phalanges and, thus, the morphology of the hand could have remained stable over the last 1.2-1.3 Ma. Taking into account the evidence recently provided by a metacarpal from Kaitio (Kenya) from around 1.42 Ma, we argue that modern hand morphology is present in the genus Homo subsequent to Homo habilis. Copyright © 2014 Elsevier Ltd. All rights reserved.

The Inner 25 au Debris Distribution in the ϵ Eri System

Energy Technology Data Exchange (ETDEWEB)

Su, Kate Y. L.; Rieke, George H.; Ballering, Nicholas P. [Steward Observatory, University of Arizona, 933 N Cherry Avenue, Tucson, AZ 85721 (United States); De Buizer, James M.; Vacca, William D. [SOFIA-USRA, NASA Ames Research Center, MS 232-12, Moffett Field, CA 94035 (United States); Krivov, Alexander V.; Löhne, Torsten [Astrophysikalisches Institut und Universitätssternwarte, Friedrich-Schiller-Universität Jena, Schillergäßchen 2–3, D-07745 Jena (Germany); Marengo, Massimo [Department of Physics and Astronomy, Iowa State University, Ames, IA 50011 (United States); Stapelfeldt, Karl R. [Jet Propulsion Laboratory, California Institute of Technology, 4800 Oak Grove Drive, Pasadena, CA 91109 (United States)

2017-05-01

Debris disk morphology is wavelength dependent due to the wide range of particle sizes and size-dependent dynamics influenced by various forces. Resolved images of nearby debris disks reveal complex disk structures that are difficult to distinguish from their spectral energy distributions. Therefore, multi-wavelength resolved images of nearby debris systems provide an essential foundation to understand the intricate interplay between collisional, gravitational, and radiative forces that govern debris disk structures. We present the Stratospheric Observatory for Infrared Astronomy (SOFIA) 35 μ m resolved disk image of ϵ Eri, the closest debris disk around a star similar to the early Sun. Combining with the Spitzer resolved image at 24 μ m and 15–38 μ m excess spectrum, we examine two proposed origins of the inner debris in ϵ Eri: (1) in situ planetesimal belt(s) and (2) dragged-in grains from the cold outer belt. We find that the presence of in situ dust-producing planetesmial belt(s) is the most likely source of the excess emission in the inner 25 au region. Although a small amount of dragged-in grains from the cold belt could contribute to the excess emission in the inner region, the resolution of the SOFIA data is high enough to rule out the possibility that the entire inner warm excess results from dragged-in grains, but not enough to distinguish one broad inner disk from two narrow belts.

Concentrations and trophic magnification of cyclic siloxanes in aquatic biota from the Western Basin of Lake Erie, Canada

International Nuclear Information System (INIS)

McGoldrick, Daryl J.; Chan, Cecilia; Drouillard, Ken G.; Keir, Michael J.; Clark, Mandi G.; Backus, Sean M.

2014-01-01

We examine the concentrations and food web biomagnification of three cyclic volatile methylsiloxanes (cVMS) octamethylcyclotetrasiloxane (D4), decamethylcyclopentasiloxane (D5), and dodecamethylcyclohexasiloxane (D6) using aquatic biota collected from Lake Erie. Concentrations of cVMS in biota were within the range reported for other studies of cVMS in aquatic biota. Trophic magnification factors (TMF) were assessed in various food web configurations to investigate the effects of food web structure. TMF estimates were highly dependent on the inclusion/exclusion of the organisms occupying the highest and lowest trophic levels and were >1 for D4 and D5, indicating biomagnification, in only 1 of the 5 food web configurations investigated and were <1 in the remaining 4 food web configurations. TMF estimates for PCB180 were also dependant on food web configuration, but did not correspond with those obtained for cVMS materials. These differences may be attributed to environmental exposure and/or lipid partitioning differences between PCB180 and cVMS. -- Highlights: • We investigated trophic magnification of siloxanes in aquatic biota from Lake Erie. • Trophic magnification estimates were variable and sensitive to food web structure. • Lipid partitioning of siloxanes and PCBs differ and may contribute to variability. -- Biomagnification estimates for siloxanes in Lake Erie are sensitive to food web structure, contaminant exposure pathways, and lipid partitioning differences between PCBs and siloxanes

Development of five-finger robotic hand using master-slave control for hand-assisted laparoscopic surgery.

Science.gov (United States)

Yoshida, Koki; Yamada, Hiroshi; Kato, Ryu; Seki, Tatsuya; Yokoi, Hiroshi; Mukai, Masaya

2016-08-01

This study aims to develop a robotic hand as a substitute for a surgeon's hand in hand-assisted laparoscopic surgery (HALS). We determined the requirements for the proposed hand from a surgeon's motions in HALS. We identified four basic behaviors: "power grasp," "precision grasp," "open hand for exclusion," and "peace sign for extending peritoneum." The proposed hand had the minimum necessary DOFs for performing these behaviors, five fingers as in a human's hand, a palm that can be folded when a surgeon inserts the hand into the abdomen, and an arm for adjusting the hand's position. We evaluated the proposed hand based on a performance test and a physician's opinions, and we confirmed that it can grasp organs.

ORF Alignment: NC_002655 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available ery: 34 ... QAGVVVGGTRFIFPADRESISILLTNTSQESWLINRKINRPTRWAGGEASTVXXXXXXXX 93 ... QAGVVVGGTRFIFPADRESISILLTNTSQESWL...INRKINRPTRWAGGEASTV ... Sbjct: 1 ... QAGVVVGGTRFIFPADRESISILLTNTSQESWL

77 FR 40266 - Safety Zone; Conneaut 4th of July Festival, Lake Erie, Conneaut, OH

Science.gov (United States)

2012-07-09

... 1625-AA00 Safety Zone; Conneaut 4th of July Festival, Lake Erie, Conneaut, OH AGENCY: Coast Guard, DHS... the Conneaut 4th of July Festival Fireworks display. This temporary safety zone is necessary to... vessels during the Conneaut 4th of July Festival Fireworks. This zone will be effective and enforced from...

3D Printed Robotic Hand

Science.gov (United States)

Pizarro, Yaritzmar Rosario; Schuler, Jason M.; Lippitt, Thomas C.

2013-01-01

Dexterous robotic hands are changing the way robots and humans interact and use common tools. Unfortunately, the complexity of the joints and actuations drive up the manufacturing cost. Some cutting edge and commercially available rapid prototyping machines now have the ability to print multiple materials and even combine these materials in the same job. A 3D model of a robotic hand was designed using Creo Parametric 2.0. Combining "hard" and "soft" materials, the model was printed on the Object Connex350 3D printer with the purpose of resembling as much as possible the human appearance and mobility of a real hand while needing no assembly. After printing the prototype, strings where installed as actuators to test mobility. Based on printing materials, the manufacturing cost of the hand was $167, significantly lower than other robotic hands without the actuators since they have more complex assembly processes.

In vivo assessment of magnesium status in human body using accelerator-based neutron activation measurement of hands: A pilot study

International Nuclear Information System (INIS)

Aslam; Pejovic-Milic, A.; McNeill, F. E.; Byun, S. H.; Prestwich, W. V.; Chettle, D. R.

2008-01-01

Magnesium (Mg) is an element essential for many enzymatic reactions in the human body. Various human and animal studies suggest that changes in Mg status are linked to diseases such as cardiac arrhythmia, coronary heart disease, hypertension, premenstrual syndrome, and diabetes mellitus. Thus, knowledge of Mg levels in the human body is needed. A direct measurement of human blood serum, which contains only 0.3% of the total body Mg, is generally used to infer information about the status of Mg in the body. However, in many clinical situations, Mg stored in large levels, for example in bones, muscles, and soft tissues, needs to be monitored either to evaluate the efficacy of a treatment or to study the progression of diseases associated with the deficiency of total body Mg. This work presents a feasibility study of a noninvasive, in vivo neutron activation analysis (IVNAA) technique using the 26 Mg(n,γ) 27 Mg reaction to measure Mg levels in human hands. The technique employs the McMaster University high beam current Tandetron accelerator hand irradiation facility and an array of eight NaI (T1) detectors arranged in a 4π geometry for delayed counting of the 0.844 and 1.014 MeV gamma rays emitted when 27 Mg decays in the irradiated hand. Mg determination in humans using IVNAA of hands has been demonstrated to be feasible, with effective doses as low as one-quarter of those delivered in chest x rays. The overall experimental uncertainty in the measurements is estimated to be approximately 5% (1σ). The results are found to be in the range of the in vitro measurements reported for other cortical bones collected from different sites of the human skeleton, which confirms that this technique mainly provides a measure of the amount of Mg in hand bones. The average concentration of Mg determined in human hands is 10.96±1.25 (±1 SD) mg Mg/g Ca. The coefficient of variation (11%) observed in this study is comparable with or lower than several studies using in vitro

Using water quality to assess ecological condition in the St. Marys River and Huron-Erie Corridor

Science.gov (United States)

The St. Marys River and Huron-Erie-Corridor were assessed by EPA for the first time in 2014-2016 as part of the National Coastal Condition Assessment (NCCA). NCCA uses a probabilistic survey design to allow unbiased assessment of ecological condition across the entire Great Lakes...

Are human hands and feet affected by climate? A test of Allen's rule.

Science.gov (United States)

Betti, Lia; Lycett, Stephen J; von Cramon-Taubadel, Noreen; Pearson, Osbjorn M

2015-09-01

In recent years, several studies have shown that populations from cold, high-latitude regions tend to have relatively shorter limbs than populations from tropical regions, with most of the difference due to the relative length of the zeugopods (i.e., radius, ulna, tibia, fibula). This pattern has been explained either as the consequence of long-term climatic selection or of phenotypic plasticity, with temperature having a direct effect on bone growth during development. The aims of this study were to test whether this pattern of intra-limb proportions extended to the bones of the hands and feet, and to determine whether the pattern remained significant after taking into account the effects of neutral evolutionary processes related to population history. Measurements of the limb bones, including the first metatarsal and metacarpal, were collected for 393 individuals from 10 globally distributed human populations. The relationship between intra-limb indices and minimum temperature was tested using generalized least squares regression, correcting for spatial autocorrelation. The results confirmed previous observations of a temperature-related gradient in intra-limb proportions, even accounting for population history. This pattern extends to the hands, with populations from cold regions displaying a relatively shorter and stockier first metacarpal; however, the first metatarsal appears to be wider but not shorter in cold-adapted populations. The results suggest that climatic adaptation played a role in shaping variation in limb proportions between human populations. The different patterns shown by the hands and feet might be due to the presence of evolutionary constraints on the foot to maintain efficient bipedal locomotion. © 2015 Wiley Periodicals, Inc.

Mental rotation of anthropoid hands: a chronometric study

Directory of Open Access Journals (Sweden)

L.G. Gawryszewski

2007-03-01

Full Text Available It has been shown that mental rotation of objects and human body parts is processed differently in the human brain. But what about body parts belonging to other primates? Does our brain process this information like any other object or does it instead maximize the structural similarities with our homologous body parts? We tried to answer this question by measuring the manual reaction time (MRT of human participants discriminating the handedness of drawings representing the hands of four anthropoid primates (orangutan, chimpanzee, gorilla, and human. Twenty-four right-handed volunteers (13 males and 11 females were instructed to judge the handedness of a hand drawing in palm view by pressing a left/right key. The orientation of hand drawings varied from 0º (fingers upwards to 90º lateral (fingers pointing away from the midline, 180º (fingers downwards and 90º medial (finger towards the midline. The results showed an effect of rotation angle (F(3, 69 = 19.57, P < 0.001, but not of hand identity, on MRTs. Moreover, for all hand drawings, a medial rotation elicited shorter MRTs than a lateral rotation (960 and 1169 ms, respectively, P < 0.05. This result has been previously observed for drawings of the human hand and related to biomechanical constraints of movement performance. Our findings indicate that anthropoid hands are essentially equivalent stimuli for handedness recognition. Since the task involves mentally simulating the posture and rotation of the hands, we wondered if "mirror neurons" could be involved in establishing the motor equivalence between the stimuli and the participants' own hands.

Growth, reproduction, mortality, distribution, and biomass of freshwater drum in Lake Erie

Science.gov (United States)

Bur, Michael T.

1984-01-01

Predominant age-groups in the Lake Erie freshwater drum Aplodinotus grunnienspopulation were 3, 4, and 5 as determined from gill net, trap net, bottom trawl, and midwater trawl samples. Age and growth calculations indicated that females grew faster than males. However, the length-weight relation did not differ between sexes and was described by the equation: log W = −5.4383 + 3.1987 log L. Some males became sexually mature at age 2 and all were mature by age 6. Females matured 1 year later than males. Three sizes of eggs were present in ovaries; the average total number was 127,000 per female for 20 females over a length range of 270 to 478 mm. Seasonal analysis of the ovary-body weight ratio indicated that spawning extended from June to August. A total annual mortality rate of 49% for drum aged 4 through 11 was derived from catch-curve analysis. Freshwater drum were widely distributed throughout Lake Erie in 1977–1979, the greatest concentration being in the western basin. They moved into warm, shallow water (less than 10 m deep) during summer, and returned to deeper water in late fall. Summer biomass estimates for the western basin, based on systematic surveys with bottom trawls, were 9,545 t in 1977 and 2,333 t in 1978.

The application of force-sensing resistor sensors for measuring forces developed by the human hand.

Science.gov (United States)

Nikonovas, A; Harrison, A J L; Hoult, S; Sammut, D

2004-01-01

Most attempts to measure forces developed by the human hand have been implemented by placing force sensors on the object of interaction. Other researchers have placed sensors just on the subject's fingertips. In this paper, a system is described that measures forces over the entire hand using thin-film sensors and associated electronics. This system was developed by the authors and is able to obtain force readings from up to 60 thin-film sensors at rates of up to 400 samples/s per sensor. The sensors can be placed anywhere on the palm and/or fingers of the hand. The sensor readings, together with a video stream containing information about hand posture, are logged into a portable computer using a multiplexer, analogue-to-digital converter and software developed for the purpose. The system has been successfully used to measure forces involved in a range of everyday tasks such as driving a vehicle, lifting saucepans and hitting a golf ball. In the latter case, results are compared with those from an instrumented golf club. Future applications include the assessment of hand strength following disease, trauma or surgery, and to enable quantitative ergonomic investigations.

Analysis of alcohol-based hand sanitizer delivery systems: efficacy of foam, gel, and wipes against influenza A (H1N1) virus on hands.

Science.gov (United States)

Larson, Elaine L; Cohen, Bevin; Baxter, Kathleen A

2012-11-01

Minimal research has been published evaluating the effectiveness of hand hygiene delivery systems (ie, rubs, foams, or wipes) at removing viruses from hands. The purposes of this study were to determine the effect of several alcohol-based hand sanitizers in removing influenza A (H1N1) virus, and to compare the effectiveness of foam, gel, and hand wipe products. Hands of 30 volunteers were inoculated with H1N1 and randomized to treatment with foam, gel, or hand wipe applied to half of each volunteer's finger pads. The log(10) count of each subject's treated and untreated finger pads were averaged. Log(10) reductions were calculated from these differences and averaged within treatment group. Between-treatment analysis compared changes from the untreated finger pads using analysis of covariance with treatment as a factor and the average log(10) untreated finger pads as the covariate. Log(10) counts on control finger pads were 2.7-5.3 log(10) of the 50% infectious dose for tissue culture (TCID(50)/0.1 mL) (mean, 3.8 ± 0.5 log(10) TCID(50)/0.1 mL), and treated finger pad counts for all test products were 0.5-1.9 log(10) TCID(50)/0.1 mL (mean, 0.53 ± 0.17 log(10) TCID(50)/0.1 mL). Treatments with all products resulted in a significant reduction in viral titers (>3 logs) at their respective exposure times that were statistically comparable. All 3 delivery systems (foam, gel, and wipe) produced significantly reduced viral counts on hands. Copyright © 2012 Association for Professionals in Infection Control and Epidemiology, Inc. Published by Mosby, Inc. All rights reserved.

Internet, Electronic Libraries, and Information Retrieval Internet, Elektronik Kütüphaneler ve Bilgi Erişim

Directory of Open Access Journals (Sweden)

Yaşar Tonta

1996-09-01

Full Text Available The number of information systems that are accessible through the Internet is constantly increasing. Information systems on those systems are getting varied and occupy more space, too. Up until a few years ago, only textual information sources were accessible via computer networks, whereas today multimedia information sources containing graphics, sound, pictures, and animation are also accessible over the Internet. Geographic information systems, electronic libraries, film and TV archives can he given as examples of multimedia information sources, We point out that information retrieval should he seen as an integral component of the computer networks, and technological, economic, and legal problems in this field should he solved. We end up with what should he done to improve the library and information services that arc accessible through the Internet in Turkey. Günümüzde Internet aracılığıyla erişilebilen bilgi sistemlerinin sayısı hızla artmaktadır. Bu sistemler üzerindeki bilgi kaynakları da giderek çeşitlenmekte ve daha fazla yer kaplamaktadır. Yakın zamana dek bilgisayar ağları aracılığıyla çoğunlukla metin (text türü bilgilere erişim sağlanabilirken, günümüzde grafik, ses, görüntü, canlandırma ve diğer görsel-işitsel veriler içeren çokluortam (multimedia türü bilgiler de Internet üzerinde hizmete sunulabilmektedir. Coğrafik bilgi sistemleri, elektronik kütüphaneler, film ve TV arşivleri bu tür bilgilere örnek olarak gösterilebilir. Bu makalede Internet aracılığıyla bilgi erişim ve bilgi keşfetmede karşılaşılan sorunlar incelenmekte ve sayıca giderek artan ve çeşitlenen bilgi kaynaklarına erişimi kolaylaştırmak için yapılması gerekenler kısaca özetlenmektedir. Sonuç olarak bilgi erişimin, büyük paralar ve entellektüel çabalar harcanarak kurulan bilgisayar ağlarının bir parçası olarak görülmesi gerektiğine işaret edilerek bu alandaki teknolojik

Longshore water-current velocity and the potential for transport of contaminants—A pilot study in Lake Erie from Walnut Creek to Presque Isle State Park beaches, Erie, Pennsylvania, June and August 2015

Science.gov (United States)

Hittle, Elizabeth A.

2017-04-20

Bacteria-driven restrictions and (or) advisories on swimming at beaches in Presque Isle State Park (PISP), Erie, Pennsylvania, can occur during the summer months. One of the suspected sources of bacteria is sediment. A terrestrial sediment source to the west of PISP is Walnut Creek, which discharges to Lake Erie about 8.5 kilometers southwest of PISP Beach 1. On June 24, June 25, August 18, and August 19, 2015, synoptic surveys were conducted by the U.S. Geological Survey, in cooperation with the Pennsylvania Sea Grant, in Lake Erie between Walnut Creek and PISP Beach 1 to characterize the water-current velocity and direction to determine whether sediment from Walnut Creek could be affecting the PISP beaches. Water-quality data (temperature, specific conductance, and turbidity) were collected in conjunction with the synoptic surveys in June. Water-quality data (Escherichia coli [E. coli] bacteria, temperature, and turbidity) were collected about a meter from the shore (nearshore) on June 24, August 19, and after a precipitation event on August 11, 2015. Additionally, suspended sediment was collected nearshore on June 24 and August 11, 2015. Samples collected near Walnut Creek during all three bacterial sampling events contained higher counts than other samples. Counts steadily decreased from west to east, then increased about 1–2 kilometers from PISP Beach 1; however, this study was not focused on examining other potential sources of bacteria.The Velocity Mapping Toolbox (VMT) was used to process the water-current synoptic surveys, and the results were visualized within ArcMap. For the survey accomplished on June 24, 2015, potential paths a particle could take between Walnut Creek and PSIP Beach 1 if conditions remained steady over a number of hours were visualized. However, the water-current velocity and direction were variable from one day to the other, indicating this was likely an unrealistic assumption for the study area. This analysis was not accomplished

Monte Carlo simulation of neutron irradiation facility developed for accelerator based in vivo neutron activation measurements in human hand bones

International Nuclear Information System (INIS)

Aslam; Prestwich, W.V.; McNeill, F.E.; Waker, A.J.

2006-01-01

The neutron irradiation facility developed at the McMaster University 3 MV Van de Graaff accelerator was employed to assess in vivo elemental content of aluminum and manganese in human hands. These measurements were carried out to monitor the long-term exposure of these potentially toxic trace elements through hand bone levels. The dose equivalent delivered to a patient during irradiation procedure is the limiting factor for IVNAA measurements. This article describes a method to estimate the average radiation dose equivalent delivered to the patient's hand during irradiation. The computational method described in this work augments the dose measurements carried out earlier [Arnold et al., 2002. Med. Phys. 29(11), 2718-2724]. This method employs the Monte Carlo simulation of hand irradiation facility using MCNP4B. Based on the estimated dose equivalents received by the patient hand, the proposed irradiation procedure for the IVNAA measurement of manganese in human hands [Arnold et al., 2002. Med. Phys. 29(11), 2718-2724] with normal (1 ppm) and elevated manganese content can be carried out with a reasonably low dose of 31 mSv to the hand. Sixty-three percent of the total dose equivalent is delivered by non-useful fast group (>10 keV); the filtration of this neutron group from the beam will further decrease the dose equivalent to the patient's hand

Detection of Potential Shallow Aquifer Using Electrical Resistivity Imaging (ERI) at UTHM Campus, Johor Malaysia

Science.gov (United States)

Izzaty Riwayat, Akhtar; Nazri, Mohd Ariff Ahmad; Hazreek Zainal Abidin, Mohd

2018-04-01

In recent years, Electrical Resistivity Imaging (ERI) has become part of important method in preliminary stage as to gain more information in indicate the hidden water in underground layers. The problem faces by engineers is to determine the exact location of groundwater zone in subsurface layers. ERI seen as the most suitable tools in exploration of groundwater as this method have been applied in geotechnical and geo-environment investigation. This study was conducted using resistivity at UTHM campus to interpret the potential shallow aquifer and potential location for borehole as observation well. A Schlumberger array was setup during data acquisition as this array is capable in imaging deeper profile data and suitable for areas with homogeneous layer. The raw data was processed using RES2DINV software for 2D subsurface image. The result obtained indicate that the thickness of shallow aquifer for both spread line varies between 7.5 m to 15 m. The analysis of rest raw data using IP showed that the chargeability parameter is equal to 0 which strongly indicated the presence of groundwater aquifer in the study area.

Quantification of manganese in human hand bones: a feasibility study

Energy Technology Data Exchange (ETDEWEB)

Aslam; Pejovic-Milic, A; Chettle, D R; McNeill, F E [Department of Medical Physics and Applied Radiation Sciences, McMaster University, Hamilton, ON, L8S 4K1 (Canada)], E-mail: aslamib@mcmaster.ca

2008-08-07

Manganese is both an essential element to human health and also toxic when humans are exposed to excessive levels, particularly by means of inhalation. Biological monitoring of manganese exposure is problematic. It is subject to homeostasis; levels in blood (or serum/plasma) reflect only the most recent exposure and rapidly return to within normal ranges, even when there has been a temporary excursion in response to exposure. In this context, we have been developing a non-invasive technique for measurement of manganese stored in bone, using in vivo neutron activation analysis. Following preliminary feasibility studies, the technique has been enhanced by two significant infrastructure advances. A specially designed irradiation facility serves to maximize the activation of manganese with respect to the dose of ionizing radiation. Secondly, an array of eight NaI(Tl) crystals provides a detection system with very close to 4{pi} geometry. This feasibility study, using neutron activation analysis to measure manganese in the bones of the hand, takes two features into account. Firstly, there is considerable magnesium present in the bone and this produces a spectral interference with the manganese. The {sup 26}Mg(n,{gamma}){sup 27}Mg reaction produces {gamma}-rays of 0.843 MeV from the decay of {sup 27}Mg, which interfere with the 0.847 MeV {gamma}-rays from the decay of {sup 56}Mn, produced by the {sup 55}Mn(n,{gamma}){sup 56}Mn reaction. Secondly, this work provides estimates of the levels of manganese to be expected in referent subjects. A revised estimate has been made from the most recent literature to explore the potential of the technique as a suitable means of screening patients and people exposed to excessive amounts of Mn who could develop many-fold increased levels of Mn in bones as demonstrated through various animal studies. This report presents the enhancements to the neutron activation system, by which manganese can be measured, which resulted in a detection

Quantification of manganese in human hand bones: a feasibility study

International Nuclear Information System (INIS)

Aslam; Pejovic-Milic, A; Chettle, D R; McNeill, F E

2008-01-01

Manganese is both an essential element to human health and also toxic when humans are exposed to excessive levels, particularly by means of inhalation. Biological monitoring of manganese exposure is problematic. It is subject to homeostasis; levels in blood (or serum/plasma) reflect only the most recent exposure and rapidly return to within normal ranges, even when there has been a temporary excursion in response to exposure. In this context, we have been developing a non-invasive technique for measurement of manganese stored in bone, using in vivo neutron activation analysis. Following preliminary feasibility studies, the technique has been enhanced by two significant infrastructure advances. A specially designed irradiation facility serves to maximize the activation of manganese with respect to the dose of ionizing radiation. Secondly, an array of eight NaI(Tl) crystals provides a detection system with very close to 4π geometry. This feasibility study, using neutron activation analysis to measure manganese in the bones of the hand, takes two features into account. Firstly, there is considerable magnesium present in the bone and this produces a spectral interference with the manganese. The 26 Mg(n,γ) 27 Mg reaction produces γ-rays of 0.843 MeV from the decay of 27 Mg, which interfere with the 0.847 MeV γ-rays from the decay of 56 Mn, produced by the 55 Mn(n,γ) 56 Mn reaction. Secondly, this work provides estimates of the levels of manganese to be expected in referent subjects. A revised estimate has been made from the most recent literature to explore the potential of the technique as a suitable means of screening patients and people exposed to excessive amounts of Mn who could develop many-fold increased levels of Mn in bones as demonstrated through various animal studies. This report presents the enhancements to the neutron activation system, by which manganese can be measured, which resulted in a detection limit in the hand of human subjects of 1.6 �

Effects of the exotic zebra mussel (Dreissena polymorpha) on metal cycling in Lake Erie

International Nuclear Information System (INIS)

Klerks, P.L.; Fraleigh, P.C.; Lawniczak, J.E.

1997-01-01

This research demonstrated the impact of high densities of the zebra mussel (Dreissena polymorpha) on the cycling of copper, nickel, and zinc in a lake environment. Experiments with mussels on sedimentation traps in western Lake Erie and with mussels in flow-through tanks receiving Lake Erie water showed that zebra mussels remove metals from the water column, incorporate metals in their tissues, and deposit metals on the lake bottom. Removal of metals from the water column was estimated at 10-17%·day -1 of the amounts present. This material was largely deposited on the lake bottom; zebra mussels more than doubled the rate at which metals were being added to the lake bottom. Metal biodeposition rates were extremely high (e.g., 50 mg Zn·m -2 ·day -1 ) in high-turbidity areas with elevated metal levels. Two factors contributed to metal biodeposition by zebra mussels. First, their production of feces and pseudofeces increased the rate at which suspended matter was being added to the sediment (accounting for 92% of the increased metal biodeposition). Second, the material coming out of suspension had higher metal concentrations when zebra mussels were present (constituting 8% of the increased biodeposition). (author)

ARGUS laser plasma experiments at 1.06 μm, 0.53 μm and 0.35 μm

International Nuclear Information System (INIS)

Turner, R.E.; Campbell, E.M.; Mead, W.C.; Ze, F.; Max, C.; Phillion, D.W.; Lee, P.; Pruett, B.; Tirsell, G.; Lasinski, B.F.

1982-01-01

ARGUS wavelength scaling experiments have been performed on low (Be) and high (Au) Z disk targets, with laser wavelengths of 1.06 μm, 0.53 μm and 0.35 μm. The laser provided a 700 psec pulse, with up to 100J and 1.06 μm; 200J at 0.53 μm; and 40J at 0.35 μm. Laser intensities on target ranged from 3 x 10 13 to over 3 x 10 15 W/cm 2 , using an f/2.2 focusing system. Box calorimeter measurements show the expected increasing fractional absorption at shorter laser wavelengths; absolutely calibrated hard x-ray detectors show the number of suprathermal electrons to be greatly decreased. Scattered light measurements concentrated on stimulated Raman scattering, and the 3/2 harmonic. The SRS was spectrally and temporally resolved during 0.53 μm irradiations; our measurements showed the scattering to be principally from the convective instability, near tenth critical density. Near ω/2, a double peaked spectral feature is observed. The time resolved data show a number of interesting features, which are discussed

Kinetic study of human hand sodium using local in vivo neutron activation analysis

International Nuclear Information System (INIS)

Cohen Boulakia, Francine.

1978-01-01

Using local 'in vivo' activation analysis, turnover of human hand sodium is studied in 14 subjects, 7 controls and 7 decalcified osteoporotics patients. The hand of each subject is irradiated with neutrons emitted by 52 Cf sources; the equivalent dose delivered is 8 cGy. The 24 Na activity variation is plotted as function of time and the experimental curve so obtained is fitted to two exponentials. Two compartements are identified: a rapidly exchangeable one, with a half life of 1 h; an other, with a very slow turnover, the half lifes varying from 79 h to 35 h as the calcium concentration becomes sub-normal. The ratios calcium to slowly exchangeable sodium and rapidly to slowly exchangeable sodium appear to be promising for the evaluation of bone disease [fr

Domestic dogs' (Canis familiaris) choices in reference to information provided by human and artificial hands.

Science.gov (United States)

Kundey, Shannon M A; Delise, Justin; De Los Reyes, Andres; Ford, Kathy; Starnes, Blair; Dennen, Weston

2014-03-01

Even young humans show sensitivity to the accuracy and reliability of informants' reports. Children are selective in soliciting information and in accepting claims. Recent research has also investigated domestic dogs' (Canis familiaris) sensitivity to agreement among human informants. Such research utilizing a common human pointing gesture to which dogs are sensitive in a food retrieval paradigm suggests that dogs might choose among informants according to the number of points exhibited, rather than the number of individuals indicating a particular location. Here, we further investigated dogs' use of information from human informants using a stationary pointing gesture, as well as the conditions under which dogs would utilize a stationary point. First, we explored whether the number of points or the number of individuals more strongly influenced dogs' choices. To this end, dogs encountered a choice situation in which the number of points exhibited toward a particular location and the number of individuals exhibiting those points conflicted. Results indicated that dogs chose in accordance with the number of points exhibited toward a particular location. In a second experiment, we explored the possibility that previously learned associations drove dogs' responses to the stationary pointing gesture. In this experiment, dogs encountered a choice situation in which artificial hands exhibited a stationary pointing gesture toward or away from choice locations in the absence of humans. Dogs chose the location to which the artificial hand pointed. These results are consistent with the notion that dogs may respond to a human pointing gesture due to their past-learning history.

SPONGE ROBOTIC HAND DESIGN FOR PROSTHESES

OpenAIRE

Mine Seçkin

2016-01-01

In this study robotic hands and fingers’ materials are investigated from past to present and a sponge robotic hand is designed for biomedical applications. Emergence and necessity of soft robotic technology are explained and description of soft robot is made. Because of the importance of hand in a person’s body, researchers have dealt with robotic hand prostheses for many centuries and developed many hand types. To mimic the best for the human limbs, softness of the hand is one of the importa...

76 FR 23799 - Erie Boulevard Hydropower, L.P.; Notice of Application Accepted for Filing, Soliciting Motions To...

Science.gov (United States)

2011-04-28

... DEPARTMENT OF ENERGY Federal Energy Regulatory Commission [Project No. P-2713-082] Erie Boulevard...: Kimberly D. Bose, Secretary, Federal Energy Regulatory Commission, 888 First Street, NE., Washington, DC... Environmental Conservation, New York State Council of Trout Unlimited, U.S. Fish and Wildlife Service, the...

Comparative Sensor Fusion between Hyperspectral and Multispectral Remote Sensing Data for Monitoring Microcystin Distribution in Lake Erie

Science.gov (United States)

Urban growth and agricultural production have caused an influx of nutrients into Lake Erie, leading to eutrophic zones. These conditions result in the formation of algal blooms, some of which are toxic due to the presence of Microcystis (a cyanobacteria), which produces the hepat...

Snipper, an Eri1 homologue, affects histone mRNA abundance and is crucial for normal Drosophila melanogaster development.

Science.gov (United States)

Alexiadis, Anastasios; Delidakis, Christos; Kalantidis, Kriton

2017-07-01

The conserved 3'-5' RNA exonuclease ERI1 is implicated in RNA interference inhibition, 5.8S rRNA maturation and histone mRNA maturation and turnover. The single ERI1 homologue in Drosophila melanogaster Snipper (Snp) is a 3'-5' exonuclease, but its in vivo function remains elusive. Here, we report Snp requirement for normal Drosophila development, since its perturbation leads to larval arrest and tissue-specific downregulation results in abnormal tissue development. Additionally, Snp directly interacts with histone mRNA, and its depletion results in drastic reduction in histone transcript levels. We propose that Snp protects the 3'-ends of histone mRNAs and upon its absence, histone transcripts are readily degraded. This in turn may lead to cell cycle delay or arrest, causing growth arrest and developmental perturbations. © 2017 Federation of European Biochemical Societies.

Simultaneous X-ray, UV, and Optical Variations in lambda ERI (B2e)

Science.gov (United States)

Smith, M. A.; Murakami, T.; Anandarao, B.

1996-12-01

We have carried out a simultaneous observing campaign on the prototypical Be star lambda Eri using ground stations and ROSAT, ASCA, IUE, and Voyager spacecrafts during the week of February-March 1995; a smaller campaign was carried out the following September. In late February lambda Eri showed extraordinary disk-wind activity. ROSAT/HRI monitoring disclosed no large flares such as ROSAT observed in 1991 in lambda Eri. Possible low amplitude fluctuations in the 1995 data occurred at the same time with unusual activity in Hα , HeI lambda 6678, HeII lambda 1640, CIII, and the CIV doublet. The helium line activity suggests that mass ejection occurred at the base of the wind. The strong CIII and CIV lines implies that shock interactions originated in the wind flow. It is not clear that the X-ray fluctuations are directly related to the increases in wind line absorption. Within hours of the mild X-ray flux variations found by ROSAT on February 28, the Voyager UVS observed a ``ringing" that decayed over three 3-hr. cycles. The amplitude of these fluctuations was large (50%) at lambda lambda 950-1100, decreased rapidly with wavelength, and faded to nondetection above lambda 1300. Various considerations indicate that these continuum variations were not due to an instrument pathology in the UVS. Rather, they appear to be due to a time-dependent flux deficit in the lambda lambda 1250 during the minima of these cycles. We outline a scenario in which dense plasma over the star's surface is alternately heated and cooled quasi-periodically to produce the flux changes. Additional examples of this new phenomenon are needed. Amateur astronomers can make a significant contribution to the understanding of flickering in Be star light curves during their outburst phases. We also draw attention to an increase in the emission of the Hα line that occurred at about the same time the FUV ringing started. This increased emission hints that ~ 50,000K plasma near the star's surface can

77 FR 35619 - Safety Zone; Old Fashion 4th July Fireworks, Presque Isle Bay, Erie, PA

Science.gov (United States)

2012-06-14

...-AA00 Safety Zone; Old Fashion 4th July Fireworks, Presque Isle Bay, Erie, PA AGENCY: Coast Guard, DHS... during the Old Fashion 4th July Fireworks display. This temporary safety zone is necessary to protect... ensure the safety of spectators and vessels during the Old Fashion 4th July Fireworks. [[Page 35620...

Multiscale Convolutional Neural Networks for Hand Detection

Directory of Open Access Journals (Sweden)

Shiyang Yan

2017-01-01

Full Text Available Unconstrained hand detection in still images plays an important role in many hand-related vision problems, for example, hand tracking, gesture analysis, human action recognition and human-machine interaction, and sign language recognition. Although hand detection has been extensively studied for decades, it is still a challenging task with many problems to be tackled. The contributing factors for this complexity include heavy occlusion, low resolution, varying illumination conditions, different hand gestures, and the complex interactions between hands and objects or other hands. In this paper, we propose a multiscale deep learning model for unconstrained hand detection in still images. Deep learning models, and deep convolutional neural networks (CNNs in particular, have achieved state-of-the-art performances in many vision benchmarks. Developed from the region-based CNN (R-CNN model, we propose a hand detection scheme based on candidate regions generated by a generic region proposal algorithm, followed by multiscale information fusion from the popular VGG16 model. Two benchmark datasets were applied to validate the proposed method, namely, the Oxford Hand Detection Dataset and the VIVA Hand Detection Challenge. We achieved state-of-the-art results on the Oxford Hand Detection Dataset and had satisfactory performance in the VIVA Hand Detection Challenge.

Detection and Modeling of a Meteotsunami in Lake Erie During a High Wind Event on May 27, 2012

Science.gov (United States)

Anderson, E. J.; Schwab, D. J.; Lombardy, K. A.; LaPlante, R. E.

2012-12-01

On May 27, 2012, a mesoscale convective system moved southeast across the central basin of Lake Erie (the shallowest of the Great Lakes) causing an increase in surface wind speed from 3 to 15 m/s over a few minutes. Although no significant pressure change was observed during this period (+1 mbar), the storm resulted in 3 reported edge waves on the southern shore (5 minutes apart), with wave heights up to 7 feet (2.13 m). Witnesses along the coast reported that the water receded before the waves hit, the only warning of the impending danger. After impact on the southern shore, several individuals were stranded in the water near Cleveland, Ohio. Fortunately, there were no fatalities or serious injury as a result of the edge waves. The storm event yielded two separate but similar squall line events that impacted the southern shore of Lake Erie several hours apart. The first event had little impact on nearshore conditions, however, the second event (moving south-eastward at 21.1 m/s or 41 knots), resulted in 7 ft waves near Cleveland as reported above. The thunderstorms generated three closely packed outflow boundaries that intersected the southern shore of Lake Erie between 1700 and 1730 UTC. The outflow boundaries were followed by a stronger outflow at 1800 UTC. Radial velocities on the WSR-88D in Cleveland, Ohio indicated the winds were stronger in the second outflow boundary. The radar indicated winds between 20.6 and 24.7 m/s (40 and 48 knots) within 240 meters (800 feet) above ground level. In order to better understand the storm event and the cause of the waves that impacted the southern shore, a three-dimensional hydrodynamic model of Lake Erie has been developed using the Finite Volume Coastal Ocean Model (FVCOM). The model is being developed as part of the Great Lakes Coastal Forecasting (GLCFS), a set of experimental real-time pre-operational hydrodynamic models run at the NOAA Great Lakes Research Laboratory that forecast currents, waves, temperature, and

Morphology of muscle attachment sites in the modern human hand does not reflect muscle architecture.

Science.gov (United States)

Williams-Hatala, E M; Hatala, K G; Hiles, S; Rabey, K N

2016-06-23

Muscle attachment sites (entheses) on dry bones are regularly used by paleontologists to infer soft tissue anatomy and to reconstruct behaviors of extinct organisms. This method is commonly applied to fossil hominin hand bones to assess their abilities to participate in Paleolithic stone tool behaviors. Little is known, however, about how or even whether muscle anatomy and activity regimes influence the morphologies of their entheses, especially in the hand. Using the opponens muscles from a sample of modern humans, we tested the hypothesis that aspects of hand muscle architecture that are known to be influenced by behavior correlate with the size and shape of their associated entheses. Results show no consistent relationships between these behaviorally-influenced aspects of muscle architecture and entheseal morphology. Consequently, it is likely premature to infer patterns of behavior, such as stone tool making in fossil hominins, from these same entheses.

[Characterization of haemolysis of the Vibrio parahaemolyticus no.93].

Science.gov (United States)

Su, S C; Lee, C Y

1997-02-01

Vibrio parahaemolyticus is a causative bacterium of food poisoning, and the haemolysin produced by this organism has been considered as one of the important virulence factors. In order to understand the pathogenic mechanism of this bacterium, the characteristics of haemolysin from Vibrio parahaemolyticus isolated from Taiwan were studied. One of the clinical strains, V. parahaemolyticus No.93, presents a weak hemolytic zone on 7% NaCl-Wagatsuma medium. The DNA hybridization results show that V. parahemolyticus has neither tdh nor trh gene. V. parahaemolyticus No.93 shows obviously hemolytic zone on 3%-NaCl Wagatsuma medium (human blood). The crude extracellular protein of V. parahaemolyticus No. 93 was evaluated for its heat tolerance and enzyme activities by media assay. The results show that this crude extracellular protein is thermolabile. The crude extracellular protein of V. parahaemolyticus No.93 was analyzed on 10% SDS-PAGE and an apparent band of 64 kDa protein was observed. Furthermore, the crude extracellular protein was analyzed by running gelatin-SDS-PAGE and hemoglobin-SDS-PAGE, and three clear zones on 62 kDa, 52 kDa and 41 kDa were observed on both SDS-PAGEs. Thus we propose that the crude extracellular protein of the V. parahaemolyticus No.93 can degrade gelatin as well as hemoglobin. Whether these protease being the virulence factors of Vibrio parahaemolyticus No.93 needs to be further studied.

Determination of zirconium 93 and molybdenum 93 in reprocessing nuclear waste

International Nuclear Information System (INIS)

Puech, P.

1998-01-01

The aim of this work is to find new determination methods of zirconium 93 and molybdenum 93 (two long-lived radioelements) contained in reprocessing nuclear waste. 93 Zr has a very long period: 1.5 * 10 6 years. The measurement of this isotope is more performing by the ICP-MS method than by the classical radiochemical measurement methods. 93 Mo disintegrates with a radioactive period of 4000 years and can be detected by radiochemical measurement in particular by X spectrometry. But these radioelements cannot be directly measured on the reprocessing nuclear waste; they require a preliminary chemical separation (removing the radioelements able to interfere and those responsible of the radioactivity of the nuclear waste). The separation is implemented with very potentially selective techniques, using Mo and Zr specific extracting molecules: solvent extraction, emulsified liquid membrane extraction and liquid chromatography extraction (on a resin impregnated by solvent). Studies carried out in CEA/Cadarache, on a synthetic solution simulating a reprocessing nuclear waste, have allowed to show the selective properties of the L'-benzoinoxime for extracting Mo and of TBP for extracting Zr for the three studied techniques. The optimal extraction and separation conditions have been reached with a methodology including experiment plans. At last, the methods have been tested on real reprocessing nuclear waste at Cogema/La Hague. 93 Zr and 93 Mo have been measured in a dissolution solution and in a fission product solution. The obtained values are 2 * 10 6 Bq/l and 10 7 Bq/l for 93 Zr and 500 Bq/l for 93 Mo in a dissolution solution. These methods have allowed to determine too the isotopic compositions for Mo and Zr elements contained in reprocessing nuclear waste. The results are in accordance with those obtained with the Cesar code. (O.M.)

Newly identified CYP2C93 is a functional enzyme in rhesus monkey, but not in cynomolgus monkey.

Directory of Open Access Journals (Sweden)

Yasuhiro Uno

Full Text Available Cynomolgus monkey and rhesus monkey are used in drug metabolism studies due to their evolutionary closeness and physiological resemblance to human. In cynomolgus monkey, we previously identified cytochrome P450 (P450 or CYP 2C76 that does not have a human ortholog and is partly responsible for species differences in drug metabolism between cynomolgus monkey and human. In this study, we report characterization of CYP2C93 cDNA newly identified in cynomolgus monkey and rhesus monkey. The CYP2C93 cDNA contained an open reading frame of 490 amino acids approximately 84-86% identical to human CYP2Cs. CYP2C93 was located in the genomic region, which corresponded to the intergenic region in the human genome, indicating that CYP2C93 does not correspond to any human genes. CYP2C93 mRNA was expressed predominantly in the liver among 10 tissues analyzed. The CYP2C93 proteins heterologously expressed in Escherichia coli metabolized human CYP2C substrates, diclofenac, flurbiprofen, paclitaxel, S-mephenytoin, and tolbutamide. In addition to a normal transcript (SV1, an aberrantly spliced transcript (SV2 lacking exon 2 was identified, which did not give rise to a functional protein due to frameshift and a premature termination codon. Mini gene assay revealed that the genetic variant IVS2-1G>T at the splice site of intron 1, at least partly, accounted for the exon-2 skipping; therefore, this genotype would influence CYP2C93-mediated drug metabolism. SV1 was expressed in 6 of 11 rhesus monkeys and 1 of 8 cynomolgus monkeys, but the SV1 in the cynomolgus monkey was nonfunctional due to a rare null genotype (c.102T>del. These results suggest that CYP2C93 can play roles as a drug-metabolizing enzyme in rhesus monkeys (not in cynomolgus monkeys, although its relative contribution to drug metabolism has yet to be validated.

Monosynaptic Ia projections from intrinsic hand muscles to forearm motoneurones in humans.

Science.gov (United States)

Marchand-Pauvert, V; Nicolas, G; Pierrot-Deseilligny, E

2000-05-15

Heteronymous Ia excitatory projections from intrinsic hand muscles to human forearm motoneurones (MNs) were investigated. Changes in firing probability of single motor units (MUs) in the flexor carpi radialis (FCR), flexor carpi ulnaris (FCU), flexor digitorum superficialis (FDS), extensor carpi radialis (ECR), extensor carpi ulnaris (ECU) and extensor digitorum communis (EDC) were studied after electrical stimuli were applied to the median and ulnar nerve at wrist level and to the corresponding homonymous nerve at elbow level. Homonymous facilitation, occurring at the same latency as the H reflex, and therefore attributed to monosynaptic Ia EPSPs, was found in all the sampled units. In many MUs an early facilitation was also evoked by heteronymous low-threshold afferents from intrinsic hand muscles. The low threshold (between 0.5 and 0.6 times motor threshold (MT)) and the inability of a pure cutaneous stimulation to reproduce this effect indicate that it is due to stimulation of group I muscle afferents. Evidence for a similar central delay (monosynaptic) in heteronymous as in homonymous pathways was accepted when the difference in latencies of the homonymous and heteronymous peaks did not differ from the estimated supplementary afferent conduction time from wrist to elbow level by more than 0.5 ms (conduction velocity in the fastest Ia afferents between wrist and elbow levels being equal to 69 m s-1). A statistically significant heteronymous monosynaptic Ia excitation from intrinsic hand muscles supplied by both median and ulnar nerves was found in MUs belonging to all forearm motor nuclei tested (although not in ECU MUs after ulnar stimulation). It was, however, more often found in flexors than in extensors, in wrist than in finger muscles and in muscles operating in the radial than in the ulnar side. It is argued that the connections of Ia afferents from intrinsic hand muscles to forearm MNs, which are stronger and more widely distributed than in the cat

76 FR 59682 - Erie Boulevard Hydropower L.P.; Notice of Dispute Resolution Panel Meeting and Technical Conference

Science.gov (United States)

2011-09-27

... DEPARTMENT OF ENERGY Federal Energy Regulatory Commission [Project No. 7518-012] Erie Boulevard Hydropower L.P.; Notice of Dispute Resolution Panel Meeting and Technical Conference On September 16, 2011, Commission staff, in response to the filing of notice of study dispute by the New York State Department of...

Increase deposition of organic matter, polychlorinated biphenyls, and cadmium by zebra mussels (Dreissena polymorpha) in western Lake Erie

Energy Technology Data Exchange (ETDEWEB)

Dobson, E. P; Mackie, G. L. [Guelph Univ., Dept. of Zoology, ON (Canada)

1998-05-01

Biodeposition of polychlorinated biphenyls (PCBs)and cadmium by zebra mussels in the western basin of Lake Erie was investigated using sediment traps, and compared to natural rates of sedimentation. On a per unit area of organic matter, deposition rates by zebra mussels up to eight to ten times higher than natural rates of sedimentation were found. These results suggest that zebra mussels are altering contaminant movement in western Lake Erie. At the same time, it was also suggested that the net effect of biodeposition may not be as great as shown in this study since only the effects of zebra mussels on the flux of the contaminants was examined and the re-suspension factor was not considered. It was recommended that to better understand the overall effects of zebra mussels on contaminant dynamics in aquatic environments, future studies should incorporate the re-suspension factors. 27 refs., 8 tabs., 3 figs.

Long-term ecosystem monitoring and assessment of the Detroit River and Western Lake Erie.

Science.gov (United States)

Hartig, J H; Zarull, M A; Ciborowski, J J H; Gannon, J E; Wilke, E; Norwood, G; Vincent, A N

2009-11-01

Over 35 years of US and Canadian pollution prevention and control efforts have led to substantial improvements in environmental quality of the Detroit River and western Lake Erie. However, the available information also shows that much remains to be done. Improvements in environmental quality have resulted in significant ecological recovery, including increasing populations of bald eagles (Haliaeetus leucocephalus), peregrine falcons (Falco columbarius), lake sturgeon (Acipenser fulvescens), lake whitefish (Coregonus clupeaformis), walleye (Sander vitreus), and burrowing mayflies (Hexagenia spp.). Although this recovery is remarkable, many challenges remain, including population growth, transportation expansion, and land use changes; nonpoint source pollution; toxic substances contamination; habitat loss and degradation; introduction of exotic species; and greenhouse gases and global warming. Research/monitoring must be sustained for effective management. Priority research and monitoring needs include: demonstrating and quantifying cause-effect relationships; establishing quantitative endpoints and desired future states; determining cumulative impacts and how indicators relate; improving modeling and prediction; prioritizing geographic areas for protection and restoration; and fostering long-term monitoring for adaptive management. Key management agencies, universities, and environmental and conservation organizations should pool resources and undertake comprehensive and integrative assessments of the health of the Detroit River and western Lake Erie at least every 5 years to practice adaptive management for long-term sustainability.

Effects of the exotic zebra mussel (Dreissena polymorpha) on metal cycling in Lake Erie

Energy Technology Data Exchange (ETDEWEB)

Klerks, P.L. [Univ. of Southwestern Louisiana, Dept. of Biology, Lafayette, Louisiana (United States)]. E-mail: klerks@usl.edu; Fraleigh, P.C.; Lawniczak, J.E. [Univ. of Toledo, Dept. of Biology, Toledo, Ohio (United States)

1997-07-15

This research demonstrated the impact of high densities of the zebra mussel (Dreissena polymorpha) on the cycling of copper, nickel, and zinc in a lake environment. Experiments with mussels on sedimentation traps in western Lake Erie and with mussels in flow-through tanks receiving Lake Erie water showed that zebra mussels remove metals from the water column, incorporate metals in their tissues, and deposit metals on the lake bottom. Removal of metals from the water column was estimated at 10-17%{center_dot}day{sup -1} of the amounts present. This material was largely deposited on the lake bottom; zebra mussels more than doubled the rate at which metals were being added to the lake bottom. Metal biodeposition rates were extremely high (e.g., 50 mg Zn{center_dot}m{sup -2}{center_dot}day{sup -1}) in high-turbidity areas with elevated metal levels. Two factors contributed to metal biodeposition by zebra mussels. First, their production of feces and pseudofeces increased the rate at which suspended matter was being added to the sediment (accounting for 92% of the increased metal biodeposition). Second, the material coming out of suspension had higher metal concentrations when zebra mussels were present (constituting 8% of the increased biodeposition). (author)

Establishment of one-axis vibration test system for measurement of biodynamic response of human hand-arm system.

Science.gov (United States)

Shibata, Nobuyuki; Hosoya, Naoki; Maeda, Setsuo

2008-12-01

Prolonged exposure to hand-arm vibration (HAV) due to use of hand-held power tools leads to an increased occurrence of symptoms of disorders in the vascular, neurological, and osteo-articular systems of the upper limbs called hand-arm vibration syndrome (HAVS). Biodynamic responses of the hand-arm system to vibration can be suggestive parameters that give us better assessment of exposure to HAV and fundamental data for design of low-vibration-exposure power tools. Recently, a single axis hand-arm vibration system has been installed in the Japan National Institute of Occupational Safety and Health (NIOSH). The aims of this study were to obtain the fundamental dynamic characteristics of an instrumented handle and to validate the performance and measurement accuracy of the system applied to dynamic response measurement. A pseudo-random vibration signal with a frequency range of 5-1,250 Hz and a power spectrum density of 1.0 (m/s2)2/Hz was used in this study. First the dynamic response of the instrumented handle without any weight was measured. After this measurement, the dynamic response measurement of the handle with weights mounted on the handle was performed. The apparent mass of a weight itself was obtained by using the mass cancellation method. The mass of the measuring cap on the instrumented handle was well compensated by using the mass cancellation method. Based on the 10% error tolerance, this handle can reliably measure the dynamic response represented by an apparent mass with a minimum weight of 2.0 g in a frequency range of 10.0 to 1,000 Hz. A marked increase in the AM magnitude of the weights of 15 g and 20 g in frequency ranges greater than 800 Hz is attributed not to the fundamental resonance frequency of the handle with weights, but to the fixation of the weight to the measuring cap. In this aspect, the peak of the AM magnitude can be reduced and hence should not be an obstacle to the biodynamic response measurement of the human hand-arm system. On the

Association of the dominant hand and needle stick injuries for ...

African Journals Online (AJOL)

The EPInet system started 2003 in Taiwan under C-MESH. When healthcare workers sustain sharp injury, they complete the injury report form, and report to infection control personnel, who then transmitted the data to EPINet website monthly. Results 93.5% of the healthcare workers reported being right handed and only ...

Development of a parametric kinematic model of the human hand and a novel robotic exoskeleton.

Science.gov (United States)

Burton, T M W; Vaidyanathan, R; Burgess, S C; Turton, A J; Melhuish, C

2011-01-01

This paper reports the integration of a kinematic model of the human hand during cylindrical grasping, with specific focus on the accurate mapping of thumb movement during grasping motions, and a novel, multi-degree-of-freedom assistive exoskeleton mechanism based on this model. The model includes thumb maximum hyper-extension for grasping large objects (~> 50 mm). The exoskeleton includes a novel four-bar mechanism designed to reproduce natural thumb opposition and a novel synchro-motion pulley mechanism for coordinated finger motion. A computer aided design environment is used to allow the exoskeleton to be rapidly customized to the hand dimensions of a specific patient. Trials comparing the kinematic model to observed data of hand movement show the model to be capable of mapping thumb and finger joint flexion angles during grasping motions. Simulations show the exoskeleton to be capable of reproducing the complex motion of the thumb to oppose the fingers during cylindrical and pinch grip motions. © 2011 IEEE

The SmartHand transradial prosthesis

Directory of Open Access Journals (Sweden)

Carrozza Maria Chiara

2011-05-01

Full Text Available Abstract Background Prosthetic components and control interfaces for upper limb amputees have barely changed in the past 40 years. Many transradial prostheses have been developed in the past, nonetheless most of them would be inappropriate if/when a large bandwidth human-machine interface for control and perception would be available, due to either their limited (or inexistent sensorization or limited dexterity. SmartHand tackles this issue as is meant to be clinically experimented in amputees employing different neuro-interfaces, in order to investigate their effectiveness. This paper presents the design and on bench evaluation of the SmartHand. Methods SmartHand design was bio-inspired in terms of its physical appearance, kinematics, sensorization, and its multilevel control system. Underactuated fingers and differential mechanisms were designed and exploited in order to fit all mechatronic components in the size and weight of a natural human hand. Its sensory system was designed with the aim of delivering significant afferent information to the user through adequate interfaces. Results SmartHand is a five fingered self-contained robotic hand, with 16 degrees of freedom, actuated by 4 motors. It integrates a bio-inspired sensory system composed of 40 proprioceptive and exteroceptive sensors and a customized embedded controller both employed for implementing automatic grasp control and for potentially delivering sensory feedback to the amputee. It is able to perform everyday grasps, count and independently point the index. The weight (530 g and speed (closing time: 1.5 seconds are comparable to actual commercial prostheses. It is able to lift a 10 kg suitcase; slippage tests showed that within particular friction and geometric conditions the hand is able to stably grasp up to 3.6 kg cylindrical objects. Conclusions Due to its unique embedded features and human-size, the SmartHand holds the promise to be experimentally fitted on transradial

Design and validation of a morphing myoelectric hand posture controller based on principal component analysis of human grasping.

Science.gov (United States)

Segil, Jacob L; Weir, Richard F ff

2014-03-01

An ideal myoelectric prosthetic hand should have the ability to continuously morph between any posture like an anatomical hand. This paper describes the design and validation of a morphing myoelectric hand controller based on principal component analysis of human grasping. The controller commands continuously morphing hand postures including functional grasps using between two and four surface electromyography (EMG) electrodes pairs. Four unique maps were developed to transform the EMG control signals in the principal component domain. A preliminary validation experiment was performed by 10 nonamputee subjects to determine the map with highest performance. The subjects used the myoelectric controller to morph a virtual hand between functional grasps in a series of randomized trials. The number of joints controlled accurately was evaluated to characterize the performance of each map. Additional metrics were studied including completion rate, time to completion, and path efficiency. The highest performing map controlled over 13 out of 15 joints accurately.

Phosphorous passivation of In{sub 0.53}Ga{sub 0.47}As using MOVPE and characterization of Au-Ga{sub 2}O{sub 3}(Gd{sub 2}O{sub 3})-In{sub 0.53}Ga{sub 0.47}As MIS capacitor

Energy Technology Data Exchange (ETDEWEB)

Pal, S. [Centre for Advanced Technology, Indore 452013, MP (India)]. E-mail: suparna@cat.ernet.in; Shivaprasad, S.M. [National Physical Laboratory, New Delhi 110012 (India); Aparna, Y. [National Physical Laboratory, New Delhi 110012 (India); Chakraborty, B.R. [National Physical Laboratory, New Delhi 110012 (India)

2005-05-30

A study of phosphorous passivation of the interface states of undoped In{sub 0.53}Ga{sub 0.47}As has been carried out. Phosphorous surface passivation has been achieved by: (1) exchange reaction of the InGaAs surface under phosphine vapor or (2) direct growth of InGaP/GaP thin epitaxial layers in a metal organic vapour phase epitaxy (MOVPE) reactor. The passivated surfaces have been characterized using X-ray photoelectron spectroscopy and capacitance-voltage measurements of the MIS devices. The minimum interface state density of 2.90 x 10{sup 11} eV{sup -1} cm{sup -2} was obtained for Au/Ga{sub 2}O{sub 3}(Gd{sub 2}O{sub 3})/GaP/In{sub 0.53}Ga{sub 0.47}As structure.

Measuring hand hygiene compliance rates at hospital entrances.

Science.gov (United States)

Vaidotas, Marina; Yokota, Paula Kiyomi Onaga; Marra, Alexandre R; Camargo, Thiago Zinsly Sampaio; Victor, Elivane da Silva; Gysi, Deisy Morselli; Leal, Flavio; Santos, Oscar Fernando Pavão dos; Edmond, Michael B

2015-07-01

Despite the importance of hand hygiene in the health care setting, there are no studies evaluating hand hygiene compliance at hospital entrances. The study was prospectively performed over a 33-week period from March 30, 2014-November 15, 2014, to evaluate hand hygiene compliance in 2 hospital reception areas. We compared electronic handwash counters with the application of radiofrequency identification (GOJO SMARTLINK) (electronic observer) that counts each activation of alcohol gel dispensers to direct observation (human observer) via remote review of video surveillance. We found low hand hygiene compliance rates of 2.2% (99/4,412) and 1.7% (140/8,277), respectively, at reception areas A and D, detected by direct observation. Using the electronic observer, we measured rates of 17% (15,624/91,724) and 7.1% (51,605/730,357) at reception areas A and D, respectively. For the overall time period of simultaneous electronic and human observation, the human observer captured 1% of the hand hygiene episodes detected by the electronic observer. Our study showed very low hand hygiene compliance in hospital reception areas, and we found an electronic hand hygiene system to be a useful method to monitor hand hygiene compliance. Copyright © 2015 Association for Professionals in Infection Control and Epidemiology, Inc. Published by Elsevier Inc. All rights reserved.

Enteric pathogens in stored drinking water and on caregiver's hands in Tanzanian households with and without reported cases of child diarrhea.

Directory of Open Access Journals (Sweden)

Mia Catharine Mattioli

Full Text Available BACKGROUND: Diarrhea is one of the leading causes of mortality in young children. Diarrheal pathogens are transmitted via the fecal-oral route, and for children the majority of this transmission is thought to occur within the home. However, very few studies have documented enteric pathogens within households of low-income countries. METHODS AND FINDINGS: The presence of molecular markers for three enteric viruses (enterovirus, adenovirus, and rotavirus, seven Escherichia coli virulence genes (ECVG, and human-specific Bacteroidales was assessed in hand rinses and household stored drinking water in Bagamoyo, Tanzania. Using a matched case-control study design, we examined the relationship between contamination of hands and water with these markers and child diarrhea. We found that the presence of ECVG in household stored water was associated with a significant decrease in the odds of a child within the home having diarrhea (OR = 0.51; 95% confidence interval 0.27-0.93. We also evaluated water management and hygiene behaviors. Recent hand contact with water or food was positively associated with detection of enteric pathogen markers on hands, as was relatively lower volumes of water reportedly used for daily hand washing. Enteropathogen markers in stored drinking water were more likely found among households in which the markers were also detected on hands, as well as in households with unimproved water supply and sanitation infrastructure. CONCLUSIONS: The prevalence of enteric pathogen genes and the human-specific Bacteroidales fecal marker in stored water and on hands suggests extensive environmental contamination within homes both with and without reported child diarrhea. Better stored water quality among households with diarrhea indicates caregivers with sick children may be more likely to ensure safe drinking water in the home. Interventions to increase the quantity of water available for hand washing, and to improve food hygiene, may

Cytomegalovirus survival and transferability and the effectiveness of common hand-washing agents against cytomegalovirus on live human hands.

Science.gov (United States)

Stowell, Jennifer D; Forlin-Passoni, Daniela; Radford, Kay; Bate, Sheri L; Dollard, Sheila C; Bialek, Stephanie R; Cannon, Michael J; Schmid, D Scott

2014-01-01

Congenital cytomegalovirus (CMV) transmission can occur when women acquire CMV while pregnant. Infection control guidelines may reduce risk for transmission. We studied the duration of CMV survival after application of bacteria to the hands and after transfer from the hands to surfaces and the effectiveness of cleansing with water, regular and antibacterial soaps, sanitizer, and diaper wipes. Experiments used CMV AD169 in saliva at initial titers of 1 × 10(5) infectious particles/ml. Samples from hands or surfaces (points between 0 and 15 min) were placed in culture and observed for at least 2 weeks. Samples were also tested using CMV real-time PCR. After application of bacteria to the hands, viable CMV was recovered from 17/20 swabs at 0 min, 18/20 swabs at 1 min, 5/20 swabs at 5 min, and 4/20 swabs at 15 min. After transfer, duration of survival was at least 15 min on plastic (1/2 swabs), 5 min on crackers and glass (3/4 swabs), and 1 min or less on metal and cloth (3/4 swabs); no viable virus was collected from wood, rubber, or hands. After cleansing, no viable virus was recovered using water (0/22), plain soap (0/20), antibacterial soap (0/20), or sanitizer (0/22). Viable CMV was recovered from 4/20 hands 10 min after diaper wipe cleansing. CMV remains viable on hands for sufficient times to allow transmission. CMV may be transferred to surfaces with reduced viability. Hand-cleansing methods were effective at eliminating viable CMV from hands.

Usûlî Kıyasın Bilgi ve Amel Değeri

Directory of Open Access Journals (Sweden)

Yrd.Doç.Dr. Temel Kacır

2016-06-01

Full Text Available “Ortak bir illete sahip olmaları nedeniyle, aslın hükmünün fer‘e verilmesidir" şeklinde tanımlanan usûlî kıyasın bilgi ve amel değeri, ilk dönemden itibaren tartışma konusu olmuştur. Şöyle ki; hüküm verme yetkisi sadece Şar‘î’e ait olduğu halde usûlî kıyasın dinde hüküm verme anlamına geldiği ve bilgi değerinin de nasslarca yerilmiş zan olduğu gibi bazı argümanlar ileri sürerek usûlî kıyası reddedenler olsa da, çoğunluk tarafından usûlî kıyas aslî ve şer‘î delil olarak kabul edilmiş ve elde edilen bu hüküm ile amel edilmesi gerekli görülmüştür. Bu çalışma, usûlî kıyası kabul eden ve etmeyenlerin görüşlerini mukayese etmenin ötesinde, usûlî kıyasın salt aklî bir çaba olmadığını, kendisi ile ulaşılan bilginin naslarda yerilen zan olmayıp aksine delile dayalı zannın en üst derecesi olduğunu ve bunun da furû fıkıhta amel için yeterli olduğunu naklî ve aklî deliller ile ele alan bir çalışmadır. Kıyasla ilgili genel bir çerçeve çizildikten sonra, usûlî kıyas ve deliller hiyerarşisindeki yeri ve kıyasın bilgi ve amelî değeri ile sınırlandırılan bu makale ile usûlî kıyasın bilgi ve amel değeri konusundaki tartışmalara açıklık getirilmek istenmektedir.

[The hands--means of expression for relationship, creativity and coping].

Science.gov (United States)

Kinzl, J F

2008-02-01

The hand is an important active sense organ. Hands help human beings to organise and change the environment, and most developments of mankind would not have been possible without hands. The hands also made a great contribution to the high degree of brain development. The hands are an important characteristic feature of identity and identification and sign of individuality as well. Human hands have a long history as an instrument of social interaction and as an object of social attention. The language of hands offers many kinds of expression and gestures help to underline the words.

A description of the severity of equestrian-related injuries (ERIs) using clinical parameters and patient-reported outcomes.

Science.gov (United States)

Papachristos, Alexander; Edwards, Elton; Dowrick, Adam; Gosling, Cameron

2014-09-01

Despite a number of injury prevention campaigns and interventions, horse riding continues to be a dangerous activity, resulting in more accidents per hour than motorcycling, skiing and football. Injuries are often serious, with one in four patients requiring admission to hospital. This study aims to describe the severity of equestrian-related injuries (ERIs) using both clinical parameters and patient-reported outcomes. A retrospective study of all patients aged ≥18 years admitted to The Alfred Hospital between January 2003 and January 2008 with an ERI was performed. Specific clinical data were extracted from the medical record. In addition, a questionnaire was conducted identifying the details of the accident, the required recovery time and levels of ongoing pain and physical disability. During the study period 172 patients met the inclusion criteria. There were three deaths (2%). Eighty-two patients (48%) suffered head injuries. Forty-one patients (24%) were admitted to the ICU and 31 patients (18%) required mechanical ventilation. On discharge, 41 patients (24%) required transfer to a sub-acute rehabilitation facility. One-hundred-and-twenty-four patients (72%) completed the questionnaire. Thirty-nine respondents (31%) were not wearing a helmet. Among patients injured for more than 6 months, 38 (35%) still experienced moderate or severe pain or disability. Ninety-five patients had returned to work at the time of review, among which 47(50%) required longer than 6 months to recover, and 40 (42%) returned at a reduced capacity. The clinical and patient-reported outcomes of ERIs requiring hospital admission are poor. Persistent pain and disability are common, even up to 5 years post-injury. A large proportion of patients required longer than 6 months to return to work and many return at a reduced capacity. Copyright © 2014 Elsevier Ltd. All rights reserved.

76 FR 4097 - Erie Boulevard Hydropower, L.P.; Notice of Application Tendered for Filing With the Commission...

Science.gov (United States)

2011-01-24

... DEPARTMENT OF ENERGY Federal Energy Regulatory Commission [Project No. 2713-082] Erie Boulevard... Oswegatchie River and consists of: (1) A 941-foot-long dam with a 192-foot-long, 69-foot-high concrete gravity... seasonal flash boards; (2) a 168-acre reservoir with a gross storage capacity of 3,234 acre-feet and a...

Distribution of native mussel (unionidae) assemblages in coastal areas of Lake Erie, Lake St. Clair, and connecting channels, twenty-five years after a dreissenid invasion

Science.gov (United States)

Zanatta, David T.; Bossenbroek, Jonathan M.; Burlakova, Lyubov E.; Crail, Todd D.; Szalay, Ferenc de; Griffith, Traci A.; Kapusinski, Douglas; Karatayev, Alexander Y.; Krebs, Robert A.; Meyer, Elizabeth S.; Paterson, Wendy L.; Prescott, Trevor J.; Rowe, Matthew T.; Schloesser, Donald W.; Walsh, Mary C.

2015-01-01

Over the past 25 years, unionid mussels in the Laurentian Great Lakes of North America have been adversely impacted by invasive dreissenid mussels, which directly (e.g., by attachment to unionid shells) and indirectly (e.g., by competing for food) cause mortality. Despite the invasion, unionids have survived in several areas in the presence of dreissenid mussels. We investigated current spatial patterns in these native mussel refuges based on surveys for unionid mussels across 48 sampling locations (141 sites) in 2011 and 2012, and documented species abundance and diversity in coastal areas of lakes St. Clair and Erie. The highest-quality assemblages of native mussels (densities, richness, and diversity) appear to be concentrated in the St. Clair delta, where abundance continues to decline, as well as in in Thompson Bay of Presque Isle in Lake Erie and in just a few coastal wetlands and drowned river-mouths in the western basin of Lake Erie. The discovery of several new refuge areas suggests that unionids have a broader distribution within the region than previously thought.

Anomalous strain relaxation and light-hole character enhancement in GaAs capped InAs/In0.53Ga0.47As quantum ring

International Nuclear Information System (INIS)

Moon, Pilkyung; Park, Kwangmin; Yoon, Euijoon; Leburton, Jean-Pierre

2009-01-01

We theoretically investigated the strain profiles and the electronic structures of InAs/In 0.53 Ga 0.47 As quantum dot and GaAs capped quantum ring. In contrast to the intuitive expectation that the GaAs layer applies a strong compressive strain along the lateral directions of InAs, the GaAs embedded in the In 0.53 Ga 0.47 As matrix provides enough space for the InAs relaxation. The GaAs embedded in In 0.53 Ga 0.47 As acts as potential barrier for both electrons and heavy-holes, and as potential well for light-holes. Each hole state of the quantum ring exhibits two to eight times larger light-hole character than that of a quantum dot. (copyright 2009 WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim) (orig.)

Humans can integrate feedback of discrete events in their sensorimotor control of a robotic hand.

Science.gov (United States)

Cipriani, Christian; Segil, Jacob L; Clemente, Francesco; ff Weir, Richard F; Edin, Benoni

2014-11-01

Providing functionally effective sensory feedback to users of prosthetics is a largely unsolved challenge. Traditional solutions require high band-widths for providing feedback for the control of manipulation and yet have been largely unsuccessful. In this study, we have explored a strategy that relies on temporally discrete sensory feedback that is technically simple to provide. According to the Discrete Event-driven Sensory feedback Control (DESC) policy, motor tasks in humans are organized in phases delimited by means of sensory encoded discrete mechanical events. To explore the applicability of DESC for control, we designed a paradigm in which healthy humans operated an artificial robot hand to lift and replace an instrumented object, a task that can readily be learned and mastered under visual control. Assuming that the central nervous system of humans naturally organizes motor tasks based on a strategy akin to DESC, we delivered short-lasting vibrotactile feedback related to events that are known to forcefully affect progression of the grasp-lift-and-hold task. After training, we determined whether the artificial feedback had been integrated with the sensorimotor control by introducing short delays and we indeed observed that the participants significantly delayed subsequent phases of the task. This study thus gives support to the DESC policy hypothesis. Moreover, it demonstrates that humans can integrate temporally discrete sensory feedback while controlling an artificial hand and invites further studies in which inexpensive, noninvasive technology could be used in clever ways to provide physiologically appropriate sensory feedback in upper limb prosthetics with much lower band-width requirements than with traditional solutions.

Nitrogen cycling in Sandusky Bay, Lake Erie: oscillations between strong and weak export and implications for harmful algal blooms

Science.gov (United States)

Salk, Kateri R.; Bullerjahn, George S.; McKay, Robert Michael L.; Chaffin, Justin D.; Ostrom, Nathaniel E.

2018-05-01

Recent global water quality crises point to an urgent need for greater understanding of cyanobacterial harmful algal blooms (cHABs) and their drivers. Nearshore areas of Lake Erie such as Sandusky Bay may become seasonally limited by nitrogen (N) and are characterized by distinct cHAB compositions (i.e., Planktothrix over Microcystis). This study investigated phytoplankton N uptake pathways, determined drivers of N depletion, and characterized the N budget in Sandusky Bay. Nitrate (NO3-) and ammonium (NH4+) uptake, N fixation, and N removal processes were quantified by stable isotopic approaches. Dissimilatory N reduction was a relatively modest N sink, with denitrification, anammox, and N2O production accounting for 84, 14, and 2 % of sediment N removal, respectively. Phytoplankton assimilation was the dominant N uptake mechanism, and NO3- uptake rates were higher than NH4+ uptake rates. Riverine N loading was sometimes insufficient to meet assimilatory and dissimilatory demands, but N fixation alleviated this deficit. N fixation made up 23.7-85.4 % of total phytoplankton N acquisition and indirectly supports Planktothrix blooms. However, N fixation rates were surprisingly uncorrelated with NO3- or NH4+ concentrations. Owing to temporal separation in sources and sinks of N to Lake Erie, Sandusky Bay oscillates between a conduit and a filter of downstream N loading to Lake Erie, delivering extensively recycled forms of N during periods of low export. Drowned river mouths such as Sandusky Bay are mediators of downstream N loading, but climate-change-induced increases in precipitation and N loading will likely intensify N export from these systems.

Design-validation of a hand exoskeleton using musculoskeletal modeling.

Science.gov (United States)

Hansen, Clint; Gosselin, Florian; Ben Mansour, Khalil; Devos, Pierre; Marin, Frederic

2018-04-01

Exoskeletons are progressively reaching homes and workplaces, allowing interaction with virtual environments, remote control of robots, or assisting human operators in carrying heavy loads. Their design is however still a challenge as these robots, being mechanically linked to the operators who wear them, have to meet ergonomic constraints besides usual robotic requirements in terms of workspace, speed, or efforts. They have in particular to fit the anthropometry and mobility of their users. This traditionally results in numerous prototypes which are progressively fitted to each individual person. In this paper, we propose instead to validate the design of a hand exoskeleton in a fully digital environment, without the need for a physical prototype. The purpose of this study is thus to examine whether finger kinematics are altered when using a given hand exoskeleton. Therefore, user specific musculoskeletal models were created and driven by a motion capture system to evaluate the fingers' joint kinematics when performing two industrial related tasks. The kinematic chain of the exoskeleton was added to the musculoskeletal models and its compliance with the hand movements was evaluated. Our results show that the proposed exoskeleton design does not influence fingers' joints angles, the coefficient of determination between the model with and without exoskeleton being consistently high (R 2 ¯=0.93) and the nRMSE consistently low (nRMSE¯ = 5.42°). These results are promising and this approach combining musculoskeletal and robotic modeling driven by motion capture data could be a key factor in the ergonomics validation of the design of orthotic devices and exoskeletons prior to manufacturing. Copyright © 2017 Elsevier Ltd. All rights reserved.

Predictability of hand skill and cognitive abilities from craniofacial width in right- and left-handed men and women: relation of skeletal structure to cerebral function

OpenAIRE

Dayi, Ertunc; Okuyan, Mukadder; Tan, Uner

2002-01-01

Recently, a family of homeobox genes involved in brain and craniofacial development was identified. In light of this genetic background, we hypothesized that some functional characteristics of human brain (hand skill, cognition) may be linked to some structural characteristics of human skull (e.g. craniofacial width) in humans. Hand preference was assessed by the Oldfield`s Handedness Questionaire. Hand skill was measured by Peg Moving Task. Face width was measured from the anteroposterior ce...

Augmented robotic device for EVA hand manoeuvres

Science.gov (United States)

Matheson, Eloise; Brooker, Graham

2012-12-01

During extravehicular activities (EVAs), pressurised space suits can lead to difficulties in performing hand manoeuvres and fatigue. This is often the cause of EVAs being terminated early, or taking longer to complete. Assistive robotic gloves can be used to augment the natural motion of a human hand, meaning work can be carried out more efficiently with less stress to the astronaut. Lightweight and low profile solutions must be found in order for the assistive robotic glove to be easily integrated with a space suit pressure garment. Pneumatic muscle actuators combined with force sensors are one such solution. These actuators are extremely light, yet can output high forces using pressurised gases as the actuation drive. Their movement is omnidirectional, so when combined with a flexible exoskeleton that itself provides a degree of freedom of movement, individual fingers can be controlled during flexion and extension. This setup allows actuators and other hardware to be stored remotely on the user's body, resulting in the least possible mass being supported by the hand. Two prototype gloves have been developed at the University of Sydney; prototype I using a fibreglass exoskeleton to provide flexion force, and prototype II using torsion springs to achieve the same result. The gloves have been designed to increase the ease of human movements, rather than to add unnatural ability to the hand. A state space control algorithm has been developed to ensure that human initiated movements are recognised, and calibration methods have been implemented to accommodate the different characteristics of each wearer's hands. For this calibration technique, it was necessary to take into account the natural tremors of the human hand which may have otherwise initiated unexpected control signals. Prototype I was able to actuate the user's hand in 1 degree of freedom (DOF) from full flexion to partial extension, and prototype II actuated a user's finger in 2 DOF with forces achieved

Low-cost design and fabrication of an anthropomorphic robotic hand.

Science.gov (United States)

Junaid, Ali Bin; Tahir, Sanan; Rasheed, Tahir; Ahmed, Sharjeel; Sohail, Mehreen; Afzal, Muhammad Raheel; Ali, Muzaffar; Kim, Yoonsoo

2014-10-01

Human hand signifies a magnificent and challenging example for scientists and engineers trying to replicate its complex structure and functionality. This paper proposes a bio-mechatronic approach for the design of an anthropomorphic artificial hand capable of performing basic human hand motions with fundamental gripping functionality. The dexterity of the artificial hand is exhibited by imitating the natural motion of the human fingers. Imitation is produced according to the data acquired from the flex sensors attached to the human fingers. In order to have proper gripping, closed-loop control is implemented using the tactile sensors. Feedback for the closed-loop control is provided by force sensing resistors (FSRs), attached on the fingertips of the robotic hand. These sensors also enable handling of fragile objects. The mathematical model is derived using forward kinematics and also simulated on MATLAB to ascertain the position of robotic fingers in 3D space.

78 FR 62348 - Erie Boulevard Hydropower L.P.; Notice of Application Tendered for Filing With the Commission and...

Science.gov (United States)

2013-10-18

... DEPARTMENT OF ENERGY Federal Energy Regulatory Commission [Project No. 7518-015] Erie Boulevard... and a maximum storage capacity of approximately 112 acre-feet; (2) a 247- foot-long, 11.5-foot-high concrete gravity dam with a spillway crest elevation of 165.2 feet above mean sea level; (3) a 34-foot-long...

A novel cortical target to enhance hand motor output in humans with spinal cord injury.

Science.gov (United States)

Long, Jinyi; Federico, Paolo; Perez, Monica A

2017-06-01

A main goal of rehabilitation strategies in humans with spinal cord injury is to strengthen transmission in spared neural networks. Although neuromodulatory strategies have targeted different sites within the central nervous system to restore motor function following spinal cord injury, the role of cortical targets remain poorly understood. Here, we use 180 pairs of transcranial magnetic stimulation for ∼30 min over the hand representation of the motor cortex at an interstimulus interval mimicking the rhythmicity of descending late indirect (I) waves in corticospinal neurons (4.3 ms; I-wave protocol) or at an interstimulus interval in-between I-waves (3.5 ms; control protocol) on separate days in a randomized order. Late I-waves are thought to arise from trans-synaptic cortical inputs and have a crucial role in the recruitment of spinal motor neurons following spinal cord injury. Motor evoked potentials elicited by transcranial magnetic stimulation, paired-pulse intracortical inhibition, spinal motor neuron excitability (F-waves), index finger abduction force and electromyographic activity as well as a hand dexterity task were measured before and after both protocols in 15 individuals with chronic incomplete cervical spinal cord injury and 17 uninjured participants. We found that motor evoked potentials size increased in spinal cord injury and uninjured participants after the I-wave but not the control protocol for ∼30 to 60 min after the stimulation. Intracortical inhibition decreased and F-wave amplitude and persistence increased after the I-wave but not the control protocol, suggesting that cortical and subcortical networks contributed to changes in corticospinal excitability. Importantly, hand motor output and hand dexterity increased in individuals with spinal cord injury after the I-wave protocol. These results provide the first evidence that late synaptic input to corticospinal neurons may represent a novel therapeutic target for improving motor function

Robot hand tackles jobs in hazardous areas

International Nuclear Information System (INIS)

Simms, Mark; Crowder, Richard.

1989-01-01

A robot hand and arm designed to mimic the operation of its human counterpart, developed at the University of Southampton for use in a standard industrial glovebox, is described. It was specifically designed for use in a radioactive environment moving high dosage components around. As dosage limits go down, there is a legal requirement to remove people from that environment. The nine-axis arm is for use in a glove designed for a human hand. Drive for the motors used to power the hand is from three-phase MOSFET inventor cards, the switching pattern controlled by the Hall effect communication sensors integral to each motor. The computer software for the arm allows the hand to be positioned using a joystick on a control box, with three levels of command for grip, pinch and touch. (author)

76 FR 63991 - Midwest Rail d/b/a Toledo, Lake Erie and Western Railway-Lease and Operation Exemption-Toledo...

Science.gov (United States)

2011-10-14

... provide common carrier rail service over the Line, connecting with and interchanging traffic with NSR, and... DEPARTMENT OF TRANSPORTATION Surface Transportation Board [Docket No. FD 35555] Midwest Rail d/b/a... Railway and Museum, Inc. Midwest Rail d/b/a Toledo, Lake Erie and Western Railway (Toledo), a noncarrier...

Mice overexpressing both non-mutated human SOD1 and mutated SOD1G93A genes: a competent experimental model for studying iron metabolism in amyotrophic lateral sclerosis

Directory of Open Access Journals (Sweden)

Anna eGajowiak

2016-01-01

Full Text Available Amyotrophic lateral sclerosis (ALS is a progressive neurodegenerative disease characterized by degeneration and loss of motor neurons in the spinal cord, brainstem and motor cortex. Up to 10% of ALS cases are inherited (familial, fALS and associated with mutations, frequently in the superoxide dismutase 1 (SOD1 gene. Rodent transgenic models of ALS are often used to elucidate a complex pathogenesis of this disease. Of importance, both ALS patients and animals carrying mutated human SOD1 gene show symptoms of oxidative stress and iron metabolism misregulation. The aim of our study was to characterize changes in iron metabolism in one of the most commonly used models of ALS – transgenic mice overexpressing human mutated SOD1G93A gene. We analyzed the expression of iron-related genes in asymptomatic, 2-month old and symptomatic, 4-month old SOD1G93A mice. In parallel, respective age-matched mice overexpressing human non-mutated SOD1 transgene and control mice were analyzed. We demonstrate that the overexpression of both SOD1 and SOD1G93A genes account for a substantial increase in SOD1 protein levels and activity in selected tissues and that not all the changes in iron metabolism genes expression are specific for the overexpression of the mutated form of SOD1.

Spawning site fidelity and apparent annual survival of walleye (Sander vitreus) differ between a Lake Huron and Lake Erie tributary

Science.gov (United States)

Hayden, Todd A.; Binder, Thomas; Holbrook, Christopher; Vandergoot, Christopher; Fielder, David G.; Cooke, Steven J.; Dettmers, John M.; Krueger, Charles C.

2018-01-01

Fidelity to spawning habitats can maximise reproductive success of fish by synchronising movements to sites of previous recruitment. To determine the role of reproductive fidelity in structuring walleye Sander vitreus populations in the Laurentian Great Lakes, we used acoustic telemetry combined with Cormack–Jolly–Seber capture–recapture models to estimate spawning site fidelity and apparent annual survival for the Tittabawassee River in Lake Huron and Maumee River in Lake Erie. Walleye in spawning condition were tagged from the Tittabawassee River in Lake Huron and Maumee River in Lake Erie in 2011–2012. Site fidelity and apparent annual survival were estimated from return of individuals to the stream where tagged. Site fidelity estimates were higher in the Tittabawassee River (95%) than the Maumee River (70%) and were not related to sex or fish length at tagging. Apparent annual survival of walleye tagged in the Tittabawassee did not differ among spawning seasons but was higher for female than male walleye and decreased linearly as fish length increased. Apparent annual survival of walleye tagged in the Maumee River did not differ among spawning seasons but was higher for female walleye than male walleye and increased linearly as fish length increased. Greater fidelity of walleye tagged in the Tittabawassee River than walleye tagged in the Maumee River may be related to the close proximity to the Maumee River of other spawning aggregations and multiple spawning sites in Lake Erie. As spawning site fidelity increases, management actions to conserve population structure require an increasing focus on individual stocks.

Position calibration of a 3-DOF hand-controller with hybrid structure

Science.gov (United States)

Zhu, Chengcheng; Song, Aiguo

2017-09-01

A hand-controller is a human-robot interactive device, which measures the 3-DOF (Degree of Freedom) position of the human hand and sends it as a command to control robot movement. The device also receives 3-DOF force feedback from the robot and applies it to the human hand. Thus, the precision of 3-DOF position measurements is a key performance factor for hand-controllers. However, when using a hybrid type 3-DOF hand controller, various errors occur and are considered originating from machining and assembly variations within the device. This paper presents a calibration method to improve the position tracking accuracy of hybrid type hand-controllers by determining the actual size of the hand-controller parts. By re-measuring and re-calibrating this kind of hand-controller, the actual size of the key parts that cause errors is determined. Modifying the formula parameters with the actual sizes, which are obtained in the calibrating process, improves the end position tracking accuracy of the device.

Unconstrained and contactless hand geometry biometrics.

Science.gov (United States)

de-Santos-Sierra, Alberto; Sánchez-Ávila, Carmen; Del Pozo, Gonzalo Bailador; Guerra-Casanova, Javier

2011-01-01

This paper presents a hand biometric system for contact-less, platform-free scenarios, proposing innovative methods in feature extraction, template creation and template matching. The evaluation of the proposed method considers both the use of three contact-less publicly available hand databases, and the comparison of the performance to two competitive pattern recognition techniques existing in literature: namely support vector machines (SVM) and k-nearest neighbour (k-NN). Results highlight the fact that the proposed method outcomes existing approaches in literature in terms of computational cost, accuracy in human identification, number of extracted features and number of samples for template creation. The proposed method is a suitable solution for human identification in contact-less scenarios based on hand biometrics, providing a feasible solution to devices with limited hardware requirements like mobile devices.

Unconstrained and Contactless Hand Geometry Biometrics

Directory of Open Access Journals (Sweden)

Carmen Sánchez-Ávila

2011-10-01

Full Text Available This paper presents a hand biometric system for contact-less, platform-free scenarios, proposing innovative methods in feature extraction, template creation and template matching. The evaluation of the proposed method considers both the use of three contact-less publicly available hand databases, and the comparison of the performance to two competitive pattern recognition techniques existing in literature: namely Support Vector Machines (SVM and k-Nearest Neighbour (k-NN. Results highlight the fact that the proposed method outcomes existing approaches in literature in terms of computational cost, accuracy in human identification, number of extracted features and number of samples for template creation. The proposed method is a suitable solution for human identification in contact-less scenarios based on hand biometrics, providing a feasible solution to devices with limited hardware requirements like mobile devices.

42 CFR 93.222 - Research.

Science.gov (United States)

2010-10-01

... 42 Public Health 1 2010-10-01 2010-10-01 false Research. 93.222 Section 93.222 Public Health... STUDIES OF HAZARDOUS SUBSTANCES RELEASES AND FACILITIES PUBLIC HEALTH SERVICE POLICIES ON RESEARCH MISCONDUCT Definitions § 93.222 Research. Research means a systematic experiment, study, evaluation...

9 CFR 93.801 - Prohibitions.

Science.gov (United States)

2010-01-01

... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Prohibitions. 93.801 Section 93.801 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE... CONVEYANCE AND SHIPPING CONTAINERS Elephants, Hippopotami, Rhinoceroses, and Tapirs § 93.801 Prohibitions...

Hand synergies: Integration of robotics and neuroscience for understanding the control of biological and artificial hands

Science.gov (United States)

Santello, Marco; Bianchi, Matteo; Gabiccini, Marco; Ricciardi, Emiliano; Salvietti, Gionata; Prattichizzo, Domenico; Ernst, Marc; Moscatelli, Alessandro; Jörntell, Henrik; Kappers, Astrid M. L.; Kyriakopoulos, Kostas; Albu-Schäffer, Alin; Castellini, Claudio; Bicchi, Antonio

2016-07-01

The term 'synergy' - from the Greek synergia - means 'working together'. The concept of multiple elements working together towards a common goal has been extensively used in neuroscience to develop theoretical frameworks, experimental approaches, and analytical techniques to understand neural control of movement, and for applications for neuro-rehabilitation. In the past decade, roboticists have successfully applied the framework of synergies to create novel design and control concepts for artificial hands, i.e., robotic hands and prostheses. At the same time, robotic research on the sensorimotor integration underlying the control and sensing of artificial hands has inspired new research approaches in neuroscience, and has provided useful instruments for novel experiments. The ambitious goal of integrating expertise and research approaches in robotics and neuroscience to study the properties and applications of the concept of synergies is generating a number of multidisciplinary cooperative projects, among which the recently finished 4-year European project ;The Hand Embodied; (THE). This paper reviews the main insights provided by this framework. Specifically, we provide an overview of neuroscientific bases of hand synergies and introduce how robotics has leveraged the insights from neuroscience for innovative design in hardware and controllers for biomedical engineering applications, including myoelectric hand prostheses, devices for haptics research, and wearable sensing of human hand kinematics. The review also emphasizes how this multidisciplinary collaboration has generated new ways to conceptualize a synergy-based approach for robotics, and provides guidelines and principles for analyzing human behavior and synthesizing artificial robotic systems based on a theory of synergies.

Hand synergies: Integration of robotics and neuroscience for understanding the control of biological and artificial hands

Science.gov (United States)

Santello, Marco; Bianchi, Matteo; Gabiccini, Marco; Ricciardi, Emiliano; Salvietti, Gionata; Prattichizzo, Domenico; Ernst, Marc; Moscatelli, Alessandro; Jörntell, Henrik; Kappers, Astrid M.L.; Kyriakopoulos, Kostas; Albu-Schäffer, Alin; Castellini, Claudio; Bicchi, Antonio

2017-01-01

The term ‘synergy’ – from the Greek synergia – means ‘working together’. The concept of multiple elements working together towards a common goal has been extensively used in neuroscience to develop theoretical frameworks, experimental approaches, and analytical techniques to understand neural control of movement, and for applications for neuro-rehabilitation. In the past decade, roboticists have successfully applied the framework of synergies to create novel design and control concepts for artificial hands, i.e., robotic hands and prostheses. At the same time, robotic research on the sensorimotor integration underlying the control and sensing of artificial hands has inspired new research approaches in neuroscience, and has provided useful instruments for novel experiments. The ambitious goal of integrating expertise and research approaches in robotics and neuroscience to study the properties and applications of the concept of synergies is generating a number of multidisciplinary cooperative projects, among which the recently finished 4-year European project “The Hand Embodied” (THE). This paper reviews the main insights provided by this framework. Specifically, we provide an overview of neuroscientific bases of hand synergies and introduce how robotics has leveraged the insights from neuroscience for innovative design in hardware and controllers for biomedical engineering applications, including myoelectric hand prostheses, devices for haptics research, and wearable sensing of human hand kinematics. The review also emphasizes how this multidisciplinary collaboration has generated new ways to conceptualize a synergy-based approach for robotics, and provides guidelines and principles for analyzing human behavior and synthesizing artificial robotic systems based on a theory of synergies. PMID:26923030

Hand synergies: Integration of robotics and neuroscience for understanding the control of biological and artificial hands.

Science.gov (United States)

Santello, Marco; Bianchi, Matteo; Gabiccini, Marco; Ricciardi, Emiliano; Salvietti, Gionata; Prattichizzo, Domenico; Ernst, Marc; Moscatelli, Alessandro; Jörntell, Henrik; Kappers, Astrid M L; Kyriakopoulos, Kostas; Albu-Schäffer, Alin; Castellini, Claudio; Bicchi, Antonio

2016-07-01

The term 'synergy' - from the Greek synergia - means 'working together'. The concept of multiple elements working together towards a common goal has been extensively used in neuroscience to develop theoretical frameworks, experimental approaches, and analytical techniques to understand neural control of movement, and for applications for neuro-rehabilitation. In the past decade, roboticists have successfully applied the framework of synergies to create novel design and control concepts for artificial hands, i.e., robotic hands and prostheses. At the same time, robotic research on the sensorimotor integration underlying the control and sensing of artificial hands has inspired new research approaches in neuroscience, and has provided useful instruments for novel experiments. The ambitious goal of integrating expertise and research approaches in robotics and neuroscience to study the properties and applications of the concept of synergies is generating a number of multidisciplinary cooperative projects, among which the recently finished 4-year European project "The Hand Embodied" (THE). This paper reviews the main insights provided by this framework. Specifically, we provide an overview of neuroscientific bases of hand synergies and introduce how robotics has leveraged the insights from neuroscience for innovative design in hardware and controllers for biomedical engineering applications, including myoelectric hand prostheses, devices for haptics research, and wearable sensing of human hand kinematics. The review also emphasizes how this multidisciplinary collaboration has generated new ways to conceptualize a synergy-based approach for robotics, and provides guidelines and principles for analyzing human behavior and synthesizing artificial robotic systems based on a theory of synergies. Copyright © 2016 Elsevier B.V. All rights reserved.

14 CFR 93.51 - Applicability.

Science.gov (United States)

2010-01-01

... AND GENERAL OPERATING RULES SPECIAL AIR TRAFFIC RULES Anchorage, Alaska, Terminal Area § 93.51... 14 Aeronautics and Space 2 2010-01-01 2010-01-01 false Applicability. 93.51 Section 93.51..., Terminal Area. [Doc. No. FAA-2002-13235, 68 FR 9795, Feb. 28, 2003] ...

Review of Reports on Lake Erie - Lake Ontario Waterway, New York. Appendix D. Economics.

Science.gov (United States)

1973-10-01

Venezuela (29 percent). Canada produced 48.3 million tons of iron ore in 1970 ,of which 23.9 million tons were exported to the United States (14.4 million...grain traffic, 1971 D-14 D-6 U.S. - Great Lakes grain exports 1960 - 1971 and projected D-15 D-7 U.S. doal traffic, Lake Erie - Lake Ontario, 1958-1970...Soybeans Wheat Barley Oats Rice Sorghum Grains Flaxseed Oilseeds, n.e.c. Tobacco, leaf Hay and Fodder Field crops, n.e.c. Fresh fruits Co ffee Cocoa beans

Reconnaissance survey for lightweight and carbon tetrachloride extractable hydrocarbons in the central and eastern basins of Lake Erie: September 1978

Energy Technology Data Exchange (ETDEWEB)

Zapotosky, J.E.; White, W.S.

1980-10-01

A reconnaissance survey of the central and eastern basins of Lake Erie (22,240 km/sup 2/) was conducted from September 17 to 27, 1978. The survey provided baseline information on natural gas and oil losses from geologic formations, prior to any potential development of natural gas resources beneath the United States portion of the Lake. Lightweight hydrocarbons indicative of natural gas (methane, ethane, propane, isobutane, and n-butane) are introduced into the waters of Lake Erie by escape from geologic formations and by biological/photochemical processes. The geochemical exploration technique of hydrocarbon sniffing provided enough data to reveal significant distribution patterns, approximate concentrations, and potential sources. Twelve sites with elevated lightweight hydrocarbon concentrations had a composition similar to natural gas. In one area of natural gas input, data analysis suggested a potential negative effect of natural gas on phytoplanktonic metabolism (i.e., ethylene concentration). Samples taken for liquid hydrocarbon analysis (carbon tetrachloride extractable hydrocarbons) correlated best with biologically derived lightweight hydrocarbons.

RELATIVE EFFICACY OF HUMAN SOCIAL INTERACTION AND FOOD AS REINFORCERS FOR DOMESTIC DOGS AND HAND-REARED WOLVES

Science.gov (United States)

Feuerbacher, Erica N; Wynne, Clive D. L

2012-01-01

Despite the intimate relationship dogs share with humans in Western society, we know relatively little about the variables that produce and maintain dog social behavior towards humans. One possibility is that human social interaction is itself a reinforcer for dog behavior. As an initial assessment of the variables that might maintain dog social behavior, we compared the relative efficacy of brief human social interaction to a small piece of food as a reinforcer for an arbitrary response (nose touch). We investigated this in three populations of canids: shelter dogs, owned dogs, and hand-reared wolves. Across all three canid populations, brief social interaction was a relatively ineffective reinforcer compared to food for most canids, producing lower responding and longer latencies than food. PMID:22851794

9 CFR 93.500 - Definitions.

Science.gov (United States)

2010-01-01

... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Definitions. 93.500 Section 93.500... CONVEYANCE AND SHIPPING CONTAINERS Swine § 93.500 Definitions. Wherever in this subpart the following terms..., Spain, Sweden, and the United Kingdom (England, Scotland, Wales, the Isle of Man, and Northern Ireland...

28 CFR 93.1 - Purpose.

Science.gov (United States)

2010-07-01

... 28 Judicial Administration 2 2010-07-01 2010-07-01 false Purpose. 93.1 Section 93.1 Judicial Administration DEPARTMENT OF JUSTICE (CONTINUED) PROVISIONS IMPLEMENTING THE VIOLENT CRIME CONTROL AND LAW ENFORCEMENT ACT OF 1994 Drug Courts § 93.1 Purpose. This part sets forth requirements and procedures to ensure...

Frontoparietal Tracts Linked to Lateralized Hand Preference and Manual Specialization.

Science.gov (United States)

Howells, Henrietta; Thiebaut de Schotten, Michel; Dell'Acqua, Flavio; Beyh, Ahmad; Zappalà, Giuseppe; Leslie, Anoushka; Simmons, Andrew; Murphy, Declan G; Catani, Marco

2018-04-21

Humans show a preference for using the right hand over the left for tasks and activities of everyday life. While experimental work in non-human primates has identified the neural systems responsible for reaching and grasping, the neural basis of lateralized motor behavior in humans remains elusive. The advent of diffusion imaging tractography for studying connectional anatomy in the living human brain provides the possibility of understanding the relationship between hemispheric asymmetry, hand preference, and manual specialization. In this study, diffusion tractography was used to demonstrate an interaction between hand preference and the asymmetry of frontoparietal tracts, specifically the dorsal branch of the superior longitudinal fasciculus, responsible for visuospatial integration and motor planning. This is in contrast to the corticospinal tract and the superior cerebellar peduncle, for which asymmetry was not related to hand preference. Asymmetry of the dorsal frontoparietal tract was also highly correlated with the degree of lateralization in tasks requiring visuospatial integration and fine motor control. These results suggest a common anatomical substrate for hand preference and lateralized manual specialization in frontoparietal tracts important for visuomotor processing.

Hand Injuries in the Oil Fields of Brunei Darussalam

Directory of Open Access Journals (Sweden)

Pramod Devkota

2013-03-01

Full Text Available Hands are essential organs and their agility and dexterity are vital to our daily lives. In the present study, we analysed 107 patients who presented at the local hospital with hand injuries sustained in the oil fields, oil industries and related employment sectors from the surrounding regions. All the patients were male and the mean age was 37.89 years (range,21-61y. Forty-seven (43.93% patients had simple cut injuries, 14 patients (13.08% had tendon injuries, 13 patients (12.14% had amputation of the digit (30.84% had bone fractures (including 20 (66.66% open fractures. Only 19 (17.75% patients were admitted in hospital for further treatment. Ninety-one (85.04% patients injured within one year of employment and 57(53.27% patients were not satisfied with instructions and orientation before starting their job. Hand injury is one of the most common injuries in the oil industry and overtime work further increases incidence of this injury.

29 CFR 93.105 - Definitions.

Science.gov (United States)

2010-07-01

... services in the private sector. (o) Recipient includes all contractors, subcontractors at any tier, and... 29 Labor 1 2010-07-01 2010-07-01 true Definitions. 93.105 Section 93.105 Labor Office of the Secretary of Labor NEW RESTRICTIONS ON LOBBYING General § 93.105 Definitions. For purposes of this part: (a...

Reorganization of the Human Somatosensory Cortex in Hand Dystonia

Directory of Open Access Journals (Sweden)

Maria Jose Catalan

2012-05-01

Full Text Available Background and Purpose: Abnormalities of finger representations in the somatosensory cortex have been identified in patients with focal hand dystonia. Measuring blood flow with positron emission tomography (PET can be use to demonstrate functional localization of receptive fields. Methods: A vibratory stimulus was applied to the right thumb and little finger of six healthy volunteers and six patients with focal hand dystonia to map their receptive fields using H215O PET. Results: The cortical finger representations in the primary somatosensory cortex were closer to each other in patients than in normal subjects. No abnormalities were found in secondary somatosensory cortex, but the somatotopy there is less well distinguished. Conclusions: These data confirm prior electrophysiological and functional neuroimaging observations showing abnormalities of finger representations in somatosensory cortex of patients with focal hand dystonia.

Effects of complex effluents on photosynthesis in Lake Erie and Lake Huron

International Nuclear Information System (INIS)

Bridgham, S.D.; McNaught, D.C.; Meadows, C.

1988-01-01

Phytoplankton are the base of the food chain in most large lake ecosystems; if affected by environmental pollutants, significant ecosystem changes can result with potential impact on higher trophic levels. The research determined the effects of a complex effluent discharge from the River Raisin in Monroe County, Michigan, on the Lake Erie ecosystem. The river flows through southern Michigan and has large nutrient and industrial inputs, especially in the Monroe Harbor area. The functional parameters measured were bacterial uptake rate of acetate, zooplankton feeding and reproduction rates, and primary production. The results of the effects of complex effluents on gross photosynthesis, measured as carbon-14 ((14)C) uptake, are presented in the paper

42 CFR 93.512 - Discovery.

Science.gov (United States)

2010-10-01

... 42 Public Health 1 2010-10-01 2010-10-01 false Discovery. 93.512 Section 93.512 Public Health... Process § 93.512 Discovery. (a) Request to provide documents. A party may only request another party to...) Responses to a discovery request. Within 30 days of receiving a request for the production of documents, a...

Coordination of hand shape.

Science.gov (United States)

Pesyna, Colin; Pundi, Krishna; Flanders, Martha

2011-03-09

The neural control of hand movement involves coordination of the sensory, motor, and memory systems. Recent studies have documented the motor coordinates for hand shape, but less is known about the corresponding patterns of somatosensory activity. To initiate this line of investigation, the present study characterized the sense of hand shape by evaluating the influence of differences in the amount of grasping or twisting force, and differences in forearm orientation. Human subjects were asked to use the left hand to report the perceived shape of the right hand. In the first experiment, six commonly grasped items were arranged on the table in front of the subject: bottle, doorknob, egg, notebook, carton, and pan. With eyes closed, subjects used the right hand to lightly touch, forcefully support, or imagine holding each object, while 15 joint angles were measured in each hand with a pair of wired gloves. The forces introduced by supporting or twisting did not influence the perceptual report of hand shape, but for most objects, the report was distorted in a consistent manner by differences in forearm orientation. Subjects appeared to adjust the intrinsic joint angles of the left hand, as well as the left wrist posture, so as to maintain the imagined object in its proper spatial orientation. In a second experiment, this result was largely replicated with unfamiliar objects. Thus, somatosensory and motor information appear to be coordinated in an object-based, spatial-coordinate system, sensitive to orientation relative to gravitational forces, but invariant to grasp forcefulness.

Optimization of Pb(Zr0.53,Ti0.47)O3 films for micropower generation using integrated cantilevers

KAUST Repository

Fuentes-Fernandez, E. M A; Baldenegro-Pé rez, Leonardo Aurelio; Quevedo-Ló pez, Manuel Angel Quevedo; Gnade, Bruce E.; Hande, Abhiman; Shah, Pradeep; Alshareef, Husam N.

2011-01-01

Lead zirconate titanate, Pb(Zr0.53,Ti0.47)O 3 or PZT, thin films and integrated cantilevers have been fabricated for energy harvesting applications. The PZT films were deposited on PECVD SiO2/Si substrates with a sol-gel derived ZrO2 buffer layer

21 CFR 808.93 - Texas.

Science.gov (United States)

2010-04-01

... 21 Food and Drugs 8 2010-04-01 2010-04-01 false Texas. 808.93 Section 808.93 Food and Drugs FOOD... and Local Exemptions § 808.93 Texas. (a) The following Texas medical device requirement is enforceable... that, in enforcing this requirement, Texas apply the definition of “used hearing aid” in § 801.420(a)(6...

Damage free Ar ion plasma surface treatment on In{sub 0.53}Ga{sub 0.47}As-on-silicon metal-oxide-semiconductor device

Energy Technology Data Exchange (ETDEWEB)

Koh, Donghyi; Shin, Seung Heon; Ahn, Jaehyun; Sonde, Sushant; Banerjee, Sanjay K. [Department of Electrical and Computer Engineering, Microelectronics Research Center, The University of Texas at Austin, 10100 Burnet Road, Austin, Texas 78758 (United States); Kwon, Hyuk-Min [SK Hynix, Icheon, 2091, Gyeongchung-daero, Bubal-eub, Icheon-si, Gyeonggi-do 136-1 (Korea, Republic of); Orzali, Tommaso; Kim, Tae-Woo, E-mail: twkim78@gmail.com [SEMATECH Inc., 257 Fuller Rd #2200, Albany, New York 12203 (United States); Kim, Dae-Hyun [Kyungpook National University, 80, Daehak-ro, Buk-gu, Daegu 702-701 (Korea, Republic of)

2015-11-02

In this paper, we investigated the effect of in-situ Ar ion plasma surface pre-treatment in order to improve the interface properties of In{sub 0.53}Ga{sub 0.47}As for high-κ top-gate oxide deposition. X-ray photoelectron spectroscopy (XPS) and metal-oxide-semiconductor capacitors (MOSCAPs) demonstrate that Ar ion treatment removes the native oxide on In{sub 0.53}Ga{sub 0.47}As. The XPS spectra of Ar treated In{sub 0.53}Ga{sub 0.47}As show a decrease in the AsO{sub x} and GaO{sub x} signal intensities, and the MOSCAPs show higher accumulation capacitance (C{sub acc}), along with reduced frequency dispersion. In addition, Ar treatment is found to suppress the interface trap density (D{sub it}), which thereby led to a reduction in the threshold voltage (V{sub th}) degradation during constant voltage stress and relaxation. These results outline the potential of surface treatment for III-V channel metal-oxide-semiconductor devices and application to non-planar device process.

Double nerve intraneural interface implant on a human amputee for robotic hand control.

Science.gov (United States)

Rossini, Paolo M; Micera, Silvestro; Benvenuto, Antonella; Carpaneto, Jacopo; Cavallo, Giuseppe; Citi, Luca; Cipriani, Christian; Denaro, Luca; Denaro, Vincenzo; Di Pino, Giovanni; Ferreri, Florinda; Guglielmelli, Eugenio; Hoffmann, Klaus-Peter; Raspopovic, Stanisa; Rigosa, Jacopo; Rossini, Luca; Tombini, Mario; Dario, Paolo

2010-05-01

The principle underlying this project is that, despite nervous reorganization following upper limb amputation, original pathways and CNS relays partially maintain their function and can be exploited for interfacing prostheses. Aim of this study is to evaluate a novel peripheral intraneural multielectrode for multi-movement prosthesis control and for sensory feed-back, while assessing cortical reorganization following the re-acquired stream of data. Four intrafascicular longitudinal flexible multielectrodes (tf-LIFE4) were implanted in the median and ulnar nerves of an amputee; they reliably recorded output signals for 4 weeks. Artificial intelligence classifiers were used off-line to analyse LIFE signals recorded during three distinct hand movements under voluntary order. Real-time control of motor output was achieved for the three actions. When applied off-line artificial intelligence reached >85% real-time correct classification of trials. Moreover, different types of current stimulation were determined to allow reproducible and localized hand/fingers sensations. Cortical organization was observed via TMS in parallel with partial resolution of symptoms due to the phantom-limb syndrome (PLS). tf-LIFE4s recorded output signals in human nerves for 4 weeks, though the efficacy of sensory stimulation decayed after 10 days. Recording from a number of fibres permitted a high percentage of distinct actions to be classified correctly. Reversal of plastic changes and alleviation of PLS represent corollary findings of potential therapeutic benefit. This study represents a breakthrough in robotic hand use in amputees. Copyright 2010 International Federation of Clinical Neurophysiology. Published by Elsevier Ireland Ltd. All rights reserved.

Hydrology and environmental aspects of Erie Canal (1817-99)

Science.gov (United States)

Langbein, Walter Basil

1976-01-01

As the first major water project in the United States, the old Erie Canal provides an example of the hydrological and environmental consequences of water development. The available record shows that the project aroused environmental fears that the canal might be impaired by the adverse hydrologic effects of land development induced by the canal. Water requirements proved greater than anticipated, and problems of floods and hydraulic inefficiencies beset navigation throughout its history. The Erie Canal proved the practicality of major hydraulic works to the extent that operations and maintenance could cope with the burdens of deficiencies in design. The weight of prior experience that upland streams, such as the Potomac and Mohawk Rivers, had proved unsatisfactory for dependable navigation, led to a decision to build an independent canal which freed the location from the constraints of river channels and made possible a cross-country water route directly to Lake Erie. The decision on dimensioning the canal prism--chiefly width and depth-involved balance between a fear of building too small and thus not achieving the economic potentials, and a fear of building too expensively. The constraints proved effective, and for the first part of its history the revenues collected were sufficient to repay all costs. So great was the economic advantage of the canal that the rising trend in traffic soon induced an enlargement of the canal cross section, based upon a new but riskier objective-build as large as the projected trend in toll revenues would finance. The increased revenues did not materialize. Water supplies were a primary concern for both the planners and the operators of the canal. Water required for lockage, although the most obvious to the planners, proved to be a relatively minor item compared with the amounts of water that were required to compensate for leakage through the bed and banks of the canal. Leakage amounted to about 8 inches of depth per day. The total

2D Hand Tracking Based on Flocking with Obstacle Avoidance

Directory of Open Access Journals (Sweden)

Zihong Chen

2014-02-01

Full Text Available Hand gesture-based interaction provides a natural and powerful means for human-computer interaction. It is also a good interface for human-robot interaction. However, most of the existing proposals are likely to fail when they meet some skin-coloured objects, especially the face region. In this paper, we present a novel hand tracking method which can track the features of the hand based on the obstacle avoidance flocking behaviour model to overcome skin-coloured distractions. It allows features to be split into two groups under severe distractions and merge later. The experiment results show that our method can track the hand in a cluttered background or when passing the face, while the Flocking of Features (FoF and the Mean Shift Embedded Particle Filter (MSEPF methods may fail. These results suggest that our method has better performance in comparison with the previous methods. It may therefore be helpful to promote the use of the hand gesture-based human-robot interaction method.

Convergence of human brain mapping tools: neuronavigated TMS parameters and fMRI activity in the hand motor area.

Science.gov (United States)

Sarfeld, Anna-Sophia; Diekhoff, Svenja; Wang, Ling E; Liuzzi, Gianpiero; Uludağ, Kamil; Eickhoff, Simon B; Fink, Gereon R; Grefkes, Christian

2012-05-01

Functional magnetic resonance imaging (fMRI) and transcranial magnetic stimulation (TMS) are well-established tools for investigating the human motor system in-vivo. We here studied the relationship between movement-related fMRI signal changes in the primary motor cortex (M1) and electrophysiological properties of the hand motor area assessed with neuronavigated TMS in 17 healthy subjects. The voxel showing the highest task-related BOLD response in the left hand motor area during right hand movements was identified for each individual subject. This fMRI peak voxel in M1 served as spatial target for coil positioning during neuronavigated TMS. We performed correlation analyses between TMS parameters, BOLD signal estimates and effective connectivity parameters of M1 assessed with dynamic causal modeling (DCM). The results showed a negative correlation between the movement-related BOLD signal in left M1 and resting as well as active motor threshold (MT) obtained for left M1. The DCM analysis revealed that higher excitability of left M1 was associated with a stronger coupling between left supplementary motor area (SMA) and M1. Furthermore, BOLD activity in left M1 correlated with ipsilateral silent period (ISP), i.e. the stronger the task-related BOLD response in left M1, the higher interhemispheric inhibition effects targeting right M1. DCM analyses revealed a positive correlation between the coupling of left SMA with left M1 and the duration of ISP. The data show that TMS parameters assessed for the hand area of M1 do not only reflect the intrinsic properties at the stimulation site but also interactions with remote areas in the human motor system. Copyright © 2011 Wiley-Liss, Inc.

Robotic hand with locking mechanism using TCP muscles for applications in prosthetic hand and humanoids

Science.gov (United States)

Saharan, Lokesh; Tadesse, Yonas

2016-04-01

This paper presents a biomimetic, lightweight, 3D printed and customizable robotic hand with locking mechanism consisting of Twisted and Coiled Polymer (TCP) muscles based on nylon precursor fibers as artificial muscles. Previously, we have presented a small-sized biomimetic hand using nylon based artificial muscles and fishing line muscles as actuators. The current study focuses on an adult-sized prosthetic hand with improved design and a position/force locking system. Energy efficiency is always a matter of concern to make compact, lightweight, durable and cost effective devices. In natural human hand, if we keep holding objects for long time, we get tired because of continuous use of energy for keeping the fingers in certain positions. Similarly, in prosthetic hands we also need to provide energy continuously to artificial muscles to hold the object for a certain period of time, which is certainly not energy efficient. In this work we, describe the design of the robotic hand and locking mechanism along with the experimental results on the performance of the locking mechanism.

The role of human parietal area 7A as a link between sequencing in hand actions and in overt speech production

Directory of Open Access Journals (Sweden)

Stefan eHeim

2012-12-01

Full Text Available Research on the evolutionary basis of the human language faculty has proposed the mirror neuron system as a link between motor processing and speech development. Consequently, most work has focussed on the left inferior frontal cortex, in particular Broca's region, and the left inferior parietal cortex. However, the direct link between planning of hand motor and speech actions remains to be elucidated. Thus, the present study investigated whether sequencing of hand motor actions vs. speech motor actions has a common neural denominator. For the hand motor task, 25 subjects performed single, repeated, or sequenced button presses with either the left or right hand. The speech task was in analogy; the same subjects produced the syllable "po" once or repeatedly, or a sequence of different syllables (po-pi-po. Speech motor vs. hand motor effectors resulted in increased perisylvian activation including Broca's region (left area 44 and areas medially adjacent to left area 45. In contrast, common activation for sequenced vs. repeated production of button presses and syllables revealed the effector-independent involvement of left area 7A in the superior parietal lobule (SPL in sequencing. These data demonstrate that sequencing of vocal gestures, an important precondition for ordered utterances and ultimately human speech, shares area 7A, rather than inferior parietal regions, as a common cortical module with hand motor sequencing. Interestingly, area 7A has previously also been shown to be involved in the observation of hand and non-hand actions. In combination with the literature, the present data thus suggest a distinction between area 44, which is specifically recruited for (cognitive aspects of speech, and SPL area 7A for general aspects of motor sequencing. In sum, the study demonstrates a yet little considered role of the superior parietal lobule in the origins of speech, and may be discussed in the light of embodiment of speech and language in the

Binary Star Orbits. V. The Nearby White Dwarf/Red Dwarf Pair 40 Eri BC

Science.gov (United States)

Mason, Brian D.; Hartkopf, William I.; Miles, Korie N.

2017-11-01

A new relative orbit solution with new dynamical masses is determined for the nearby white dwarf-red dwarf pair 40 Eri BC. The period is 230.09 ± 0.68 years. It is predicted to close slowly over the next half-century, getting as close as 1.″32 in early 2066. We determine masses of 0.575 ± 0.018 {{ M }}⊙ for the white dwarf and 0.2041 ± 0.0064 {{ M }}⊙ for the red dwarf companion. The inconsistency of the masses determined by gravitational redshift and dynamical techniques, due to a premature orbit calculation, no longer exists.

UHT Yöntemiyle İşlenmiş Sterilize Sütün Besin Değeri

Directory of Open Access Journals (Sweden)

Emel Sezgin

2015-02-01

Full Text Available Sütün bir gıda olarak değeri günümüzde artık çok iyi bilinmektedir. Özellikle ülkemiz gibi hayvansal proteinin az tüketildiği yerlerde, içinde ihtiyacımız olan besin elementlerinin hemen hemen hepsini yeterli ve dengeli bir şekilde bulunduran sütün önemi daha da artmaktadır. Bilindiği gibi sütün besin değeri tamamen sütün bileşimiyle ilgili bulunmakta ve bu da hayvanın, türü, ırkı, yem, laktasyon mevsim ve benzeri faktörlerle geniş ölçüde değişmektedir. Süt esas olarak protein, kalsiyum ve bazı suda eriyen vitaminler yönünden önem taşımaktadır. Örneğin, 0.5 L süt 5 yaşındaki bir çocuğun protein ihtiyacının %40’ını kalsiyum ve riboflavin ihtiyacının %70’ni, tiamin, folik asit, A vitamini ihtiyacının 1/3’ni, B12 vitamini ihtiyacının ise tamamını karşılayabilmektedir.

Finger tips detection for two handed gesture recognition

Science.gov (United States)

Bhuyan, M. K.; Kar, Mithun Kumar; Neog, Debanga Raj

2011-10-01

In this paper, a novel algorithm is proposed for fingertips detection in view of two-handed static hand pose recognition. In our method, finger tips of both hands are detected after detecting hand regions by skin color-based segmentation. At first, the face is removed in the image by using Haar classifier and subsequently, the regions corresponding to the gesturing hands are isolated by a region labeling technique. Next, the key geometric features characterizing gesturing hands are extracted for two hands. Finally, for all possible/allowable finger movements, a probabilistic model is developed for pose recognition. Proposed method can be employed in a variety of applications like sign language recognition and human-robot-interactions etc.

Laser irradiation of disk targets at 0.53 μm wavelength

International Nuclear Information System (INIS)

Mead, W.C.; Campbell, E.M.; Estabrook, K.G.

1981-01-01

We present results and analysis for laser-irradiations of Be, CH, Ti, and Au disk targets with 0.53 μm light in 3 to 35 J, 600 ps pulses, at nominal intensities from 3 x 10 13 to approx. 4 x 10 15 W/cm 2 . The measured absorptions are higher than observed in similar 1.06 μm irradiations, and are largely consistent with modeling which shows the importance of inverse bremsstrahlung and Brillouin scattering. Observed red-shifted back-reflected light shows that Brillouin is operating at low to moderate levels. The measured fluxes of multi-keV x-rays indicate low hot-electron fractions, with temperatures which are consistent with resonance absorption. Measurements show efficient conversion of absorbed light into sub-keV x-rays, with time-, angular-, and spatial-emission distributions which are generally consistent with non-LTE modeling using inhibited thermal electron transport

Underactuated hands : Fundamentals, performance analysis and design

NARCIS (Netherlands)

Kragten, G.A.

2011-01-01

There is an emerging need to apply adaptive robotic hands to substitute humans in dangerous, laborious, or monotonous work. The state-of-the-art robotic hands cannot fulfill this need, because they are expensive, hard to control and they consist of many vulnerable motors and sensors. It is aimed to

Development of a prototype over-actuated biomimetic prosthetic hand.

Directory of Open Access Journals (Sweden)

Matthew R Williams

Full Text Available The loss of a hand can greatly affect quality of life. A prosthetic device that can mimic normal hand function is very important to physical and mental recuperation after hand amputation, but the currently available prosthetics do not fully meet the needs of the amputee community. Most prosthetic hands are not dexterous enough to grasp a variety of shaped objects, and those that are tend to be heavy, leading to discomfort while wearing the device. In order to attempt to better simulate human hand function, a dexterous hand was developed that uses an over-actuated mechanism to form grasp shape using intrinsic joint mounted motors in addition to a finger tendon to produce large flexion force for a tight grip. This novel actuation method allows the hand to use small actuators for grip shape formation, and the tendon to produce high grip strength. The hand was capable of producing fingertip flexion force suitable for most activities of daily living. In addition, it was able to produce a range of grasp shapes with natural, independent finger motion, and appearance similar to that of a human hand. The hand also had a mass distribution more similar to a natural forearm and hand compared to contemporary prosthetics due to the more proximal location of the heavier components of the system. This paper describes the design of the hand and controller, as well as the test results.

Air Muscle Actuated Low Cost Humanoid Hand

Directory of Open Access Journals (Sweden)

Peter Scarfe

2008-11-01

Full Text Available The control of humanoid robot hands has historically been expensive due to the cost of precision actuators. This paper presents the design and implementation of a low-cost air muscle actuated humanoid hand developed at Curtin University of Technology. This hand offers 10 individually controllable degrees of freedom ranging from the elbow to the fingers, with overall control handled through a computer GUI. The hand is actuated through 20 McKibben-style air muscles, each supplied by a pneumatic pressure-balancing valve that allows for proportional control to be achieved with simple and inexpensive components. The hand was successfully able to perform a number of human-equivalent tasks, such as grasping and relocating objects.

Air Muscle Actuated Low Cost Humanoid Hand

Directory of Open Access Journals (Sweden)

Peter Scarfe

2006-06-01

Full Text Available The control of humanoid robot hands has historically been expensive due to the cost of precision actuators. This paper presents the design and implementation of a low-cost air muscle actuated humanoid hand developed at Curtin University of Technology. This hand offers 10 individually controllable degrees of freedom ranging from the elbow to the fingers, with overall control handled through a computer GUI. The hand is actuated through 20 McKibben-style air muscles, each supplied by a pneumatic pressure-balancing valve that allows for proportional control to be achieved with simple and inexpensive components. The hand was successfully able to perform a number of human-equivalent tasks, such as grasping and relocating objects.

Non-primary motor areas in the human frontal lobe are connected directly to hand muscles.

Science.gov (United States)

Teitti, S; Määttä, S; Säisänen, L; Könönen, M; Vanninen, R; Hannula, H; Mervaala, E; Karhu, J

2008-04-15

Structural studies in primates have shown that, in addition to the primary motor cortex (M1), premotor areas are a source of corticospinal tracts. The function of these putative corticospinal neuronal tracts in humans is still unclear. We found frontal non-primary motor areas (NPMAs), which react to targeted non-invasive magnetic pulses and activate peripheral muscles as fast as or even faster than those in M1. Hand muscle movements were observed in all our subjects about 20 ms after transcranial stimulation of the superior frontal gyrus (Brodmann areas 6 and 8). Stimulation of NPMA could activate both proximal and distal upper limb muscles with the same delay as a stimulation of the M1, indicating converging motor representations with direct functional connections to the hand. We suggest that these non-primary cortical motor representations provide additional capacity for the fast execution of movements. Such a capacity may play a role in motor learning and in recovery from motor deficits.

Do right-handed monkeys use the right cheek pouch before the left?

Directory of Open Access Journals (Sweden)

Madhur Mangalam

Full Text Available There can be several factors that are likely to have played a role in the evolution of hand preference in humans and non-human primates, which the existing theories do not consider. There exists a possibility that hand preference in non-human primates evolved from the pre-existing lateralities in more elementary brain functions and behavior, or alternatively, the two coevolved. A basic example can be a hand-mouth command system that could have evolved in the context of ingestion. In the present study, we examined the relationship between lateralities in prehension and mastication processes, that is, hand and cheek pouch usage, in free-ranging bonnet macaques, Macaca radiata. The macaques preferentially used one hand-the 'preferred' hand, to pick up the bananas lying on the ground. Lateralities in hand and cheek pouch usage (for both filling and emptying were positively related with each other, that is, the macaques used the cheek pouch corresponding to the preferred hand predominantly and before the other. Moreover, when the macaques used the non-preferred hand to pick up the bananas, the frequency of contralateral cheek pouch usage was higher than the frequency of ipsilateral cheek pouch usage, that is, the combined structure of hand, mouth, and food did not influence the relationship between laterality in hand usage and laterality in cheek pouch usage. These findings demonstrate laterality in a relatively more involuntary function than those explored previously in any non-human primate species (e.g., facial expressions and manual gestures.

The visual development of hand-centered receptive fields in a neural network model of the primate visual system trained with experimentally recorded human gaze changes.

Science.gov (United States)

Galeazzi, Juan M; Navajas, Joaquín; Mender, Bedeho M W; Quian Quiroga, Rodrigo; Minini, Loredana; Stringer, Simon M

2016-01-01

Neurons have been found in the primate brain that respond to objects in specific locations in hand-centered coordinates. A key theoretical challenge is to explain how such hand-centered neuronal responses may develop through visual experience. In this paper we show how hand-centered visual receptive fields can develop using an artificial neural network model, VisNet, of the primate visual system when driven by gaze changes recorded from human test subjects as they completed a jigsaw. A camera mounted on the head captured images of the hand and jigsaw, while eye movements were recorded using an eye-tracking device. This combination of data allowed us to reconstruct the retinal images seen as humans undertook the jigsaw task. These retinal images were then fed into the neural network model during self-organization of its synaptic connectivity using a biologically plausible trace learning rule. A trace learning mechanism encourages neurons in the model to learn to respond to input images that tend to occur in close temporal proximity. In the data recorded from human subjects, we found that the participant's gaze often shifted through a sequence of locations around a fixed spatial configuration of the hand and one of the jigsaw pieces. In this case, trace learning should bind these retinal images together onto the same subset of output neurons. The simulation results consequently confirmed that some cells learned to respond selectively to the hand and a jigsaw piece in a fixed spatial configuration across different retinal views.

9 CFR 93.325 - Horses from Mexico.

Science.gov (United States)

2010-01-01

... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Horses from Mexico. 93.325 Section 93... CONVEYANCE AND SHIPPING CONTAINERS Horses Mexico 18 § 93.325 Horses from Mexico. Horses offered for entry from Mexico shall be inspected as provided in §§ 93.306 and 93.323; shall be accompanied by a...

Cesium adsorption on In0.53Ga0.47As (1 0 0) β2 (2 × 4) surface: A first-principles research

International Nuclear Information System (INIS)

Guo, Jing; Chang, Benkang; Jin, Muchun; Wang, Honggang; Wang, MeiShan

2015-01-01

Highlights: • Eight different cesium adsorption In 0.53 Ga 0.47 As (1 0 0) β 2 (2 × 4) surface models have been built. • Surface characteristics of the cesium adsorption In 0.53 Ga 0.47 As (1 0 0) β 2 (2 × 4) surfaces are investigated based on the first principle. • New energy bands appear and band gap is narrowed after adsorption. • The cesium adsorption enhances the surface ionization. • T 2 and T 3 are the reasonable adsorption sites relatively. - Abstract: In 0.53 Ga 0.47 As is a perfect III–V compound semiconductor for the photoemissive layer of the infrared-extension negative electron affinity photocathode. It is the key step for the formation of negative electron affinity that the cesium atoms and oxygen atoms activate the photocathode surface alternately. Geometry optimizations based on the first principles have been carried out for the In 0.53 Ga 0.47 As (1 0 0) β 2 (2 × 4) surfaces with a cesium atom adsorbed on 8 different possible sites named as D, D′, T 2 , T 2 ′, T 3 , T 3 ′, T 4 and T 4 ′. The surfaces characteristics have been investigated before and after adsorption from the point of negative electron affinity formation. Meanwhile, the surface atom structure, the adsorption energy, work function, surface energy bands, charge transfer and the dipole generation of the 8 different adsorption surfaces have been compared to each other. The work function and the surface energy bands have been analyzed in detail, which are closely related with the photoelectrons escaping from the surface. The surface work functions are all decreased in varying degrees and energy band bends all appear at the 8 different adsorption sites due to the surface charge transfer and the dipole formation. In conclusion, T 2 and T 3 are the favorable adsorption sites relatively. The surfaces with a cesium atom adsorbed on these two sites are most stable and have much lower work functions, which generates reasonable energy band bend and is benefit for the

Consumer attitudes about health care-acquired infections and hand hygiene.

Science.gov (United States)

McGuckin, Maryanne; Waterman, Richard; Shubin, Arlene

2006-01-01

Mandatory reporting and disclosure of health care-acquired infections have resulted in controversy over the perceived notion that consumers will not understand how to interpret data and that such information may negatively influence utilization of hospitals. The objective was to determine consumers' attitudes about health care-acquired infections, hand hygiene practices, and patient empowerment. A telephone survey based on a random digit dialing sample of all households in the United States was conducted. Consumers were asked about choosing a hospital, hand hygiene practices, and health care-acquired infections. Some 94% of respondents rated environmental cleanliness as very important. Hospital infection rates would influence decision making for 93% of consumers. Four in 5 consumers said they would ask their health care worker to wash and sanitize his or her hands. Our findings strongly suggest that (1) consumers will use infection data in selecting and/or leaving a hospital system and (2) consumers are ready to be empowered with information to ensure a positive outcome.

Food of forage fishes in western Lake Erie, 1975-76

Science.gov (United States)

Muth, Kenneth M.; Busch, Wolf-Dieter N.

1989-01-01

In western Lake Erie in the summer and fall of 1975–1976, food eaten by seven forage fishes—emerald shiner (Notropis atherinoides), spottail shiner (Notropis hudsonius), trout-perch (Percopsis omiscomaycus), andyoung-of-the-year (YOY) of alewife (Alosa pseudoharengus), gizzard shad (Dorosoma cepedianum), white bass (Morone chrysops), and freshwater drum (Aplodi-notus grunniens)—was divided among six major taxa: Cladocera, Copepoda, Diptera, Ostracoda, Amphipoda, and Algae. In addition, fish were eaten by YOY white bass, and Rotifera were consumed by YOY gizzard shad. Interspecies diet overlap indices, calculated to compare the food of the different species and to evaluate diet similarities, were usually highest for YOY white bass and YOY freshwater drum when compared with the other species and usually lowest between emerald shiners and all other forage fishes. Understanding the feeding interactions among fishes that could influence production at the forage-food level of the food web could provide insight into how cascading trophic interactions influence the production of piscivorous predators.

Hand Grasping Synergies As Biometrics.

Science.gov (United States)

Patel, Vrajeshri; Thukral, Poojita; Burns, Martin K; Florescu, Ionut; Chandramouli, Rajarathnam; Vinjamuri, Ramana

2017-01-01

Recently, the need for more secure identity verification systems has driven researchers to explore other sources of biometrics. This includes iris patterns, palm print, hand geometry, facial recognition, and movement patterns (hand motion, gait, and eye movements). Identity verification systems may benefit from the complexity of human movement that integrates multiple levels of control (neural, muscular, and kinematic). Using principal component analysis, we extracted spatiotemporal hand synergies (movement synergies) from an object grasping dataset to explore their use as a potential biometric. These movement synergies are in the form of joint angular velocity profiles of 10 joints. We explored the effect of joint type, digit, number of objects, and grasp type. In its best configuration, movement synergies achieved an equal error rate of 8.19%. While movement synergies can be integrated into an identity verification system with motion capture ability, we also explored a camera-ready version of hand synergies-postural synergies. In this proof of concept system, postural synergies performed well, but only when specific postures were chosen. Based on these results, hand synergies show promise as a potential biometric that can be combined with other hand-based biometrics for improved security.

Hand Grasping Synergies As Biometrics

Directory of Open Access Journals (Sweden)

Ramana Vinjamuri

2017-05-01

Full Text Available Recently, the need for more secure identity verification systems has driven researchers to explore other sources of biometrics. This includes iris patterns, palm print, hand geometry, facial recognition, and movement patterns (hand motion, gait, and eye movements. Identity verification systems may benefit from the complexity of human movement that integrates multiple levels of control (neural, muscular, and kinematic. Using principal component analysis, we extracted spatiotemporal hand synergies (movement synergies from an object grasping dataset to explore their use as a potential biometric. These movement synergies are in the form of joint angular velocity profiles of 10 joints. We explored the effect of joint type, digit, number of objects, and grasp type. In its best configuration, movement synergies achieved an equal error rate of 8.19%. While movement synergies can be integrated into an identity verification system with motion capture ability, we also explored a camera-ready version of hand synergies—postural synergies. In this proof of concept system, postural synergies performed well, but only when specific postures were chosen. Based on these results, hand synergies show promise as a potential biometric that can be combined with other hand-based biometrics for improved security.

Design and implementation of a dexterous anthropomorphic robotic typing (DART) hand

International Nuclear Information System (INIS)

Thayer, Nicholas; Priya, Shashank

2011-01-01

This paper focuses on design and implementation of a biomimetic dexterous humanoid hand. Several design rules are proposed to retain human form and functionality in a robotic hand while overcoming the difficultly of actuation within a confined geometry. Size and weight have been optimized in order to achieve human-like performance with the prime objective of typing on a computer keyboard. Each finger has four joints and three degrees of freedom (DOF) while the thumb has an additional degree of freedom necessary for manipulating small objects. The hand consists of 16 servo motors dedicated to finger motion and three motors for wrist motion. A closed-loop kinematic control scheme utilizing the Denavit–Hartenberg convention for spatial joint positioning was implemented. Servo motors housed in the forearm act as an origin for wires to travel to their insertion points in the hand. The dexterity of the DART hand was measured by quantifying functionality and typing speed on a standard keyboard. The typing speed of a single DART hand was found to be 20 words min −1 . In comparison, the average human has a typing speed of 33 words min −1 with two hands

Measuring spatial variation in secondary production and food quality using a common consumer approach in Lake Erie

Science.gov (United States)

Larson, James H.; Richardson, William B.; Evans, Mary Anne; Schaeffer, Jeff; Wynne, Timothy; Bartsch, Michelle; Bartsch, Lynn; Nelson, J. C.; Vallazza, Jon M.

2016-01-01

Lake Erie is a large lake straddling the border of the U.S. and Canada that has become increasingly eutrophic in recent years. Eutrophication is particularly focused in the shallow western basin. The western basin of Lake Erie is hydrodynamically similar to a large estuary, with riverine inputs from the Detroit and Maumee Rivers mixing together and creating gradients in chemical and physical conditions. This study was driven by two questions: How does secondary production and food quality for consumers vary across this large mixing zone? and Are there correlations between cyanobacterial abundance and secondary production or food quality for consumers? Measuring spatial and temporal variation in secondary production and food quality is difficult for a variety of logistical reasons, so here a common consumer approach was used. In a common consumer approach, individuals of a single species are raised under similar conditions until placed in the field across environmental gradients of interest. After some period of exposure, the response of that common consumer is measured to provide an index of spatial variation in conditions. Here, a freshwater mussel (Lampsilis siliquoidea) was deployed at 32 locations that spanned habitat types and a gradient in cyanobacterial abundance in the western basin of Lake Erie to measure spatial variation in growth (an index of secondary production) and fatty acid (FA) content (an index of food quality). We found secondary production was highest within the Maumee rivermouth and lowest in the open waters of the lake. Mussel tissues in the Maumee rivermouth also included more eicosapentaenoic and docosapentaenoic fatty acids (EPA and DPA, respectively), but fewer bacterial FAs, suggesting more algae at the base of the food web in the Maumee rivermouth compared to open lake sites. The satellite-derived estimate of cyanobacterial abundance was not correlated to secondary production, but was positively related to EPA and DPA content in the

14 CFR 437.93 - Compliance monitoring.

Science.gov (United States)

2010-01-01

... 14 Aeronautics and Space 4 2010-01-01 2010-01-01 false Compliance monitoring. 437.93 Section 437.93 Aeronautics and Space COMMERCIAL SPACE TRANSPORTATION, FEDERAL AVIATION ADMINISTRATION, DEPARTMENT....93 Compliance monitoring. A permittee must allow access by, and cooperate with, federal officers or...

The hand: MR imaging with a 4.7-T magnet

International Nuclear Information System (INIS)

Wang, P.C.; Archer, A.; Rajan, S.; Carvlin, M.J.; Mun, S.K.; Nelson, M.C.

1987-01-01

MR images of normal and pathologic human hands were obtained using a 4.7-T magnet Varian system. Standard spin-echo techniques and inversion-recovery sequences were used to produce both T1- and T2-weighted images. The higher gradient (2 gauss/cm) of the 4.7-T system allows submillimeter resolution. A specially designed surface coil is used to improve the signal-to-noise ratio. The coil is elliptical and measures 3 inches by 4.5 inches. Axial, coronal, and sagittal images were obtained, revealing fine, detailed structures of the human hand. The joint capsule, ligaments and tendons, and vascular structures were clearly visible. The authors will show images of the normal anatomy of the hand, as well as pathologic lesions of inflammatory and crystalline arthropathy. Techniques and special problems of imaging the human hand with a 4.7-T system are discussed

10 CFR 76.93 - Quality assurance.

Science.gov (United States)

2010-01-01

... 10 Energy 2 2010-01-01 2010-01-01 false Quality assurance. 76.93 Section 76.93 Energy NUCLEAR REGULATORY COMMISSION (CONTINUED) CERTIFICATION OF GASEOUS DIFFUSION PLANTS Safety § 76.93 Quality assurance. The Corporation shall establish, maintain, and execute a quality assurance program satisfying each of...

Potentially toxic elements in soil of the Khyber Pakhtunkhwa province and Tribal areas, Pakistan: evaluation for human and ecological risk assessment.

Science.gov (United States)

Saddique, Umar; Muhammad, Said; Tariq, Mohsin; Zhang, Hua; Arif, Mohammad; Jadoon, Ishtiaq A K; Khattak, Nimat Ullah

2018-03-22

Potentially toxic elements (PTEs) contaminations in the soil ecosystem are considered as extremely hazardous due to toxicity, persistence and bioaccumulative nature. Therefore, this study was aimed to summarize the results of published PTEs in soil of Khyber Pakhtunkhwa and Tribal areas, Pakistan. Results were evaluated for the pollution quantification factors, including contamination factor (CF), pollution load index (PLI), ecological risk index (ERI) and human health risk assessment. The highest CF (797) and PLI (7.35) values were observed for Fe and ERI (857) values for Cd. Soil PTEs concentrations were used to calculate the human exposure for the risk assessment, including chronic or non-carcinogenic risks such as the hazard quotient (HQ) and carcinogenic or cancer risk (CR). The values of HQ were > 1 for the Cd, Co and Cr in Khyber Pakhtunkhwa and Tribal areas. Tribal areas showed higher values of ERI, HQ, and CR as compared to the Khyber Pakhtunkhwa that were attributed to the mining activities, weathering and erosion of mafic and ultramafic bedrocks hosting ophiolites. This study strongly recommends that best control measures need to be taken for soil PTEs with the intent to alleviate any continuing potential threat to the human health, property and environment, which otherwise could enter ecosystem and ultimately the living beings. Further studies are recommended to combat the soil PTEs concentrations and toxicity in the Tribal areas for a best picture of understanding the element effects on human, and environment can be achieved that will lead to a sustainable ecological harmony.

The Marble-Hand Illusion.

Science.gov (United States)

Senna, Irene; Maravita, Angelo; Bolognini, Nadia; Parise, Cesare V

2014-01-01

Our body is made of flesh and bones. We know it, and in our daily lives all the senses constantly provide converging information about this simple, factual truth. But is this always the case? Here we report a surprising bodily illusion demonstrating that humans rapidly update their assumptions about the material qualities of their body, based on their recent multisensory perceptual experience. To induce a misperception of the material properties of the hand, we repeatedly gently hit participants' hand with a small hammer, while progressively replacing the natural sound of the hammer against the skin with the sound of a hammer hitting a piece of marble. After five minutes, the hand started feeling stiffer, heavier, harder, less sensitive, unnatural, and showed enhanced Galvanic skin response (GSR) to threatening stimuli. Notably, such a change in skin conductivity positively correlated with changes in perceived hand stiffness. Conversely, when hammer hits and impact sounds were temporally uncorrelated, participants did not spontaneously report any changes in the perceived properties of the hand, nor did they show any modulation in GSR. In two further experiments, we ruled out that mere audio-tactile synchrony is the causal factor triggering the illusion, further demonstrating the key role of material information conveyed by impact sounds in modulating the perceived material properties of the hand. This novel bodily illusion, the 'Marble-Hand Illusion', demonstrates that the perceived material of our body, surely the most stable attribute of our bodily self, can be quickly updated through multisensory integration.

Prosthetic hand sensor placement: Analysis of touch perception during the grasp

Directory of Open Access Journals (Sweden)

Mirković Bojana

2014-01-01

Full Text Available Humans rely on their hands to perform everyday tasks. The hand is used as a tool, but also as the interface to “sense” the world. Current prosthetic hands are based on sophisticated multi-fingered structures, and include many sensors which counterpart natural proprioceptors and exteroceptors. The sensory information is used for control, but not sent to the user of the hand (amputee. Grasping without sensing is not good enough. This research is part of the development of the sensing interface for amputees, specifically addressing the analysis of human perception while grasping. The goal is to determine the small number of preferred positions of sensors on the prosthetic hand. This task has previously been approached by trying to replicate a natural sensory system characteristic for healthy humans, resulting in a multitude of redundant sensors and basic inability to make the patient aware of the sensor readings on the subconscious level. We based our artificial perception system on the reported sensations of humans when grasping various objects without seeing the objects (obstructed visual feedback. Subjects, with no known sensory deficits, were asked to report on the touch sensation while grasping. The analysis included objects of various sizes, weights, textures and temperatures. Based on this data we formed a map of the preferred positions for the sensors that is appropriate for five finger human-like robotic hand. The final map was intentionally minimized in size (number of sensors.

25 CFR 700.93 - Relocation plan.

Science.gov (United States)

2010-04-01

... 25 Indians 2 2010-04-01 2010-04-01 false Relocation plan. 700.93 Section 700.93 Indians THE OFFICE OF NAVAJO AND HOPI INDIAN RELOCATION COMMISSION OPERATIONS AND RELOCATION PROCEDURES General Policies and Instructions Definitions § 700.93 Relocation plan. The relocation plan shall be the plan prepared...

40 CFR 93.154 - Conformity analysis.

Science.gov (United States)

2010-07-01

... 40 Protection of Environment 20 2010-07-01 2010-07-01 false Conformity analysis. 93.154 Section 93...) DETERMINING CONFORMITY OF FEDERAL ACTIONS TO STATE OR FEDERAL IMPLEMENTATION PLANS Determining Conformity of General Federal Actions to State or Federal Implementation Plans § 93.154 Conformity analysis. Any Federal...

Natural-pose hand detection in low-resolution images

Directory of Open Access Journals (Sweden)

Nyan Bo Bo1

2009-07-01

Full Text Available Robust real-time hand detection and tracking in video sequences would enable many applications in areas as diverse ashuman-computer interaction, robotics, security and surveillance, and sign language-based systems. In this paper, we introducea new approach for detecting human hands that works on single, cluttered, low-resolution images. Our prototype system, whichis primarily intended for security applications in which the images are noisy and low-resolution, is able to detect hands as smallas 2424 pixels in cluttered scenes. The system uses grayscale appearance information to classify image sub-windows as eithercontaining or not containing a human hand very rapidly at the cost of a high false positive rate. To improve on the false positiverate of the main classifier without affecting its detection rate, we introduce a post-processor system that utilizes the geometricproperties of skin color blobs. When we test our detector on a test image set containing 106 hands, 92 of those hands aredetected (86.8% detection rate, with an average false positive rate of 1.19 false positive detections per image. The rapiddetection speed, the high detection rate of 86.8%, and the low false positive rate together ensure that our system is useable asthe main detector in a diverse variety of applications requiring robust hand detection and tracking in low-resolution, clutteredscenes.

Combining heterogenous features for 3D hand-held object recognition

Science.gov (United States)

Lv, Xiong; Wang, Shuang; Li, Xiangyang; Jiang, Shuqiang

2014-10-01

Object recognition has wide applications in the area of human-machine interaction and multimedia retrieval. However, due to the problem of visual polysemous and concept polymorphism, it is still a great challenge to obtain reliable recognition result for the 2D images. Recently, with the emergence and easy availability of RGB-D equipment such as Kinect, this challenge could be relieved because the depth channel could bring more information. A very special and important case of object recognition is hand-held object recognition, as hand is a straight and natural way for both human-human interaction and human-machine interaction. In this paper, we study the problem of 3D object recognition by combining heterogenous features with different modalities and extraction techniques. For hand-craft feature, although it reserves the low-level information such as shape and color, it has shown weakness in representing hiconvolutionalgh-level semantic information compared with the automatic learned feature, especially deep feature. Deep feature has shown its great advantages in large scale dataset recognition but is not always robust to rotation or scale variance compared with hand-craft feature. In this paper, we propose a method to combine hand-craft point cloud features and deep learned features in RGB and depth channle. First, hand-held object segmentation is implemented by using depth cues and human skeleton information. Second, we combine the extracted hetegerogenous 3D features in different stages using linear concatenation and multiple kernel learning (MKL). Then a training model is used to recognize 3D handheld objects. Experimental results validate the effectiveness and gerneralization ability of the proposed method.

A geophysical analysis of hydro-geomorphic controls within a headwater wetland in a granitic landscape, through ERI and IP

OpenAIRE

E. S. Riddell; S. A. Lorentz; D. C. Kotze

2010-01-01

Wetlands are undergoing considerable degradation in South Africa. As interventions are often technical and costly, there is a requirement to develop conceptual process models for these wetland systems so that rehabilitation attempts will be successful. This paper presents an approach using the geophysical methods of Electrical Resistivity Imaging (ERI) and Induced Polarization (IP) to delineate sub-surface hydro-geomorphic controls that maintain equilibrium disconnectivity of wetland-catchmen...

9 CFR 93.916 - Special provisions.

Science.gov (United States)

2010-01-01

... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Special provisions. 93.916 Section 93... § 93.916 Special provisions. (a) Slaughter. Live VHS-regulated fish from VHS-regulated regions may be... establishment discharges its waste water to a municipal sewage system that includes waste water disinfection...

Detection of the spatiotemporal trends of mercury in Lake Erie fish communities: a Bayesian approach.

Science.gov (United States)

Azim, M Ekram; Kumarappah, Ananthavalli; Bhavsar, Satyendra P; Backus, Sean M; Arhonditsis, George

2011-03-15

The temporal trends of total mercury (THg) in four fish species in Lake Erie were evaluated based on 35 years of fish contaminant data. Our Bayesian statistical approach consists of three steps aiming to address different questions. First, we used the exponential and mixed-order decay models to assess the declining rates in four intensively sampled fish species, i.e., walleye (Stizostedion vitreum), yellow perch (Perca flavescens), smallmouth bass (Micropterus dolomieui), and white bass (Morone chrysops). Because the two models postulate monotonic decrease of the THg levels, we included first- and second-order random walk terms in our statistical formulations to accommodate nonmonotonic patterns in the data time series. Our analysis identified a recent increase in the THg concentrations, particularly after the mid-1990s. In the second step, we used double exponential models to quantify the relative magnitude of the THg trends depending on the type of data used (skinless-boneless fillet versus whole fish data) and the fish species examined. The observed THg concentrations were significantly higher in skinless boneless fillet than in whole fish portions, while the whole fish portions of walleye exhibited faster decline rates and slower rates of increase relative to the skinless boneless fillet data. Our analysis also shows lower decline rates and higher rates of increase in walleye relative to the other three fish species examined. The food web structural shifts induced by the invasive species (dreissenid mussels and round goby) may be associated with the recent THg trends in Lake Erie fish.

Eriocalyxin B induces apoptosis and cell cycle arrest in pancreatic adenocarcinoma cells through caspase- and p53-dependent pathways

International Nuclear Information System (INIS)

Li, Lin; Yue, Grace G.L.; Lau, Clara B.S.; Sun, Handong; Fung, Kwok Pui; Leung, Ping Chung; Han, Quanbin; Leung, Po Sing

2012-01-01

Pancreatic cancer is difficult to detect early and responds poorly to chemotherapy. A breakthrough in the development of new therapeutic agents is urgently needed. Eriocalyxin B (EriB), isolated from the Isodon eriocalyx plant, is an ent-kaurane diterpenoid with promise as a broad-spectrum anti-cancer agent. The anti-leukemic activity of EriB, including the underlying mechanisms involved, has been particularly well documented. In this study, we demonstrated for the first time EriB's potent cytotoxicity against four pancreatic adenocarcinoma cell lines, namely PANC-1, SW1990, CAPAN-1, and CAPAN-2. The effects were comparable to that of the chemotherapeutic camptothecin (CAM), but with much lower toxicity against normal human liver WRL68 cells. EriB's cytoxicity against CAPAN-2 cells was found to involve caspase-dependent apoptosis and cell cycle arrest at the G2/M phase. Moreover, the p53 pathway was found to be activated by EriB in these cells. Furthermore, in vivo studies showed that EriB inhibited the growth of human pancreatic tumor xenografts in BALB/c nude mice without significant secondary adverse effects. These results suggest that EriB should be considered a candidate for pancreatic cancer treatment. -- Highlights: ► We study Eriocalyxin B (EriB)'s cytotoxic effects on pancreatic cancer cell lines. ► EriB inhibits cell proliferation via mediation of apoptosis and cell cycle arrest. ► The effects are involved in caspase-dependent apoptosis and p53 pathway. ► In vivo study also shows EriB inhibits the growth of human pancreatic tumor. ► EriB can be a good candidate for chemotherapy in pancreatic cancer.

Eriocalyxin B induces apoptosis and cell cycle arrest in pancreatic adenocarcinoma cells through caspase- and p53-dependent pathways

Energy Technology Data Exchange (ETDEWEB)

Li, Lin [School of Biomedical Sciences, The Chinese University of Hong Kong, Hong Kong (China); Institute of Chinese Medicine, The Chinese University of Hong Kong, Hong Kong (China); State Key Laboratory of Phytochemistry and Plant Resources in West China, The Chinese University of Hong Kong, Hong Kong (China); Yue, Grace G.L. [Institute of Chinese Medicine, The Chinese University of Hong Kong, Hong Kong (China); State Key Laboratory of Phytochemistry and Plant Resources in West China, The Chinese University of Hong Kong, Hong Kong (China); Lau, Clara B.S. [Institute of Chinese Medicine, The Chinese University of Hong Kong, Hong Kong (China); Institute of Chinese Medicine, The Chinese University of Hong Kong, Hong Kong (China); Sun, Handong [State Key Laboratory of Phytochemistry and Plant Resources in West China, Kunming Institute of Botany, CAS, Yunnan (China); Fung, Kwok Pui [School of Biomedical Sciences, The Chinese University of Hong Kong, Hong Kong (China); Institute of Chinese Medicine, The Chinese University of Hong Kong, Hong Kong (China); State Key Laboratory of Phytochemistry and Plant Resources in West China, The Chinese University of Hong Kong, Hong Kong (China); Leung, Ping Chung [Institute of Chinese Medicine, The Chinese University of Hong Kong, Hong Kong (China); State Key Laboratory of Phytochemistry and Plant Resources in West China, The Chinese University of Hong Kong, Hong Kong (China); Han, Quanbin, E-mail: simonhan@hkbu.edu.hk [Institute of Chinese Medicine, The Chinese University of Hong Kong, Hong Kong (China); State Key Laboratory of Phytochemistry and Plant Resources in West China, The Chinese University of Hong Kong, Hong Kong (China); School of Chinese Medicine, The Hong Kong Baptist University, Hong Kong (China); Leung, Po Sing, E-mail: psleung@cuhk.edu.hk [School of Biomedical Sciences, The Chinese University of Hong Kong, Hong Kong (China)

2012-07-01

Pancreatic cancer is difficult to detect early and responds poorly to chemotherapy. A breakthrough in the development of new therapeutic agents is urgently needed. Eriocalyxin B (EriB), isolated from the Isodon eriocalyx plant, is an ent-kaurane diterpenoid with promise as a broad-spectrum anti-cancer agent. The anti-leukemic activity of EriB, including the underlying mechanisms involved, has been particularly well documented. In this study, we demonstrated for the first time EriB's potent cytotoxicity against four pancreatic adenocarcinoma cell lines, namely PANC-1, SW1990, CAPAN-1, and CAPAN-2. The effects were comparable to that of the chemotherapeutic camptothecin (CAM), but with much lower toxicity against normal human liver WRL68 cells. EriB's cytoxicity against CAPAN-2 cells was found to involve caspase-dependent apoptosis and cell cycle arrest at the G2/M phase. Moreover, the p53 pathway was found to be activated by EriB in these cells. Furthermore, in vivo studies showed that EriB inhibited the growth of human pancreatic tumor xenografts in BALB/c nude mice without significant secondary adverse effects. These results suggest that EriB should be considered a candidate for pancreatic cancer treatment. -- Highlights: ► We study Eriocalyxin B (EriB)'s cytotoxic effects on pancreatic cancer cell lines. ► EriB inhibits cell proliferation via mediation of apoptosis and cell cycle arrest. ► The effects are involved in caspase-dependent apoptosis and p53 pathway. ► In vivo study also shows EriB inhibits the growth of human pancreatic tumor. ► EriB can be a good candidate for chemotherapy in pancreatic cancer.

7 CFR 93.4 - Analytical methods.

Science.gov (United States)

2010-01-01

... 7 Agriculture 3 2010-01-01 2010-01-01 false Analytical methods. 93.4 Section 93.4 Agriculture... PROCESSED FRUITS AND VEGETABLES Citrus Juices and Certain Citrus Products § 93.4 Analytical methods. (a) The majority of analytical methods for citrus products are found in the Official Methods of Analysis of AOAC...

Human motion retrieval from hand-drawn sketch.

Science.gov (United States)

Chao, Min-Wen; Lin, Chao-Hung; Assa, Jackie; Lee, Tong-Yee

2012-05-01

The rapid growth of motion capture data increases the importance of motion retrieval. The majority of the existing motion retrieval approaches are based on a labor-intensive step in which the user browses and selects a desired query motion clip from the large motion clip database. In this work, a novel sketching interface for defining the query is presented. This simple approach allows users to define the required motion by sketching several motion strokes over a drawn character, which requires less effort and extends the users’ expressiveness. To support the real-time interface, a specialized encoding of the motions and the hand-drawn query is required. Here, we introduce a novel hierarchical encoding scheme based on a set of orthonormal spherical harmonic (SH) basis functions, which provides a compact representation, and avoids the CPU/processing intensive stage of temporal alignment used by previous solutions. Experimental results show that the proposed approach can well retrieve the motions, and is capable of retrieve logically and numerically similar motions, which is superior to previous approaches. The user study shows that the proposed system can be a useful tool to input motion query if the users are familiar with it. Finally, an application of generating a 3D animation from a hand-drawn comics strip is demonstrated.

Where one hand meets the other: limb-specific and action-dependent movement plans decoded from preparatory signals in single human frontoparietal brain areas.

Science.gov (United States)

Gallivan, Jason P; McLean, D Adam; Flanagan, J Randall; Culham, Jody C

2013-01-30

Planning object-directed hand actions requires successful integration of the movement goal with the acting limb. Exactly where and how this sensorimotor integration occurs in the brain has been studied extensively with neurophysiological recordings in nonhuman primates, yet to date, because of limitations of non-invasive methodologies, the ability to examine the same types of planning-related signals in humans has been challenging. Here we show, using a multivoxel pattern analysis of functional MRI (fMRI) data, that the preparatory activity patterns in several frontoparietal brain regions can be used to predict both the limb used and hand action performed in an upcoming movement. Participants performed an event-related delayed movement task whereby they planned and executed grasp or reach actions with either their left or right hand toward a single target object. We found that, although the majority of frontoparietal areas represented hand actions (grasping vs reaching) for the contralateral limb, several areas additionally coded hand actions for the ipsilateral limb. Notable among these were subregions within the posterior parietal cortex (PPC), dorsal premotor cortex (PMd), ventral premotor cortex, dorsolateral prefrontal cortex, presupplementary motor area, and motor cortex, a region more traditionally implicated in contralateral movement generation. Additional analyses suggest that hand actions are represented independently of the intended limb in PPC and PMd. In addition to providing a unique mapping of limb-specific and action-dependent intention-related signals across the human cortical motor system, these findings uncover a much stronger representation of the ipsilateral limb than expected from previous fMRI findings.

The human homologue of unc-93 maps to chromosome 6q27 – characterisation and analysis in sporadic epithelial ovarian cancer

Directory of Open Access Journals (Sweden)

Charnock F Mark L

2002-10-01

Full Text Available Abstract Background In sporadic ovarian cancer, we have previously reported allele loss at D6S193 (62% on chromosome 6q27, which suggested the presence of a putative tumour suppressor gene. Based on our data and that from another group, the minimal region of allele loss was between D6S264 and D6S149 (7.4 cM. To identify the putative tumour suppressor gene, we established a physical map initially with YACs and subsequently with PACs/BACs from D6S264 to D6S149. To accelerate the identification of genes, we sequenced the entire contig of approximately 1.1 Mb. Seven genes were identified within the region of allele loss between D6S264 and D6S149. Results The human homologue of unc-93 (UNC93A in C. elegans was identified to be within the interval of allele loss centromeric to D6S149. This gene is 24.5 kb and comprises of 8 exons. There are two transcripts with the shorter one due to splicing out of exon 4. It is expressed in testis, small intestine, spleen, prostate, and ovary. In a panel of 8 ovarian cancer cell lines, UNC93A expression was detected by RT-PCR which identified the two transcripts in 2/8 cell lines. The entire coding sequence was examined for mutations in a panel of ovarian tumours and ovarian cancer cell lines. Mutations were identified in exons 1, 3, 4, 5, 6 and 8. Only 3 mutations were identified specifically in the tumour. These included a c.452G>A (W151X mutation in exon 3, c.676C>T (R226X in exon 5 and c.1225G>A(V409I mutation in exon 8. However, the mutations in exon 3 and 5 were also present in 6% and 2% of the normal population respectively. The UNC93A cDNA was shown to express at the cell membrane and encodes for a protein of 60 kDa. Conclusions These results suggest that no evidence for UNC93A as a tumour suppressor gene in sporadic ovarian cancer has been identified and further research is required to evaluate its normal function and role in the pathogenesis of ovarian cancer.

Ultra-weak photon emission as a non-invasive tool for monitoring of oxidative processes in the epidermal cells of human skin: comparative study on the dorsal and the palm side of the hand.

Science.gov (United States)

Rastogi, Anshu; Pospísil, Pavel

2010-08-01

All living organisms emit spontaneous ultra-weak photon emission as a result of cellular metabolic processes. Exposure of living organisms to exogenous factors results in oxidative processes and enhancement in ultra-weak photon emission. Here, hydrogen peroxide (H(2)O(2)), as a strongly oxidizing molecule, was used to induce oxidative processes and enhance ultra-weak photon emission in human hand skin. The presented work intends to compare both spontaneous and peroxide-induced ultra-weak photon emission from the epidermal cells on the dorsal and the palm side of the hand. A highly sensitive photomultiplier tube and a charge-coupled device camera were used to detect ultra-weak photon emission from human hand skin. Spontaneous ultra-weak photon emission from the epidermal cells on the dorsal side of the hand was 4 counts/s. Topical application of 500 mM H(2)O(2) to the dorsal side of the hand caused enhancement in ultra-weak photon emission to 40 counts/s. Interestingly, both spontaneous and peroxide-induced ultra-weak photon emission from the epidermal cells on the palm side of the hand were observed to increase twice their values, i.e. 8 and 80 counts/s, respectively. Similarly, the two-dimensional image of ultra-weak photon emission observed after topical application of H(2)O(2) to human skin reveals that photon emission from the palm side exceeds the photon emission from the dorsal side of the hand. The results presented indicate that the ultra-weak photon emission originating from the epidermal cells on the dorsal and the palm side of the hand is related to the histological structure of the human hand skin. Ultra-weak photon emission is shown as a non-destructive technique for monitoring of oxidative processes in the epidermal cells of the human hand skin and as a diagnostic tool for skin diseases.

Surface EMG in advanced hand prosthetics.

Science.gov (United States)

Castellini, Claudio; van der Smagt, Patrick

2009-01-01

One of the major problems when dealing with highly dexterous, active hand prostheses is their control by the patient wearing them. With the advances in mechatronics, building prosthetic hands with multiple active degrees of freedom is realisable, but actively controlling the position and especially the exerted force of each finger cannot yet be done naturally. This paper deals with advanced robotic hand control via surface electromyography. Building upon recent results, we show that machine learning, together with a simple downsampling algorithm, can be effectively used to control on-line, in real time, finger position as well as finger force of a highly dexterous robotic hand. The system determines the type of grasp a human subject is willing to use, and the required amount of force involved, with a high degree of accuracy. This represents a remarkable improvement with respect to the state-of-the-art of feed-forward control of dexterous mechanical hands, and opens up a scenario in which amputees will be able to control hand prostheses in a much finer way than it has so far been possible.

14 CFR 125.93 - Airplane limitations.

Science.gov (United States)

2010-01-01

... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false Airplane limitations. 125.93 Section 125.93...: AIRPLANES HAVING A SEATING CAPACITY OF 20 OR MORE PASSENGERS OR A MAXIMUM PAYLOAD CAPACITY OF 6,000 POUNDS OR MORE; AND RULES GOVERNING PERSONS ON BOARD SUCH AIRCRAFT Airplane Requirements § 125.93 Airplane...

Hand grips strength effect on motor function in human brain using fMRI: a pilot study

International Nuclear Information System (INIS)

Ismail, S S; Mohamad, M; Syazarina, S O; Nafisah, W Y

2014-01-01

Several methods of motor tasks for fMRI scanning have been evolving from simple to more complex tasks. Motor tasks on upper extremity were applied in order to excite the increscent of motor activation on contralesional and ipsilateral hemispheres in brain. The main objective of this study is to study the different conditions for motor tasks on upper extremity that affected the brain activation. Ten healthy right handed with normal vision (3 male and 7 female, age range=20-30 years, mean=24.6 years, SD=2.21) participated in this study. Prior to the scanning, participants were trained on hand grip tasks using rubber ball and pressure gauge tool outside the scanner. During fMRI session, a block design with 30-s task blocks and alternating 30-s rest periods was employed while participants viewed a computer screen via a back projection-mirror system and instructed to follow the instruction by gripping their hand with normal and strong grips using a rubber ball. Statistical Parametric mapping (SPM8) software was used to determine the brain activation. Both tasks activated the primary motor (M1), supplementary motor area (SMA), dorsal and ventral of premotor cortex area (PMA) in left hemisphere while in right hemisphere the area of primary motor (M1) somatosensory was activated. However, the comparison between both tasks revealed that the strong hand grip showed the higher activation at M1, PMA and SMA on left hemisphere and also the area of SMA on right hemisphere. Both conditions of motor tasks could provide insights the functional organization on human brain

Hand grips strength effect on motor function in human brain using fMRI: a pilot study

Science.gov (United States)

Ismail, S. S.; Mohamad, M.; Syazarina, S. O.; Nafisah, W. Y.

2014-11-01

Several methods of motor tasks for fMRI scanning have been evolving from simple to more complex tasks. Motor tasks on upper extremity were applied in order to excite the increscent of motor activation on contralesional and ipsilateral hemispheres in brain. The main objective of this study is to study the different conditions for motor tasks on upper extremity that affected the brain activation. Ten healthy right handed with normal vision (3 male and 7 female, age range=20-30 years, mean=24.6 years, SD=2.21) participated in this study. Prior to the scanning, participants were trained on hand grip tasks using rubber ball and pressure gauge tool outside the scanner. During fMRI session, a block design with 30-s task blocks and alternating 30-s rest periods was employed while participants viewed a computer screen via a back projection-mirror system and instructed to follow the instruction by gripping their hand with normal and strong grips using a rubber ball. Statistical Parametric mapping (SPM8) software was used to determine the brain activation. Both tasks activated the primary motor (M1), supplementary motor area (SMA), dorsal and ventral of premotor cortex area (PMA) in left hemisphere while in right hemisphere the area of primary motor (M1) somatosensory was activated. However, the comparison between both tasks revealed that the strong hand grip showed the higher activation at M1, PMA and SMA on left hemisphere and also the area of SMA on right hemisphere. Both conditions of motor tasks could provide insights the functional organization on human brain.

Fecundity of walleyes in western Lake Erie, 1966 and 1990-91

Science.gov (United States)

Muth, Kenneth M.; Ickes, Brian S.

1993-01-01

Ovaries were collected from walleyes (Stizostedion vitreum vitreum) in western Lake Erie just prior to spawning in 1990 and 1991 to determine current fecundity. Results were compared with fecundity determined in 1966 prior to stock rehabilitation when walleye abundance was lower and fish size at age was greater. Fecundity estimates determined from 121 fish aged 3-10 ranged from 53,000 to 426,000 eggs per female. Increases in egg production correlated with increases in length and weight, and weight accounting for most of the variability. In 1990-91 the mean egg production of the dominant age groups of spawners (ages 4 to 8) was approximately 25% lower than fishes of similar age in 1966. The mean egg diameter in 1990-91 (1.63 mm) was not related to the size or age of the fish and was not significantly smaller than the egg diameter in 1966 (1.72 mm).

Influencia de Gregorio de Nisa sobre Juan Escoto Eriúgena: Aproximación a partir del Periphyseon

OpenAIRE

Pachas, José Antonio

2004-01-01

A partir de los cinco libros del Periphyseon el autor intenta un acercamiento entre el pensamiento de Juan Escoto Eriúgena y Gregorio de Nisa, buscando sobre todo las principales influencias del segundo sobre el primero. Encuentra una plataforma de amplia base común entre ambos pensadores, marcada principalmente por un tipo de pensamiento circular según el esquema: procesión y retorno. Sin embargo, es notoria la influencia del Niseno sobre el Carolingio, principalmente cuando se trata de plan...

42 CFR 93.210 - Good faith.

Science.gov (United States)

2010-10-01

... 42 Public Health 1 2010-10-01 2010-10-01 false Good faith. 93.210 Section 93.210 Public Health... MISCONDUCT Definitions § 93.210 Good faith. Good faith as applied to a complainant or witness, means having a... allegation or cooperation with a research misconduct proceeding is not in good faith if made with knowing or...

9 CFR 93.317 - Horses from Canada.

Science.gov (United States)

2010-01-01

... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Horses from Canada. 93.317 Section 93... CONVEYANCE AND SHIPPING CONTAINERS Horses Canada 16 § 93.317 Horses from Canada. (a) Except as provided in paragraph (c) of this section, horses from Canada shall be inspected as provided in § 93.306; shall be...

Muusika. Cannes Classical Award Eri Klasile. EFK USAsse ja Kanadasse. "opeNBaroque" ئ 11 kontserti. Chopini konkurss Narvas. Tubina ühingu aastakoosolek

Index Scriptorium Estoniae

2002-01-01

Eri Klasi ja Tampere Linnaorkestri CD helilooja Einar Englundi loominguga pälvis mainekaplaadiauhinna, Cannes Classical Award'i. 7.-24. veebruarini on Eesti Filharmoonia Kammerkoorringreisil USAs ja Kanadas. Festivali "opeNBaroque" kontsertidest. Chopini loomingule pühendatud Läänemeremaade noorte pianistide konkursist Narvas. Tubina ühingu aastakoosolekust 5. veebruaril

Cytomegalovirus Survival and Transferability and the Effectiveness of Common Hand-Washing Agents against Cytomegalovirus on Live Human Hands

OpenAIRE

Stowell, Jennifer D.; Forlin-Passoni, Daniela; Radford, Kay; Bate, Sheri L.; Dollard, Sheila C.; Bialek, Stephanie R.; Cannon, Michael J.; Schmid, D. Scott

2014-01-01

Congenital cytomegalovirus (CMV) transmission can occur when women acquire CMV while pregnant. Infection control guidelines may reduce risk for transmission. We studied the duration of CMV survival after application of bacteria to the hands and after transfer from the hands to surfaces and the effectiveness of cleansing with water, regular and antibacterial soaps, sanitizer, and diaper wipes. Experiments used CMV AD169 in saliva at initial titers of 1 × 105 infectious particles/ml. Samples fr...

14 CFR 141.93 - Enrollment.

Science.gov (United States)

2010-01-01

... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false Enrollment. 141.93 Section 141.93 Aeronautics and Space FEDERAL AVIATION ADMINISTRATION, DEPARTMENT OF TRANSPORTATION (CONTINUED) SCHOOLS AND... limitations and simulated emergency landing instructions; and (x) A description of and instructions regarding...

Age-related changes in cutaneous sensation in the healthy human hand.

Science.gov (United States)

Bowden, Jocelyn L; McNulty, Penelope A

2013-08-01

Cutaneous sensation deteriorates with age. It is not known if this change is consistent over the entire hand or if sensation is affected by changes in skin mechanics. Cutaneous perceptual thresholds were tested at eight sites in the glabrous skin and two in the hairy skin of both hands in 70 subjects (20-88 years), five male and five female per decade, using calibrated von Frey filaments, two-point discrimination, and texture discrimination. Venous occlusion at the wrist (40 ± 10 mmHg) and moisturizer were used to alter skin mechanics. Cutaneous thresholds increased significantly with age (p sensation varied according to the site tested with smaller changes on the fingers compared to the palm. Two-point discrimination deteriorated with age (p = 0.046), but with no interaction between sex, handedness, or changes in skin mechanics. There were no significant differences for texture discrimination. Changes in skin mechanics improved cutaneous thresholds in the oldest males after moisturizing (p = 0.001) but not otherwise. These results emphasize the complex pattern of age-related deterioration in cutaneous sensation with differences between sexes, the hands, sites on the hand, and the mode of testing. As the index fingertip is not a sensitive indicator of sensory decline, the minimum assessment of age-related changes in cutaneous sensation should include both hands, and sites on the palm.

[Study on an Exoskeleton Hand Function Training Device].

Science.gov (United States)

Hu, Xin; Zhang, Ying; Li, Jicai; Yi, Jinhua; Yu, Hongliu; He, Rongrong

2016-02-01

Based on the structure and motion bionic principle of the normal adult fingers, biological characteristics of human hands were analyzed, and a wearable exoskeleton hand function training device for the rehabilitation of stroke patients or patients with hand trauma was designed. This device includes the exoskeleton mechanical structure and the electromyography (EMG) control system. With adjustable mechanism, the device was capable to fit different finger lengths, and by capturing the EMG of the users' contralateral limb, the motion state of the exoskeleton hand was controlled. Then driven by the device, the user's fingers conducting adduction/abduction rehabilitation training was carried out. Finally, the mechanical properties and training effect of the exoskeleton hand were verified through mechanism simulation and the experiments on the experimental prototype of the wearable exoskeleton hand function training device.

Complex tasks force hand laterality and technological behaviour in naturalistically housed chimpanzees: inferences in hominin evolution.

Science.gov (United States)

Mosquera, M; Geribàs, N; Bargalló, A; Llorente, M; Riba, D

2012-01-01

Clear hand laterality patterns in humans are widely accepted. However, humans only elicit a significant hand laterality pattern when performing complementary role differentiation (CRD) tasks. Meanwhile, hand laterality in chimpanzees is weaker and controversial. Here we have reevaluated our results on hand laterality in chimpanzees housed in naturalistic environments at Fundació Mona (Spain) and Chimfunshi Wild Orphanage (Zambia). Our results show that the difference between hand laterality in humans and chimpanzees is not as great as once thought. Furthermore, we found a link between hand laterality and task complexity and also an even more interesting connection: CRD tasks elicited not only the hand laterality but also the use of tools. This paper aims to turn attention to the importance of this threefold connection in human evolution: the link between CRD tasks, hand laterality, and tool use, which has important evolutionary implications that may explain the development of complex behaviour in early hominins.

Decoding Individual Finger Movements from One Hand Using Human EEG Signals

Science.gov (United States)

Gonzalez, Jania; Ding, Lei

2014-01-01

Brain computer interface (BCI) is an assistive technology, which decodes neurophysiological signals generated by the human brain and translates them into control signals to control external devices, e.g., wheelchairs. One problem challenging noninvasive BCI technologies is the limited control dimensions from decoding movements of, mainly, large body parts, e.g., upper and lower limbs. It has been reported that complicated dexterous functions, i.e., finger movements, can be decoded in electrocorticography (ECoG) signals, while it remains unclear whether noninvasive electroencephalography (EEG) signals also have sufficient information to decode the same type of movements. Phenomena of broadband power increase and low-frequency-band power decrease were observed in EEG in the present study, when EEG power spectra were decomposed by a principal component analysis (PCA). These movement-related spectral structures and their changes caused by finger movements in EEG are consistent with observations in previous ECoG study, as well as the results from ECoG data in the present study. The average decoding accuracy of 77.11% over all subjects was obtained in classifying each pair of fingers from one hand using movement-related spectral changes as features to be decoded using a support vector machine (SVM) classifier. The average decoding accuracy in three epilepsy patients using ECoG data was 91.28% with the similarly obtained features and same classifier. Both decoding accuracies of EEG and ECoG are significantly higher than the empirical guessing level (51.26%) in all subjects (pEEG as in ECoG, and demonstrates the feasibility of discriminating finger movements from one hand using EEG. These findings are promising to facilitate the development of BCIs with rich control signals using noninvasive technologies. PMID:24416360

Relationship Between Hand Contact Angle and Shoulder Loading During Manual Wheelchair Propulsion by Individuals with Paraplegia.

Science.gov (United States)

Requejo, Philip Santos; Mulroy, Sara J; Ruparel, Puja; Hatchett, Patricia E; Haubert, Lisa Lighthall; Eberly, Valerie J; Gronley, JoAnne K

2015-01-01

Shoulder loading during manual wheelchair propulsion (WCP) contributes to the development of shoulder pain in individuals with spinal cord injury (SCI). To use regression analysis to investigate the relationships between the hand contact angle (location of the hand on the pushrim at initial contact and release during the push phase of the WCP cycle) with propulsion characteristics, pushrim forces, and shoulder kinetics during WCP in individuals with paraplegia. Biomechanical data were collected from 222 individuals (198 men and 24 women) with paraplegia from SCI during WCP on a stationary ergometer at a self-selected speed. The average age of participants was 34.7 years (±9.3), mean time since SCI was 9.3 years (±6.1), and average body weight was 74.4 kg (±15.9). The majority (n = 127; 56%) of participants had lower level paraplegia (T8 to L5) and 95 (42%) had high paraplegia (T2 to T7). Increased push arc (mean = 75.3°) was associated with greater velocity (R = 0.384, P contact angle and hand release angles were equally associated with cycle distance and cadence, whereas a more anterior release angle was associated with greater velocity (R = 0.372, P contact angle was associated with greater posterior shoulder net joint force (R = 0.229, P = .001) and greater flexor net joint moment (R = 0.204, P = .002), whereas a more anterior hand release angle was significantly associated with increased vertical (R = 0.270, P contact and hand release must be considered in WCP training. It is recommended that participants should reach back to initiate contact with the pushrim to maximize push arc but avoid a more anterior hand position at release, because this could increase shoulder load during the push phase of WCP.

Novel Approach to Control of Robotic Hand Using Flex Sensors

Directory of Open Access Journals (Sweden)

Sandesh R.S

2014-05-01

Full Text Available This paper discuss about novel design approach to control of a robotic hand using flex sensors which indicates a biomechatronic multi fingered robotic hand. This robotic hand consists of base unit, upper arm, lower arm, palm and five fingers. The aim is to develop an anthropomorphic five fingered robotic hand. The proposed design illustrates the use of 5 micro DC motors with 9 Degrees of Freedom (DOF.Each finger is controlled independently. Further three extra motors were used for the control of wrist elbow and base movement. The study of the DC motor is being carried out using the transfer function model for constant excitation. The micro DC motor performance was analyzed using MATLAB simulation environment. The whole system is implemented using flex sensors. The flex sensors placed on the human hand gloves appear as if they look like real human hand.  89v51 microcontroller was used for all the controlling actions along with RF transmitter/receiver .The performance of the system has been conducted experimentally and studied.

Interaction of 0.53 {mu}m laser pulse with millimeter-scale plasmas generated by gasbag target

Energy Technology Data Exchange (ETDEWEB)

Li Zhichao; Guo Liang [CAS Key Laboratory of Basic Plasma Physics, and Department of Modern Physics, University of Science and Technology of China, Hefei, Anhui (China); Research Center of Laser Fusion, China Academy of Engineering Physics, Mianyang, Sichuan (China); Zheng Jian; Yuan Peng [CAS Key Laboratory of Basic Plasma Physics, and Department of Modern Physics, University of Science and Technology of China, Hefei, Anhui (China); Jiang Xiaohua; Wang Zhebin; Yang Dong; Zhang Huan; Li Sanwei; Yin Qiang; Zhu Fanghua; Peng Xiaoshi; Wang Feng; Yuan Zheng; Chen Li; Liu Shenye; Jiang Shaoen; Ding Yongkun [Research Center of Laser Fusion, China Academy of Engineering Physics, Mianyang, Sichuan (China); Shao Ping [Shanghai Institute of Optics and Fine Mechanics, CAS, Shanghai (China)

2012-06-15

Detailed research on the interaction of a 0.53 {mu}m laser pulse with millimeter-scale plasmas produced by a gasbag target on the Shengguang-II facility is presented. The x-ray pinhole images confirm that millimeter-scale plasmas are generated and the x-ray framing images show a temporal window of 0.6-1.1 ns during which the millimeter-scale plasmas exist. The electron temperature is measured with a collective Thomson scattering system, providing 0.64 keV for C{sub 5}H{sub 12} and 1.8 keV for Xe plasmas. The electron density is inferred from the stimulated Raman scattering spectra. The experimental spectra show large differences for C{sub 5}H{sub 12}- and Xe-filled gasbags. A one-dimensional code based upon steady-state, kinetic linear theory is applied to calculate the stimulated Raman scattering spectra. Excellent agreement between the calculated and experimental results shows that the plasma parameters, especially the electron density and the temperature, dominate the disruption behavior of stimulated Raman scattering. The results also indicate that stimulated Raman scattering is probably located within specific region of the gasbag. The time-integrated reflectivity of both the stimulated Raman and Brillouin scattering is at a low level, even in the conditions of high laser intensity (1.5 Multiplication-Sign 10{sup 15} W/cm{sup 2}) and no beam-smoothing. The experimental results are promising for future ignition experiments with a 0.53 {mu}m laser as the driver.

Nutrient Application and Algal Blooms: Farmer Decisions Regarding the Use of Best Management Practices in Lake Erie's Maumee River Watershed

Science.gov (United States)

Heeren, A.; Toman, E.; Wilson, R. S.; Martin, J.

2016-12-01

Lake Erie is the most productive of the Great Lakes. However, harmful algal blooms (HABs) caused by nutrient run-off threaten the lake. Experts have proposed numerous best management practices (BMPs) designed to reduce nutrient and sediment run-off. However, for these practices to be effective at reducing HABs, a significant portion of farmers and landowners within Lake Erie's watersheds have to first adopt and implement these practices. In order to better understand how farmers and landowners make decisions about whether or not to adopt and implement BMPs we conducted a series of focus groups and a mail survey of Lake Erie's largest watershed. We found that many farmers were supportive of adopting BMPs. For example, 60% of farmers in the watershed have already adopted using grid soil sampling while another 30% are willing to adopt the practice in the future. However, other practices were less popular, for example, only 18% of farmers had already adopted cover crops. Farmers also expressed several reservations about adopting some BMPs. For example, farmers were concerned about the costs of some BMPs, such as cover crops and drainage management systems, and how such practices might interfere with the planting of subsequent crops. Our research has several implications for reducing nutrient production by promoting BMPs. First, we identified potential concerns and limitations farmers faced in implementing specific BMPs. For example, conservationists can design future programs and communication efforts to target these specific concerns. Second, through examining the socio-psychological and cognitive characteristics that influence farmer decision-making, we identified that willingness to adopt nutrient BMPs is association with how strongly a farmer identifies with conservation and how effective they believed the BMP was at reducing run-off. Messages and information about BMPs may be more effective if they are framed in a way that aligns with identities and beliefs about

28 CFR 93.3 - Definitions.

Science.gov (United States)

2010-07-01

... 28 Judicial Administration 2 2010-07-01 2010-07-01 false Definitions. 93.3 Section 93.3 Judicial Administration DEPARTMENT OF JUSTICE (CONTINUED) PROVISIONS IMPLEMENTING THE VIOLENT CRIME CONTROL AND LAW... 901(a)(2) of the Omnibus Crime Control and Safe Streets Act of 1968, as amended. (b) Unit of Local...

32 CFR 93.7 - Responsibilities.

Science.gov (United States)

2010-07-01

... ACCEPTANCE OF SERVICE OF PROCESS; RELEASE OF OFFICIAL INFORMATION IN LITIGATION; AND TESTIMONY BY NSA... overseeing NSA compliance with § 93.1(a) and this part 93, and for consulting with DoJ when appropriate. In response to a litigation demand requesting official information or the testimony of NSA personnel as...

The Making of a 3D-Printed, Cable-Driven, Single-Model, Lightweight Humanoid Robotic Hand

Directory of Open Access Journals (Sweden)

Li Tian

2017-12-01

Full Text Available Dexterity robotic hands can (Cummings, 1996 greatly enhance the functionality of humanoid robots, but the making of such hands with not only human-like appearance but also the capability of performing the natural movement of social robots is a challenging problem. The first challenge is to create the hand’s articulated structure and the second challenge is to actuate it to move like a human hand. A robotic hand for humanoid robot should look and behave human like. At the same time, it also needs to be light and cheap for widely used purposes. We start with studying the biomechanical features of a human hand and propose a simplified mechanical model of robotic hands, which can achieve the important local motions of the hand. Then, we use 3D modeling techniques to create a single interlocked hand model that integrates pin and ball joints to our hand model. Compared to other robotic hands, our design saves the time required for assembling and adjusting, which makes our robotic hand ready-to-use right after the 3D printing is completed. Finally, the actuation of the hand is realized by cables and motors. Based on this approach, we have designed a cost-effective, 3D printable, compact, and lightweight robotic hand. Our robotic hand weighs 150 g, has 15 joints, which are similar to a real human hand, and 6 Degree of Freedom (DOFs. It is actuated by only six small size actuators. The wrist connecting part is also integrated into the hand model and could be customized for different robots such as Nadine robot (Magnenat Thalmann et al., 2017. The compact servo bed can be hidden inside the Nadine robot’s sleeve and the whole robotic hand platform will not cause extra load to her arm as the total weight (150 g robotic hand and 162 g artificial skin is almost the same as her previous unarticulated robotic hand which is 348 g. The paper also shows our test results with and without silicon artificial hand skin, and on Nadine robot.

Design of a 3-DOF Parallel Hand-Controller

Directory of Open Access Journals (Sweden)

Chengcheng Zhu

2017-01-01

Full Text Available Hand-controllers, as human-machine-interface (HMI devices, can transfer the position information of the operator’s hands into the virtual environment to control the target objects or a real robot directly. At the same time, the haptic information from the virtual environment or the sensors on the real robot can be displayed to the operator. It helps human perceive haptic information more truly with feedback force. A parallel hand-controller is designed in this paper. It is simplified from the traditional delta haptic device. The swing arms in conventional delta devices are replaced with the slider rail modules. The base consists of two hexagons and several links. For the use of the linear sliding modules instead of swing arms, the arc movement is replaced by linear movement. So that, the calculating amount of the position positive solution and the force inverse solution is reduced for the simplification of the motion. The kinematics, static mechanics, and dynamic mechanics are analyzed in this paper. What is more, two demonstration applications are developed to verify the performance of the designed hand-controller.

Fall diets of red-breasted merganser (Mergus serrator) and walleye (Sander vitreus) in Sandusky Bay and adjacent waters of western Lake Erie

Science.gov (United States)

Bur, M.T.; Stapanian, M.A.; Bernhardt, G.; Turner, M.W.

2008-01-01

Although published studies indicate the contrary, there is concern among many sport anglers that migrating red-breasted mergansers (Mergus serrator) and other waterbirds pose a competitive threat to sport fish species such as walleye (Sander vitreus) in Lake Erie. We quantified the diet of autumn-migrant mergansers and walleye during 1998-2000 in Sandusky Bay and adjacent waters of western Lake Erie. We hypothesized that the diets of both predators would be similar in species composition, but because of different foraging ecologies their diets would differ markedly in size of prey consumed. In addition to predator samples, we used trawl data from the same general area as an index of prey availability. We found that mergansers fed almost exclusively on fish (nine species). Gizzard shad (Dorosoma cepedianum), emerald shiner (Notropis atherinoides) and round goby (Neogobius melanostomus) were consumed in the greatest numbers, most frequently and comprised the greatest biomass. Walleye fed exclusively on fish: gizzard shad, alewife (Alosa psuedoharengus) and emerald shiner were consumed in the greatest numbers, most frequently and comprised the greatest biomass. Diet overlap between mergansers and walleye was 67% by weight and 66% by species frequency. Mean total lengths of gizzard shad, emerald shiner and round goby found in walleye stomachs exceeded those captured in trawls by 47%, on average. Mean total lengths of gizzard shad, emerald shiner and round goby were greater in walleye stomachs than in merganser stomachs. Mean total lengths of emerald shiner and round goby were less in merganser stomachs than in trawls. Our results suggest that although the diets of walleye and mergansers overlapped considerably, mergansers generally consumed smaller fish than walleye. Given the abundance and diversity of prey species available, and the transient nature of mergansers on Lake Erie during migration, we conclude that competition for food between these species is minimal.

Hearing in the matter of an application by Erie Shores Wind Farm Limited Partnership for an Order granting leave to construct transmission facilities to connect a wind farm to the transmission facilities of Hydro One Network Inc.[In the matter of the Ontario Energy Board Act, 1998, S.O. 1998, c. 15, Schedule B

Energy Technology Data Exchange (ETDEWEB)

Kaiser, G.; Vlahos, P.; Betts, B.

2005-06-20

This document presents the transcripts of an Ontario Energy Board hearing regarding an application filed by Erie Shores Wind Farm Limited to construct transmission facilities that will connect Erie Shores' wind farm on the north shore of Lake Erie to the transmission facilities of Hydro One Network. This document presents the examinations by representatives of the Board Counsel, Erie Shores Wind Farm Limited Partnership, Hydro One Networks Inc., Ontario's Independent Electricity System Operator and intervenors. Erie Shores is a limited partnership between AIM PowerGen Corporation and Clean Power Income Fund. The proposed wind farm is to be located along the north shore of Lake Erie, covering about 14,000 acres of farmland in the townships of Bayham, Malahide and Norfolk County. It consists of 66 wind turbines with a net output of 99 MW. The construction of transmission facilities would involve the construction of a new transformer station with a 34.5/115 kV transformer, a capacitor bank, switch gear, and space for a future transformer. It would also include a transmission line from the Port Burwell transmission station to Hydro One's circuits at Cranberry Junction near Tillsonburg. Erie Shores also proposes to construct 27 km of the transmission line within the existing Otter Valley utility corridor, 3 km along the active Canadian Pacific Rail corridor, and over certain private lands located south of Tillsonburg Junction. Erie Shores was one of the successful bidders that has entered into a 20-year renewable energy supply contract with the Ontario Electricity Financial Corporation. The Board considers that the project is in the public interest and granted approval for the project, subject to certain conditions regarding communications, monitoring and reporting requirements. 2 refs., 1 appendix.

Measurement of cross-sections for the 93Nb(p,n)93mMo and 93Nb(p,pn)92mNb reactions up to ∼20 MeV energy

Science.gov (United States)

Lawriniang, B.; Ghosh, R.; Badwar, S.; Vansola, V.; Santhi Sheela, Y.; Suryanarayana, S. V.; Naik, H.; Naik, Y. P.; Jyrwa, B.

2018-05-01

Excitation functions of the 93Nb(p,n)93mMo and 93Nb(p,pn)92mNb reactions were measured from threshold energies to ∼ 20MeV by employing stacked foil activation technique in combination with the off-line γ-ray spectroscopy at the BARC-TIFR Pelletron facility, Mumbai. For the 20 MeV proton beam, the energy degradation along the stack was calculated using the computer code SRIM 2013. The proton beam intensity was determined via the natCu(p,x)62Zn monitor reaction. The experimental data obtained were compared with the theoretical results from TALYS-1.8 as well as with the literature data available in EXFOR. It was found that for the 93Nb(p,n)92mMo reaction, the present data are in close agreement with some of the recent literature data and the theoretical values based on TALYS-1.8 but are lower than the other literature data. In the case of 93Nb(p,pn)93mNb reaction, present data agree very well with the literature data and the theoretical values.

32 CFR 93.6 - Fees.

Science.gov (United States)

2010-07-01

... SERVICE OF PROCESS; RELEASE OF OFFICIAL INFORMATION IN LITIGATION; AND TESTIMONY BY NSA PERSONNEL AS WITNESSES § 93.6 Fees. Consistent with the guidelines in § 93.1(e), NSA may charge reasonable fees to... providing such information, and may include: (a) The costs of time expended by NSA employees to process and...

Vertical Stratification of Soil Phosphorus as a Concern for Dissolved Phosphorus Runoff in the Lake Erie Basin.

Science.gov (United States)

Baker, David B; Johnson, Laura T; Confesor, Remegio B; Crumrine, John P

2017-11-01

During the re-eutrophication of Lake Erie, dissolved reactive phosphorus (DRP) loading and concentrations to the lake have nearly doubled, while particulate phosphorus (PP) has remained relatively constant. One potential cause of increased DRP concentrations is P stratification, or the buildup of soil-test P (STP) in the upper soil layer (soil samples (0-5 or 0-2.5 cm) alongside their normal agronomic samples (0-20 cm) ( = 1758 fields). The mean STP level in the upper 2.5 cm was 55% higher than the mean of agronomic samples used for fertilizer recommendations. The amounts of stratification were highly variable and did not correlate with agronomic STPs (Spearman's = 0.039, = 0.178). Agronomic STP in 70% of the fields was within the buildup or maintenance ranges for corn ( L.) and soybeans [ (L.) Merr.] (0-46 mg kg Mehlich-3 P). The cumulative risks for DRP runoff from the large number of fields in the buildup and maintenance ranges exceeded the risks from fields above those ranges. Reducing stratification by a one-time soil inversion has the potential for larger and quicker reductions in DRP runoff risk than practices related to drawing down agronomic STP levels. Periodic soil inversion and mixing, targeted by stratified STP data, should be considered a viable practice to reduce DRP loading to Lake Erie. Copyright © by the American Society of Agronomy, Crop Science Society of America, and Soil Science Society of America, Inc.

Space robotics--DLR's telerobotic concepts, lightweight arms and articulated hands.

Science.gov (United States)

Hirzinger, G; Brunner, B; Landzettel, K; Sporer, N; Butterfass, J; Schedl, M

2003-01-01

The paper briefly outlines DLR's experience with real space robot missions (ROTEX and ETS VII). It then discusses forthcoming projects, e.g., free-flying systems in low or geostationary orbit and robot systems around the space station ISS, where the telerobotic system MARCO might represent a common baseline. Finally it describes our efforts in developing a new generation of "mechatronic" ultra-light weight arms with multifingered hands. The third arm generation is operable now (approaching present-day technical limits). In a similar way DLR's four-fingered hand II was a big step towards higher reliability and yet better performance. Artificial robonauts for space are a central goal now for the Europeans as well as for NASA, and the first verification tests of DLR's joint components are supposed to fly already end of 93 on the space station.

Magnetodielectric behaviour in La0.53Ca0.47MnO3

International Nuclear Information System (INIS)

Pandey, Suchita; Kumar, Jitender; Awasthi, A M

2014-01-01

We explore magneto-dielectricity in La 0.53 Ca 0.47 MnO 3 across its paramagnetic (PMI) to ferromagnetic (FMM) isostructural transition at T C  ∼ 253 K, by magnetic (M), caloric (W), dielectric (ε′), magnetoresistive (MR), and magnetocapacitance (MC) investigations. A skew-broadened first-order transition character is confirmed via heating/cooling hystereses in M(T) and W(T), with a superheating temperature T ** next to T C and supercooling temperature T * exhibiting kinetics. Above T C , linearly related MC and MR reflect purely a magnetoresistance effect. Near T C , the high-frequency MC (5 Tesla (T)), far exceeds the magneto-losses, and is uncorrelated with dc MR (5 T) in the FM-ordered state. The intrinsic magneto-dielectricity manifest below T C and above ∼kHz is traced to an intra-granular Maxwell–Wagner-type effect at the interface region of PMI–FMM phase coexistence. (paper)

No Effect of TETRA Hand Portable Transmission Signals on Human Cognitive Function and Symptoms

DEFF Research Database (Denmark)

Riddervold, Ingunn Skogstad; Kjærgaard, Søren K.; Pedersen, Gert F.

2010-01-01

Current radio frequency radiation exposure guidelines rest on well-established thermal effects. However, recent research into analogue and digital transmission fields at levels covered by the exposure guidelines has indicated possible detrimental effects on human cognitive performance. To investi......Current radio frequency radiation exposure guidelines rest on well-established thermal effects. However, recent research into analogue and digital transmission fields at levels covered by the exposure guidelines has indicated possible detrimental effects on human cognitive performance....... To investigate this, we conducted a controlled climate chamber study of possible changes in cognitive performance in healthy volunteers exposed to transmission signals from TETRA hand portables (TETRA handsets). The trial deployed a balanced, randomized, double-blinded cross-over design. Performance on different...... paper-and-pencil, auditory and computer-based cognitive tasks was monitored in 53 male volunteers (mean age 36.41 years, SD 8.35) during 45-min exposure to a TETRA handset and sham control signals remotely controlled from a laboratory more than 100 km away. The main cognitive outcome was the Trail...

User evaluation of patient counselling, combining nurse consultation and eHealth in hand eczema.

Science.gov (United States)

Mollerup, Annette; Harboe, Gitte; Johansen, Jeanne D

2016-04-01

This study reports the findings from a user evaluation of a counselling programme for hand eczema patients in which face-to-face encounters were supplemented with user access to a new website. Patients treated for hand eczema in two different settings were included consecutively. Website utilization was examined by use of the transaction log. Comparisons were made between participants who used the website and those who did not. The patients' perspectives were explored by the use of interviews. Among potential website users (n = 140), 88 patients (63%) had an average of 5.1 site visits. At follow-up, the website users had improved more in quality of life (p = 0.014), current burden of disease (p = 0.053), and itching (p = 0.042). The website users reported more changes in habits than did the non-website users (p = 0.024). No differences in clinical severity of hand eczema were found. The interviewees were generally satisfied with the counselling and the website. The strict log-on procedures were considered to be an obstacle to using the site. The consecutive inclusion of participants was considered to be a barrier to engagement in the dialogue forum. The website users benefited from the website, although this was not substantiated by clinical measurements. The trial design partly hampered website utilization. An initial feasibility study could have been warranted. © 2016 John Wiley & Sons A/S. Published by John Wiley & Sons Ltd.

[Bertha Röntgen or the transparency of the hand].

Science.gov (United States)

Picard, J D

1996-01-01

It is to Wilhelm Conrad Röntgen, the first elected "radiologist" of our Academy and the first Nobel Prize winner in physics, that we owe the transparency of the hand. We celebrate today the centenary of the great scientific discovery which was to revolutionize the diagnosis, and thereby the treatment, of a large number of illnesses the discovery of X-rays. It would be unjust not to link the name of this scientist with that of his wife, Bertha, who, ignorant of the dangers of all "novel medical inventions" volunteered her own hand for his research experiments: the hand which was to bring to the world tangible proof of this remarkable discovery. To a lesser degree, but nonetheless essential, we acknowledge, albeit not in exhaustive detail, all the progress made by the work of pioneers using this new investigative technique. So let us now return to the hand:--a body part which it was easy to immobilize, remembering that in those days a single radiographic exposure took up to an hour to obtain,--we will consider the immortalised hand of Bertha Röntgen,---to whom this address is dedicated,---and its radiographic exposures which allow us to appreciate the advances and to perceive the limitations of this technique. They also enable us better to envisage future investigative approaches whereby a deeper knowledge of the human body may be acquired. We note that compared with the histopathological sciences, imaging is not specific. Numerous microscopic structures, in particular neurological and vascular ones, are still insufficiently well visualised and the transmission pathways between the hand and the central nervous system deserve better characterisation. Current, research programmes are attempting to overcome these limitation of modern imaging. All the experience gained in studying the transparency of the hand, as we have discussed, is applicable to every part of the human anatomy. To credit: Röntgen's discovery with all its originality, we could say that the hand was

9 CFR 93.409 - Articles accompanying ruminants.

Science.gov (United States)

2010-01-01

... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Articles accompanying ruminants. 93.409 Section 93.409 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT...; REQUIREMENTS FOR MEANS OF CONVEYANCE AND SHIPPING CONTAINERS Ruminants § 93.409 Articles accompanying ruminants...

38 CFR 18b.93 - Expeditious treatment.

Science.gov (United States)

2010-07-01

... 38 Pensions, Bonuses, and Veterans' Relief 2 2010-07-01 2010-07-01 false Expeditious treatment. 18b.93 Section 18b.93 Pensions, Bonuses, and Veterans' Relief DEPARTMENT OF VETERANS AFFAIRS... Judicial Standards of Practice § 18b.93 Expeditious treatment. Requests for expeditious treatment of...

Real-Time Hand Posture Recognition Using a Range Camera

Science.gov (United States)

Lahamy, Herve

The basic goal of human computer interaction is to improve the interaction between users and computers by making computers more usable and receptive to the user's needs. Within this context, the use of hand postures in replacement of traditional devices such as keyboards, mice and joysticks is being explored by many researchers. The goal is to interpret human postures via mathematical algorithms. Hand posture recognition has gained popularity in recent years, and could become the future tool for humans to interact with computers or virtual environments. An exhaustive description of the frequently used methods available in literature for hand posture recognition is provided. It focuses on the different types of sensors and data used, the segmentation and tracking methods, the features used to represent the hand postures as well as the classifiers considered in the recognition process. Those methods are usually presented as highly robust with a recognition rate close to 100%. However, a couple of critical points necessary for a successful real-time hand posture recognition system require major improvement. Those points include the features used to represent the hand segment, the number of postures simultaneously recognizable, the invariance of the features with respect to rotation, translation and scale and also the behavior of the classifiers against non-perfect hand segments for example segments including part of the arm or missing part of the palm. A 3D time-of-flight camera named SR4000 has been chosen to develop a new methodology because of its capability to provide in real-time and at high frame rate 3D information on the scene imaged. This sensor has been described and evaluated for its capability for capturing in real-time a moving hand. A new recognition method that uses the 3D information provided by the range camera to recognize hand postures has been proposed. The different steps of this methodology including the segmentation, the tracking, the hand

9 CFR 93.508 - Articles accompanying swine.

Science.gov (United States)

2010-01-01

... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Articles accompanying swine. 93.508 Section 93.508 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF... FOR MEANS OF CONVEYANCE AND SHIPPING CONTAINERS Swine § 93.508 Articles accompanying swine. No litter...

fMRI-compatible rehabilitation hand device

Directory of Open Access Journals (Sweden)

Tzika Aria

2006-10-01

Full Text Available Abstract Background Functional magnetic resonance imaging (fMRI has been widely used in studying human brain functions and neurorehabilitation. In order to develop complex and well-controlled fMRI paradigms, interfaces that can precisely control and measure output force and kinematics of the movements in human subjects are needed. Optimized state-of-the-art fMRI methods, combined with magnetic resonance (MR compatible robotic devices for rehabilitation, can assist therapists to quantify, monitor, and improve physical rehabilitation. To achieve this goal, robotic or mechatronic devices with actuators and sensors need to be introduced into an MR environment. The common standard mechanical parts can not be used in MR environment and MR compatibility has been a tough hurdle for device developers. Methods This paper presents the design, fabrication and preliminary testing of a novel, one degree of freedom, MR compatible, computer controlled, variable resistance hand device that may be used in brain MR imaging during hand grip rehabilitation. We named the device MR_CHIROD (Magnetic Resonance Compatible Smart Hand Interfaced Rehabilitation Device. A novel feature of the device is the use of Electro-Rheological Fluids (ERFs to achieve tunable and controllable resistive force generation. ERFs are fluids that experience dramatic changes in rheological properties, such as viscosity or yield stress, in the presence of an electric field. The device consists of four major subsystems: a an ERF based resistive element; b a gearbox; c two handles and d two sensors, one optical encoder and one force sensor, to measure the patient induced motion and force. The smart hand device is designed to resist up to 50% of the maximum level of gripping force of a human hand and be controlled in real time. Results Laboratory tests of the device indicate that it was able to meet its design objective to resist up to approximately 50% of the maximum handgrip force. The detailed

Development of High Resolution Resonance Ionization Mass Spectrometry for Neutron Dosimetry Technique with93Nb(n,n'93mNb Reaction

Directory of Open Access Journals (Sweden)

Tomita Hideki

2016-01-01

Full Text Available We have proposed an advanced technique to measure the 93mNb yield precisely by Resonance Ionization Mass Spectrometry, instead of conventional characteristic X-ray spectroscopy. 93mNb-selective resonance ionization is achievable by distinguishing the hyperfine splitting of the atomic energy levels between 93Nb and 93mNb at high resolution. In advance of 93mNb detection, we could successfully demonstrate high resolution resonant ionization spectroscopy of stable 93Nb using an all solid-state, narrow-band and tunable Ti:Sapphire laser system operated at 1 kHz repetition rate.

32 CFR 728.93 - Chart of adjuncts.

Science.gov (United States)

2010-07-01

... 32 National Defense 5 2010-07-01 2010-07-01 false Chart of adjuncts. 728.93 Section 728.93 National Defense Department of Defense (Continued) DEPARTMENT OF THE NAVY PERSONNEL MEDICAL AND DENTAL CARE FOR ELIGIBLE PERSONS AT NAVY MEDICAL DEPARTMENT FACILITIES Adjuncts to Medical Care § 728.93 Chart of...

40 CFR 406.93-406.94 - [Reserved

Science.gov (United States)

2010-07-01

... 40 Protection of Environment 28 2010-07-01 2010-07-01 true [Reserved] 406.93-406.94 Section 406.93-406.94 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) EFFLUENT GUIDELINES AND STANDARDS GRAIN MILLS POINT SOURCE CATEGORY Ready-to-Eat Cereal Subcategory §§ 406.93-406.94 [Reserved] ...

9 CFR 93.418 - Cattle from Canada.

Science.gov (United States)

2010-01-01

... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Cattle from Canada. 93.418 Section 93... CONVEYANCE AND SHIPPING CONTAINERS Ruminants Canada 8 § 93.418 Cattle from Canada. (a) Health certificates. Cattle intended for importation from Canada must be accompanied by a certificate issued in accordance...

9 CFR 93.517 - Swine from Canada.

Science.gov (United States)

2010-01-01

... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Swine from Canada. 93.517 Section 93... CONVEYANCE AND SHIPPING CONTAINERS Swine Canada 7 § 93.517 Swine from Canada. (a) For purposes other than immediate slaughter. Swine offered for importation from Canada for purposes other than immediate slaughter...

9 CFR 93.427 - Cattle from Mexico.

Science.gov (United States)

2010-01-01

... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Cattle from Mexico. 93.427 Section 93... CONVEYANCE AND SHIPPING CONTAINERS Ruminants Mexico 10 § 93.427 Cattle from Mexico. (a) Cattle and other ruminants imported from Mexico, except animals being transported in bond for immediate return to Mexico or...

Draft environmental statement related to construction of Erie Nuclear Plant, Units 1 and 2: (Docket Nos. STN 50-580 and STN 50-581)

International Nuclear Information System (INIS)

1977-11-01

The proposed action is the issuance of construction permits to the Ohio Edison Company, acting on behalf of itself, the Cleveland Electric Illuminating Company, Duquesne Light Company, Pennsylvania Power Company, and the Toledo Edison Company, for the construction of the Erie Nuclear Plant Units 1 and 2, located in Erie County, Ohio. A total of 704 hectares (ha) (1740 acres) will be used for the Erie plant site. Construction-related activities on the primary site will disturb about 223 ha (551 acres). Approximately 641 ha (1584 acres) will be required for transmission line rights-of-way. The 3.86-km (2.4-mile) intake and discharge pipeline land corridor will involve alteration of approximately 13 ha (32 acres) of corridor and 1 ha (2.5 acres) for shore facilities. Also, 3.9 ha (9.6 acres) of lake bottom will be disturbed to provide 15-m-wide (50-ft-wide) trenches and an additional 15-m-wide (50-ft-wide) area for storage of excavated material for subsequent backfill for the 701-m (2300-ft) intake and 579-m (1900-ft) discharge lines. Plant construction will involve some community impacts. No residents will be displaced from the site property. Traffic on local roads will increase due to construction and commuting activities. The influx of construction workers' families (a peak work force of about 2700) is expected to cause no major housing or school problems. It is assumed that aquatic organisms entrained in the circulating water system will be killed due to thermal and mechanical shock. The maximum impact based on the population densities of phytoplankton and zooplankton organisms in the adjacent lake area will be the destruction of 0.1% of the entrainable organisms from the lake water. The entrainment of fish larvae will not constitute a significant impact on the lake fishery. 62 figs., 32 tabs

9 CFR 93.435 - Sheep and goats.

Science.gov (United States)

2010-01-01

... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Sheep and goats. 93.435 Section 93.435... CONVEYANCE AND SHIPPING CONTAINERS Ruminants Additional General Provisions § 93.435 Sheep and goats. (a) Except as provided in paragraph (b) of this section, all sheep and goats imported into the United States...

7 CFR 1948.93 - Appeal procedure.

Science.gov (United States)

2010-01-01

... 7 Agriculture 13 2010-01-01 2009-01-01 true Appeal procedure. 1948.93 Section 1948.93 Agriculture Regulations of the Department of Agriculture (Continued) RURAL HOUSING SERVICE, RURAL BUSINESS-COOPERATIVE... accordance with FmHA Instruction 1900-B. ...

Effect on Al:MO{sub 2}/In{sub 0.53}Ga{sub 0.47}As interface (M = Hf, Zr) of trimethyl-aluminum pre-treatment during atomic layer deposition

Energy Technology Data Exchange (ETDEWEB)

Lamperti, A., E-mail: alessio.lamperti@mdm.imm.cnr.it [Laboratorio MDM, IMM-CNR, via C. Olivetti 2, 20864 Agrate Brianza, MB (Italy); Molle, A.; Cianci, E.; Wiemer, C.; Spiga, S. [Laboratorio MDM, IMM-CNR, via C. Olivetti 2, 20864 Agrate Brianza, MB (Italy); Fanciulli, M. [Laboratorio MDM, IMM-CNR, via C. Olivetti 2, 20864 Agrate Brianza, MB (Italy); Dipartimento di Scienza dei Materiali, Università di Milano-Bicocca, Milano (Italy)

2014-07-31

For the fabrication of n-type metal–oxide–semiconductor field-effect transistor based on high mobility III–V compound semiconductors as channel materials, a major requirement is the integration of high quality gate oxides on top of the III–V substrates. A detailed knowledge of the interface between the oxide layer and the substrate is mandatory to assess the relevance of interdiffusion and related defects, which are detrimental. Here we grow high dielectric constant (k) Al:MO{sub 2} (M = Hf, Zr) gate materials on In{sub 0.53}Ga{sub 0.47}As substrates by atomic layer deposition, after an Al{sub 2}O{sub 3} pre-treatment based on trimethylaluminum is performed to properly passivate the substrate surface. Time of flight secondary ion mass spectrometry depth profiles reveal not only the film integrity and the chemical composition of the high-k oxide but also well elucidate the effect of the Al{sub 2}O{sub 3} pre-treatment on Al:MO{sub 2}/In{sub 0.53}Ga{sub 0.47}As interface. Even though the chemical profile is well defined in both cases, a broader interface is detected for Al:ZrO{sub 2}. X-ray photoemission spectroscopy evidenced the presence of As{sup 3+} states in Al:ZrO{sub 2} only. Accordingly, preliminary capacitance–voltage measurements point out to a better field effect modulation in the capacitor incorporating Al:HfO{sub 2}. Based on the above considerations Al:HfO{sub 2} looks as a preferred candidate with respect to Al:ZrO{sub 2} for the integration on top of In{sub 0.53}Ga{sub 0.47}As substrates. - Highlights: • Al:MO{sub 2} (M = Hf, Zr) thin films are grown on In{sub 0.53}Ga{sub 0.47}As substrates. • Trimethylaluminum (TMA) pre-treatment properly passivates the substrate surface. • ToF-SIMS depth profiles reveal the chemical composition of the high-k films. • Depth profiles well elucidate the effect of TMA on Al:MO{sub 2}/In{sub 0.53}Ga{sub 0.47}As substrates. • XPS evidences the presence of As{sup 3+} state in Al:ZrO{sub 2}/In{sub 0.53

Controller design for Robotic hand through Electroencephalogram

OpenAIRE

Pandelidis P.; Kiriazis N.; Orgianelis K.; Koulios N.

2016-01-01

- This paper deals with the designing, the construction and the control of a robotic hand via an electroencephalogram sensor. First a robotic device that is able to mimic a real human hand is constructed. A PID controller is designed in order to improve the performance of the robotic arm for grabbing objects. Furthermore, a novel design approach is presented for controlling the motion of the robotic arm using signals produced from an innovative electroencephalogram sensor that detects the con...

Meteotsunamis in the Great Lakes and Investigation into the May 27, 2012 Event on Lake Erie

Science.gov (United States)

Anderson, E. J.; Bechle, A.; Wu, C. H.; Schwab, D. J.; Mann, G.

2016-02-01

Meteotsunami events have been documented in several countries around the world in the coastal ocean, semi-enclosed basins, and in the Great Lakes. In particular, investigations in the Great Lakes have raised the issue of dangers posed by enclosed basins due to the reflection and interaction of meteotsunami waves, in which the destructive waves can arrive several hours after the atmospheric disturbance has passed. This disassociation in time and space between the atmospheric disturbance and resultant meteotsunami wave can pose a significant threat to the public. In a recent event on May 27, 2012, atmospheric conditions gave rise to two convective systems that generated a series of waves in the meteotsunami band on Lake Erie. The resulting waves swept three swimmers a half-mile offshore, inundated a marina, and may have led to a capsized boat along the southern shoreline. Examination of the observed conditions shows that these events occurred at a time between the arrivals of these two storm systems when atmospheric conditions were relatively calm but water level displacements were at their greatest. In this work, we attempt to explain the processes that led to these conditions through a combination of atmospheric and hydrodynamic modeling and an analysis of the observed radial velocities associated with the meteotsunami-inducing front. Results from a high-resolution atmospheric model and hydrodynamic model reveal that the formation of these destructive waves resulted from a combination of wave reflection, focusing, and edge waves that impacted the southern shore of Lake Erie. This event illustrates the unique danger posed by temporal lags between the inducing atmospheric conditions and resulting dangerous nearshore wave conditions.

Hand-assisted right laparoscopic nephrectomy in living donor

Directory of Open Access Journals (Sweden)

Fernando Meyer

2005-02-01

Full Text Available OBJECTIVE: To assess results obtained with the authors' technique of right hand-assisted laparoscopic nephrectomy in living kidney donors. MATERIALS AND METHODS: We retrospectively analyzed 16 kidney donors who underwent hand-assisted right laparoscopic nephrectomy from February 2001 to July 2004. Among these patients, 7 were male and 9 were female, with mean age ranging between 22 and 58 years (mean 35.75. RESULTS: Surgical time ranged from 55 to 210 minutes (mean 127.81 min and warm ischemia time from 2 to 6 minutes (mean 3.78 min with mean intra-operative blood loss estimated at 90.62 mL. There was no need for conversion in any case. Discharge from hospital occurred between the 3rd and 6th days (mean 3.81. On the graft assessment, immediate diuresis was seen in 15 cases (93.75% and serum creatinine on the 7th post-operative day was 1.60 mg/dL on average. Renal vein thrombosis occurred in 1 patient (6.25% who required graft removal, and lymphocele was seen in 1 recipient (6.25%. CONCLUSION: Hand-assisted right laparoscopic nephrectomy in living donors is a safe and effective alternative to open nephrectomy. Despite a greater technical difficulty, the procedure presented low postoperative morbidity providing good morphological and functional quality of the graft on the recipient.

7 CFR 93.13 - Analytical methods.

Science.gov (United States)

2010-01-01

... No. 1, USDA, Agricultural Marketing Service, Science and Technology, 3521 South Agriculture Building... 7 Agriculture 3 2010-01-01 2010-01-01 false Analytical methods. 93.13 Section 93.13 Agriculture Regulations of the Department of Agriculture (Continued) AGRICULTURAL MARKETING SERVICE (Standards...

Development of Pneumatic Robot Hand and Construction of Master-Slave System

Science.gov (United States)

Tsujiuchi, Nobutaka; Koizumi, Takayuki; Nishino, Shinya; Komatsubara, Hiroyuki; Kudawara, Tatsuwo; Hirano, Masanori

Recently, research and development has focused on robots that work in place of people. It is necessary for robots to perform the same flexible motions as people. Additionally, such robots need to incorporate high-level safety features in order not to injure people. For creation of such robots, we need to develop a robot hand that functions like a human hand. At the same time, this type of robot hand can be used as an artificial hand. Here, we present artificial muscle-type pneumatic actuators as the driving source of a robot hand that is both safe and flexible. Some development of robot hands using pneumatic actuators has already taken place. But, until now, when a pneumatic actuator is used, a big compressor is needed. So, the driving system also needs to be big; enlargement of the driving system is a major problem. Consequently, in this research, we develop a low-pressure, low-volume pneumatic actuator for driving a robot hand that works flexibly and safely on the assumption that it will be in contact with people. We develop a five-fingered robot hand with pneumatic actuators. And, we construct a master-slave system to enable the robot hand to perform the same operations as a human hand. We make a 1-link arm that has one degree of freedom using a pneumatic actuator, and construct a control system for the 1-link arm and verify its control performance.

Complementary Hand Responses Occur in Both Peri- and Extrapersonal Space.

Directory of Open Access Journals (Sweden)

Tim W Faber

Full Text Available Human beings have a strong tendency to imitate. Evidence from motor priming paradigms suggests that people automatically tend to imitate observed actions such as hand gestures by performing mirror-congruent movements (e.g., lifting one's right finger upon observing a left finger movement; from a mirror perspective. Many observed actions however, do not require mirror-congruent responses but afford complementary (fitting responses instead (e.g., handing over a cup; shaking hands. Crucially, whereas mirror-congruent responses don't require physical interaction with another person, complementary actions often do. Given that most experiments studying motor priming have used stimuli devoid of contextual information, this space or interaction-dependency of complementary responses has not yet been assessed. To address this issue, we let participants perform a task in which they had to mirror or complement a hand gesture (fist or open hand performed by an actor depicted either within or outside of reach. In three studies, we observed faster reaction times and less response errors for complementary relative to mirrored hand movements in response to open hand gestures (i.e., 'hand-shaking' irrespective of the perceived interpersonal distance of the actor. This complementary effect could not be accounted for by a low-level spatial cueing effect. These results demonstrate that humans have a strong and automatic tendency to respond by performing complementary actions. In addition, our findings underline the limitations of manipulations of space in modulating effects of motor priming and the perception of affordances.

Complementary Hand Responses Occur in Both Peri- and Extrapersonal Space.

Science.gov (United States)

Faber, Tim W; van Elk, Michiel; Jonas, Kai J

2016-01-01

Human beings have a strong tendency to imitate. Evidence from motor priming paradigms suggests that people automatically tend to imitate observed actions such as hand gestures by performing mirror-congruent movements (e.g., lifting one's right finger upon observing a left finger movement; from a mirror perspective). Many observed actions however, do not require mirror-congruent responses but afford complementary (fitting) responses instead (e.g., handing over a cup; shaking hands). Crucially, whereas mirror-congruent responses don't require physical interaction with another person, complementary actions often do. Given that most experiments studying motor priming have used stimuli devoid of contextual information, this space or interaction-dependency of complementary responses has not yet been assessed. To address this issue, we let participants perform a task in which they had to mirror or complement a hand gesture (fist or open hand) performed by an actor depicted either within or outside of reach. In three studies, we observed faster reaction times and less response errors for complementary relative to mirrored hand movements in response to open hand gestures (i.e., 'hand-shaking') irrespective of the perceived interpersonal distance of the actor. This complementary effect could not be accounted for by a low-level spatial cueing effect. These results demonstrate that humans have a strong and automatic tendency to respond by performing complementary actions. In addition, our findings underline the limitations of manipulations of space in modulating effects of motor priming and the perception of affordances.

Does behavioural thermoregulation underlie seasonal movements in Lake Erie walleye?

Science.gov (United States)

Raby, Graham D.; Vandergoot, Christopher; Hayden, Todd A.; Faust, Matthew D.; Kraus, Richard T.; Dettmers, John M.; Cooke, Steven J.; Zhao, Yingming; Fisk, Aaron T.; Krueger, Charles C.

2018-01-01

Thermoregulation is presumed to be a widespread determinant of behaviour in fishes, but has not often been investigated as a mechanism shaping long-distance migrations. We used acoustic telemetry and animal-borne thermal loggers to test the hypothesis that seasonal migration in adult walleye (Sander vitreus) in Lake Erie is size- and (or) sex-specific and related to behavioural thermoregulation. Female walleye migrated out of the warm, shallow western basin earlier than did males and were 1.8 times more likely to be detected on acoustic receivers in the deeper and cooler eastern basin. The few fish that remained in the western basin were restricted to a smaller range of higher temperatures (≥20 °C) than those that migrated to the central and eastern basins (∼16–21 °C). However, temperature records from walleye in the central basin were nearly indistinguishable from those in the eastern basin, suggesting thermal preferences alone could not explain migration to the eastern basin. As such, our effort to understand the mechanisms that cause migratory behaviours has generated mixed evidence on the role of temperature and that factors like foraging opportunities may have synergistic roles in the migration.

Hand dominance in orthopaedic surgeons.

LENUS (Irish Health Repository)

Lui, Darren F

2012-08-01

Handedness is perhaps the most studied human asymmetry. Laterality is the preference shown for one side and it has been studied in many aspects of medicine. Studies have shown that some orthopaedic procedures had poorer outcomes and identified laterality as a contributing factor. We developed a questionnaire to assess laterality in orthopaedic surgery and compared this to an established scoring system. Sixty-two orthopaedic surgeons surveyed with the validated Waterloo Handedness Questionnaire (WHQ) were compared with the self developed Orthopaedic Handedness Questionnaire (OHQ). Fifty-eight were found to be right hand dominant (RHD) and 4 left hand dominant (LHD). In RHD surgeons, the average WHQ score was 44.9% and OHQ 15%. For LHD surgeons the WHQ score was 30.2% and OHQ 9.4%. This represents a significant amount of time using the non dominant hand but does not necessarily determine satisfactory or successful dexterity transferable to the operating room. Training may be required for the non dominant side.

Bioenergy 93 conference

International Nuclear Information System (INIS)

1993-01-01

In this report the presentations given in the Bioenergy 93 Conference are published. The papers are grouped as follows: Opening addresses, biomass implementation strategies, nordic bioenergy research programs, production, handling and conversion of biofuels, combustion technology of biofuels and bioenergy visions

"Pollical palmar interosseous muscle" (musculus adductor pollicis accessorius): attachments, innervation, variations, phylogeny, and implications for human evolution and medicine.

Science.gov (United States)

Bello-Hellegouarch, Gaelle; Aziz, M Ashraf; Ferrero, Eva M; Kern, Michael; Francis, Nadia; Diogo, Rui

2013-03-01

Most atlases and textbooks dealing with human anatomy do not refer to the "pollical palmar interosseous" (PPI) muscle of Henle. In order to undertake a fresh and detailed study of this muscle and to thus better understand human comparative anatomy and evolution, we: 1) analyze the frequency of the PPI in a large sample of human hands; 2) describe the attachments, innervation and varieties of the PPI in these hands; 3) compare the data obtained with the information available in the literature; and 4) discuss the phylogenetic origin of the PPI and the implications of our observations and comparisons for medicine and for the understanding of human evolutionary history. Within the 72 hands dissected by us, the PPI is present in 67 hands (93%), commonly having a single muscular branch, originating from the medial side of the base of metacarpal I only, inserting onto the medial side of the base of the pollical proximal phalanx and/or surrounding structures (e.g., ulnar sesamoid bone, wing tendon of extensor apparatus), and passing at least partially, and usually mainly, medial to the princeps pollicis artery. A careful study of the human PPI, as well as a detailed comparison with other mammals, strongly suggest that the muscle is evolutionarily derived from the adductor pollicis, and namely from its oblique head. Therefore, we propose that PPI should be designated by the name musculus adductor pollicis accessorius, which indicates that the muscle is most likely a de novo structure derived from the adductor pollicis. Copyright © 2012 Wiley Periodicals, Inc.

28 CFR 93.4 - Grant authority.

Science.gov (United States)

2010-07-01

... 28 Judicial Administration 2 2010-07-01 2010-07-01 false Grant authority. 93.4 Section 93.4 Judicial Administration DEPARTMENT OF JUSTICE (CONTINUED) PROVISIONS IMPLEMENTING THE VIOLENT CRIME CONTROL... violent offenders, and (2) The integrated administration of other sanctions and services, which shall...

Synchrotron radiation photoemission study of interface formation between MgO and the atomically clean In{sub 0.53}Ga{sub 0.47}As surface

Energy Technology Data Exchange (ETDEWEB)

Chauhan, Lalit; Hughes, Greg [School of Physical Sciences, Dublin City University, Glasnevin Dublin 9 (Ireland)

2014-02-15

The evolution of interface formation between MgO and the atomically clean In{sub 0.53}Ga{sub 0.47}As is studied by synchrotron radiation based photoemission. The deposition of MgO in a step wise fashion on the decapped In{sub 0.53}Ga{sub 0.47}As surface at room temperature results in the growth of an ultrathin interfacial oxide layer. Subsequent thermal annealing at 400 C led to the reduction of the As and In oxides and the appearance of a Ga oxide component. The deposition of metallic Mg resulted in the further removal of the interfacial oxide and the out diffusion of In into the overlayer indicating severe disruption of the interface. (copyright 2014 WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim) (orig.)

Avalanche solar blind photodetectors based on single crystalline Mg0.47Zn0.53O thin film on Ga:ZnO substrate

Science.gov (United States)

Chen, Hao; Zhang, Jingtao; Chen, Zuxin; Liu, Huiqiang; Ma, Xinzhou; Li, Qiuguo; Chu, Guang; Chu, Sheng

2018-05-01

Single crystalline wurtzite Mg0.47Zn0.53O films were grown on Ga:ZnO substrates by pulse laser deposition. The band gap of the films was measured to be 4.43 eV. Vertical devices were fabricated for solar blind photodetection, realizing a high responsivity of 2 A W‑1 at 278 nm and  ‑5 V bias as well as a rejection ratio (R 278 nm/R 350 nm) of over 6  ×  103. A cut-off wavelength of 286 nm and a response time of 77 ms were also achieved. Besides, the devices showed stable response without degeneration under repeating illumination. The high performance of this photodetector was analyzed and attributed to the avalanche effect from high quality Mg0.47Zn0.53O/Ga:ZnO heterojunction at reverse bias. The avalanche gain was calculated to be 14.5 at  ‑10 V.

Recommendation 93-5 Implementation Plan

International Nuclear Information System (INIS)

1994-01-01

On July 19, 1993, the Defense Nuclear Facilities Safety Board (DNFSB) provided to the Secretary of Energy its Recommendation 93-5, which commented on the Hanford Tank Waste Characterization effort. Recommendation 93-5 highlighted the need to accelerate the characterization of the Hanford Site tank wastes to expedite the resolution of identified tank safety issues, and to provide timely design data in support of activities addressing the disposal of the tank wastes. The Department of Energy (DOE) and its prime contractor, Westinghouse Hanford Company (WHC), are in full agreement with the content of Recommendation 93-5 and have prepared this Implementation Plan to document those actions that have been or will be taken to meet Recommendation 93-5. The new Characterization Strategy embodied by this Plan acknowledges that waste distribution within a tank is the critical unknown with respect to successfully characterizing the tank for any Tank Waste Remediation Systems (TWRS) programmatic need. The new strategy has been incorporated into the following seven task: (1) strengthen technical management; (2) accelerate safety related characterization; (3) improve the quality and quantity of sampling (4) streamline tank access; (5) improve the quality and quantity of analyses; (6) improve data management; and (7) change control

Short-Pulse-Width Repetitively Q-Switched ~2.7-μm Er:Y2O3 Ceramic Laser

Directory of Open Access Journals (Sweden)

Xiaojing Ren

2017-11-01

Full Text Available A short-pulse-width repetitively Q-switched 2.7-μm Er:Y2O3 ceramic laser is demonstrated using a specially designed mechanical switch, a metal plate carved with slits of both slit-width and duty-cycle optimized. With a 20% transmission output coupler, stable pulse trains with durations (full-width at half-maximum, FWHM of 27–38 ns were generated with a repetition rate within the range of 0.26–4 kHz. The peak power at a 0.26 kHz repetition rate was ~3 kW.

Diagnostic imaging of the hand

Energy Technology Data Exchange (ETDEWEB)

Schmitt, Rainer [Hospital for Cardiovascular Diseases, Bad Neustadt an der Saale (Germany). Dept. of Radiology; Lanz, Ulrich [Perlach Hospital, Munich (Germany). Dept. of Hand Surgery

2008-07-01

With its complex anatomy and specialized biomechanics, the human hand has always presented physicians with a unique challenge when it comes to diagnosing and treating the diseases that afflict it. And while recent decades have seen a rapid increase in the number of therapeutic options, many diseases and injuries of the hand are still commonly misinterpreted. In diagnostic imaging of the hand, an interdisciplinary team, comprisingspecialists in radiology, surgery, and rheumatology, presents a comprehensive,reliable guide to this topographically intricate area. Highlights include: - More than 1000 high-quality illustrations - All state-of-the-art imaging modalities-including multidetector CT, with 2D displays and 3D reconstructions, and contrast-enhanced MRI with multi-channel, phased-array coils - An overview of all currently used methods of examination - A detailed presentation of the anatomic and functional foundations necessary for diagnosis - Full coverage of all disorders of the hand - Systematic treatment of each disease's definition, pathogenesis, and clinical symptoms, according to a graduated diagnostic plan - Easy-to-use format, featuring crisp images and line drawings seamlessly integrated with concise text, summary tables, and handy checklists - A heavily cross-referenced appendix of differential diagnosis tables - Emphasis on interdisciplinary consultation throughout designed to help both radiologists and clinicians develop the most efficient and effective strategies for evaluating and treating patients, Diagnostic imaging of the hand will leave specialists of all levels with a fresh appreciation for - and a richer understanding of - the expanding array of cutting-edge alternatives for diagnosing and treating disorders of the hand. (orig.)

Diagnostic imaging of the hand

International Nuclear Information System (INIS)

Schmitt, Rainer; Lanz, Ulrich

2008-01-01

With its complex anatomy and specialized biomechanics, the human hand has always presented physicians with a unique challenge when it comes to diagnosing and treating the diseases that afflict it. And while recent decades have seen a rapid increase in the number of therapeutic options, many diseases and injuries of the hand are still commonly misinterpreted. In diagnostic imaging of the hand, an interdisciplinary team, comprisingspecialists in radiology, surgery, and rheumatology, presents a comprehensive,reliable guide to this topographically intricate area. Highlights include: - More than 1000 high-quality illustrations - All state-of-the-art imaging modalities-including multidetector CT, with 2D displays and 3D reconstructions, and contrast-enhanced MRI with multi-channel, phased-array coils - An overview of all currently used methods of examination - A detailed presentation of the anatomic and functional foundations necessary for diagnosis - Full coverage of all disorders of the hand - Systematic treatment of each disease's definition, pathogenesis, and clinical symptoms, according to a graduated diagnostic plan - Easy-to-use format, featuring crisp images and line drawings seamlessly integrated with concise text, summary tables, and handy checklists - A heavily cross-referenced appendix of differential diagnosis tables - Emphasis on interdisciplinary consultation throughout designed to help both radiologists and clinicians develop the most efficient and effective strategies for evaluating and treating patients, Diagnostic imaging of the hand will leave specialists of all levels with a fresh appreciation for - and a richer understanding of - the expanding array of cutting-edge alternatives for diagnosing and treating disorders of the hand. (orig.)

Performance Comparison Between FEDERICA Hand and LARM Hand

OpenAIRE

Carbone, Giuseppe; Rossi, Cesare; Savino, Sergio

2015-01-01

This paper describes two robotic hands that have been\\ud developed at University Federico II of Naples and at the\\ud University of Cassino. FEDERICA Hand and LARM Hand\\ud are described in terms of design and operational features.\\ud In particular, careful attention is paid to the differences\\ud between the above-mentioned hands in terms of transmission\\ud systems. FEDERICA Hand uses tendons and pulleys\\ud to drive phalanxes, while LARM Hand uses cross four-bar\\ud linkages. Results of experime...

Focused risk assessment: Mound Plant, Miami-Erie Canal Operable Unit 4

International Nuclear Information System (INIS)

Rogers, D.R.; Dunning, D.F.

1994-01-01

In 1969, an underground waste line at Mound Plant ruptured and released plutonium-238 in a dilute nitric acid solution to the surrounding soils. Most of the acid was neutralized by the native soils. The plutonium, which in a neutral solution is tightly sorbed onto clay particles, remained within the spill area. During remediation, a severe storm eroded some of the contaminated soil. Fine grained plutonium-contaminated clay particles were carried away through the natural drainage courses to the remnants of the Miami-Erie Canal adjacent to Mound Plant, and then into the Great Miami River. This focused risk assessment considers exposure pathways relevant to site conditions, including incidental ingestion of contaminated soils, ingestion of drinking water and fish, and inhalation of resuspended soils and sediments. For each potential exposure pathway, a simplified conceptual model and exposure scenarios have been used to develop conservative estimates of potential radiation dose equivalents and health risks. The conservatism of the dose and risk estimates provides a substantive margin of safety in assuring that the public health is protected

Vision-Based Pose Estimation for Robot-Mediated Hand Telerehabilitation

Directory of Open Access Journals (Sweden)

Giuseppe Airò Farulla

2016-02-01

Full Text Available Vision-based Pose Estimation (VPE represents a non-invasive solution to allow a smooth and natural interaction between a human user and a robotic system, without requiring complex calibration procedures. Moreover, VPE interfaces are gaining momentum as they are highly intuitive, such that they can be used from untrained personnel (e.g., a generic caregiver even in delicate tasks as rehabilitation exercises. In this paper, we present a novel master–slave setup for hand telerehabilitation with an intuitive and simple interface for remote control of a wearable hand exoskeleton, named HX. While performing rehabilitative exercises, the master unit evaluates the 3D position of a human operator’s hand joints in real-time using only a RGB-D camera, and commands remotely the slave exoskeleton. Within the slave unit, the exoskeleton replicates hand movements and an external grip sensor records interaction forces, that are fed back to the operator-therapist, allowing a direct real-time assessment of the rehabilitative task. Experimental data collected with an operator and six volunteers are provided to show the feasibility of the proposed system and its performances. The results demonstrate that, leveraging on our system, the operator was able to directly control volunteers’ hands movements.

Seasonal and interannual effects of hypoxia on fish habitat quality in central Lake Erie

Science.gov (United States)

Arend, Kristin K.; Beletsky, Dmitry; DePinto, Joseph; Ludsin, Stuart A.; Roberts, James J.; Rucinski, Daniel K.; Scavia, Donald; Schwab, David J.; Höök, Tomas O.

2011-01-01

1. Hypoxia occurs seasonally in many stratified coastal marine and freshwater ecosystems when bottom dissolved oxygen (DO) concentrations are depleted below 2–3 mg O2 L-1. 2. We evaluated the effects of hypoxia on fish habitat quality in the central basin of Lake Erie from 1987 to 2005, using bioenergetic growth rate potential (GRP) as a proxy for habitat quality. We compared the effect of hypoxia on habitat quality of (i) rainbow smelt, Osmerus mordax mordax Mitchill (young-of-year, YOY, and adult), a cold-water planktivore, (ii) emerald shiner, Notropis atherinoides Rafinesque (adult), a warm-water planktivore, (iii) yellow perch, Perca flavescens Mitchill (YOY and adult), a cool-water benthopelagic omnivore and (iv) round goby Neogobius melanostomus Pallas (adult) a eurythermal benthivore. Annual thermal and DO profiles were generated from 1D thermal and DO hydrodynamics models developed for Lake Erie’s central basin. 3. Hypoxia occurred annually, typically from mid-July to mid-October, which spatially and temporally overlaps with otherwise high benthic habitat quality. Hypoxia reduced the habitat quality across fish species and life stages, but the magnitude of the reduction varied both among and within species because of the differences in tolerance to low DO levels and warm-water temperatures. 4. Across years, trends in habitat quality mirrored trends in phosphorus concentration and water column oxygen demand in central Lake Erie. The per cent reduction in habitat quality owing to hypoxia was greatest for adult rainbow smelt and round goby (mean: -35%), followed by adult emerald shiner (mean: -12%), YOY rainbow smelt (mean: -10%) and YOY and adult yellow perch (mean: -8.5%). 5. Our results highlight the importance of differential spatiotemporally interactive effects of DO and temperature on relative fish habitat quality and quantity. These effects have the potential to influence the performance of individual fish species as well as population dynamics

Back to basics: hand hygiene and surgical hand antisepsis.

Science.gov (United States)

Spruce, Lisa

2013-11-01

Health care-associated infections (HAIs) are a significant issue in the United States and throughout the world, but following proper hand hygiene practices is the most effective and least expensive way to prevent HAIs. Hand hygiene is inexpensive and protects patients and health care personnel alike. The four general types of hand hygiene that should be performed in the perioperative environment are washing hands that are visibly soiled, hand hygiene using alcohol-based products, surgical hand scrubs, and surgical hand scrubs using an alcohol-based surgical hand rub product. Barriers to proper hand hygiene may include not thinking about it, forgetting, skin irritation, a lack of role models, or a lack of a safety culture. One strategy for improving hand hygiene practices is monitoring hand hygiene as part of a quality improvement project, but the most important aspect for perioperative team members is to set an example for other team members by following proper hand hygiene practices and reminding each other to perform hand hygiene. Copyright © 2013 AORN, Inc. Published by Elsevier Inc. All rights reserved.

Hand-assisted hybrid laparoscopic-robotic total proctocolectomy with ileal pouch--anal anastomosis.

Science.gov (United States)

Morelli, Luca; Guadagni, Simone; Mariniello, Maria Donatella; Furbetta, Niccolò; Pisano, Roberta; D'Isidoro, Cristiano; Caprili, Giovanni; Marciano, Emanuele; Di Candio, Giulio; Boggi, Ugo; Mosca, Franco

2015-08-01

Few studies have reported minimally invasive total proctocolectomy with ileal pouch-anal anastomosis (IPAA) for ulcerative colitis (UC) and familial adenomatous polyposis (FAP). We herein report a novel hand-assisted hybrid laparoscopic-robotic technique for patients with FAP and UC. Between February 2010 and March 2014, six patients underwent hand-assisted hybrid laparoscopic-robotic total proctocolectomy with IPAA. The abdominal colectomy was performed laparoscopically with hand assistance through a transverse suprapubic incision, also used to fashion the ileal pouch. The proctectomy was carried out with the da Vinci Surgical System. The IPAA was hand-sewn through a trans-anal approach. The procedure was complemented by a temporary diverting loop ileostomy. The mean hand-assisted laparoscopic surgery (HALS) time was 154.6 (±12.8) min whereas the mean robotic time was 93.6 (±8.1) min. In all cases, a nerve-sparing proctectomy was performed, and no conversion to traditional laparotomy was required. The mean postoperative hospital stay was 13.2 (±7.4) days. No anastomotic leakage was observed. To date, no autonomic neurological disorders have been observed with a mean of 5.8 (±1.3) bowel movements per day. The hand-assisted hybrid laparoscopic-robotic approach to total proctocolectomy with IPAA has not been previously described. Our report shows the feasibility of this hybrid approach, which surpasses most of the limitations of pure laparoscopic and robotic techniques. Further experience is necessary to refine the technique and fully assess its potential advantages.

Interference-free determination of sub ng kg-1 levels of long-lived 93Zr in the presence of high concentrations (μg kg-1) of 93Mo and 93Nb using ICP-MS/MS.

Science.gov (United States)

Petrov, Panayot; Russell, Ben; Douglas, David N; Goenaga-Infante, Heidi

2018-01-01

Long-lived high abundance radionuclides are of increasing interest with regard to decommissioning of nuclear sites and longer term nuclear waste storage and disposal. In many cases, no routine technique is available for their measurement in nuclear waste and low-level (ng kg -1 ) environmental samples. Recent advances in ICP-MS technology offer attractive features for the selective and sensitive determination of a wide range of long-lived radionuclides. In this work, inductively coupled plasma-tandem mass spectrometry (ICP-MS/MS)-based methodology, suitable for accurate routine determinations of 93 Zr at very low (ng kg -1 ) levels in the presence of high levels (μg kg -1 ) of the isobaric interferents 93 Nb and 93 Mo (often present in nuclear waste samples), is reported for the first time. Additionally, a novel and systematic strategy for method development based on the use of non-radioactive isotopes is proposed. It relies on gas-phase chemical reactions for different molecular ion formation to achieve isobaric interference removal. Using cell gas mixtures of NH 3 /He/H 2 or H 2 /O 2 , and suitable mass shifts, the signal from the 93 Nb and 93 Mo isobaric interferences on 93 Zr were suppressed by up to 5 orders of magnitude. The achieved limit of detection for 93 Zr was 1.3 × 10 -5  Bq g -1 (equivalent to 0.14 ng kg -1 ). The sample analysis time is 2 min, which represents a significant improvement in terms of sample throughput, compared to liquid scintillation counting methods. The method described here can be used for routine measurements of 93 Zr at environmentally relevant levels. It can also be combined with radiometric techniques for use towards the standardisation of 93 Zr measurements. Graphical abstract Interference-free determination of 93 Zr in the presence of high concentrations of isobaric 93 Mo and 93 Nb by ICP-MS/MS.

Normative data for hand grip strength and key pinch strength, stratified by age and gender for a multiethnic Asian population.

Science.gov (United States)

Lam, Ngee Wei; Goh, Hui Ting; Kamaruzzaman, Shahrul Bahyah; Chin, Ai-Vyrn; Poi, Philip Jun Hua; Tan, Maw Pin

2016-10-01

Hand strength is a good indicator of physical fitness and frailty among the elderly. However, there are no published hand strength references for Malaysians aged > 65 years. This study aimed to establish normative data for hand grip strength (HGS) and key pinch strength (KPS) for Malaysians aged ≥ 60 years, and explore the relationship between hand strength and physical ability. Healthy participants aged ≥ 60 years with no neurological conditions were recruited from rural and urban locations in Malaysia. HGS and KPS were measured using hand grip and key pinch dynamometers. Basic demographic data, anthropometric measures, modified Barthel Index scores and results of the Functional Reach Test (FRT), Timed Up and Go (TUG) test and Jebsen-Taylor Hand Function Test (JTHFT) were recorded. 362 subjects aged 60-93 years were recruited. The men were significantly stronger than the women in both HGS and KPS (p Malaysia. Future studies are required to determine the modifiable factors for poor hand strength. Copyright: © Singapore Medical Association

9 CFR 93.106 - Quarantine requirements.

Science.gov (United States)

2010-01-01

... Section 93.106 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF... other than ratites and hatching eggs of ratites. Each lot of pet birds, except as provided for in § 93.... (2) Physical plant requirements. The facility shall comply with the following requirements: (i...

28 CFR 93.2 - Statutory authority.

Science.gov (United States)

2010-07-01

... 28 Judicial Administration 2 2010-07-01 2010-07-01 false Statutory authority. 93.2 Section 93.2 Judicial Administration DEPARTMENT OF JUSTICE (CONTINUED) PROVISIONS IMPLEMENTING THE VIOLENT CRIME CONTROL... under the Violent Crime Control and Law Enforcement Act of 1994, Title V, Public Law 103-322, 108 Stat...

Hand1 overexpression inhibits medulloblastoma metastasis

Energy Technology Data Exchange (ETDEWEB)

Asuthkar, Swapna; Guda, Maheedhara R. [Department of Cancer Biology and Pharmacology, University of Illinois College of Medicine at Peoria, Peoria, IL 61656 (United States); Martin, Sarah E. [Department of Pathology, University of Illinois College of Medicine at Peoria, Peoria, IL 61656 (United States); Antony, Reuben; Fernandez, Karen [Department of Pediatrics, University of Illinois College of Medicine at Peoria, Peoria, IL 61656 (United States); Lin, Julian [Department of Neurosurgery, University of Illinois College of Medicine at Peoria, Peoria, IL 61656 (United States); Tsung, Andrew J. [Department of Cancer Biology and Pharmacology, University of Illinois College of Medicine at Peoria, Peoria, IL 61656 (United States); Department of Neurosurgery, University of Illinois College of Medicine at Peoria, Peoria, IL 61656 (United States); Illinois Neurological Institute, Peoria, IL 61656 (United States); Velpula, Kiran K., E-mail: velpula@uic.edu [Department of Cancer Biology and Pharmacology, University of Illinois College of Medicine at Peoria, Peoria, IL 61656 (United States); Department of Neurosurgery, University of Illinois College of Medicine at Peoria, Peoria, IL 61656 (United States)

2016-08-19

Medulloblastoma (MB) is the most frequent malignant pediatric brain tumor. Current treatment includes surgery, radiation and chemotherapy. However, ongoing treatment in patients is further classified according to the presence or absence of metastasis. Since metastatic medulloblastoma are refractory to current treatments, there is need to identify novel biomarkers that could be used to reduce metastatic potential, and more importantly be targeted therapeutically. Previously, we showed that ionizing radiation-induced uPAR overexpression is associated with increased accumulation of β-catenin in the nucleus. We further demonstrated that uPAR protein act as cytoplasmic sequestration factor for a novel basic helix-loop-helix transcription factor, Hand1. Among the histological subtypes classical and desmoplastic subtypes account for the majority while large cell/anaplastic variant is most commonly associated with metastatic disease. In this present study using immunohistochemical approach and patient data mining for the first time, we demonstrated that Hand1 expression is observed to be downregulated in all the subtypes of medulloblastoma. Previously we showed that Hand1 overexpression regulated medulloblastoma angiogenesis and here we investigated the role of Hand1 in the context of Epithelial-Mesenchymal Transition (EMT). Moreover, UW228 and D283 cells overexpressing Hand1 demonstrated decreased-expression of mesenchymal markers (N-cadherin, β-catenin and SOX2); metastatic marker (SMA); and increased expression of epithelial marker (E-cadherin). Strikingly, human pluripotent stem cell antibody array showed that Hand1 overexpression resulted in substantial decrease in pluripotency markers (Nanog, Oct3/4, Otx2, Flk1) suggesting that Hand1 expression may be essential to attenuate the EMT and our findings underscore a novel role for Hand1 in medulloblastoma metastasis. - Highlights: • Hand1 expression is downregulated in Medulloblastoma. • Hand1 over expression reduce

Hand1 overexpression inhibits medulloblastoma metastasis

International Nuclear Information System (INIS)

Asuthkar, Swapna; Guda, Maheedhara R.; Martin, Sarah E.; Antony, Reuben; Fernandez, Karen; Lin, Julian; Tsung, Andrew J.; Velpula, Kiran K.

2016-01-01

Medulloblastoma (MB) is the most frequent malignant pediatric brain tumor. Current treatment includes surgery, radiation and chemotherapy. However, ongoing treatment in patients is further classified according to the presence or absence of metastasis. Since metastatic medulloblastoma are refractory to current treatments, there is need to identify novel biomarkers that could be used to reduce metastatic potential, and more importantly be targeted therapeutically. Previously, we showed that ionizing radiation-induced uPAR overexpression is associated with increased accumulation of β-catenin in the nucleus. We further demonstrated that uPAR protein act as cytoplasmic sequestration factor for a novel basic helix-loop-helix transcription factor, Hand1. Among the histological subtypes classical and desmoplastic subtypes account for the majority while large cell/anaplastic variant is most commonly associated with metastatic disease. In this present study using immunohistochemical approach and patient data mining for the first time, we demonstrated that Hand1 expression is observed to be downregulated in all the subtypes of medulloblastoma. Previously we showed that Hand1 overexpression regulated medulloblastoma angiogenesis and here we investigated the role of Hand1 in the context of Epithelial-Mesenchymal Transition (EMT). Moreover, UW228 and D283 cells overexpressing Hand1 demonstrated decreased-expression of mesenchymal markers (N-cadherin, β-catenin and SOX2); metastatic marker (SMA); and increased expression of epithelial marker (E-cadherin). Strikingly, human pluripotent stem cell antibody array showed that Hand1 overexpression resulted in substantial decrease in pluripotency markers (Nanog, Oct3/4, Otx2, Flk1) suggesting that Hand1 expression may be essential to attenuate the EMT and our findings underscore a novel role for Hand1 in medulloblastoma metastasis. - Highlights: • Hand1 expression is downregulated in Medulloblastoma. • Hand1 over expression reduce

Stiff Hands

Science.gov (United States)

... All Topics A-Z Videos Infographics Symptom Picker Anatomy Bones Joints Muscles Nerves Vessels Tendons About Hand Surgery What is a Hand Surgeon? What is a Hand Therapist? Media Find a Hand Surgeon Home Anatomy Stiff Hands Email to a friend * required fields ...

Hand Infections

Science.gov (United States)

... All Topics A-Z Videos Infographics Symptom Picker Anatomy Bones Joints Muscles Nerves Vessels Tendons About Hand Surgery What is a Hand Surgeon? What is a Hand Therapist? Media Find a Hand Surgeon Home Anatomy Hand Infections Email to a friend * required fields ...

Hand hygiene compliance rates: Fact or fiction?

Science.gov (United States)

McLaws, Mary-Louise; Kwok, Yen Lee Angela

2018-05-16

The mandatory national hand hygiene program requires Australian public hospitals to use direct human auditing to establish compliance rates. To establish the magnitude of the Hawthorne effect, we compared direct human audit rates with concurrent automated surveillance rates. A large tertiary Australian teaching hospital previously trialed automated surveillance while simultaneously performing mandatory human audits for 20 minutes daily on a medical and a surgical ward. Subtracting automated surveillance rates from human audit rates provided differences in percentage points (PPs) for each of the 3 quarterly reporting periods for 2014 and 2015. Direct human audit rates for the medical ward were inflated by an average of 55 PPs in 2014 and 64 PPs in 2015, 2.8-3.1 times higher than automated surveillance rates. The rates for the surgical ward were inflated by an average of 32 PPs in 2014 and 31 PPs in 2015, 1.6 times higher than automated surveillance rates. Over the 6 mandatory reporting quarters, human audits collected an average of 255 opportunities, whereas automation collected 578 times more data, averaging 147,308 opportunities per quarter. The magnitude of the Hawthorne effect on direct human auditing was not trivial and produced highly inflated compliance rates. Mandatory compliance necessitates accuracy that only automated surveillance can achieve, whereas daily hand hygiene ambassadors or reminder technology could harness clinicians' ability to hyperrespond to produce habitual compliance. Crown Copyright © 2018. Published by Elsevier Inc. All rights reserved.

Multiple intracerebroventricular injections of human umbilical cord mesenchymal stem cells delay motor neurons loss but not disease progression of SOD1G93A mice.

Science.gov (United States)

Sironi, Francesca; Vallarola, Antonio; Violatto, Martina Bruna; Talamini, Laura; Freschi, Mattia; De Gioia, Roberta; Capelli, Chiara; Agostini, Azzurra; Moscatelli, Davide; Tortarolo, Massimo; Bigini, Paolo; Introna, Martino; Bendotti, Caterina

2017-12-01

Stem cell therapy is considered a promising approach in the treatment of amyotrophic lateral sclerosis (ALS) and mesenchymal stem cells (MSCs) seem to be the most effective in ALS animal models. The umbilical cord (UC) is a source of highly proliferating fetal MSCs, more easily collectable than other MSCs. Recently we demonstrated that human (h) UC-MSCs, double labeled with fluorescent nanoparticles and Hoechst-33258 and transplanted intracerebroventricularly (ICV) into SOD1G93A transgenic mice, partially migrated into the spinal cord after a single injection. This prompted us to assess the effect of repeated ICV injections of hUC-MSCs on disease progression in SOD1G93A mice. Although no transplanted cells migrated to the spinal cord, a partial but significant protection of motor neurons (MNs) was found in the lumbar spinal cord of hUC-MSCs-treated SOD1G93A mice, accompanied by a shift from a pro-inflammatory (IL-6, IL-1β) to anti-inflammatory (IL-4, IL-10) and neuroprotective (IGF-1) environment in the lumbar spinal cord, probably linked to the activation of p-Akt survival pathway in both motor neurons and reactive astrocytes. However, this treatment neither prevented the muscle denervation nor delayed the disease progression of mice, emphasizing the growing evidence that protecting the motor neuron perikarya is not sufficient to delay the ALS progression. Copyright © 2017. Published by Elsevier B.V.

27 CFR 70.93 - Interest rate.

Science.gov (United States)

2010-04-01

... 27 Alcohol, Tobacco Products and Firearms 2 2010-04-01 2010-04-01 false Interest rate. 70.93... Excise and Special (Occupational) Tax Interest § 70.93 Interest rate. (a) In general. The interest rate... annual percentage rate of interest will exceed the prescribed rate of interest. (b) Applicability of...

Controller design for Robotic hand through Electroencephalogram

Directory of Open Access Journals (Sweden)

Pandelidis P.

2016-01-01

Full Text Available - This paper deals with the designing, the construction and the control of a robotic hand via an electroencephalogram sensor. First a robotic device that is able to mimic a real human hand is constructed. A PID controller is designed in order to improve the performance of the robotic arm for grabbing objects. Furthermore, a novel design approach is presented for controlling the motion of the robotic arm using signals produced from an innovative electroencephalogram sensor that detects the concentration of the brain

Pilot evaluation of a ward-based automated hand hygiene training system.

Science.gov (United States)

Ghosh, Anarta; Ameling, Stefan; Zhou, Jiang; Lacey, Gerard; Creamer, Eilish; Dolan, Anthony; Sherlock, Orla; Humphreys, Hilary

2013-04-01

A novel artificial intelligence (AI) system (SureWash; GLANTA, Dublin, Ireland) was placed on a ward with 45 staff members for two 6-day periods to automatically assess hand hygiene technique and the potential effectiveness of the automated training system. Two human reviewers assessed videos from 50 hand hygiene events with an interrater reliability (IIR) of 88% (44/50). The IIR was 88% (44/50) for the human reviewers and 80% (40/50) for the software. This study also investigated the poses missed and the impact of feedback on participation (+113%), duration (+11%), and technique (+2.23%). Our findings showed significant correlation between the human raters and the computer, demonstrating for the first time in a clinical setting the potential use of this type of AI technology in hand hygiene training. Copyright © 2013 Association for Professionals in Infection Control and Epidemiology, Inc. Published by Mosby, Inc. All rights reserved.

Biomimetic actuator and sensor for robot hand

International Nuclear Information System (INIS)

Kim, Baekchul; Chung, Jinah; Cho, Hanjoung; Shin, Seunghoon; Lee, Hyoungsuk; Moon, Hyungpil; Choi, Hyouk Ryeol; Koo, Jachoon

2012-01-01

To manufacture a robot hand that essentially mimics the functions of a human hand, it is necessary to develop flexible actuators and sensors. In this study, we propose the design, manufacture, and performance verification of flexible actuators and sensors based on Electro Active Polymer (EAP). EAP is fabricated as a type of film, and it moves with changes in the voltage because of contraction and expansion in the polymer film. Furthermore, if a force is applied to an EAP film, its thickness and effective area change, and therefore, the capacitance also changes. By using this mechanism, we produce capacitive actuators and sensors. In this study, we propose an EAP based capacitive sensor and evaluate its use as a robot hand sensor

Biomimetic actuator and sensor for robot hand

Energy Technology Data Exchange (ETDEWEB)

Kim, Baekchul; Chung, Jinah; Cho, Hanjoung; Shin, Seunghoon; Lee, Hyoungsuk; Moon, Hyungpil; Choi, Hyouk Ryeol; Koo, Jachoon [Sungkyunkwan Univ., Seoul (Korea, Republic of)

2012-12-15

To manufacture a robot hand that essentially mimics the functions of a human hand, it is necessary to develop flexible actuators and sensors. In this study, we propose the design, manufacture, and performance verification of flexible actuators and sensors based on Electro Active Polymer (EAP). EAP is fabricated as a type of film, and it moves with changes in the voltage because of contraction and expansion in the polymer film. Furthermore, if a force is applied to an EAP film, its thickness and effective area change, and therefore, the capacitance also changes. By using this mechanism, we produce capacitive actuators and sensors. In this study, we propose an EAP based capacitive sensor and evaluate its use as a robot hand sensor.

A preliminary study for non-invasive quantification of manganese in human hand bones

International Nuclear Information System (INIS)

Aslam; Pejovic-Milic, A; Chettle, D R; McNeill, F E; Pysklywec, M W; Oudyk, J

2008-01-01

Manganese (Mn) is a nutrient essential for regulating neurological and skeletal functions in the human body, but it is also toxic when humans are excessively exposed to Mn. Blood (or serum/plasma) and other body fluids reflect only the most recent exposure and rapidly return to within normal ranges, even when there has been a temporary excursion in response to exposure. In this context, we have been developing a non-invasive measurement of Mn stored in bone, using in vivo neutron activation analysis. Following feasibility studies, a first pilot study, using neutron activation analysis to measure Mn in the bones of the hand of ten healthy male human subjects, was conducted with the approval of the concerned research ethics boards. The participants of this study had no known history of exposure to Mn. Two volunteers were excluded from this study due to technical problems with their measurements. The inverse variance weighted mean value of Mn/Ca for the participants of this study is 0.12 ± 0.68 μg Mn/g Ca which is comparable within uncertainties with the estimated range of 0.16-0.78 μg Mn/g Ca and mean value of 0.63 ± 0.30 μg Mn/g Ca derived from cadaver data. It is recommended to investigate the use of the diagnostic technique for in vivo measurements of workers exposed occupationally to excessive amounts of Mn who could develop many-fold increased levels of Mn in bones as demonstrated through various animal studies. The technique needs further development to improve the precision of in vivo measurements in the non-exposed population. (note)

29 CFR 1917.93 - Head protection.

Science.gov (United States)

2010-07-01

... 29 Labor 7 2010-07-01 2010-07-01 false Head protection. 1917.93 Section 1917.93 Labor Regulations... of the following consensus standards: (i) ANSI Z89.1-2003, “American National Standard for Industrial... constructed in accordance with one of the above consensus standards will be deemed to be in compliance with...

9 CFR 93.326 - Horses for immediate slaughter.

Science.gov (United States)

2010-01-01

... CERTAIN ANIMALS, BIRDS, FISH, AND POULTRY, AND CERTAIN ANIMAL, BIRD, AND POULTRY PRODUCTS; REQUIREMENTS FOR MEANS OF CONVEYANCE AND SHIPPING CONTAINERS Horses Mexico 18 § 93.326 Horses for immediate slaughter. Horses may be imported from Mexico, subject to the applicable provisions of §§ 93.321, 93.322...

46 CFR 221.93 - Collection of civil penalties.

Science.gov (United States)

2010-10-01

... 46 Shipping 8 2010-10-01 2010-10-01 false Collection of civil penalties. 221.93 Section 221.93... RELATED ACTIVITIES REGULATED TRANSACTIONS INVOLVING DOCUMENTED VESSELS AND OTHER MARITIME INTERESTS Civil Penalties § 221.93 Collection of civil penalties. Within 30 days after receipt of the Hearing Officer's...

Intracellular Distribution of Capsid-Associated pUL77 of Human Cytomegalovirus and Interactions with Packaging Proteins and pUL93.

Science.gov (United States)

Köppen-Rung, Pánja; Dittmer, Alexandra; Bogner, Elke

2016-07-01

DNA packaging into procapsids is a common multistep process during viral maturation in herpesviruses. In human cytomegalovirus (HCMV), the proteins involved in this process are terminase subunits pUL56 and pUL89, which are responsible for site-specific cleavage and insertion of the DNA into the procapsid via portal protein pUL104. However, additional viral proteins are required for the DNA packaging process. We have shown previously that the plasmid that encodes capsid-associated pUL77 encodes another potential player during capsid maturation. Pulse-chase experiments revealed that pUL77 is stably expressed during HCMV infection. Time course analysis demonstrated that pUL77 is expressed in the early late part of the infectious cycle. The sequence of pUL77 was analyzed to find nuclear localization sequences (NLSs), revealing monopartite NLSm at the N terminus and bipartite NLSb in the middle of pUL77. The potential NLSs were inserted into plasmid pHM829, which encodes a chimeric protein with β-galactosidase and green fluorescent protein. In contrast to pUL56, neither NLSm nor NLSb was sufficient for nuclear import. Furthermore, we investigated by coimmunoprecipitation whether packaging proteins, as well as pUL93, the homologue protein of herpes simplex virus 1 pUL17, are interaction partners of pUL77. The interactions between pUL77 and packaging proteins, as well as pUL93, were verified. We showed that the capsid-associated pUL77 is another potential player during capsid maturation of HCMV. Protein UL77 (pUL77) is a conserved core protein of HCMV. This study demonstrates for the first time that pUL77 has early-late expression kinetics during the infectious cycle and an intrinsic potential for nuclear translocation. According to its proposed functions in stabilization of the capsid and anchoring of the encapsidated DNA during packaging, interaction with further DNA packaging proteins is required. We identified physical interactions with terminase subunits pUL56 and p

Spatial and temporal genetic diversity of lake whitefish (Coregonus clupeaformis (Mitchill)) from Lake Huron and Lake Erie

Science.gov (United States)

Stott, Wendylee; Ebener, Mark P.; Mohr, Lloyd; Hartman, Travis; Johnson, Jim; Roseman, Edward F.

2013-01-01

Lake whitefish (Coregonus clupeaformis (Mitchill)) are important commercially, culturally, and ecologically in the Laurentian Great Lakes. Stocks of lake whitefish in the Great Lakes have recovered from low levels of abundance in the 1960s. Reductions in abundance, loss of habitat and environmental degradation can be accompanied by losses of genetic diversity and overall fitness that may persist even as populations recover demographically. Therefore, it is important to be able to identify stocks that have reduced levels of genetic diversity. In this study, we investigated patterns of genetic diversity at microsatellite DNA loci in lake whitefish collected between 1927 and 1929 (historical period) and between 1997 and 2005 (contemporary period) from Lake Huron and Lake Erie. Genetic analysis of lake whitefish from Lakes Huron and Erie shows that the amount of population structuring varies from lake to lake. Greater genetic divergences among collections from Lake Huron may be the result of sampling scale, migration patterns and demographic processes. Fluctuations in abundance of lake whitefish populations may have resulted in periods of increased genetic drift that have resulted in changes in allele frequencies over time, but periodic genetic drift was not severe enough to result in a significant loss of genetic diversity. Migration among stocks may have decreased levels of genetic differentiation while not completely obscuring stock boundaries. Recent changes in spatial boundaries to stocks, the number of stocks and life history characteristics of stocks further demonstrate the potential of coregonids for a swift and varied response to environmental change and emphasise the importance of incorporating both spatial and temporal considerations into management plans to ensure that diversity is preserved.

Hand gesture recognition in confined spaces with partial observability and occultation constraints

Science.gov (United States)

Shirkhodaie, Amir; Chan, Alex; Hu, Shuowen

2016-05-01

Human activity detection and recognition capabilities have broad applications for military and homeland security. These tasks are very complicated, however, especially when multiple persons are performing concurrent activities in confined spaces that impose significant obstruction, occultation, and observability uncertainty. In this paper, our primary contribution is to present a dedicated taxonomy and kinematic ontology that are developed for in-vehicle group human activities (IVGA). Secondly, we describe a set of hand-observable patterns that represents certain IVGA examples. Thirdly, we propose two classifiers for hand gesture recognition and compare their performance individually and jointly. Finally, we present a variant of Hidden Markov Model for Bayesian tracking, recognition, and annotation of hand motions, which enables spatiotemporal inference to human group activity perception and understanding. To validate our approach, synthetic (graphical data from virtual environment) and real physical environment video imagery are employed to verify the performance of these hand gesture classifiers, while measuring their efficiency and effectiveness based on the proposed Hidden Markov Model for tracking and interpreting dynamic spatiotemporal IVGA scenarios.

Hand Motion Classification Using a Multi-Channel Surface Electromyography Sensor

Directory of Open Access Journals (Sweden)

Dong Sun

2012-01-01

Full Text Available The human hand has multiple degrees of freedom (DOF for achieving high-dexterity motions. Identifying and replicating human hand motions are necessary to perform precise and delicate operations in many applications, such as haptic applications. Surface electromyography (sEMG sensors are a low-cost method for identifying hand motions, in addition to the conventional methods that use data gloves and vision detection. The identification of multiple hand motions is challenging because the error rate typically increases significantly with the addition of more hand motions. Thus, the current study proposes two new methods for feature extraction to solve the problem above. The first method is the extraction of the energy ratio features in the time-domain, which are robust and invariant to motion forces and speeds for the same gesture. The second method is the extraction of the concordance correlation features that describe the relationship between every two channels of the multi-channel sEMG sensor system. The concordance correlation features of a multi-channel sEMG sensor system were shown to provide a vast amount of useful information for identification. Furthermore, a new cascaded-structure classifier is also proposed, in which 11 types of hand gestures can be identified accurately using the newly defined features. Experimental results show that the success rate for the identification of the 11 gestures is significantly high.

Hand motion classification using a multi-channel surface electromyography sensor.

Science.gov (United States)

Tang, Xueyan; Liu, Yunhui; Lv, Congyi; Sun, Dong

2012-01-01

The human hand has multiple degrees of freedom (DOF) for achieving high-dexterity motions. Identifying and replicating human hand motions are necessary to perform precise and delicate operations in many applications, such as haptic applications. Surface electromyography (sEMG) sensors are a low-cost method for identifying hand motions, in addition to the conventional methods that use data gloves and vision detection. The identification of multiple hand motions is challenging because the error rate typically increases significantly with the addition of more hand motions. Thus, the current study proposes two new methods for feature extraction to solve the problem above. The first method is the extraction of the energy ratio features in the time-domain, which are robust and invariant to motion forces and speeds for the same gesture. The second method is the extraction of the concordance correlation features that describe the relationship between every two channels of the multi-channel sEMG sensor system. The concordance correlation features of a multi-channel sEMG sensor system were shown to provide a vast amount of useful information for identification. Furthermore, a new cascaded-structure classifier is also proposed, in which 11 types of hand gestures can be identified accurately using the newly defined features. Experimental results show that the success rate for the identification of the 11 gestures is significantly high.

A four-dimensional virtual hand brain-machine interface using active dimension selection.

Science.gov (United States)

Rouse, Adam G

2016-06-01

Brain-machine interfaces (BMI) traditionally rely on a fixed, linear transformation from neural signals to an output state-space. In this study, the assumption that a BMI must control a fixed, orthogonal basis set was challenged and a novel active dimension selection (ADS) decoder was explored. ADS utilizes a two stage decoder by using neural signals to both (i) select an active dimension being controlled and (ii) control the velocity along the selected dimension. ADS decoding was tested in a monkey using 16 single units from premotor and primary motor cortex to successfully control a virtual hand avatar to move to eight different postures. Following training with the ADS decoder to control 2, 3, and then 4 dimensions, each emulating a grasp shape of the hand, performance reached 93% correct with a bit rate of 2.4 bits s(-1) for eight targets. Selection of eight targets using ADS control was more efficient, as measured by bit rate, than either full four-dimensional control or computer assisted one-dimensional control. ADS decoding allows a user to quickly and efficiently select different hand postures. This novel decoding scheme represents a potential method to reduce the complexity of high-dimension BMI control of the hand.

Double-Crested Cormorant ( Phalacrocorax auritus) Nesting Effects on Understory Composition and Diversity on Island Ecosystems in Lake Erie

Science.gov (United States)

McGrath, Darby M.; Murphy, Stephen D.

2012-08-01

The context for this study is the management concerns over the severity and extent of the impact of cormorants on island flora in the recent past on Lake Erie islands. Accordingly, this study sought to quantify the nesting colonies' influence on coarse woody litter and how nest densities and litter depth may influence the herbaceous layer, the seed bank composition and viability across the extent of three Lake Erie islands. The data for this study were collected from 2004 to 2008 on East Sister Island and Middle Island using two main strategies. First, herbaceous layer surveys, cormorant nest counts, soil seed bank cores, and litter depth measurements were executed using a plotless-point quarter method to test island-wide impacts from nesting activities (data were also collected on a third island, West Sister Island as a reference for the other two islands). Secondly, a sub-sample of the entire plot set was examined in particularly high nesting density areas for two islands (Middle Island and East Sister Island). Kruskal-Wallis tests indicated that there are subtle changes in the herbaceous diversity (total, native and exotic) and seed bank composition across the islands. The sub sample set of the plots demonstrated that Phalacrocorax auritus nest density does influence litter depth, herbaceous species abundance and diversity. Cormorant nesting pressures are restricted to areas of high nesting pressures and competition. However, there remains a risk to the interior herbaceous layer of the island if the effects of nesting pressures at the edges advance inward from this perimeter.

Weak localization/antilocalization in a nearly symmetric In0.53Ga0.47As/In0.52Al0.48As quantum well

International Nuclear Information System (INIS)

Faniel, S.; Matsuura, T.; Koga, T.; Mineshige, S.; Sekine, Y.

2011-01-01

We report weak antilocalization (WAL) measurements in a nearly symmetric In 0.53 Ga 0.47 As/In 0.52 Al 0.48 As quantum well. In this system, an enhancement of the spin-orbit scattering time, equivalently the weakening of the WAL effect, is expected at carrier densities N s where equal magnitudes between the Rashba and Dresselhaus parameters (α = ±β) are realized. Our magnetotransport measurements indeed exhibited a weakening of the WAL effect as a function of N s , though the weakening took place at only one carrier density. Our interpretation is that the value of β is so small that the two carrier densities corresponding to α = β and α = -β are very close to each other. It turned out that the deduced values for the bulk Dresselhaus parameter γ in In 0.53 Ga 0.47 As/In 0.52 Al 0.48 As quantum wells is considerably smaller than the k·p value of 27 eVA 3 .

40 CFR 600.011-93 - Reference materials.

Science.gov (United States)

2010-07-01

... Density (Specific Gravity), or API Gravity of Crude Petroleum and Liquid Petroleum Products by Hydrometer... Petroleum and Liquid Petroleum Products by Hydrometer Method, IBR approved for §§ 600.113-93, 600.510-93...

Phenotype of transgenic mice carrying a very low copy number of the mutant human G93A superoxide dismutase-1 gene associated with amyotrophic lateral sclerosis.

Directory of Open Access Journals (Sweden)

Jeffrey S Deitch

Full Text Available Amyotrophic lateral sclerosis (ALS is a progressive neurodegenerative disease of the motor neuron. While most cases of ALS are sporadic, 10% are familial (FALS with 20% of FALS caused by a mutation in the gene that codes for the enzyme Cu/Zn superoxide dismutase (SOD1. There is variability in sporadic ALS as well as FALS where even within the same family some siblings with the same mutation do not manifest disease. A transgenic (Tg mouse model of FALS containing 25 copies of the mutant human SOD1 gene demonstrates motor neuron pathology and progressive weakness similar to ALS patients, leading to death at approximately 130 days. The onset of symptoms and survival of these transgenic mice are directly related to the number of copies of the mutant gene. We report the phenotype of a very low expressing (VLE G93A SOD1 Tg carrying only 4 copies of the mutant G93ASOD1 gene. While weakness can start at 9 months, only 74% of mice 18 months or older demonstrate disease. The VLE mice show decreased motor neurons compared to wild-type mice as well as increased cytoplasmic translocation of TDP-43. In contrast to the standard G93A SOD1 Tg mouse which always develops motor weakness leading to death, not all VLE animals manifested clinical disease or shortened life span. In fact, approximately 20% of mice older than 24 months had no motor symptoms and only 18% of VLE mice older than 22 months reached end stage. Given the variable penetrance of clinical phenotype, prolonged survival, and protracted loss of motor neurons the VLE mouse provides a new tool that closely mimics human ALS. This tool will allow the study of pathologic events over time as well as the study of genetic and environmental modifiers that may not be causative, but can exacerbate or accelerate motor neuron disease.

Determination of 93Zr in nuclear power plant wastes

DEFF Research Database (Denmark)

Osváth, Szabolcs; Vajda, Nora; Molnar, Zsuzsa

2017-01-01

A radioanalytical method (based on separation using UTEVA columns and ICP-MS measurement) has been used for determination of 93Zr in 37 nuclear power plant samples. As 93Nb might affect the detection of 93Zr, Monte Carlo activation model was used to calculate the expected 93Zr/natZr mass ratio...

Bipedal tool use strengthens chimpanzee hand preferences

DEFF Research Database (Denmark)

Braccini, Stephanie; Lambeth, Susan; Schapiro, Steve

2010-01-01

The degree to which non-human primate behavior is lateralized, at either individual or population levels, remains controversial. We investigated the relationship between hand preference and posture during tool use in chimpanzees (Pan troglodytes) during bipedal tool use. We experimentally induced...

Electromyogram synergy control of a dexterous artificial hand to unscrew and screw objects.

Science.gov (United States)

Kent, Benjamin A; Karnati, Nareen; Engeberg, Erik D

2014-03-21

Due to their limited dexterity, it is currently not possible to use a commercially available prosthetic hand to unscrew or screw objects without using elbow and shoulder movements. For these tasks, prosthetic hands function like a wrench, which is unnatural and limits their use in tight working environments. Results from timed rotational tasks with human subjects demonstrate the clinical need for increased dexterity of prosthetic hands, and a clinically viable solution to this problem is presented for an anthropomorphic artificial hand. Initially, a human hand motion analysis was performed during a rotational task. From these data, human hand synergies were derived and mapped to an anthropomorphic artificial hand. The synergy for the artificial hand is controlled using conventional dual site electromyogram (EMG) signals. These EMG signals were mapped to the developed synergy to control four joints of the dexterous artificial hand simultaneously.Five limb absent and ten able-bodied test subjects participated in a comparison study to complete a timed rotational task as quickly as possible with their natural hands (except for one subject with a bilateral hand absence), eight commercially available prosthetic hands, and the proposed synergy controller. Each test subject used two to four different artificial hands. With the able-bodied subjects, the developed synergy controller reduced task completion time by 177% on average. The limb absent subjects completed the task faster on average than with their own prostheses by 46%. There was a statistically significant improvement in task completion time with the synergy controller for three of the four limb absent participants with integrated prostheses, and was not statistically different for the fourth. The proposed synergy controller reduced average task completion time compared to commercially available prostheses. Additionally, the synergy controller is able to function in a small workspace and requires less physical

29 CFR 93.205 - Professional and technical services.

Science.gov (United States)

2010-07-01

... professional or technical discipline. For example, drafting of a legal document accompanying a bid or proposal... 29 Labor 1 2010-07-01 2010-07-01 true Professional and technical services. 93.205 Section 93.205... Professional and technical services. (a) The prohibition on the use of appropriated funds, in § 93.100 (a...

Energy research information system (eris) projects report. volume 4, number 1. Report for December 1978-June 1979

International Nuclear Information System (INIS)

Boyd, C.A.; Jelinek, J.

1979-06-01

The goal of the Energy Research Information System (ERIS) is to provide an inventory of the energy related programs and research activities from 1974 to the present in the States of Montana, Nebraska, North Dakota, South Dakota and Wyoming. Areas of research covered include: coal, petroleum, oil shales, fission fuels, synthetic fuels, hydro-energy, renewable energy, resources, energy policy, reclamation, socioeconomic impacts, environmental impacts and land use. Each project description lists title, investigator(s), research institution, sponsor, funding, time frame, location, a descriptive abstract of the research and the titles of reports and/or publications generated by the research. All projects are indexed by location, personal names, organizations and subject keywords

Effects of H2 High-pressure Annealing on HfO2/Al2O3/In0.53Ga0.47As Capacitors: Chemical Composition and Electrical Characteristics.

Science.gov (United States)

Choi, Sungho; An, Youngseo; Lee, Changmin; Song, Jeongkeun; Nguyen, Manh-Cuong; Byun, Young-Chul; Choi, Rino; McIntyre, Paul C; Kim, Hyoungsub

2017-08-29

We studied the impact of H 2 pressure during post-metallization annealing on the chemical composition of a HfO 2 /Al 2 O 3 gate stack on a HCl wet-cleaned In 0.53 Ga 0.47 As substrate by comparing the forming gas annealing (at atmospheric pressure with a H 2 partial pressure of 0.04 bar) and H 2 high-pressure annealing (H 2 -HPA at 30 bar) methods. In addition, the effectiveness of H 2 -HPA on the passivation of the interface states was compared for both p- and n-type In 0.53 Ga 0.47 As substrates. The decomposition of the interface oxide and the subsequent out-diffusion of In and Ga atoms toward the high-k film became more significant with increasing H 2 pressure. Moreover, the increase in the H 2 pressure significantly improved the capacitance‒voltage characteristics, and its effect was more pronounced on the p-type In 0.53 Ga 0.47 As substrate. However, the H 2 -HPA induced an increase in the leakage current, probably because of the out-diffusion and incorporation of In/Ga atoms within the high-k stack.

Hand-related physical function in rheumatic hand conditions

DEFF Research Database (Denmark)

Klokker, Louise; Terwee, Caroline B; Wæhrens, Eva Ejlersen

2016-01-01

as well as those items from the Patient Reported Outcomes Measurement Information System (PROMIS) Physical Function (PF) item bank that are relevant to patients with rheumatic hand conditions. Selection will be based on consensus among reviewers. Content validity of selected items will be established......INTRODUCTION: There is no consensus about what constitutes the most appropriate patient-reported outcome measurement (PROM) instrument for measuring physical function in patients with rheumatic hand conditions. Existing instruments lack psychometric testing and vary in feasibility...... and their psychometric qualities. We aim to develop a PROM instrument to assess hand-related physical function in rheumatic hand conditions. METHODS AND ANALYSIS: We will perform a systematic search to identify existing PROMs to rheumatic hand conditions, and select items relevant for hand-related physical function...

Hand-related physical function in rheumatic hand conditions

DEFF Research Database (Denmark)

Klokker, Louise; Terwee, Caroline; Wæhrens, Eva Elisabet Ejlersen

2016-01-01

INTRODUCTION: There is no consensus about what constitutes the most appropriate patient-reported outcome measurement (PROM) instrument for measuring physical function in patients with rheumatic hand conditions. Existing instruments lack psychometric testing and vary in feasibility...... and their psychometric qualities. We aim to develop a PROM instrument to assess hand-related physical function in rheumatic hand conditions. METHODS AND ANALYSIS: We will perform a systematic search to identify existing PROMs to rheumatic hand conditions, and select items relevant for hand-related physical function...... as well as those items from the Patient Reported Outcomes Measurement Information System (PROMIS) Physical Function (PF) item bank that are relevant to patients with rheumatic hand conditions. Selection will be based on consensus among reviewers. Content validity of selected items will be established...

Hand Gesture Recognition Using Modified 1$ and Background Subtraction Algorithms

Directory of Open Access Journals (Sweden)

Hazem Khaled

2015-01-01

Full Text Available Computers and computerized machines have tremendously penetrated all aspects of our lives. This raises the importance of Human-Computer Interface (HCI. The common HCI techniques still rely on simple devices such as keyboard, mice, and joysticks, which are not enough to convoy the latest technology. Hand gesture has become one of the most important attractive alternatives to existing traditional HCI techniques. This paper proposes a new hand gesture detection system for Human-Computer Interaction using real-time video streaming. This is achieved by removing the background using average background algorithm and the 1$ algorithm for hand’s template matching. Then every hand gesture is translated to commands that can be used to control robot movements. The simulation results show that the proposed algorithm can achieve high detection rate and small recognition time under different light changes, scales, rotation, and background.

INC '93 overview

International Nuclear Information System (INIS)

Howe, Bruce

1993-01-01

At the close of the International Nuclear Congress, INC '93, held in Toronto in October 1993, Bruce Howe, then president of AECL, presented a 'Review and Conclusions' under the following headings: Introduction, Future Energy Requirements, Economics of electricity generation, Radioactive waste management, Reactor safety, Public acceptance, Technology developments, Future energy strategies, Conclusion

The deep lymphatic anatomy of the hand.

Science.gov (United States)

Ma, Chuan-Xiang; Pan, Wei-Ren; Liu, Zhi-An; Zeng, Fan-Qiang; Qiu, Zhi-Qiang

2018-04-03

The deep lymphatic anatomy of the hand still remains the least described in medical literature. Eight hands were harvested from four nonembalmed human cadavers amputated above the wrist. A small amount of 6% hydrogen peroxide was employed to detect the lymphatic vessels around the superficial and deep palmar vascular arches, in webs from the index to little fingers, the thenar and hypothenar areas. A 30-gauge needle was inserted into the vessels and injected with a barium sulphate compound. Each specimen was dissected, photographed and radiographed to demonstrate deep lymphatic distribution of the hand. Five groups of deep collecting lymph vessels were found in the hand: superficial palmar arch lymph vessel (SPALV); deep palmar arch lymph vessel (DPALV); thenar lymph vessel (TLV); hypothenar lymph vessel (HTLV); deep finger web lymph vessel (DFWLV). Each group of vessels drained in different directions first, then all turned and ran towards the wrist in different layers. The deep lymphatic drainage of the hand has been presented. The results will provide an anatomical basis for clinical management, educational reference and scientific research. Copyright © 2018 Elsevier GmbH. All rights reserved.

Effects of H2 High-pressure Annealing on HfO2/Al2O3/In0.53Ga0.47As Capacitors: Chemical Composition and Electrical Characteristics

OpenAIRE

Choi, Sungho; An, Youngseo; Lee, Changmin; Song, Jeongkeun; Nguyen, Manh-Cuong; Byun, Young-Chul; Choi, Rino; McIntyre, Paul C.; Kim, Hyoungsub

2017-01-01

We studied the impact of H2 pressure during post-metallization annealing on the chemical composition of a HfO2/Al2O3 gate stack on a HCl wet-cleaned In0.53Ga0.47As substrate by comparing the forming gas annealing (at atmospheric pressure with a H2 partial pressure of 0.04?bar) and H2 high-pressure annealing (H2-HPA at 30?bar) methods. In addition, the effectiveness of H2-HPA on the passivation of the interface states was compared for both p- and n-type In0.53Ga0.47As substrates. The decomposi...

Rubber hand illusion induced by touching the face ipsilaterally to a deprived hand: evidence for plastic ‘somatotopic’ remapping in tetraplegics

Directory of Open Access Journals (Sweden)

Michele eScandola

2014-06-01

Full Text Available Background: Studies in animals and humans indicate that the interruption of body-brain connections following spinal cord injury (SCI leads to plastic cerebral reorganization.Objective: To explore whether inducing the Rubber Hand Illusion (RHI via synchronous multisensory visuo-tactile bodily stimulation may reveal any perceptual correlates of plastic remapping in SCI.Methods: In 16 paraplegic, 16 tetraplegic and 16 healthy participants we explored whether RHI may be induced by tactile stimuli involving not only the left hand but also the left hemi-face. Touching the participant’s actual hand or face was either synchronous or asynchronous with tactile stimuli seen on a rubber hand. We assessed two components of the illusion, namely perceived changes in the real hand in space (indexed by proprioceptive drift and ownership of the rubber hand (indexed by subjective responses to an ad-hoc questionnaire.Results: Proprioceptive drift and ownership were found in the healthy group only in the condition where the left real and fake hand were touched simultaneously. In contrast, no drift was found in the SCI patients who, however, showed ownership after both synchronous and asynchronous hand stroking. Importantly, only tetraplegics showed the effect also after synchronous face stroking. Conclusions: RHI may reveal plastic phenomena in SCI. In hand representation-deprived tetraplegics, stimuli on the face (represented contiguously in the somatic and motor systems, drive the sense of hand ownership. This hand-face remapping phenomenon may be useful for restoring a sense of self in massively deprived individuals.

Design and control of five fingered under-actuated robotic hand

Science.gov (United States)

Sahoo, Biswojit; Parida, Pramod Kumar

2018-04-01

Now a day's research regarding humanoid robots and its application in different fields (industry, household, rehabilitation and exploratory) is going on entire the globe. Among which a challenging topic is to design a dexterous robotic hand which not only can perform as a hand of a robot but also can be used in re habilitation. The basic key concern is a dexterous robot hand which can be able to mimic the function of biological hand to perform different operations. This thesis work is regarding design and control of a under-actuated robotic hand consisting of four under actuated fingers (index finger, middle finger, little finger and ring finger ) , a thumb and a dexterous palm which can copy the motions and grasp type of human hand which having 21degrees of freedom instead of 25Degree Of Freedom.

40 CFR 93.157 - Frequency of conformity determinations.

Science.gov (United States)

2010-07-01

... convenience of the user, the revised text is set forth as follows: § 93.157 Reevaluation of conformity. (a... were below the limits in § 93.153(b) and changes to the action would result in the total emissions from the action being above the limits in § 93.153(b), then the Federal agency must make a conformity...

Compact Dexterous Robotic Hand

Science.gov (United States)

Lovchik, Christopher Scott (Inventor); Diftler, Myron A. (Inventor)

2001-01-01

A compact robotic hand includes a palm housing, a wrist section, and a forearm section. The palm housing supports a plurality of fingers and one or more movable palm members that cooperate with the fingers to grasp and/or release an object. Each flexible finger comprises a plurality of hingedly connected segments, including a proximal segment pivotally connected to the palm housing. The proximal finger segment includes at least one groove defining first and second cam surfaces for engagement with a cable. A plurality of lead screw assemblies each carried by the palm housing are supplied with power from a flexible shaft rotated by an actuator and output linear motion to a cable move a finger. The cable is secured within a respective groove and enables each finger to move between an opened and closed position. A decoupling assembly pivotally connected to a proximal finger segment enables a cable connected thereto to control movement of an intermediate and distal finger segment independent of movement of the proximal finger segment. The dexterous robotic hand closely resembles the function of a human hand yet is light weight and capable of grasping both heavy and light objects with a high degree of precision.

Lightwand-Guided Endotracheal Intubation Performed by the Nondominant Hand is Feasible

Directory of Open Access Journals (Sweden)

Yi-Wei Kuo

2007-10-01

Full Text Available The aim of this study was to evaluate the efficiency of lightwand-guided endotracheal intubation (LWEI performed using either the right (dominant or left (nondominant hand. Two hundred and forty patients aged 21–64 years, with a Mallampati airway classification grade of I—II and undergoing endotracheal intubation under general anesthesia, were enrolled in this randomized and controlled study. Induction of anesthesia was initiated by intravenous administration of fentanyl (2 mg/kg and thiopentone (5mg/kg, and tracheal intubation was facilitated by intravenous atracurium (0.5 mg/kg. In the direct-vision laryngoscope group (group D; n = 80, the intubator held the laryngoscope in the left hand and inserted the endotracheal tube (ETT into the glottic opening with the right hand. In the group in which LWEI was performed with the right hand (group R; n = 80, the intubator lifted the patients' jaws with the left hand and inserted the ETT-LW unit into the glottic openings with the right hand. On the contrary, in the group in which LWEI was performed with the left hand (group L; n = 80, the intubator lifted the jaws with the right hand and inserted the ETT-LW unit with the left hand. Data including total intubation time, the number of intubation attempts, hemodynamic changes during intubation, and side effects following intubation, were collected. Regardless of whether lightwand manipulation was performed with the left hand (group L; 11.4 ± 9.3 s or the right-hand (group R; 12.4 ± 9.2 s, less time was consumed in the LWEI groups than in the laryngoscope group (group D; 17.9 ± 9.9s (p 95% on their first intubation attempts. The changes in mean arterial blood pressure and heart rate were similar among the three groups. A higher incidence of intubation-related oral injury and ventricular premature contractions (VPC was found in group D compared with groups L and R (oral injury: group D 8.5%, group L 1.3%, group R 0%, p = 0.005; VPC: group D 16

Human health risk assessment of chloroxylenol in liquid hand soap and dishwashing soap used by consumers and health-care professionals.

Science.gov (United States)

Yost, Lisa J; Rodricks, Joseph D; Turnbull, Duncan; DeLeo, Paul C; Nash, J Frank; Quiñones-Rivera, Antonio; Carlson, Pete A

2016-10-01

A quantitative human risk assessment of chloroxylenol was conducted for liquid hand and dishwashing soap products used by consumers and health-care workers. The toxicological data for chloroxylenol indicate lack of genotoxicity, no evidence of carcinogenicity, and minimal systemic toxicity. No observed adverse effect levels (NOAEL) were established from chronic toxicity studies, specifically a carcinogenicity study that found no cancer excess (18 mg/kg-day) and studies of developmental and reproductive toxicity (100 mg/kg-day). Exposure to chloroxylenol for adults and children was estimated for two types of rinse-off cleaning products, one liquid hand soap, and two dishwashing products. The identified NOAELs were used together with exposure estimates to derive margin of exposure (MOE) estimates for chloroxylenol (i.e., estimates of exposure over NOAELs). These estimates were designed with conservative assumptions and likely overestimate exposure and risk (i.e., highest frequency, 100% dermal penetration). The resulting MOEs ranged from 178 to over 100, 000, 000 indicating negligibly small potential for harm related to consumer or health-care worker exposure to chloroxylenol in liquid soaps used in dish washing and hand washing. Copyright © 2016 Elsevier Inc. All rights reserved.

[Bacteriological study of oral cavity of people of Mexican origin to determine etiology agents of human infections in hand bite].

Science.gov (United States)

Cañedo-Guzmán, Cristhyan Baruch; Espinosa-Gutiérrez, Alejandro; Guzmán-Murillo, María Antonia

2013-01-01

Hand infections secondary to human bites often leave serious consequences on the functioning of the hand. Such infections are caused by different bacteria. Most bacteriological studies have been made to people of Anglo-Saxon origin or descent, and based on these findings; provide treatment to patients of different origins which may not always be as effective. Descriptive, internal stratified 17 patients were isolated samples of oral cavity and dental plaque bacterial species to identify and define the possible treatment according to the species identified. Microorganisms were isolated Gram (+) and Gram (-) belonging to the normal flora of the oral cavity and dental plaque in all the cases studied, presenting a variable number of microorganisms according to age but not by sex. The group of Gram-positive bacteria isolated showed sensitivity to: erythromycin, chloramphenicol and ciprofloxacin. In the group of Gram negative: kanamycin, amoxicillin + clavulanic acid, ciprofloxacin and norfloxacin, E. Corrodens sensitive to the group of quinolones as ciprofloxacin, norfloxacin as well as ceftriaxone and cefoperazone sulbactam. The bacterial species that are commonly found in normal flora of the oral cavity and dental plaque may be potential pathogens in a hand injury where to find the appropriate conditions for their development.

Specification of jaw identity by the Hand2 transcription factor

Science.gov (United States)

Funato, Noriko; Kokubo, Hiroki; Nakamura, Masataka; Yanagisawa, Hiromi; Saga, Yumiko

2016-01-01