WorldWideScience

Sample records for human est collections

  1. Collection of offshore human error probability data

    International Nuclear Information System (INIS)

    Basra, Gurpreet; Kirwan, Barry

    1998-01-01

    Accidents such as Piper Alpha have increased concern about the effects of human errors in complex systems. Such accidents can in theory be predicted and prevented by risk assessment, and in particular human reliability assessment (HRA), but HRA ideally requires qualitative and quantitative human error data. A research initiative at the University of Birmingham led to the development of CORE-DATA, a Computerised Human Error Data Base. This system currently contains a reasonably large number of human error data points, collected from a variety of mainly nuclear-power related sources. This article outlines a recent offshore data collection study, concerned with collecting lifeboat evacuation data. Data collection methods are outlined and a selection of human error probabilities generated as a result of the study are provided. These data give insights into the type of errors and human failure rates that could be utilised to support offshore risk analyses

  2. Identification of candidate genes for human pituitary development by EST analysis

    Directory of Open Access Journals (Sweden)

    Xiao Huasheng

    2009-03-01

    Full Text Available Abstract Background The pituitary is a critical neuroendocrine gland that is comprised of five hormone-secreting cell types, which develops in tandem during the embryonic stage. Some essential genes have been identified in the early stage of adenohypophysial development, such as PITX1, FGF8, BMP4 and SF-1. However, it is likely that a large number of signaling molecules and transcription factors essential for determination and terminal differentiation of specific cell types remain unidentified. High-throughput methods such as microarray analysis may facilitate the measurement of gene transcriptional levels, while Expressed sequence tag (EST sequencing, an efficient method for gene discovery and expression level analysis, may no-redundantly help to understand gene expression patterns during development. Results A total of 9,271 ESTs were generated from both fetal and adult pituitaries, and assigned into 961 gene/EST clusters in fetal and 2,747 in adult pituitary by homology analysis. The transcription maps derived from these data indicated that developmentally relevant genes, such as Sox4, ST13 and ZNF185, were dominant in the cDNA library of fetal pituitary, while hormones and hormone-associated genes, such as GH1, GH2, POMC, LHβ, CHGA and CHGB, were dominant in adult pituitary. Furthermore, by using RT-PCR and in situ hybridization, Sox4 was found to be one of the main transcription factors expressed in fetal pituitary for the first time. It was expressed at least at E12.5, but decreased after E17.5. In addition, 40 novel ESTs were identified specifically in this tissue. Conclusion The significant changes in gene expression in both tissues suggest a distinct and dynamic switch between embryonic and adult pituitaries. All these data along with Sox4 should be confirmed to further understand the community of multiple signaling pathways that act as a cooperative network that regulates maturation of the pituitary. It was also suggested that EST

  3. Human reliability data collection and modelling

    International Nuclear Information System (INIS)

    1991-09-01

    The main purpose of this document is to review and outline the current state-of-the-art of the Human Reliability Assessment (HRA) used for quantitative assessment of nuclear power plants safe and economical operation. Another objective is to consider Human Performance Indicators (HPI) which can alert plant manager and regulator to departures from states of normal and acceptable operation. These two objectives are met in the three sections of this report. The first objective has been divided into two areas, based on the location of the human actions being considered. That is, the modelling and data collection associated with control room actions are addressed first in chapter 1 while actions outside the control room (including maintenance) are addressed in chapter 2. Both chapters 1 and 2 present a brief outline of the current status of HRA for these areas, and major outstanding issues. Chapter 3 discusses HPI. Such performance indicators can signal, at various levels, changes in factors which influence human performance. The final section of this report consists of papers presented by the participants of the Technical Committee Meeting. A separate abstract was prepared for each of these papers. Refs, figs and tabs

  4. Assessing human error during collecting a hydrocarbon sample of ...

    African Journals Online (AJOL)

    This paper reports the assessment method of the hydrocarbon sample collection standard operation procedure (SOP) using THERP. The Performance Shaping Factors (PSF) from THERP analyzed and assessed the human errors during collecting a hydrocarbon sample of a petrochemical refinery plant. Twenty-two ...

  5. Applicability of non-invasively collected matrices for human biomonitoring

    Directory of Open Access Journals (Sweden)

    Nickmilder Marc

    2009-03-01

    Full Text Available Abstract With its inclusion under Action 3 in the Environment and Health Action Plan 2004–2010 of the European Commission, human biomonitoring is currently receiving an increasing amount of attention from the scientific community as a tool to better quantify human exposure to, and health effects of, environmental stressors. Despite the policy support, however, there are still several issues that restrict the routine application of human biomonitoring data in environmental health impact assessment. One of the main issues is the obvious need to routinely collect human samples for large-scale surveys. Particularly the collection of invasive samples from susceptible populations may suffer from ethical and practical limitations. Children, pregnant women, elderly, or chronically-ill people are among those that would benefit the most from non-invasive, repeated or routine sampling. Therefore, the use of non-invasively collected matrices for human biomonitoring should be promoted as an ethically appropriate, cost-efficient and toxicologically relevant alternative for many biomarkers that are currently determined in invasively collected matrices. This review illustrates that several non-invasively collected matrices are widely used that can be an valuable addition to, or alternative for, invasively collected matrices such as peripheral blood sampling. Moreover, a well-informed choice of matrix can provide an added value for human biomonitoring, as different non-invasively collected matrices can offer opportunities to study additional aspects of exposure to and effects from environmental contaminants, such as repeated sampling, historical overview of exposure, mother-child transfer of substances, or monitoring of substances with short biological half-lives.

  6. Strontium-90 content of human bone collected in 1967

    International Nuclear Information System (INIS)

    Jeanmaire, L.; Patti, F.

    1969-01-01

    This report follows report CEA-R-3381 and presents the strontium 90 content of human bones collected in 1967 in the Paris area. The main trend is much the same as during 1966; contamination levels are falling down in infants up to 5 year old. Beyond this age, the values are the same or experience a slight increase. (authors) [fr

  7. Establishment of the U.S. castor (Ricinus communis L.) core collection using seed chemical composition analysis and genotyping with EST-SSR markers

    Science.gov (United States)

    Natural genetic variation exists in the plant germplasm collections. Normally the germplasm collection for a specific species encompasses many accessions. Due to its large number of accessions, the entire collection is hard to handle and can’t be easily utilized. To facilitate the end-users (such as...

  8. Human collective intelligence under dual exploration-exploitation dilemmas.

    Directory of Open Access Journals (Sweden)

    Wataru Toyokawa

    Full Text Available The exploration-exploitation dilemma is a recurrent adaptive problem for humans as well as non-human animals. Given a fixed time/energy budget, every individual faces a fundamental trade-off between exploring for better resources and exploiting known resources to optimize overall performance under uncertainty. Colonies of eusocial insects are known to solve this dilemma successfully via evolved coordination mechanisms that function at the collective level. For humans and other non-eusocial species, however, this dilemma operates within individuals as well as between individuals, because group members may be motivated to take excessive advantage of others' exploratory findings through social learning. Thus, even though social learning can reduce collective exploration costs, the emergence of disproportionate "information scroungers" may severely undermine its potential benefits. We investigated experimentally whether social learning opportunities might improve the performance of human participants working on a "multi-armed bandit" problem in groups, where they could learn about each other's past choice behaviors. Results showed that, even though information scroungers emerged frequently in groups, social learning opportunities reduced total group exploration time while increasing harvesting from better options, and consequentially improved collective performance. Surprisingly, enriching social information by allowing participants to observe others' evaluations of chosen options (e.g., Amazon's 5-star rating system in addition to choice-frequency information had a detrimental impact on performance compared to the simpler situation with only the choice-frequency information. These results indicate that humans groups can handle the fundamental "dual exploration-exploitation dilemmas" successfully, and that social learning about simple choice-frequencies can help produce collective intelligence.

  9. DNA typing of Calliphorids collected from human corpses in Malaysia.

    Science.gov (United States)

    Kavitha, R; Tan, T C; Lee, H L; Nazni, W A; Sofian-Azirun, M

    2013-03-01

    Estimation of post-mortem interval (PMI) is crucial for time of death determination. The advent of DNA-based identification techniques forensic entomology saw the beginning of a proliferation of molecular studies into forensically important Calliphoridae (Diptera). The use of DNA to characterise morphologically indistinguishable immature calliphorids was recognised as a valuable molecular tool with enormous practical utility. The local entomofauna in most cases is important for the examination of entomological evidences. The survey of the local entomofauna has become a fundamental first step in forensic entomological studies, because different geographical distributions, seasonal and environmental factors may influence the decomposition process and the occurrence of different insect species on corpses. In this study, calliphorids were collected from 13 human corpses recovered from indoors, outdoors and aquatic conditions during the post-mortem examination by pathologists from the government hospitals in Malaysia. Only two species, Chrysomya megacephala and Chrysomya rufifacies were recovered from human corpses. DNA sequencing was performed to study the mitochondrial encoded COI gene and to evaluate the suitability of the 1300 base pairs of COI fragments for identification of blow fly species collected from real crime scene. The COI gene from blow fly specimens were sequenced and deposited in GenBank to expand local databases. The sequenced COI gene was useful in identifying calliphorids retrieved from human corpses.

  10. Genetic diversity and population structure of castor (Ricinus communis L.) germplasm within the U.S. collection assessed with EST-SSR markers

    Science.gov (United States)

    Castor is an important oilseed crop and although its oil is inedible, it has multiple industrial and pharmaceutical applications. The entire U.S. castor germplasm collection was previously screened for oil content and fatty acid composition, but its genetic diversity and population structure has not...

  11. Effects of vasopressin on the isolated perfused human collecting tubule.

    Science.gov (United States)

    Yanagawa, N; Trizna, W; Bar-Khayim, Y; Fine, L G

    1981-05-01

    Cortical collecting tubules (CCT) were dissected from the surviving normal tissue of human kidneys removed at operation for either carcinoma or calculus. These CCT's were perfused in vitro shortly after the nephrectomy was performed. Transtubular potential differences in different tubules varied from +3.2 to -2.0 mV and were reduced towards zero by lowering the temperature or by adding ouabain to the bath. In the absence of vasopressin, tubules were essentially impermeable to water with extremely low net water fluxes even in the presence of a transtubular osmotic gradient. Addition of vasopressin to the bath caused the transtubular osmotic water permeability coefficient to increase to values of 125, 175, and 155 X 10(-4) cm/sec in three tubules thus studied. These results demonstrate close similarities between the human CCT and the more extensively studied rabbit CCT.

  12. Human performance data collected in a virtual environment

    Directory of Open Access Journals (Sweden)

    Mashrura Musharraf

    2017-12-01

    Full Text Available This data article describes the experimental data used in the research article “Incorporating individual differences in human reliability analysis: an extension to the virtual experimental technique” (Musharraf et al., 2017 [1]. The article provides human performance data for 36 individuals collected using a virtual environment. Each participant was assigned to one of two groups for training: 1 G1: high level training and 2 G2: low level training. Participants’ performance was tested in 4 different virtual scenarios with different levels of visibility and complexity. Several performance metrics of the participants were recorded during each scenario. The metrics include: time to muster, time spent running, interaction with fire doors and watertight doors, interaction with hazards, and reporting at different muster locations.

  13. Human performance data collected in a virtual environment.

    Science.gov (United States)

    Musharraf, Mashrura; Smith, Jennifer; Khan, Faisal; Veitch, Brian; MacKinnon, Scott

    2017-12-01

    This data article describes the experimental data used in the research article "Incorporating individual differences in human reliability analysis: an extension to the virtual experimental technique" (Musharraf et al., 2017) [1]. The article provides human performance data for 36 individuals collected using a virtual environment. Each participant was assigned to one of two groups for training: 1) G1: high level training and 2) G2: low level training. Participants' performance was tested in 4 different virtual scenarios with different levels of visibility and complexity. Several performance metrics of the participants were recorded during each scenario. The metrics include: time to muster, time spent running, interaction with fire doors and watertight doors, interaction with hazards, and reporting at different muster locations.

  14. Bacteria, fungi and arthropod pests collected on modern human mummies

    Directory of Open Access Journals (Sweden)

    F. Palla

    2011-08-01

    Full Text Available A survey of opportunistic biocenosis (macro and micro organisms associated with a rest of human mummy samples was carried out to characterise the biocenosis and to detect the potential of biodeteriogens. The rests of the human modern mummies come from a hypogeic site. Since mummies are relevant from a historic-artistic-scientific point of view, an aspect of this study was the identification and characterization of the biological systems related with biodeterioration of organic matter. In a first step, different sampling methods, according to the taxa, were applied. Technological procedures were combined in order to have an interdisciplinary approach to the conservation actions for testing future restoration protocols. Specimens were collected, identified and characterized by Microscopy (light, SEM, CLSM and molecular analyses (DNA extraction, in vitro target sequence amplification, sequencing, sequence analysis. The results highlight a rather complex biocenonsis consisting of fungi, cyanobacteria, several insects and other arthropods.

  15. 77 FR 33774 - Agency Information Collection Activities: Comment Request; Education and Human Resources Project...

    Science.gov (United States)

    2012-06-07

    ... and Human Resources Project Monitoring Clearance AGENCY: National Science Foundation. ACTION: Notice...). SUPPLEMENTARY INFORMATION: Title of Collection: Education and Human Resources Project Monitoring Clearance. OMB... States and internationally. The Directorate for Education and Human Resources (EHR), a unit within NSF...

  16. EST! best practices

    Science.gov (United States)

    2000-10-05

    This booklet presents the eighteen winners in a competition for projects that promote environmentally sustainable transportation (EST). These range from car sharing to hydrogen fueled buses to public transit promotion campaign. Each project is presen...

  17. Understanding Collective Learning and Human Agency in Diverse ...

    African Journals Online (AJOL)

    2018-05-07

    May 7, 2018 ... made between students' lives, their African identities and local natural places. Introduction to the Think Piece Collection: 'Collective Learning and Change ... is increasingly recognised in the social-ecological and global change sciences. For example, ..... processes that allow for the change agent to act.

  18. [Collections of human biological resources for research purposes: from regulations to the need of a guide of good collection practices].

    Science.gov (United States)

    Le Roux, N; de Montgolfier, S; di Donato, J-H; Boccon-Gibod, L; Teillac, P; Hervé, C; Berthon, P

    2003-12-01

    In France, collections of human biological resources are regulated by the "Bioethics Law", currently in revision. Hence, we analyse the regulatory and ethical issues of these practices in the context of scientific research. The ultimate aim of such collections is to improve biological and medical knowledge. We think that the French regulatory system is quite complicated and non-explicit for "collection holders". The multiplicity of legal texts concerning this activity has made their application difficult, especially in the absence of application decrees. The project amending the actual law has clarified the legal status of collections but it did not shed light on the status of human body detached parts. Furthermore, the text is still very far from the international bioethical recommendations, and does not reflect the actual collection's implementation. The establishment of a guideline of Good Collection Practices, based on clear principles, should help to simplify the situation, especially when it is imbedded in the regulation and linked to control procedures. It would allow a balance between collective interests and the protection of individuals, taking into account of the international highly competitive scientific and economical constraints. The major issue is to preserve and to perpetuate the existing and future collections because of their precious value as an important tool for biomedical knowledge. The efficiency of a regulation depends on its legibility and accessibility, two requirements that seem to determine the acceptance of the regulatory tool and its application allowing subsequently to reach fairness in proceedings.

  19. EST Vocabulary Instruction

    Directory of Open Access Journals (Sweden)

    Célia D.S. Bell

    2012-05-01

    Full Text Available This study aims at contributing to the investigation on the instruction of EST (English for Science and Technology vocabulary, in terms of receptive use of the language. It evaluates the effectiveness of two teaching approaches to the acquisition of vocabulary. The first approach consisted of teaching vocabulary through the use of dictionaries, where the words were merely translated into the learners’ L1 or defined in the target language thus promoting superficial level of word processing. The second approach employed activities promoting deep level of word processing. Data were analysed quantitatively. Results indicated that the two approaches seem to have some equipotentiality, as far as EST vocabulary is concerned.

  20. HANPP Collection: Global Patterns in Human Appropriation of Net Primary Productivity (HANPP)

    Data.gov (United States)

    National Aeronautics and Space Administration — The Global Patterns in Human Appropriation of Net Primary Productivity (HANPP) portion of the HANPP Collection represents a digital map of human appropriation of net...

  1. HANPP Collection: Human Appropriation of Net Primary Productivity (HANPP) by Country and Product

    Data.gov (United States)

    National Aeronautics and Space Administration — The Global Patterns in Human Appropriation of Net Primary Productivity (HANPP) portion of the HANPP Collection represents a digital map of human appropriation of net...

  2. Understanding Collective Learning and Human Agency in Diverse ...

    African Journals Online (AJOL)

    2018-05-07

    May 7, 2018 ... new social systems that are more sustainable and socially just. ... collection to these international deliberations about the role of education in enabling ... learning can foster and contribute to the development of change agents ...

  3. 78 FR 41403 - Agency Information Collection Activities; Proposed Collection; Comment Request; Human Tissue...

    Science.gov (United States)

    2013-07-10

    ... these topics: (1) Whether the proposed collection of information is necessary for the proper performance... (b) also requires recording and justification of any deviation from the written procedures. Section 1270.33(a) requires records to be maintained concurrently with the performance of each significant step...

  4. 75 FR 9226 - Agency Information Collection Activities; Proposed Collection; Comment Request; Human Tissue...

    Science.gov (United States)

    2010-03-01

    ... collection of information is necessary for the proper performance of FDA's functions, including whether the... of any deviation from the written procedures. Section 1270.33(a) requires records to be maintained concurrently with the performance of each significant step in the performance of infectious disease screening...

  5. Human Saliva Collection Devices for Proteomics: An Update

    Directory of Open Access Journals (Sweden)

    Zohaib Khurshid

    2016-06-01

    Full Text Available There has been a rapid growth in the interest and adaptation of saliva as a diagnostic specimen over the last decade, and in the last few years in particular, there have been major developments involving the application of saliva as a clinically relevant specimen. Saliva provides a “window” into the oral and systemic health of an individual, and like other bodily fluids, saliva can be analyzed and studied to diagnose diseases. With the advent of new, more sensitive technologies to detect smaller concentrations of analytes in saliva relative to blood levels, there have been a number of critical developments in the field that we will describe. In particular, recent advances in standardized saliva collection devices that were not available three to four years ago, have made it easy for safe, simple, and non-invasive collection of samples to be carried out from patients. With the availability of these new technologies, we believe that in the next decade salivary proteomics will make it possible to predict and diagnose oral as well as systemic diseases, cancer, and infectious diseases, among others. The aim of this article is to review recent developments and advances in the area of saliva specimen collection devices and applications that will advance the field of proteomics.

  6. SHERLOCK: Simple Human Experiments Regarding Locally Observed Collective Knowledge

    Science.gov (United States)

    2015-12-01

    Suite 1204, Arlington, VA 22202-4302. Respondents should be aware that notwithstanding any other provision of law, no person shall be subject to... aware approach in coalition decision making at or near the network edge. The studies, named SHERLOCK (for Simple Human Experiments Regarding Locally...character’s location, shirt colour , preferred fruit, and hobby — are discoverable by visiting a set of locations around a university building. In

  7. CitEST libraries

    Directory of Open Access Journals (Sweden)

    Maria Luísa P. Natividade Targon

    2007-01-01

    Full Text Available In order to obtain a better understanding of what is citrus, 33 cDNA libraries were constructed from different citrus species and genera. Total RNA was extracted from fruits, leaves, flowers, bark, seeds and roots, and subjected or not to different biotic and abiotic stresses (pathogens and drought and at several developmental stages. To identify putative promoter sequences, as well as molecular markers that could be useful for breeding programs, one shotgun library was prepared from sweet orange (Citrus sinensis var. Olimpia. In addition, EST libraries were also constructed for a citrus pathogen, the oomycete Phythophthora parasitica in either virulent or avirulent form. A total of 286,559 cDNA clones from citrus were sequenced from their 5’ end, generating 242,790 valid reads of citrus. A total of 9,504 sequences were produced in the shotgun library and the valid reads were assembled using CAP3. In this procedure, we obtained 1,131 contigs and 4,083 singletons. A total of 19,200 cDNA clones from P. parasitica were sequenced, resulting in 16,400 valid reads. The number of ESTs generated in this project is, to our knowledge, the largest citrus sequence database in the world.

  8. The Tedeschi collection: A collection of documented and undocumented human skeletal remains at the Museum of Anthropology, Padua University (Italy).

    Science.gov (United States)

    Carrara, Nicola; Scaggion, Cinzia; Holland, Emily

    2018-04-01

    Documented and undocumented skeletal collections offer unique windows into life in the past and are integral for research in biological anthropology. The objective of this article is to describe the documented and undocumented collections curated by the Museum of Anthropology at Padua University (Italy) to demonstrate their potential for research and encourage researchers to consider them for future projects. The collection was established by Prof. Enrico Tedeschi at the beginning of 20th century, and dates to the late 19th and early 20th century. The collection consists primarily of individuals excavated from cemeteries, ossarios, or unclaimed individuals donated by hospitals or other institutions. Both documented and undocumented human skeletal remains are included in the collection, totalling 1,580 individuals. Associated documented information including age at death, date of death, sex, occupation, and cause of death is available in different combinations for 293 individuals of varying completeness (188 crania only, 93 crania and postcranial, 12 postcranial only). Origin and chronological period are known for the remaining 1,287 individuals. Overall, this little studied collection could be particularly useful for researchers interested in craniometrics, dentition, and 19th and 20th century health and demography in Italy. The documented skeletons will be especially useful for forensic anthropological research. © 2018 Wiley Periodicals, Inc.

  9. Collective human mobility pattern from taxi trips in urban area

    KAUST Repository

    Peng, Chengbin

    2012-04-18

    We analyze the passengers\\' traffic pattern for 1.58 million taxi trips of Shanghai, China. By employing the non-negative matrix factorization and optimization methods, we find that, people travel on workdays mainly for three purposes: commuting between home and workplace, traveling from workplace to workplace, and others such as leisure activities. Therefore, traffic flow in one area or between any pair of locations can be approximated by a linear combination of three basis flows, corresponding to the three purposes respectively. We name the coefficients in the linear combination as traffic powers, each of which indicates the strength of each basis flow. The traffic powers on different days are typically different even for the same location, due to the uncertainty of the human motion. Therefore, we provide a probability distribution function for the relative deviation of the traffic power. This distribution function is in terms of a series of functions for normalized binomial distributions. It can be well explained by statistical theories and is verified by empirical data. These findings are applicable in predicting the road traffic, tracing the traffic pattern and diagnosing the traffic related abnormal events. These results can also be used to infer land uses of urban area quite parsimoniously. 2012 Peng et al.

  10. HANPP Collection: Human Appropriation of Net Primary Productivity as a Percentage of Net Primary Productivity

    Data.gov (United States)

    National Aeronautics and Space Administration — The Human Appropriation of Net Primary Productivity (HANPP) as a Percentage of Net Primary Product (NPP) portion of the HANPP Collection represents a map identifying...

  11. 78 FR 8192 - Agency Information Collection Activities: Comment Request; Education and Human Resources Project...

    Science.gov (United States)

    2013-02-05

    ... NATIONAL SCIENCE FOUNDATION Agency Information Collection Activities: Comment Request; Education and Human Resources Project Monitoring Clearance AGENCY: National Science Foundation. ACTION: Notice... study will assess the implementation of resources, models, and technologies to determine how and why...

  12. HANPP Collection: Human Appropriation of Net Primary Productivity (HANPP) by Country and Product

    Data.gov (United States)

    National Aeronautics and Space Administration — The Human Appropriation of Net Primary Productivity (HANPP) by Country and Product portion of the HANPP Collection contains tabular data on carbon-equivalents of...

  13. Use of COTS Infrared Camera Arrays for Enhanced Human in the Loop Data Collection

    Data.gov (United States)

    National Aeronautics and Space Administration — Demonstrate the use of one or more Microsoft Kinect infrared cameras for the application of passive data collection during human in the loop (HITL) tests. By using...

  14. The Zagreb Collection of human brains: a unique, versatile, but underexploited resource for the neuroscience community.

    Science.gov (United States)

    Judaš, Miloš; Šimić, Goran; Petanjek, Zdravko; Jovanov-Milošević, Nataša; Pletikos, Mihovil; Vasung, Lana; Vukšić, Mario; Kostović, Ivica

    2011-05-01

    The Zagreb Collection of developing and adult human brains was founded in 1974 by Ivica Kostović and consists of 1,278 developing and adult human brains, including 610 fetal, 317 children, and 359 adult brains. It is one of the largest collections of developing human brains. The collection serves as a key resource for many focused research projects and has led to several seminal contributions on mammalian cortical development, such as the discovery of the transient fetal subplate zone and of early bilaminar synaptogenesis in the embryonic and fetal human cerebral cortex, and the first description of growing afferent pathways in the human fetal telencephalon. The Zagreb Collection also serves as a core resource for ever-growing networks of international collaboration and represents the starting point for many young investigators who now pursue independent research careers at leading international institutions. The Zagreb Collection, however, remains underexploited owing to a lack of adequate funding in Croatia. Funding could establish an online catalog of the collection and modern virtual microscopy scanning methods to make the collection internationally more accessible. © 2011 New York Academy of Sciences.

  15. SNP-finding in pig mitochondrial ESTs

    DEFF Research Database (Denmark)

    Scheibye-Alsing, Karsten; Cirera Salicio, Susanna; Gilchrist, M.J.

    2008-01-01

    The Sino-Danish pig genome project produced 685 851 ESTs (Gorodkin et al. 2007), of which 41 499 originated from the mitochondrial genome. In this study, the mitochondrial ESTs were assembled, and 374 putative SNPs were found. Chromatograms for the ESTs containing SNPs were manually inspected, an......, and 112 total (52 non-synonymous) SNPs were found to be of high confidence (five of them are close to disease-causing SNPs in humans). Nine of the high-confidence SNPs were tested experimentally, and eight were confirmed. The SNPs can be accessed online at http://pigest.ku.dk/more.mito...

  16. Social collective intelligence: combining the powers of humans and machines to build a smarter society

    NARCIS (Netherlands)

    Miorandi, Daniele; Maltese, Vincenzo; Rovatsos, Michael; Nijholt, Antinus; Stewart, James

    2014-01-01

    The book focuses on Social Collective Intelligence, a term used to denote a class of socio-technical systems that combine, in a coordinated way, the strengths of humans, machines and collectives in terms of competences, knowledge and problem solving capabilities with the communication, computing and

  17. Estética marítima pesqueira: perfeição, resistência e humanização do mar Maritime fishing aesthetics: perfection, humanization and resistance of sea

    Directory of Open Access Journals (Sweden)

    Cristiano Wellington Noberto Ramalho

    2010-06-01

    Full Text Available Este escrito analisa a definição que os pescadores artesanais do mar-alto da praia de Suape (PE realizam sobre seu trabalho, ao categorizá-lo de belo. O belo é associado ao trabalho pesqueiro feito com perfeição, de maneira autônoma e aprazível. O que se traduz em formas de humanização do mar e do modo de vida dos próprios pescadores, produzindo, assim, uma estética marítima pesqueira.This paper examines the definition that the craft fishermen of Suape beach (PE carry on their work, categorizing it as beautiful. Beauty is associated with the fishing work done with perfection, autonomously and pleasantly. That is reflected in the ways of the sea humanization and in the livelihoods of the fishermen themselves, thereby producing a maritime fishing aesthetics.

  18. Privacy in Sensor-Driven Human Data Collection: A Guide for Practitioners

    OpenAIRE

    Stopczynski, Arkadiusz; Pietri, Riccardo; Pentland, Alex; Lazer, David; Lehmann, Sune

    2014-01-01

    In recent years, the amount of information collected about human beings has increased dramatically. This development has been partially driven by individuals posting and storing data about themselves and friends using online social networks or collecting their data for self-tracking purposes (quantified-self movement). Across the sciences, researchers conduct studies collecting data with an unprecedented resolution and scale. Using computational power combined with mathematical models, such r...

  19. 78 FR 26639 - Proposed Collection; 60-Day Comment Request: Financial Sustainability of Human Tissue Biobanking...

    Science.gov (United States)

    2013-05-07

    ... Comment Request: Financial Sustainability of Human Tissue Biobanking (NCI) Summary: In compliance with the... techniques or other forms of information technology. To Submit Comments and for Further Information: To... this publication. Proposed Collection: Financial Sustainability of Human Tissue Biobanking, 0925-NEW...

  20. Developing Humanities Collections in the Digital Age: Exploring Humanities Faculty Engagement with Electronic and Print Resources

    Science.gov (United States)

    Kachaluba, Sarah Buck; Brady, Jessica Evans; Critten, Jessica

    2014-01-01

    This article is based on quantitative and qualitative research examining humanities scholars' understandings of the advantages and disadvantages of print versus electronic information resources. It explores how humanities' faculty members at Florida State University (FSU) use print and electronic resources, as well as how they perceive these…

  1. EST2Prot: Mapping EST sequences to proteins

    Directory of Open Access Journals (Sweden)

    Lin David M

    2006-03-01

    Full Text Available Abstract Background EST libraries are used in various biological studies, from microarray experiments to proteomic and genetic screens. These libraries usually contain many uncharacterized ESTs that are typically ignored since they cannot be mapped to known genes. Consequently, new discoveries are possibly overlooked. Results We describe a system (EST2Prot that uses multiple elements to map EST sequences to their corresponding protein products. EST2Prot uses UniGene clusters, substring analysis, information about protein coding regions in existing DNA sequences and protein database searches to detect protein products related to a query EST sequence. Gene Ontology terms, Swiss-Prot keywords, and protein similarity data are used to map the ESTs to functional descriptors. Conclusion EST2Prot extends and significantly enriches the popular UniGene mapping by utilizing multiple relations between known biological entities. It produces a mapping between ESTs and proteins in real-time through a simple web-interface. The system is part of the Biozon database and is accessible at http://biozon.org/tools/est/.

  2. Collection and classification of human error and human reliability data from Indian nuclear power plants for use in PSA

    International Nuclear Information System (INIS)

    Subramaniam, K.; Saraf, R.K.; Sanyasi Rao, V.V.S.; Venkat Raj, V.; Venkatraman, R.

    2000-01-01

    Complex systems such as NPPs involve a large number of Human Interactions (HIs) in every phase of plant operations. Human Reliability Analysis (HRA) in the context of a PSA, attempts to model the HIs and evaluate/predict their impact on safety and reliability using human error/human reliability data. A large number of HRA techniques have been developed for modelling and integrating HIs into PSA but there is a significant lack of HAR data. In the face of insufficient data, human reliability analysts have had to resort to expert judgement methods in order to extend the insufficient data sets. In this situation, the generation of data from plant operating experience assumes importance. The development of a HRA data bank for Indian nuclear power plants was therefore initiated as part of the programme of work on HRA. Later, with the establishment of the coordinated research programme (CRP) on collection of human reliability data and use in PSA by IAEA in 1994-95, the development was carried out under the aegis of the IAEA research contract No. 8239/RB. The work described in this report covers the activities of development of a data taxonomy and a human error reporting form (HERF) based on it, data structuring, review and analysis of plant event reports, collection of data on human errors, analysis of the data and calculation of human error probabilities (HEPs). Analysis of plant operating experience does yield a good amount of qualitative data but obtaining quantitative data on human reliability in the form of HEPs is seen to be more difficult. The difficulties have been highlighted and some ways to bring about improvements in the data situation have been discussed. The implementation of a data system for HRA is described and useful features that can be incorporated in future systems are also discussed. (author)

  3. Possibilities of collecting evidences about crime act of sexual exploitation in human beings

    Directory of Open Access Journals (Sweden)

    Mijalković Saša

    2006-01-01

    Full Text Available Collecting evidences about organized crime act of sexual exploitation in human begins often is very difficult because of high level of organization, secrecy ant precaution taken during committing prostitution, pornography, sex tourism and human trafficking. On the other side, high illegal profit enable criminals to engage "expensive" and experienced lawyers, whose often make values and reliability of collected evidences questionable, appealing to irregularities during police collecting procedure. Among traditional criminalities methods and proofing activities, in the study, modern tendencies in special investigative measures and techniques are considered. After that, there is pointing at specificity, meaning and value of material tracks and objects, which are essential for proofing crime act or perpetrator’s guiltiness. On the end, there is pointing at importance of victims’ cooperation in collecting evidences about their sexual exploitation.

  4. Human Computer Collaboration at the Edge: Enhancing Collective Situation Understanding with Controlled Natural Language

    Science.gov (United States)

    2016-09-06

    conversational agent with information exchange disabled until the end of the experiment run. The meaning of the indicator in the top- right of the agent... Human Computer Collaboration at the Edge: Enhancing Collective Situation Understanding with Controlled Natural Language Alun Preece∗, William...email: PreeceAD@cardiff.ac.uk †Emerging Technology Services, IBM United Kingdom Ltd, Hursley Park, Winchester, UK ‡US Army Research Laboratory, Human

  5. galaxieEST: addressing EST identity through automated phylogenetic analysis.

    Science.gov (United States)

    Nilsson, R Henrik; Rajashekar, Balaji; Larsson, Karl-Henrik; Ursing, Björn M

    2004-07-05

    Research involving expressed sequence tags (ESTs) is intricately coupled to the existence of large, well-annotated sequence repositories. Comparatively complete and satisfactory annotated public sequence libraries are, however, available only for a limited range of organisms, rendering the absence of sequences and gene structure information a tangible problem for those working with taxa lacking an EST or genome sequencing project. Paralogous genes belonging to the same gene family but distinguished by derived characteristics are particularly prone to misidentification and erroneous annotation; high but incomplete levels of sequence similarity are typically difficult to interpret and have formed the basis of many unsubstantiated assumptions of orthology. In these cases, a phylogenetic study of the query sequence together with the most similar sequences in the database may be of great value to the identification process. In order to facilitate this laborious procedure, a project to employ automated phylogenetic analysis in the identification of ESTs was initiated. galaxieEST is an open source Perl-CGI script package designed to complement traditional similarity-based identification of EST sequences through employment of automated phylogenetic analysis. It uses a series of BLAST runs as a sieve to retrieve nucleotide and protein sequences for inclusion in neighbour joining and parsimony analyses; the output includes the BLAST output, the results of the phylogenetic analyses, and the corresponding multiple alignments. galaxieEST is available as an on-line web service for identification of fungal ESTs and for download / local installation for use with any organism group at http://galaxie.cgb.ki.se/galaxieEST.html. By addressing sequence relatedness in addition to similarity, galaxieEST provides an integrative view on EST origin and identity, which may prove particularly useful in cases where similarity searches return one or more pertinent, but not full, matches and

  6. Social collective intelligence combining the powers of humans and machines to build a smarter society

    CERN Document Server

    Miorandi, Daniele; Rovatsos, Michael

    2014-01-01

    The book focuses on Social Collective Intelligence, a term used to denote a class of socio-technical systems that combine, in a coordinated way, the strengths of humans, machines and collectives in terms of competences, knowledge and problem solving capabilities with the communication, computing and storage capabilities of advanced ICT.Social Collective Intelligence opens a number of challenges for researchers in both computer science and social sciences; at the same time it provides an innovative approach to solve challenges in diverse application domains, ranging from health to education

  7. La parole est à vous

    CERN Multimedia

    Staff Association

    2015-01-01

    Nous avons identifié, ci-dessous, 3 grands chapitres pour lesquelles bon nombre d’entre vous se posent des questions et ont fréquemment sollicités leurs délégués, qui n’ont pas toujours pu donner de réponses : La retraite et sa préparation. L’affiliation aux régimes sécurité sociale de nos états hôtes et ses conséquences au moment de la retraite. La fiscalité en général. Le service juridique, que nous avons interrogé récemment, n’est pas toujours informé de vos interrogations et de ce fait, il n’a pas encore pu investiguer sur ces questions auprès des services compétents. Il nous a suggéré de vous interroger afin de collecter vos questions, de les synthétiser, afin de les transmettre...

  8. Human error data collection analysis program undertaken since 1982 by Electricite de France with INPO

    International Nuclear Information System (INIS)

    Ghertman, F.; Dietz, P.

    1985-01-01

    The preoccupation for reducing in frequency and importance events which harm at various degrees the availability, the safety and the security of nuclear power plants lead Electricite de France, in cooperation with INPO (Institute of Nuclear Power Operations) to launch a Human Error Collection and Analysis Program. On account with the difficulties met to develop such a program, it has been decided to begin with a pilot data collection limited to a six months period (October 1982 to April 1983) and three nuclear power plants (three US units and two French units). This pilot data collection followed four steps: (1) elaboration of the collection methodology; (2) sensitization and related training of the power plant personnel; (3) data collection in the power plant; and (4) analysis of the data and results. Each of the steps are discussed in the paper

  9. An Animal Model for Collective Behavior in Humans: The Impact of Manipulated Trust and Aggression

    Science.gov (United States)

    2014-04-30

    political choice, in consumer preferences , etc.). Numerous terms and theories have been posited in order to explain this group effect (‘Herd morality’; ‘Herd...human collective behavior (e.g. in the stock market, in political choice, in consumer preferences , etc), as well as disclosing the underlying

  10. A methodology for collection and analysis of human error data based on a cognitive model: IDA

    International Nuclear Information System (INIS)

    Shen, S.-H.; Smidts, C.; Mosleh, A.

    1997-01-01

    This paper presents a model-based human error taxonomy and data collection. The underlying model, IDA (described in two companion papers), is a cognitive model of behavior developed for analysis of the actions of nuclear power plant operating crew during abnormal situations. The taxonomy is established with reference to three external reference points (i.e. plant status, procedures, and crew) and four reference points internal to the model (i.e. information collected, diagnosis, decision, action). The taxonomy helps the analyst: (1) recognize errors as such; (2) categorize the error in terms of generic characteristics such as 'error in selection of problem solving strategies' and (3) identify the root causes of the error. The data collection methodology is summarized in post event operator interview and analysis summary forms. The root cause analysis methodology is illustrated using a subset of an actual event. Statistics, which extract generic characteristics of error prone behaviors and error prone situations are presented. Finally, applications of the human error data collection are reviewed. A primary benefit of this methodology is to define better symptom-based and other auxiliary procedures with associated training to minimize or preclude certain human errors. It also helps in design of control rooms, and in assessment of human error probabilities in the probabilistic risk assessment framework. (orig.)

  11. Strontium-90 content of human bones collected from 1962 to 1966

    International Nuclear Information System (INIS)

    Jeanmaire, L.

    1967-01-01

    The aim of this report is essentially to present results of 90 Sr determination made on human bones collected in the Paris region from 1962 to 1966. The results are classified according to the year and the age-group in, two tables and one figure which show the general evolution of the contamination during this period. (author) [fr

  12. Collective violence caused by climate change and how it threatens health and human rights.

    Science.gov (United States)

    Levy, Barry S; Sidel, Victor W

    2014-06-14

    The weight of scientific evidence indicates that climate change is causally associated with collective violence. This evidence arises from individual studies over wide ranges of time and geographic location, and from two extensive meta-analyses. Complex pathways that underlie this association are not fully understood; however, increased ambient temperatures and extremes of rainfall, with their resultant adverse impacts on the environment and risk factors for violence, appear to play key roles. Collective violence due to climate change poses serious threats to health and human rights, including by causing morbidity and mortality directly and also indirectly by damage to the health-supporting infrastructure of society, forcing people to migrate from their homes and communities, damaging the environment, and diverting human and financial resources. This paper also briefly addresses issues for future research on the relationship between climate change and collective violence, the prevention of collective violence due to climate change, and States' obligations to protect human rights, to prevent collective violence, and to promote and support measures to mitigate and adapt to climate change. Copyright © 2014 Levy and Sidel. This is an open access article distributed under the terms of the Creative Commons Attribution Non-Commercial License (http://creativecommons.org/licenses/by-nc/3.0/), which permits unrestricted non-commercial use, distribution, and reproduction in any medium, provided the original author and source are credited.

  13. Collective cognition in humans: groups outperform their best members in a sentence reconstruction task.

    Directory of Open Access Journals (Sweden)

    Romain J G Clément

    Full Text Available Group-living is widespread among animals and one of the major advantages of group-living is the ability of groups to solve cognitive problems that exceed individual ability. Humans also make use of collective cognition and have simultaneously developed a highly complex language to exchange information. Here we investigated collective cognition of human groups regarding language use in a realistic situation. Individuals listened to a public announcement and had to reconstruct the sentence alone or in groups. This situation is often encountered by humans, for instance at train stations or airports. Using recent developments in machine speech recognition, we analysed how well individuals and groups reconstructed the sentences from a syntactic (i.e., the number of errors and semantic (i.e., the quality of the retrieved information perspective. We show that groups perform better both on a syntactic and semantic level than even their best members. Groups made fewer errors and were able to retrieve more information when reconstructing the sentences, outcompeting even their best group members. Our study takes collective cognition studies to the more complex level of language use in humans.

  14. Evaluation of home collection performed by a human milk bank in a university hospital in Brazil.

    Directory of Open Access Journals (Sweden)

    Glória Menezes

    2014-05-01

    Full Text Available Objective. Evaluation of procedures during household milking and transport of human milk associated with their quality control. Materials and methods. 48 donors registered in the Human Milk Bank of the Clinics Hospital of the Federal University at Uberlândia. Observations were made during home visits. A checklist was elaborated according to the technical standards for human milk banks, been associated with  physical-chemical, and microbiological controls. The chi-square test, logistic regression and Spearman test (p menor que 0.05 were used for data analysis. Results. The results suggest that most donors assimilated the guidelines of the milk bank staff and procedures were satisfactorily performed. Conclusion. It could be demonstrated that milking and home collection are safe and effective ways for obtaining donated human milk.

  15. Imaging of a large collection of human embryo using a super-parallel MR microscope

    International Nuclear Information System (INIS)

    Matsuda, Yoshimasa; Ono, Shinya; Otake, Yosuke; Handa, Shinya; Kose, Katsumi; Haishi, Tomoyuki; Yamada, Shigeto; Uwabe, Chikako; Shiota, Kohei

    2007-01-01

    Using 4 and 8-channel super-parallel magnetic resonance (MR) microscopes with a horizontal bore 2.34T superconducting magnet developed for 3-dimensional MR microscopy of the large Kyoto Collection of Human Embryos, we acquired T 1 -weighted 3D images of 1204 embryos at a spatial resolution of (40 μm) 3 to (150 μm) 3 in about 2 years. Similarity of image contrast between the T 1 -weighted images and stained anatomical sections indicated that T 1 -weighted 3D images could be used for an anatomical 3D image database for human embryology. (author)

  16. Human error data collection as a precursor to the development of a human reliability assessment capability in air traffic management

    International Nuclear Information System (INIS)

    Kirwan, Barry; Gibson, W. Huw; Hickling, Brian

    2008-01-01

    Quantified risk and safety assessments are now required for safety cases for European air traffic management (ATM) services. Since ATM is highly human-dependent for its safety, this suggests a need for formal human reliability assessment (HRA), as carried out in other industries such as nuclear power. Since the fundamental aspect of HRA is human error data, in the form of human error probabilities (HEPs), it was decided to take a first step towards development of an ATM HRA approach by deriving some HEPs in an ATM context. This paper reports a study, which collected HEPs via analysing the results of a real-time simulation involving air traffic controllers (ATCOs) and pilots, with a focus on communication errors. This study did indeed derive HEPs that were found to be concordant with other known communication human error data. This is a first step, and shows promise for HRA in ATM, since HEPs have been derived which could be used in safety assessments, although these HEPs are for only one (albeit critical) aspect of ATCOs' tasks (communications). The paper discusses options and potential ways forward for the development of a full HRA capability in ATM

  17. Preliminary perspectives on DNA collection in anti-human trafficking efforts.

    Science.gov (United States)

    Katsanis, Sara H; Kim, Joyce; Minear, Mollie A; Chandrasekharan, Subhashini; Wagner, Jennifer K

    2014-01-01

    Forensic DNA methodologies have potential applications in the investigation of human trafficking cases. DNA and relationship testing may be useful for confirmation of biological relationship claims in immigration, identification of trafficked individuals who are missing persons, and family reunification of displaced individuals after mass disasters and conflicts. As these applications rely on the collection of DNA from non-criminals and potentially vulnerable individuals, questions arise as to how to address the ethical challenges of collection, security, and privacy of collected samples and DNA profiles. We administered a survey targeted to victims' advocates to gain preliminary understanding of perspectives regarding human trafficking definitions, DNA and sex workers, and perceived trust of authorities potentially involved in DNA collection. We asked respondents to consider the use of DNA for investigating adoption fraud, sex trafficking, and post-conflict child soldier cases. We found some key differences in perspectives on defining what qualifies as "trafficking." When we varied terminology between "sex worker" and "sex trafficking victim" we detected differences in perception on which authorities can be trusted. Respondents were supportive of the hypothetical models proposed to collect DNA. Most were favorable of DNA specimens being controlled by an authority outside of law enforcement. Participants voiced concerns focused on privacy, misuse of DNA samples and data, unintentional harms, data security, and infrastructure. These preliminary data indicate that while there is perceived value in programs to use DNA for investigating cases of human trafficking, these programs may need to consider levels of trust in authorities as their logistics are developed and implemented.

  18. Persistent organochlorines in human breast milk collected from primiparae in Dalian and Shenyang, China

    International Nuclear Information System (INIS)

    Kunisue, Tatsuya; Someya, Masayuki; Kayama, Fujio; Jin Yihe; Tanabe, Shinsuke

    2004-01-01

    The present study determined the concentrations of organochlorines (OCs) such as polychlorinated biphenyls (PCBs), dichlorodiphenyltrichloroethane and its metabolites (DDTs), hexachlorocyclohexane isomers (HCHs), chlordane compounds (CHLs), hexachlorobenzene (HCB) and tris(4-chlorophenyl)methane (TCPMe) in human breast milk collected from primiparae in Dalian and Shenyang, northeastern China during 2002. In addition, dioxins and related compounds in pooled samples of human breast milk from Dalian and Shenyang were also analyzed. OCs were detected in all the human breast milk samples analyzed in this study. The predominant contaminants in human breast milk were HCHs, DDTs and HCB, and the levels were relatively higher than those in other countries. On the other hand, concentrations of dioxins and related compounds, PCBs, and CHLs were relatively low. Concentrations of OCs in human breast milk from Dalian, which is located along the coast of Bo Hai Strait, were significantly higher than those from Shenyang, implying that the residents in Dalian might be mainly exposed to these contaminants from seafood. When the relationship between concentrations of OCs in human breast milk and age of primiparae was examined, no significant correlation was observed. This might be caused by the limited sample numbers and narrow range of mother's age and/or recent ban of DDT and HCH production and use. Significant correlation between concentrations of TCPMe and DDTs in human breast milk suggested that technical DDT might be a source of TCPMe in the Chinese population. When daily intakes of DDTs and HCHs to infants through human breast milk were estimated, human breast milk from Dalian showed significantly higher contribution than Shenyang, implying that infants in Dalian might be at higher risk by these contaminants

  19. Stages of in vitro phagocytosis of Plasmodium falciparum-infected erythrocytes by human monocytes Estágios da fagocitose in vitro por monócitos humanos de eritrócitos infectados por Plasmodium falciparum

    Directory of Open Access Journals (Sweden)

    Maria Imaculada Muniz-Junqueira

    2009-04-01

    Full Text Available Monocytes/macrophages play a critical role in the defense mechanisms against malaria parasites, and are the main cells responsible for the elimination of malaria parasites from the blood circulation. We carried out a microscope-aided evaluation of the stages of in vitro phagocytosis of Plasmodium falciparum-infected erythrocytes, by human monocytes. These cells were obtained from healthy adult individuals by means of centrifugation through a cushion of Percoll density medium and were incubated with erythrocytes infected with Plasmodium falciparum that had previously been incubated with a pool of anti-plasmodial immune serum. We described the stages of phagocytosis, starting from adherence of infected erythrocytes to the phagocyte membrane and ending with their destruction within the phagolisosomes of the monocytes. We observed that the different erythrocytic forms of the parasite were ingested by monocytes, and that the process of phagocytosis may be completed in around 30 minutes. Furthermore, we showed that phagocytosis may occur continuously, such that different phases of the process were observed in the same phagocyte.Monócitos/macrófagos desempenham uma função crítica nos mecanismos de defesa antiplasmódio e constituem as principais células responsáveis pela eliminação das formas eritrocitárias do plasmódio da circulação sangüínea. Realizamos uma avaliação microscópica dos estágios da fagocitose in vitro de eritrócitos infectados por Plasmodium falciparum por monócitos humanos. Essas células foram obtidas de indivíduos adultos sadios por centrifugação em Percoll e incubadas com eritrócitos infectados por Plasmodium falciparum previamente incubados com um pool de soro imune contra plasmódio. Descrevemos os estágios da fagocitose, desde a aderência dos eritrócitos infectados até sua destruição nos fagolisossomas dos monócitos. Observou-se que eritrócitos infectados por todos os diferentes est

  20. Review of forensically important entomological specimens collected from human cadavers in Malaysia (2005-2010).

    Science.gov (United States)

    Kavitha, Rajagopal; Nazni, Wasi Ahmad; Tan, Tian Chye; Lee, Han Lim; Azirun, Mohd Sofian

    2013-07-01

    Forensic entomological specimens collected from human decedents during crime scene investigations in Malaysia in the past 6 years (2005-2010) are reviewed. A total of 80 cases were recorded and 93 specimens were collected. From these specimens, 10 species of cyclorrphagic flies were identified, consisting of Chrysomya rufifacies (Macquart) -38 specimens (40.86%), Chrysomya megacephala (Fabricius) -36 specimens (38.70%), Chrysomya villeneuvi (Patton) -2 specimens (2.15%), Chrysomya nigripes (Aubertin) -2 specimens (2.15%), Chrysomya pinguis (Walker) -1 specimen (1.08%), Hermetia illucens (Linnaeus) -1 specimen (1.08%), Hemipyrellia liguriens (Wiedemann) -5 specimens (5.37%), Synthesiomyia nudiseta (Wulp) -1 specimen (1.08%), Megaselia scalaris (Loew)-1 specimen (1.08%) and Sarcophaga ruficornis (Fabricius) -4 specimens (4.30%). In two specimens (2.15%), the maggots were not identifiable. Ch. megacephala and Ch. rufifacies were the commonest species found in human decedents from three different ecological habitats. S. nudiseta is an uncommon species found only on human cadavers from indoors. A total of 75 cases (93.75%) had a single fly infestation and 5 cases (6.25%) had double fly infestation. In conclusion, although large numbers of fly species were found on human decedents, the predominant species are still those of Chrysomya. Copyright © 2013 Elsevier Ltd and Faculty of Forensic and Legal Medicine. All rights reserved.

  1. A retrospective study of the characterization of Rickettsia species in ticks collected from humans.

    Science.gov (United States)

    Blanda, Valeria; Torina, Alessandra; La Russa, Francesco; D'Agostino, Rosalia; Randazzo, Kety; Scimeca, Salvatore; Giudice, Elisabetta; Caracappa, Santo; Cascio, Antonio; de la Fuente, José

    2017-06-01

    Rickettsiae (family Rickettsiaceae, order Rickettsiales) are obligate intracellular bacteria transmitted by arthropod vectors. Several Rickettsia species causing vector-borne rickettsioses belong to the spotted fever group (SFG). Traditionally, Rickettsia conorii has been considered as the main etiologic agent of Mediterranean spotted fever. However, the molecular characterization of rickettsiae allowed identifying other species involved in spotted fever in the Mediterranean region. In this study, 42 ticks collected from humans were subjected to morphological identification and molecular characterization of Rickettsia species potentially involved in human rickettsiosis in Sicily. Fourteen ticks positive to at least two Rickettsia spp. molecular markers were used in the study. Identified Rickettsia spp. included R. conorii, found in Rhipicephalus sanguineus sensu lato and Rhipicephalus turanicus, Rickettsia aeschlimannii found in Hyalomma marginatum, Hyalomma lusitanicum, Dermacentor marginatus and Ixodes ricinus, Rickettsia massiliae found in R. turanicus and R. sanguineus s.l., and Rickettsia slovaca found in D. marginatus and R. sanguineus s.l. Our results showed a great variety of zoonotic Rickettsia spp. in ticks collected from humans in Sicily. The Rickettsia spp. reported in this study were identified in previously recognized or new potential tick vectors in Europe, highlighting the risk of infection by different Rickettsia spp. for humans bitten by ticks in Sicily. Copyright © 2017 The Authors. Published by Elsevier GmbH.. All rights reserved.

  2. Setting health research priorities using the CHNRI method: V. Quantitative properties of human collective knowledge.

    Science.gov (United States)

    Rudan, Igor; Yoshida, Sachiyo; Wazny, Kerri; Chan, Kit Yee; Cousens, Simon

    2016-06-01

    The CHNRI method for setting health research priorities has crowdsourcing as the major component. It uses the collective opinion of a group of experts to generate, assess and prioritize between many competing health research ideas. It is difficult to compare the accuracy of human individual and collective opinions in predicting uncertain future outcomes before the outcomes are known. However, this limitation does not apply to existing knowledge, which is an important component underlying opinion. In this paper, we report several experiments to explore the quantitative properties of human collective knowledge and discuss their relevance to the CHNRI method. We conducted a series of experiments in groups of about 160 (range: 122-175) undergraduate Year 2 medical students to compare their collective knowledge to their individual knowledge. We asked them to answer 10 questions on each of the following: (i) an area in which they have a degree of expertise (undergraduate Year 1 medical curriculum); (ii) an area in which they likely have some knowledge (general knowledge); and (iii) an area in which they are not expected to have any knowledge (astronomy). We also presented them with 20 pairs of well-known celebrities and asked them to identify the older person of the pair. In all these experiments our goal was to examine how the collective answer compares to the distribution of students' individual answers. When answering the questions in their own area of expertise, the collective answer (the median) was in the top 20.83% of the most accurate individual responses; in general knowledge, it was in the top 11.93%; and in an area with no expertise, the group answer was in the top 7.02%. However, the collective answer based on mean values fared much worse, ranging from top 75.60% to top 95.91%. Also, when confronted with guessing the older of the two celebrities, the collective response was correct in 18/20 cases (90%), while the 8 most successful individuals among the

  3. AcEST: DK948090 [AcEST

    Lifescience Database Archive (English)

    Full Text Available erase A OS=Aspergillus tubingen... 50 1e-05 sp|P0C1S9|DGLB_RAT Sn1-specific diacy...|P47145|YJ77_YEAST Putative lipase YJR107W OS=Saccharomyces ce... 50 8e-06 sp|O42815|FAEA_ASPTU Feruloyl est

  4. Human rights abuses and collective resilience among sex workers in four African countries: a qualitative study.

    Science.gov (United States)

    Scorgie, Fiona; Vasey, Katie; Harper, Eric; Richter, Marlise; Nare, Prince; Maseko, Sian; Chersich, Matthew F

    2013-07-26

    Sex work is a criminal offence, virtually throughout Africa. This criminalisation and the intense stigma attached to the profession shapes interactions between sex workers and their clients, family, fellow community members, and societal structures such as the police and social services. We explore the impact of violence and related human rights abuses on the lives of sex workers, and how they have responded to these conditions, as individuals and within small collectives. These analyses are based on data from 55 in-depth interviews and 12 focus group discussions with female, male and transgender sex workers in Kenya, South Africa, Uganda and Zimbabwe. Data were collected by sex worker outreach workers trained to conduct qualitative research among their peers. In describing their experiences of unlawful arrests and detention, violence, extortion, vilification and exclusions, participants present a picture of profound exploitation and repeated human rights violations. This situation has had an extreme impact on the physical, mental and social wellbeing of this population. Overall, the article details the multiple effects of sex work criminalisation on the everyday lives of sex workers and on their social interactions and relationships. Underlying their stories, however, are narratives of resilience and resistance. Sex workers in our study draw on their own individual survival strategies and informal forms of support and very occasionally opt to seek recourse through formal channels. They generally recognize the benefits of unified actions in assisting them to counter risks in their environment and mobilise against human rights violations, but note how the fluctuant and stigmatised nature of their profession often undermines collective action. While criminal laws urgently need reform, supporting sex work self-organisation and community-building are key interim strategies for safeguarding sex workers' human rights and improving health outcomes in these communities. If

  5. Blood groups and human groups: collecting and calibrating genetic data after World War Two.

    Science.gov (United States)

    Bangham, Jenny

    2014-09-01

    Arthur Mourant's The Distribution of the Human Blood Groups (1954) was an "indispensable" reference book on the "anthropology of blood groups" containing a vast collection of human genetic data. It was based on the results of blood-grouping tests carried out on half-a-million people and drew together studies on diverse populations around the world: from rural communities, to religious exiles, to volunteer transfusion donors. This paper pieces together sequential stages in the production of a small fraction of the blood-group data in Mourant's book, to examine how he and his colleagues made genetic data from people. Using sources from several collecting projects, I follow how blood was encountered, how it was inscribed, and how it was turned into a laboratory resource. I trace Mourant's analytical and representational strategies to make blood groups both credibly 'genetic' and understood as relevant to human ancestry, race and history. In this story, 'populations' were not simply given, but were produced through public health, colonial and post-colonial institutions, and by the labour and expertise of subjects, assistants and mediators. Genetic data were not self-evidently 'biological', but were shaped by existing historical and geographical identities, by political relationships, and by notions of kinship and belonging. Copyright © 2014 The Author. Published by Elsevier Ltd.. All rights reserved.

  6. Collecting Protein Biomarkers in Breath Using Electret Filters: A Preliminary Method on New Technical Model and Human Study.

    Directory of Open Access Journals (Sweden)

    Wang Li

    Full Text Available Biomarkers in exhaled breath are useful for respiratory disease diagnosis in human volunteers. Conventional methods that collect non-volatile biomarkers, however, necessitate an extensive dilution and sanitation processes that lowers collection efficiencies and convenience of use. Electret filter emerged in recent decade to collect virus biomarkers in exhaled breath given its simplicity and effectiveness. To investigate the capability of electret filters to collect protein biomarkers, a model that consists of an atomizer that produces protein aerosol and an electret filter that collects albumin and carcinoembryonic antigen-a typical biomarker in lung cancer development- from the atomizer is developed. A device using electret filter as the collecting medium is designed to collect human albumin from exhaled breath of 6 volunteers. Comparison of the collecting ability between the electret filter method and other 2 reported methods is finally performed based on the amounts of albumin collected from human exhaled breath. In conclusion, a decreasing collection efficiency ranging from 17.6% to 2.3% for atomized albumin aerosol and 42% to 12.5% for atomized carcinoembryonic antigen particles is found; moreover, an optimum volume of sampling human exhaled breath ranging from 100 L to 200 L is also observed; finally, the self-designed collecting device shows a significantly better performance in collecting albumin from human exhaled breath than the exhaled breath condensate method (p0.05. In summary, electret filters are potential in collecting non-volatile biomarkers in human exhaled breath not only because it was simpler, cheaper and easier to use than traditional methods but also for its better collecting performance.

  7. Detection of human bacterial pathogens in ticks collected from Louisiana black bears (Ursus americanus luteolus).

    Science.gov (United States)

    Leydet, Brian F; Liang, Fang-Ting

    2013-04-01

    There are 4 major human-biting tick species in the northeastern United States, which include: Amblyomma americanum, Amblyomma maculatum, Dermacentor variabilis, and Ixodes scapularis. The black bear is a large mammal that has been shown to be parasitized by all the aforementioned ticks. We investigated the bacterial infections in ticks collected from Louisiana black bears (Ursus americanus subspecies luteolus). Eighty-six ticks were collected from 17 black bears in Louisiana from June 2010 to March 2011. All 4 common human-biting tick species were represented. Each tick was subjected to polymerase chain reaction (PCR) targeting select bacterial pathogens and symbionts. Bacterial DNA was detected in 62% of ticks (n=53). Rickettsia parkeri, the causative agent of an emerging spotted fever group rickettsiosis, was identified in 66% of A. maculatum, 28% of D. variabilis, and 11% of I. scapularis. The Lyme disease bacterium, Borrelia burgdorferi, was detected in 2 I. scapularis, while one A. americanum was positive for Borrelia bissettii, a putative human pathogen. The rickettsial endosymbionts Candidatus Rickettsia andeanae, rickettsial endosymbiont of I. scapularis, and Rickettsia amblyommii were detected in their common tick hosts at 21%, 39%, and 60%, respectively. All ticks were PCR-negative for Anaplasma phagocytophilum, Ehrlichia spp., and Babesia microti. This is the first reported detection of R. parkeri in vector ticks in Louisiana; we also report the novel association of R. parkeri with I. scapularis. Detection of both R. parkeri and B. burgdorferi in their respective vectors in Louisiana demands further investigation to determine potential for human exposure to these pathogens. Copyright © 2013 Elsevier GmbH. All rights reserved.

  8. AcEST: DK947950 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 10071|GLI3_HUMAN Zinc finger protein GLI3 OS=Homo sapiens GN... 31 4.9 sp|Q8WXX7|AUTS2_HUMAN Autism suscepti...FSPPHPYINPYMDYIRSLHSSPSLSMI 216 >sp|Q8WXX7|AUTS2_HUMAN Autism susceptibility gene 2 protein OS=Homo sapiens

  9. AcEST: BP911533 [AcEST

    Lifescience Database Archive (English)

    Full Text Available HUMAN cDNA FLJ35079 fis, clone PLACE6005283, hi... 33 7.1 tr|Q7ZZ40|Q7ZZ40_DANRE Novel protein similar to human autism...6 +P+V VS Sbjct: 191 VPKSPSVDKYNVS 203 >tr|Q7ZZ40|Q7ZZ40_DANRE Novel protein similar to human autism-related

  10. School version of ESTE EU

    International Nuclear Information System (INIS)

    Carny, P.; Suchon, D.; Chyly, M.; Smejkalova, E.; Fabova, V.

    2008-01-01

    ESTE EU is information system and software for radiological impacts assessment to the territory of the country in case of radiation accident inside/outside of the country .The program enables to model dispersion of radioactive clouds in small-scale and meso-scale. The system enables the user to estimate prediction of the source term (release to the atmosphere ) for any point of radiation/nuclear accident in Europe (for any point of the release, but especially for the sites of European power reactors ). The system enables to utilize results of real radiological monitoring in the process of source term estimation. Radiological impacts of release to the atmosphere are modelled and calculated across the Europe and displayed in the geographical information system (GIS). The school version of ESTE EU is intended for students of the universities which are interested in or could work in the field of emergency response, radiological and nuclear accidents, dispersion modelling, radiological impacts calculation and urgent or preventive protective measures implementation. The school version of ESTE EU is planned to be donated to specialized departments of faculties in Slovakia, Czech Republic, etc. System can be fully operated in Slovak, Czech or English language. (authors)

  11. School version of ESTE EU

    International Nuclear Information System (INIS)

    Carny, P.; Suchon, D.; Chyly, M.; Smejkalova, E.; Fabova, V.

    2009-01-01

    ESTE EU is information system and software for radiological impacts assessment to the territory of the country in case of radiation accident inside/outside of the country .The program enables to model dispersion of radioactive clouds in small-scale and meso-scale. The system enables the user to estimate prediction of the source term (release to the atmosphere ) for any point of radiation/nuclear accident in Europe (for any point of the release, but especially for the sites of European power reactors ). The system enables to utilize results of real radiological monitoring in the process of source term estimation. Radiological impacts of release to the atmosphere are modelled and calculated across the Europe and displayed in the geographical information system (GIS). The school version of ESTE EU is intended for students of the universities which are interested in or could work in the field of emergency response, radiological and nuclear accidents, dispersion modelling, radiological impacts calculation and urgent or preventive protective measures implementation. The school version of ESTE EU is planned to be donated to specialized departments of faculties in Slovakia, Czech Republic, etc. System can be fully operated in Slovak, Czech or English language. (authors)

  12. 77 FR 25533 - Agency Requests for Approval of a New Information Collection(s): Human Subjects Experiments...

    Science.gov (United States)

    2012-04-30

    ... collection involves recruitment of participants, balancing the subject sample and debriefing questionnaires...Rulemaking Portal: http://www.regulations.gov . Follow the online instructions for submitting comments. Fax... information consists of: (1) Recruitment material and a brief eligibility questionnaire for applicants and (2...

  13. AcEST: BP912503 [AcEST

    Lifescience Database Archive (English)

    Full Text Available n sp|Q96JI7|SPTCS_HUMAN Spatacsin OS=Homo sapiens Align length 47 Score (bit) 32.....................done Score E Sequences producing significant alignments: (bits) Value sp|Q96JI7|SPTCS_HUMAN Spatacsi...e transporter-like protein 3 OS=Bos t... 30 6.4 >sp|Q96JI7|SPTCS_HUMAN Spatacsin OS=Homo sapiens GN=SPG11 PE

  14. AcEST: BP921832 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 3975|SC6A2_HUMAN Sodium-dependent noradrenaline transporter OS=Homo sapiens Align...lue sp|P23975|SC6A2_HUMAN Sodium-dependent noradrenaline transporter... 31 2.1 sp...|Q6DEL1|S38A7_DANRE Putative sodium-coupled neutral amino acid... 30 4.7 >sp|P23975|SC6A2_HUMAN Sodium-dependent noradrenaline

  15. AcEST: DK944136 [AcEST

    Lifescience Database Archive (English)

    Full Text Available |P26015|VS06_ROTGA VP6 protein OS=Rotavirus B (isolate Human/China/ADRV/1982) Align length 37 Score (bit) 31...bits) Value sp|P26015|VS06_ROTGA VP6 protein OS=Rotavirus B (isolate Human/C... 31 2.5 sp|Q69BK3|UCRI_PONPY ...avirus B (isolate Human/China/ADRV/1982) GN=S5 PE=4 SV=1 Length = 391 Score = 31.2 ...|UCRIL_HUMAN Cytochrome b-c1 complex subunit Rieske-lik... 29 9.4 >sp|P26015|VS06_ROTGA VP6 protein OS=Rot

  16. Human Development IX: A Model of the Wholeness of Man, His Consciousness, and Collective Consciousness

    Directory of Open Access Journals (Sweden)

    Søren Ventegodt

    2006-01-01

    Full Text Available In this paper we look at the rational and the emotional interpretation of reality in the human brain and being, and discuss the representation of the brain-mind (ego, the body-mind (Id, and the outer world in the human wholeness (the I or “soul”. Based on this we discuss a number of factors including the coherence between perception, attention and consciousness, and the relation between thought, fantasies, visions and dreams. We discuss and explain concepts as intent, will, morals and ethics. The Jungian concept of the human collective conscious and unconscious is also analyzed. We also hypothesis on the nature of intuition and consider the source of religious experience of man. These phenomena are explained based on the concept of deep quantum chemistry and infinite dancing fractal spirals making up the energetic backbone of the world. In this paper we consider man as a real wholeness and debate the concepts of subjectivity, consciousness and intent that can be deduced from such a perspective.

  17. Classifying Human Activity Patterns from Smartphone Collected GPS data: a Fuzzy Classification and Aggregation Approach.

    Science.gov (United States)

    Wan, Neng; Lin, Ge

    2016-12-01

    Smartphones have emerged as a promising type of equipment for monitoring human activities in environmental health studies. However, degraded location accuracy and inconsistency of smartphone-measured GPS data have limited its effectiveness for classifying human activity patterns. This study proposes a fuzzy classification scheme for differentiating human activity patterns from smartphone-collected GPS data. Specifically, a fuzzy logic reasoning was adopted to overcome the influence of location uncertainty by estimating the probability of different activity types for single GPS points. Based on that approach, a segment aggregation method was developed to infer activity patterns, while adjusting for uncertainties of point attributes. Validations of the proposed methods were carried out based on a convenient sample of three subjects with different types of smartphones. The results indicate desirable accuracy (e.g., up to 96% in activity identification) with use of this method. Two examples were provided in the appendix to illustrate how the proposed methods could be applied in environmental health studies. Researchers could tailor this scheme to fit a variety of research topics.

  18. AcEST: DK948707 [AcEST

    Lifescience Database Archive (English)

    Full Text Available GN=Syn1 PE=1 SV=2 31 5.2 sp|Q8WXX7|AUTS2_HUMAN Autism susceptibility gene 2 protein OS=Ho... 31 6.7 sp|Q9UZW...ASQAGPGPRTGPPTT-QQPRPSGPGPAGRPAKPQLAQKPSQDVPPPIT 650 Query: 533 SLWG 544 + G Sbjct: 651 AAAG 654 >sp|Q8WXX7|AUTS2_HUMAN Autism

  19. AcEST: DK961757 [AcEST

    Lifescience Database Archive (English)

    Full Text Available otein FLJ22184 ... 37 0.095 sp|Q01205|ODO2_RAT Dihydrolipoyllysine-residue succinyltransfera... 33 1.4 sp|Q8WXX7|AUTS2_HUMAN Autism...202 >sp|Q8WXX7|AUTS2_HUMAN Autism susceptibility gene 2 protein OS=Homo sapiens GN=AUTS2 PE=2 SV=1 Length =

  20. AcEST: BP917834 [AcEST

    Lifescience Database Archive (English)

    Full Text Available ntrin-specific protease 7 OS=Mus musculu... 31 2.2 sp|P32537|POLG_HE701 Genome polyprotein OS=Human enterovirus...7 GQEPDASAASGRASSPNKSLESSASSEVSENSSV 400 >sp|P32537|POLG_HE701 Genome polyprotein OS=Human enterovirus

  1. AcEST: DK962755 [AcEST

    Lifescience Database Archive (English)

    Full Text Available OS=Xenopus trop... 31 3.4 sp|Q66479|POLG_HE71M Genome polyprotein OS=Human enterovirus...|PUC1_SCHPO Cyclin puc1 OS=Schizosaccharomyces pombe GN... 30 7.7 sp|Q66478|POLG_HE71B Genome polyprotein OS=Human enterovirus

  2. AcEST: BP916412 [AcEST

    Lifescience Database Archive (English)

    Full Text Available sociated protein, putative OS=... 33 5.5 tr|Q7ZZ40|Q7ZZ40_DANRE Novel protein similar to human autism...427 R + GK++G Sbjct: 116 DRRDLEGKVEG 126 >tr|Q7ZZ40|Q7ZZ40_DANRE Novel protein similar to human autism-relat

  3. AcEST: DK947278 [AcEST

    Lifescience Database Archive (English)

    Full Text Available HUMAN Zinc finger protein 40 OS=Homo sapiens GN=H... 29 8.2 sp|P32550|VGLG_RABVT Glycoprotein G OS=Rabies vi...>sp|P32550|VGLG_RABVT Glycoprotein G OS=Rabies virus (isolate Human/Algeria/1991) GN=G PE=1 SV=1 Length = 52

  4. AcEST: BP911627 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 1-like protein OS=Bos taurus GN=TRM1L P... 30 5.0 sp|Q9Y2K6|UBP20_HUMAN Ubiquitin carboxyl-terminal hydrolas...HVRRHVNKGETKSRYIAASAAKPPKE 233 >sp|Q9Y2K6|UBP20_HUMAN Ubiquitin carboxyl-terminal hydrolase 20 OS=Homo sapie

  5. AcEST: DK952682 [AcEST

    Lifescience Database Archive (English)

    Full Text Available T_CAEEL Xylosyltransferase sqv-6 OS=Caenorhabditis ... 31 3.4 sp|Q9Y2K3|MYH15_HUMAN Myosin-15 OS=Homo sapien...t: 295 WGGASLLQ 302 >sp|Q9Y2K3|MYH15_HUMAN Myosin-15 OS=Homo sapiens GN=MYH15 PE=

  6. AcEST: BP921466 [AcEST

    Lifescience Database Archive (English)

    Full Text Available OS=Hepatitis E virus genotype 1 (isolate Human/Myanmar/HEVNE8L) Align length 19 Score (bit) 31.6 E-value 2....polyprotein pORF1 OS=Hepatitis E virus genotype 1 (isolate Human/Myanmar/HEVNE8L) GN=ORF1 PE=1 SV=1 Length =

  7. AcEST: DK956292 [AcEST

    Lifescience Database Archive (English)

    Full Text Available -diphosphooligosaccharide--protein ... 30 7.5 sp|Q9NRI5|DISC1_HUMAN Disrupted in schizophrenia 1 protein OS=...KSMSYYSNLSSSNIKK 684 >sp|Q9NRI5|DISC1_HUMAN Disrupted in schizophrenia 1 protein

  8. Carbon dioxide baited trap catches do not correlate with human landing collections of Anopheles aquasalis in Suriname

    NARCIS (Netherlands)

    Hiwat-van Laar, H.; Andriessen, R.; Rijk, de M.; Koenraadt, C.J.M.; Takken, W.

    2011-01-01

    Three types of carbon dioxide-baited traps, i.e., the Centers for Disease Control Miniature Light Trap without light, the BioGents (BG) Sentinel Mosquito Trap (BG-Sentinel) and the Mosquito Magnet® Liberty Plus were compared with human landing collections in their efficiency in collecting Anopheles

  9. AcEST: BP920221 [AcEST

    Lifescience Database Archive (English)

    Full Text Available nition sp|Q9Y4A5|TRRAP_HUMAN Transformation/transcription domain-associated protein OS=Homo sapiens Align le...ficant alignments: (bits) Value sp|Q9Y4A5|TRRAP_HUMAN Transformation/transcription domain-associ... 42 5e-05..... 29 6.3 sp|Q91820|STK6_XENLA Serine/threonine-protein kinase 6 OS=Xenopu... 29 8.2 >sp|Q9Y4A5|TRRAP_HUMAN Transformation

  10. AcEST: BP914318 [AcEST

    Lifescience Database Archive (English)

    Full Text Available Definition sp|Q9Y4A5|TRRAP_HUMAN Transformation/transcription domain-associated protein OS=Homo sapiens Alig... significant alignments: (bits) Value sp|Q9Y4A5|TRRAP_HUMAN Transformation/transcription domain-associ... 11...ormation/transcription domain-associated protein OS=Homo sapiens GN=TRRAP PE=1 SV=3...lase mnmA OS=Campy... 30 9.0 sp|Q9U720|DCSA_DICDI Cellulose synthase catalytic subunit A [UDP... 30 9.0 >sp|Q9Y4A5|TRRAP_HUMAN Transf

  11. AcEST: DK943548 [AcEST

    Lifescience Database Archive (English)

    Full Text Available astX Result : Swiss-Prot sp_hit_id Q9Y2K1 Definition sp|Q9Y2K1|ZBTB1_HUMAN Zinc finger and BTB domain-contai......done Score E Sequences producing significant alignments: (bits) Value sp|Q9Y2K1|ZBTB1_HUMAN Zinc finger a...6.3 sp|Q9DDT5|SPT5H_DANRE Transcription elongation factor SPT5 OS=Da... 29 8.2 >sp|Q9Y2K1|ZBTB1_HUMAN Zinc f

  12. AcEST: BP911764 [AcEST

    Lifescience Database Archive (English)

    Full Text Available SESSSSCSSIHSMDTNSSGMSSLIN 609 Query: 275 NLSNPVASN 301 LS+P + N Sbjct: 610 PLSSPPSCN 618 >sp|Q4G0P3|HYDIN_HUMAN Hydrocephalus...erase OS=Pseudom... 30 6.1 sp|Q9NZL6|RGL1_HUMAN Ral guanine nucleotide dissociation stimula... 30 8.0 sp|Q4G0P3|HYDIN_HUMAN Hydroceph...alus-inducing protein homolog OS=... 30 8.0 >sp|P36495|YCF78_CHLRE Uncharacterized

  13. Trimming and clustering sugarcane ESTs

    Directory of Open Access Journals (Sweden)

    Guilherme P. Telles

    2001-12-01

    Full Text Available The original clustering procedure adopted in the Sugarcane Expressed Sequence Tag project (SUCEST had many problems, for instance too many clusters, the presence of ribosomal sequences, etc. We therefore redesigned the clustering procedure entirely, including a much more careful initial trimming of the reads. In this paper the new trimming and clustering strategies are described in detail and we give the new official figures for the project, 237,954 expressed sequence tags and 43,141 clusters.O método de clustering adotado no Projeto SUCEST (Sugarcane EST Project tinha vários problemas (muitos clusters, presença de seqüências de ribossomo etc. Nós assumimos a tarefa de reprojetar todo o processo de clustering, propondo uma "limpeza" inicial mais cuidadosa das seqüências. Neste artigo as estratégias de limpeza das seqüências e de clustering são descritas em detalhe, incluindo os números oficiais do projeto (237,954 ESTs e 43,141 clusters.

  14. AcEST: BP914375 [AcEST

    Lifescience Database Archive (English)

    Full Text Available Result : Swiss-Prot sp_hit_id P32926 Definition sp|P32926|DSG3_HUMAN Desmoglein-...nt alignments: (bits) Value sp|P32926|DSG3_HUMAN Desmoglein-3 OS=Homo sapiens GN=....3 >sp|P32926|DSG3_HUMAN Desmoglein-3 OS=Homo sapiens GN=DSG3 PE=1 SV=1 Length = ...d A8K2V2 Definition tr|A8K2V2|A8K2V2_HUMAN cDNA FLJ75630, highly similar to Homo sapiens desmoglein 3 (pemph... similar to Homo sapiens desmoglein 3 (pemphigus vulgaris antigen) (DSG3), mRNA O

  15. Saudi anti-human cancer plants database (SACPD): A collection of plants with anti-human cancer activities.

    Science.gov (United States)

    Al-Zahrani, Ateeq Ahmed

    2018-01-30

    Several anticancer drugs have been developed from natural products such as plants. Successful experiments in inhibiting the growth of human cancer cell lines using Saudi plants were published over the last three decades. Up to date, there is no Saudi anticancer plants database as a comprehensive source for the interesting data generated from these experiments. Therefore, there was a need for creating a database to collect, organize, search and retrieve such data. As a result, the current paper describes the generation of the Saudi anti-human cancer plants database (SACPD). The database contains most of the reported information about the naturally growing Saudi anticancer plants. SACPD comprises the scientific and local names of 91 plant species that grow naturally in Saudi Arabia. These species belong to 38 different taxonomic families. In Addition, 18 species that represent16 family of medicinal plants and are intensively sold in the local markets in Saudi Arabia were added to the database. The website provides interesting details, including plant part containing the anticancer bioactive compounds, plants locations and cancer/cell type against which they exhibit their anticancer activity. Our survey revealed that breast, liver and leukemia were the most studied cancer cell lines in Saudi Arabia with percentages of 27%, 19% and 15%, respectively. The current SACPD represents a nucleus around which more development efforts can expand to accommodate all future submissions about new Saudi plant species with anticancer activities. SACPD will provide an excellent starting point for researchers and pharmaceutical companies who are interested in developing new anticancer drugs. SACPD is available online at https://teeqrani1.wixsite.com/sapd.

  16. 78 FR 13688 - Proposed Collection; 60-Day Comment Request: Request for Human Embryonic Stem Cell Line To Be...

    Science.gov (United States)

    2013-02-28

    ... Comment Request: Request for Human Embryonic Stem Cell Line To Be Approved for Use in NIH Funded Research... Embryonic Stem Cell Line to be Approved for Use in NIH Funded Research. OMB No. 0925-0601-- Expiration Date... and Use of Information Collection: The form is used by applicants to request that human embryonic stem...

  17. AcEST: DK955250 [AcEST

    Lifescience Database Archive (English)

    Full Text Available S=Myxococcus xan... 31 5.1 sp|Q5QXV0|RL17_IDILO 50S ribosomal protein L17 OS=Idiomarina loi... 31 5.1 sp|Q8WXX7|AUTS2_HUMAN Autism...APMAYIELVGRP 119 >sp|Q8WXX7|AUTS2_HUMAN Autism susceptibility gene 2 protein OS=Homo sapiens GN=AUTS2 PE=2 S

  18. AcEST: BP920123 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 1.3 sp|Q9NRI5|DISC1_HUMAN Disrupted in schizophrenia 1 protein OS=Ho... 30 2.9 sp|Q8BMI0|FBX38_MOUSE F-box o... PL*LPVHSL 238 L LPV SL Sbjct: 86 VLKLPVRSL 94 >sp|Q9NRI5|DISC1_HUMAN Disrupted in schizophrenia 1 protein O

  19. AcEST: DK962463 [AcEST

    Lifescience Database Archive (English)

    Full Text Available =Mus musc... 31 5.6 sp|Q9Y2K5|R3HD2_HUMAN R3H domain-containing protein 2 OS=Homo sa... 31 5.6 >sp|A0JNC2|R3...HSSCCNICCKKLCPLPHISAC 347 P+ SSCC CC+ C + S C Sbjct: 423 PQSQSSCCGACCESWCEIFRYSCC 446 >sp|Q9Y2K5|R3HD2_HUMAN

  20. AcEST: DK948527 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 31 4.5 sp|Q4G0P3|HYDIN_HUMAN Hydrocephalus-inducing protein homolog OS=... 31 4.5 sp|P61561|ENW1_GORGO ERV-W...86 YLQDSITSLTVS*VSGD 236 + T L VS + GD Sbjct: 215 FAMHGATILAVSHLGGD 231 >sp|Q4G0P3|HYDIN_HUMAN Hydrocephal...us-inducing protein homolog OS=Homo sapiens GN=HYDIN PE=1 SV=2 Length = 5120 Score

  1. AcEST: DK951349 [AcEST

    Lifescience Database Archive (English)

    Full Text Available Forkhead box protein J3 OS=Mus musculus GN... 33 1.5 sp|Q9UIG4|PS1C2_HUMAN Psoriasis...se kinase kin... 32 2.6 sp|Q7YR45|PS1C2_PANTR Psoriasis susceptibility 1 candidat...PQQHSQLQPPHSQHPPPHQH 424 >sp|Q9UIG4|PS1C2_HUMAN Psoriasis susceptibility 1 candidate gene 2 protein OS=Homo

  2. AcEST: DK945557 [AcEST

    Lifescience Database Archive (English)

    Full Text Available S=Mus mus... 32 0.77 sp|Q7YR45|PS1C2_PANTR Psoriasis susceptibility 1 candidate g...ene ... 32 0.77 sp|Q9Y6Y8|S23IP_HUMAN SEC23-interacting protein OS=Homo sapiens ... 32 1.3 sp|Q9UIG4|PS1C2_HUMAN Psoriasis

  3. AcEST: BP918479 [AcEST

    Lifescience Database Archive (English)

    Full Text Available eracting protein-like protein (F... 75 3e-12 tr|Q2TU77|Q2TU77_HUMAN Aging-associated protein 2 OS=Homo sapie...n... 75 3e-12 tr|Q1XBU6|Q1XBU6_HUMAN Aging-associated protein 14b OS=Homo sapi... 75 3e-12 tr|B7ZA40|B7ZA40_

  4. Can human-like Bots control collective mood: agent-based simulations of online chats

    International Nuclear Information System (INIS)

    Tadić, Bosiljka; Šuvakov, Milovan

    2013-01-01

    Using an agent-based modeling approach, in this paper, we study self-organized dynamics of interacting agents in the presence of chat Bots. Different Bots with tunable ‘human-like’ attributes, which exchange emotional messages with agents, are considered, and the collective emotional behavior of agents is quantitatively analyzed. In particular, using detrended fractal analysis we determine persistent fluctuations and temporal correlations in time series of agent activity and statistics of avalanches carrying emotional messages of agents when Bots favoring positive/negative affects are active. We determine the impact of Bots and identify parameters that can modulate that impact. Our analysis suggests that, by these measures, the emotional Bots induce collective emotion among interacting agents by suitably altering the fractal characteristics of the underlying stochastic process. Positive emotion Bots are slightly more effective than negative emotion Bots. Moreover, Bots which periodically alternate between positive and negative emotion can enhance fluctuations in the system, leading to avalanches of agent messages that are reminiscent of self-organized critical states. (paper)

  5. Can human-like Bots control collective mood: agent-based simulations of online chats

    Science.gov (United States)

    Tadić, Bosiljka; Šuvakov, Milovan

    2013-10-01

    Using an agent-based modeling approach, in this paper, we study self-organized dynamics of interacting agents in the presence of chat Bots. Different Bots with tunable ‘human-like’ attributes, which exchange emotional messages with agents, are considered, and the collective emotional behavior of agents is quantitatively analyzed. In particular, using detrended fractal analysis we determine persistent fluctuations and temporal correlations in time series of agent activity and statistics of avalanches carrying emotional messages of agents when Bots favoring positive/negative affects are active. We determine the impact of Bots and identify parameters that can modulate that impact. Our analysis suggests that, by these measures, the emotional Bots induce collective emotion among interacting agents by suitably altering the fractal characteristics of the underlying stochastic process. Positive emotion Bots are slightly more effective than negative emotion Bots. Moreover, Bots which periodically alternate between positive and negative emotion can enhance fluctuations in the system, leading to avalanches of agent messages that are reminiscent of self-organized critical states.

  6. Collective Hunger in the Vision of Amartya Sen as One of the Impeditive Factors of Sustainable Human Development

    Directory of Open Access Journals (Sweden)

    Eduardo Torres Roberti

    2016-12-01

    Full Text Available The study aims at collective hunger in the vision of Amartya Sen as one of the impeding factors of Sustainable Human Development. In the economist's view, collective hunger goes beyond chronic hunger, involves a sudden outbreak of deprivation for a portion of the population. To eliminate hunger in the modern world, it is crucial to understand the cause of collective hunger in a broad way, and not just because of some mechanical imbalance between food and population. By illustrating the deprivation of liberty, child labor is included as one of the impediments to sustainable human development.

  7. Sympatric Distribution of Three Human Taenia Tapeworms Collected between 1935 and 2005 in Korea

    Science.gov (United States)

    Jeon, Hyeong-Kyu; Kim, Kyu-Heon; Chai, Jong-Yil; Yang, Hyun-Jong; Rim, Han-Jong

    2008-01-01

    Taeniasis has been known as one of the prevalent parasitic infections in Korea. Until recently, Taenia saginata had long been considered a dominant, and widely distributed species but epidemiological profiles of human Taenia species in Korea still remain unclear. In order to better understand distribution patterns of human Taenia tapeworms in Korea, partial nucleotide sequences of mitochondrial cox1 and ITS2 (internal transcribed spacer 2) were determined, along with morphological examinations, on 68 Taenia specimens obtained from university museum collections deposited since 1935. Genomic DNA was extracted from formalin-preserved specimens. Phylogenetic relationships among the genotypes (cox1 haplotype) detected in this study were inferred using the neighbor-joining method as a tree building method. Morphological and genetic analyses identified 3 specimens as T. solium, 51 specimens as T. asiatica, and 14 specimens as T. saginata. Our results indicate that all 3 Taenia tapeworms are sympatrically distributed in Korea with T. asiatica dominating over T. saginata and T. solium. PMID:19127329

  8. AcEST: BP913708 [AcEST

    Lifescience Database Archive (English)

    Full Text Available ial protein cyt-4 OS=Neurospora c... 32 1.3 sp|P23975|SC6A2_HUMAN Sodium-dependent nora...drenaline transporter... 30 4.9 sp|O55192|SC6A2_MOUSE Sodium-dependent noradrenaline transporter... 29...+ Sbjct: 237 LLLCLMVVVIVLYFSLWKGVKTSGKVVWITATLPYFV 273 >sp|O55192|SC6A2_MOUSE Sodium-dependent nora...RERHA-------KTLANI 982 Query: 183 N--NKALFQALV 212 + N+ + QALV Sbjct: 983 DGRNELILQALV 994 >sp|P23975|SC6A2_...HUMAN Sodium-dependent noradrenaline transporter OS=Homo sapiens GN=SLC6A2 PE=1 S

  9. AcEST: BP920479 [AcEST

    Lifescience Database Archive (English)

    Full Text Available .. 30 5.3 sp|P38996|NAB3_YEAST Nuclear polyadenylated RNA-binding protein ... 30 5.4 sp|Q80YV3|TRRAP_MOUSE Transformation.../transcription domain-associ... 30 7.0 sp|Q9Y4A5|TRRAP_HUMAN Transformation...SAPPMSHQPPPPQQQQQQQQQQ 778 >sp|Q80YV3|TRRAP_MOUSE Transformation/transcription domain-associated protein OS=...PIQWLAWIPQL 1926 >sp|Q9Y4A5|TRRAP_HUMAN Transformation/transcription domain-assoc

  10. AcEST: BP916642 [AcEST

    Lifescience Database Archive (English)

    Full Text Available ides f... 35 0.20 sp|Q9NRI5|DISC1_HUMAN Disrupted in schizophrenia 1 protein OS=Ho... 34 0.34 sp|O94386|YGS9...EL----QAHADEVEELRRKMAQ-KISEYEEQLEALLNKCSSLEKQKSR 258 Query: 145 L 143 L Sbjct: 259 L 259 >sp|Q9NRI5|DISC1_HUMAN Disrupted in schizoph...renia 1 protein OS=Homo sapiens GN=DISC1 PE=1 SV=3 Length = 854 Score = 34.3 bits (

  11. AcEST: BP913064 [AcEST

    Lifescience Database Archive (English)

    Full Text Available _MOUSE Experimental autoimmune prostatitis antige... 31 5.2 sp|Q9NVV0|TM38B_HUMAN...|Q6QR59|EAPA2_MOUSE Experimental autoimmune prostatitis antigen 2 OS=Mus musculus GN=Eapa2 PE=2 SV=1 Length

  12. AcEST: BP920738 [AcEST

    Lifescience Database Archive (English)

    Full Text Available LNL 2101 Query: 217 PKNRLR 234 PK + R Sbjct: 2102 PKIKSR 2107 >sp|B2C4J1|NCAP_CHAVB Nucleoprotein OS=Chapare virus (isolate Human/Bol...ivia/810419/2003) GN=N PE=3 SV=1 Length = 562 Score = 29

  13. AcEST: DK961875 [AcEST

    Lifescience Database Archive (English)

    Full Text Available bjct: 559 LFKTLDKIMKKDGMLYFKTDHDVYYNDVLELVKTLD 594 >sp|B2C4J3|L_CHAVB RNA-directed RNA polymerase OS=Chapare virus (isolate Human/Bol...ivia/810419/2003) GN=L PE=3 SV=1 Length = 2208 Score = 31.2 bits (69), Expect = 5.2

  14. AcEST: DK950341 [AcEST

    Lifescience Database Archive (English)

    Full Text Available FSCB_MOUSE Fibrous sheath CABYR-binding protein OS=Mus... 33 1.3 sp|Q9DBY1|SYVN1_MOUSE E3 ubiquitin-protein ligase synoviolin... OS=... 33 1.7 sp|Q86TM6|SYVN1_HUMAN E3 ubiquitin-protein ligase synoviolin OS=... 33 1.7 s

  15. AcEST: DK956080 [AcEST

    Lifescience Database Archive (English)

    Full Text Available ABYR-binding protein OS=Mus... 33 0.85 sp|Q9DBY1|SYVN1_MOUSE E3 ubiquitin-protein ligase synoviolin... OS=... 33 1.1 sp|Q86TM6|SYVN1_HUMAN E3 ubiquitin-protein ligase synoviolin OS=... 33 1.1

  16. AcEST: BP914877 [AcEST

    Lifescience Database Archive (English)

    Full Text Available equency clock protein OS=Sordaria fimicola... 30 8.6 >sp|Q9P2D1|CHD7_HUMAN Chromo...ery: 242 LCRKI 256 +C K+ Sbjct: 892 VCMKL 896 >sp|Q09033|FRQ_SORFI Frequency clock protein OS=Sordaria

  17. AcEST: DK948956 [AcEST

    Lifescience Database Archive (English)

    Full Text Available OLN_SFV Non-structural polyprotein OS=Semliki forest ... 32 2.4 sp|Q8NDX5|PHC3_HUMAN Polyhomeotic-like prote...NLPSHLPLPAS 458 >sp|P08411|POLN_SFV Non-structural polyprotein OS=Semliki forest virus PE=1 SV=2 Length = 24

  18. AcEST: BP912479 [AcEST

    Lifescience Database Archive (English)

    Full Text Available |P81282|CSPG2_BOVIN Versican core protein OS=Bos taurus GN=VCA... 35 0.22 sp|Q9Y2K3|MYH15_HUMAN Myosin-15 OS...PSVNQRCLGG 325 + + + E+ KVPSV + G Sbjct: 2452 STTFVSD---RSLEKHPKVPSVEAVTVNG 2477 >sp|Q9Y2K

  19. AcEST: DK954980 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 1|ENC_DROME Protein encore OS=Drosophila melanogaster GN... 53 2e-06 sp|Q9Y2K5|R3...DEVRQSPYLCPLSLDRKA-------KSFEEREEDYDRARSRIFS 573 >sp|Q9Y2K5|R3HD2_HUMAN R3H domain-containing protein 2 OS=H

  20. AcEST: DK950437 [AcEST

    Lifescience Database Archive (English)

    Full Text Available n Hook homolog 1 OS=Mus musculus GN=... 45 4e-04 sp|Q9UJC3|HOOK1_HUMAN Protein Hook homolog 1 OS=Homo sapien... 483 IVELESQVDSLSARVAELNTERMSSQQ 563 I EL+ Q++ ++ EL TE+ S++ Sbjct: 489 IEELQEQLEQKHRKMNELETEQRLSKE 515 >sp|Q9Y2K

  1. AcEST: DK959715 [AcEST

    Lifescience Database Archive (English)

    Full Text Available associated transmembrane protein... 30 7.7 sp|Q9Y2K2|QSK_HUMAN Serine/threonine-protein kinase QSK OS=Homo .... 340 WYL LN+VV L++L+ + DP H S+ + Sbjct: 31 WYLILNAVVLLILLSALADPDHYHFSSSEL 60 >sp|Q9Y2K

  2. AcEST: BP917675 [AcEST

    Lifescience Database Archive (English)

    Full Text Available SD_TASV2 Capsid polyprotein OS=Turkey astrovirus 2 ... 30 4.2 sp|P09001|RM03_HUMAN 39S ribosomal protein L3,...RINELRRLKRKKEYH------NDEYKDDEIYLDNILKG 315 >sp|Q9Q3G5|CAPSD_TASV2 Capsid polyprotein OS=Turkey astrovirus 2

  3. AcEST: DK949530 [AcEST

    Lifescience Database Archive (English)

    Full Text Available L + R+ID G Sbjct: 451 PRTRFGAFARGAKVVLYTKKSGAHLRIIDGG 481 >sp|Q9NQ79|CRAC1_HUMAN Cartilage acidic protein 1 OS=Homo sapiens GN=CRTAC1...ovel protein similar to H.sapiens CRTAC1... 146 1e-33 tr|B6MKC0|B6MKC0_BRAFL Putative uncharacterized protei

  4. AcEST: DK951922 [AcEST

    Lifescience Database Archive (English)

    Full Text Available N=ct... 32 2.4 sp|A0RHW4|CTAA_BACAH Heme A synthase OS=Bacillus thuringiensis (... 32 2.4 sp|Q00682|VS10_ROTHC Protein NS26 OS=Rotavi...rus C (isolate Human/... 31 3.2 sp|Q64298|MCSP_RAT Sperm mitochondrial-associated c

  5. AcEST: BP917499 [AcEST

    Lifescience Database Archive (English)

    Full Text Available NI_CHLNI Troponin I OS=Chlamys nipponensis akazara Align length 90 Score (bit) 30...Troponin I OS=Chlamys nipponensis akazara P... 31 2.2 sp|Q13127|REST_HUMAN RE1-si...NNI_CHLNI Troponin I OS=Chlamys nipponensis akazara PE=1 SV=2 Length = 292 Score = 30.8 bits (68), Expect =

  6. AcEST: DK960773 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 0.026 tr|Q8K1K8|Q8K1K8_MOUSE Budding uninhibited by benzimidazoles 1 h... 37 0.046 tr|A2APR8|A2APR8_MOUSE Budding uninhibited by benz...VLYAD 116 >tr|Q53QE4|Q53QE4_HUMAN Putative uncharacterized protein BUB1 (BUB1 budding uninhibited by benzimidazoles...QGELQHASAVLQRGIQNQA 130 >tr|A8K5A6|A8K5A6_HUMAN cDNA FLJ76827, highly similar to Homo sapiens BUB1 budding uninhibited by benzimidazo...imidazoles 1 h... 37 0.046 tr|A6RAA5|A6RAA5_AJECN Putati...les 1 homolog (yeast) (BUB1), mRNA OS=Homo sapiens PE=2 SV=1 Length = 1085 Score =

  7. Collection of human reaction times and supporting health related data for analysis of cognitive and physical performance

    Directory of Open Access Journals (Sweden)

    Petr Brůha

    2018-04-01

    Full Text Available Smoking, excessive drinking, overeating and physical inactivity are well-established risk factors decreasing human physical performance. Moreover, epidemiological work has identified modifiable lifestyle factors, such as poor diet and physical and cognitive inactivity that are associated with the risk of reduced cognitive performance. Definition, collection and annotation of human reaction times and suitable health related data and metadata provides researchers with a necessary source for further analysis of human physical and cognitive performance. The collection of human reaction times and supporting health related data was obtained from two groups comprising together 349 people of all ages - the visitors of the Days of Science and Technology 2016 held on the Pilsen central square and members of the Mensa Czech Republic visiting the neuroinformatics lab at the University of West Bohemia. Each provided dataset contains a complete or partial set of data obtained from the following measurements: hands and legs reaction times, color vision, spirometry, electrocardiography, blood pressure, blood glucose, body proportions and flexibility. It also provides a sufficient set of metadata (age, gender and summary of the participant's current life style and health to allow researchers to perform further analysis. This article has two main aims. The first aim is to provide a well annotated collection of human reaction times and health related data that is suitable for further analysis of lifestyle and human cognitive and physical performance. This data collection is complemented with a preliminarily statistical evaluation. The second aim is to present a procedure of efficient acquisition of human reaction times and supporting health related data in non-lab and lab conditions. Keywords: Reaction time, Health related data, Cognitive and physical performance, Chronic disease, Data acquisition, Data collection, Software for data collection

  8. AcEST: DK956743 [AcEST

    Lifescience Database Archive (English)

    Full Text Available p|A1EGX6|FSCB_MOUSE Fibrous sheath CABYR-binding protein OS=Mus... 33 1.0 sp|Q9DBY1|SYVN1_MOUSE E3 ubiquitin-protein ligase synovioli...n OS=... 33 1.3 sp|Q86TM6|SYVN1_HUMAN E3 ubiquitin-protein ligase synoviolin OS=...

  9. AcEST: DK954361 [AcEST

    Lifescience Database Archive (English)

    Full Text Available in 5-4 OS=Homo sap... 33 1.1 sp|Q9DBY1|SYVN1_MOUSE E3 ubiquitin-protein ligase synoviolin OS=... 33 1.4 sp|Q...86TM6|SYVN1_HUMAN E3 ubiquitin-protein ligase synoviolin OS=... 33 1.4 sp|O55188|DMP1_MOUSE Dentin matrix ac

  10. AcEST: DK957523 [AcEST

    Lifescience Database Archive (English)

    Full Text Available th CABYR-binding protein OS=Mus... 33 1.1 sp|Q9DBY1|SYVN1_MOUSE E3 ubiquitin-protein ligase synoviolin OS=...... 33 1.4 sp|Q86TM6|SYVN1_HUMAN E3 ubiquitin-protein ligase synoviolin OS=... 33 1.4 sp|O55188|DMP1_MOUSE Den

  11. AcEST: BP917290 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 7DTG3|SRTD4_MOUSE SERTA domain-containing protein 4 OS=Mus m... 31 3.7 sp|O41174|POLG_PEV9U Genome polyprotein OS=Porcine enterovirus...1DP68_NEOFI Putative uncharacterized protein OS=Neosa... 33 5.7 tr|Q68T42|Q68T42_9ENTO Polyprotein OS=Human enterovirus

  12. AcEST: DK952414 [AcEST

    Lifescience Database Archive (English)

    Full Text Available CPKELPCGHRCKEMCHPGECPFNCNQKVKLRCPCKRIKKELQCNK 813 >sp|P40798|STC_DROME Protein shuttle craft...in 1... 190 4e-48 sp|Q6ZNB6|NFXL1_HUMAN NF-X1-type zinc finger protein NFXL1 OS=Ho... 58 4e-08 sp|P40798|STC..._DROME Protein shuttle craft OS=Drosophila melanoga... 54 6e-07 sp|A0JMY5|NFXL1_XENLA NF-X1-type zinc finger

  13. AcEST: DK946915 [AcEST

    Lifescience Database Archive (English)

    Full Text Available Meth... 31 3.7 sp|A4VKN0|DNLJ_PSEU5 DNA ligase OS=Pseudomonas stutzeri (strain ... 31 3.7 sp|Q9P287|BCCI...VHVPEQCPVCGSAVERTQLIKRSKGRESVSEGSIYR 447 >sp|Q9P287|BCCIP_HUMAN BRCA2 and CDKN1A-...interacting protein OS=Homo sapiens GN=BCCIP PE=1 SV=1 Length = 314 Score = 31.2 bits (69), Expect = 3.7 Ide

  14. AcEST: DK959595 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 0.16 sp|Q08778|VP4_ROTHQ Outer capsid protein VP4 OS=Rotavirus A (iso... 33 1.7 sp|Q5BEN5|STU1_EMENI Protei...8778|VP4_ROTHQ Outer capsid protein VP4 OS=Rotavirus A (isolate Human/Thailand/Mc35/1992 G10-P11[14]-Ix-Rx-C

  15. AcEST: BP914074 [AcEST

    Lifescience Database Archive (English)

    Full Text Available d P36357 Definition sp|P36357|VS09_ROTA1 Glycoprotein VP7 OS=Rotavirus A (strain ...VS09_ROTA1 Glycoprotein VP7 OS=Rotavirus A (strain Tur... 30 4.2 sp|P59051|CU087_HUMAN Uncharacterized prote...-like protein 1 OS=Homo ... 29 9.3 >sp|P36357|VS09_ROTA1 Glycoprotein VP7 OS=Rotavirus A (strain Turkey/Irel

  16. Applying Multiple Data Collection Tools to Quantify Human Papillomavirus Vaccine Communication on Twitter.

    Science.gov (United States)

    Massey, Philip M; Leader, Amy; Yom-Tov, Elad; Budenz, Alexandra; Fisher, Kara; Klassen, Ann C

    2016-12-05

    Human papillomavirus (HPV) is the most common sexually transmitted infection in the United States. There are several vaccines that protect against strains of HPV most associated with cervical and other cancers. Thus, HPV vaccination has become an important component of adolescent preventive health care. As media evolves, more information about HPV vaccination is shifting to social media platforms such as Twitter. Health information consumed on social media may be especially influential for segments of society such as younger populations, as well as ethnic and racial minorities. The objectives of our study were to quantify HPV vaccine communication on Twitter, and to develop a novel methodology to improve the collection and analysis of Twitter data. We collected Twitter data using 10 keywords related to HPV vaccination from August 1, 2014 to July 31, 2015. Prospective data collection used the Twitter Search API and retrospective data collection used Twitter Firehose. Using a codebook to characterize tweet sentiment and content, we coded a subsample of tweets by hand to develop classification models to code the entire sample using machine learning procedures. We also documented the words in the 140-character tweet text most associated with each keyword. We used chi-square tests, analysis of variance, and nonparametric equality of medians to test for significant differences in tweet characteristic by sentiment. A total of 193,379 English-language tweets were collected, classified, and analyzed. Associated words varied with each keyword, with more positive and preventive words associated with "HPV vaccine" and more negative words associated with name-brand vaccines. Positive sentiment was the largest type of sentiment in the sample, with 75,393 positive tweets (38.99% of the sample), followed by negative sentiment with 48,940 tweets (25.31% of the sample). Positive and neutral tweets constituted the largest percentage of tweets mentioning prevention or protection (20

  17. Bacterial and protozoal pathogens found in ticks collected from humans in Corum province of Turkey.

    Directory of Open Access Journals (Sweden)

    Djursun Karasartova

    2018-04-01

    Full Text Available Tick-borne diseases are increasing all over the word, including Turkey. The aim of this study was to determine the bacterial and protozoan vector-borne pathogens in ticks infesting humans in the Corum province of Turkey.From March to November 2014 a total of 322 ticks were collected from patients who attended the local hospitals with tick bites. Ticks were screened by real time-PCR and PCR, and obtained amplicons were sequenced. The dedected tick was belonging to the genus Hyalomma, Haemaphysalis, Rhipicephalus, Dermacentor and Ixodes. A total of 17 microorganism species were identified in ticks. The most prevalent Rickettsia spp. were: R. aeschlimannii (19.5%, R. slovaca (4.5%, R. raoultii (2.2%, R. hoogstraalii (1.9%, R. sibirica subsp. mongolitimonae (1.2%, R. monacensis (0.31%, and Rickettsia spp. (1.2%. In addition, the following pathogens were identified: Borrelia afzelii (0.31%, Anaplasma spp. (0.31%, Ehrlichia spp. (0.93%, Babesia microti (0.93%, Babesia ovis (0.31%, Babesia occultans (3.4%, Theileria spp. (1.6%, Hepatozoon felis (0.31%, Hepatozoon canis (0.31%, and Hemolivia mauritanica (2.1%. All samples were negative for Francisella tularensis, Coxiella burnetii, Bartonella spp., Toxoplasma gondii and Leishmania spp.Ticks in Corum carry a large variety of human and zoonotic pathogens that were detected not only in known vectors, but showed a wider vector diversity. There is an increase in the prevalence of ticks infected with the spotted fever group and lymphangitis-associated rickettsiosis, while Ehrlichia spp. and Anaplasma spp. were reported for the first time from this region. B. microti was detected for the first time in Hyalomma marginatum infesting humans. The detection of B. occultans, B. ovis, Hepatozoon spp., Theileria spp. and Hemolivia mauritanica indicate the importance of these ticks as vectors of pathogens of veterinary importance, therefore patients with a tick infestation should be followed for a variety of pathogens

  18. HOCOMOCO: a comprehensive collection of human transcription factor binding sites models

    Science.gov (United States)

    Kulakovskiy, Ivan V.; Medvedeva, Yulia A.; Schaefer, Ulf; Kasianov, Artem S.; Vorontsov, Ilya E.; Bajic, Vladimir B.; Makeev, Vsevolod J.

    2013-01-01

    Transcription factor (TF) binding site (TFBS) models are crucial for computational reconstruction of transcription regulatory networks. In existing repositories, a TF often has several models (also called binding profiles or motifs), obtained from different experimental data. Having a single TFBS model for a TF is more pragmatic for practical applications. We show that integration of TFBS data from various types of experiments into a single model typically results in the improved model quality probably due to partial correction of source specific technique bias. We present the Homo sapiens comprehensive model collection (HOCOMOCO, http://autosome.ru/HOCOMOCO/, http://cbrc.kaust.edu.sa/hocomoco/) containing carefully hand-curated TFBS models constructed by integration of binding sequences obtained by both low- and high-throughput methods. To construct position weight matrices to represent these TFBS models, we used ChIPMunk software in four computational modes, including newly developed periodic positional prior mode associated with DNA helix pitch. We selected only one TFBS model per TF, unless there was a clear experimental evidence for two rather distinct TFBS models. We assigned a quality rating to each model. HOCOMOCO contains 426 systematically curated TFBS models for 401 human TFs, where 172 models are based on more than one data source. PMID:23175603

  19. HOCOMOCO: A comprehensive collection of human transcription factor binding sites models

    KAUST Repository

    Kulakovskiy, Ivan V.; Medvedeva, Yulia A.; Schaefer, Ulf; Kasianov, Artem S.; Vorontsov, Ilya E.; Bajic, Vladimir B.; Makeev, Vsevolod J.

    2012-01-01

    Transcription factor (TF) binding site (TFBS) models are crucial for computational reconstruction of transcription regulatory networks. In existing repositories, a TF often has several models (also called binding profiles or motifs), obtained from different experimental data. Having a single TFBS model for a TF is more pragmatic for practical applications. We show that integration of TFBS data from various types of experiments into a single model typically results in the improved model quality probably due to partial correction of source specific technique bias. We present the Homo sapiens comprehensive model collection (HOCOMOCO, http://autosome.ru/HOCOMOCO/, http://cbrc.kaust.edu.sa/ hocomoco/) containing carefully hand-curated TFBS models constructed by integration of binding sequences obtained by both low- and high-throughput methods. To construct position weight matrices to represent these TFBS models, we used ChIPMunk software in four computational modes, including newly developed periodic positional prior mode associated with DNA helix pitch. We selected only one TFBS model per TF, unless there was a clear experimental evidence for two rather distinct TFBS models. We assigned a quality rating to each model. HOCOMOCO contains 426 systematically curated TFBS models for 401 human TFs, where 172 models are based on more than one data source. The Author(s) 2012.

  20. HOCOMOCO: A comprehensive collection of human transcription factor binding sites models

    KAUST Repository

    Kulakovskiy, Ivan V.

    2012-11-21

    Transcription factor (TF) binding site (TFBS) models are crucial for computational reconstruction of transcription regulatory networks. In existing repositories, a TF often has several models (also called binding profiles or motifs), obtained from different experimental data. Having a single TFBS model for a TF is more pragmatic for practical applications. We show that integration of TFBS data from various types of experiments into a single model typically results in the improved model quality probably due to partial correction of source specific technique bias. We present the Homo sapiens comprehensive model collection (HOCOMOCO, http://autosome.ru/HOCOMOCO/, http://cbrc.kaust.edu.sa/ hocomoco/) containing carefully hand-curated TFBS models constructed by integration of binding sequences obtained by both low- and high-throughput methods. To construct position weight matrices to represent these TFBS models, we used ChIPMunk software in four computational modes, including newly developed periodic positional prior mode associated with DNA helix pitch. We selected only one TFBS model per TF, unless there was a clear experimental evidence for two rather distinct TFBS models. We assigned a quality rating to each model. HOCOMOCO contains 426 systematically curated TFBS models for 401 human TFs, where 172 models are based on more than one data source. The Author(s) 2012.

  1. From single cilia to collective waves in human airway ciliated tissues

    Science.gov (United States)

    Cicuta, Pietro; Chioccioli, Maurizio; Feriani, Luigi; Pellicciotta, Nicola; Kotar, Jurij

    I will present experimental results on activity of motile cilia on various scales: from waveforms on individual cilia to the synchronised motion in cilia carpets of airway cells. Model synthetic experiments have given us an understanding of how cilia could couple with each other through forces transmitted by the fluid, and thus coordinate to beat into well organized waves (previous work is reviewed in Annu. Rev. Condens. Matter Phys. 7, 1-26 (2016)). Working with live imaging of airway human cells at the different scales, we can now test whether the biological system satisfies the ``simple'' behavior expected of the fluid flow coupling, or if other factors of mechanical forces transmission need to be accounted for. In general being able to link from the scale of molecular biological activity up to the phenomenology of collective dynamics requires to understand the relevant physical mechanism. This understanding then allows informed diagnostics (and perhaps therapeutic) approaches to a variety of diseases where mucociliary clearance in the airways is compromised. We have started exploring particularly cystic fibrosis, where the rheological properties of the mucus are affected and prevent efficient cilia synchronization. ERC Grant HydroSync.

  2. AcEST: DK947347 [AcEST

    Lifescience Database Archive (English)

    Full Text Available Prot sp_hit_id Q4Z8K6 Definition sp|Q4Z8K6|RBP9X_DROME Protein midlife crisis OS=Drosophila melanogaster Ali...g significant alignments: (bits) Value sp|Q4Z8K6|RBP9X_DROME Protein midlife crisis OS=Drosophila melan... 3..... 30 7.6 sp|Q07954|LRP1_HUMAN Prolow-density lipoprotein receptor-related... 30 7.6 >sp|Q4Z8K6|RBP9X_DROME Protein midlife crisis

  3. AcEST: DK956182 [AcEST

    Lifescience Database Archive (English)

    Full Text Available se 56.9) Link to BlastX Result : Swiss-Prot sp_hit_id Q9Y2K2 Definition sp|Q9Y2K2...........done Score E Sequences producing significant alignments: (bits) Value sp|Q9Y2K...AM 32 OS=Homo sapiens GN=ADAM32 PE=1 SV=1 29 8.4 >sp|Q9Y2K2|QSK_HUMAN Serine/thre

  4. AcEST: BP920099 [AcEST

    Lifescience Database Archive (English)

    Full Text Available esult : Swiss-Prot sp_hit_id Q9QSP0 Definition sp|Q9QSP0|L_ABLVB Large structural protein OS=Australian bat lyssavirus.... 30 8.0 >sp|Q9QSP0|L_ABLVB Large structural protein OS=Australian bat lyssavirus (isolate Bat/AUS/1996) GN=...avirus (isolate Human/AUS/1998) GN=L PE=3 SV=1 Length = 2127 Score = 32.7 bits (73)...RSRKCLSDLTQFYQKSSPIE--KLLNYTLGNRGLR 145 >sp|Q8JTG9|L_ABLVH Large structural protein OS=Australian bat lyss

  5. AcEST: BP915042 [AcEST

    Lifescience Database Archive (English)

    Full Text Available LG_EBLV2 Glycoprotein G OS=European bat lyssavirus 2 (strain Human/Scotland/RV133...p|Q91C28|VGLG_DUVV Glycoprotein G OS=Duvenhage virus GN=G PE=3 ... 35 0.24 sp|A4UHQ6|VGLG_EBLV2 Glycoprotein G OS=European bat lyssav...irus 2... 32 1.5 sp|Q9FE22|HFR1_ARATH Transcription factor HFR1 OS=Arabidopsis th..

  6. AcEST: BP911457 [AcEST

    Lifescience Database Archive (English)

    Full Text Available D K YR G++ + N +G Sbjct: 192 WLKPEGFPHQEIRQYSLTRKPDGKGYRIAVKREEGGQVSNWLHNHANVG 240 >sp|Q5TIS6|NOTO_MOUSE Homeobox protein notochord...=h... 32 2.1 sp|Q7ABK6|HMP_ECO57 Flavohemoprotein OS=Escherichia coli O157:H7... 32 2.1 sp|Q5TIS6|NOTO_MOUSE Homeobox protein notocho...rd OS=Mus musculus ... 31 2.8 sp|Q9BYQ7|KRA41_HUMAN Kera

  7. AcEST: DK962269 [AcEST

    Lifescience Database Archive (English)

    Full Text Available -structural glycoprotein 4 OS=Rotavirus A (isolate Human/United Kingdom/A64/1987 G10-P11[14]-I2-R2-C2-M2-A3-...quences producing significant alignments: (bits) Value sp|P30031|VS10_ROTH7 Non-structural glycoprotein 4 OS=Rotavirus...CHPO SAC3 family protein 1 OS=Schizosaccharomyc... 30 9.4 >sp|P30031|VS10_ROTH7 Non-structural glycoprotein 4 OS=Rotavirus

  8. Good agreements between self and clinician-collected specimens for the detection of human papillomavirus in Brazilian patients

    Directory of Open Access Journals (Sweden)

    Karla Lopes Mandu de Campos

    2014-06-01

    Full Text Available Women infected with human papillomavirus (HPV are at a higher risk of developing cervical lesions. In the current study, self and clinician-collected vaginal and cervical samples from women were processed to detect HPV DNA using polymerase chain reaction (PCR with PGMY09/11 primers. HPV genotypes were determined using type-specific PCR. HPV DNA detection showed good concordance between self and clinician-collected samples (84.6%; kappa = 0.72. HPV infection was found in 30% women and genotyping was more concordant among high-risk HPV (HR-HPV than low-risk HPV (HR-HPV. HPV16 was the most frequently detected among the HR-HPV types. LR-HPV was detected at a higher frequency in self-collected; however, HR-HPV types were more frequently identified in clinician-collected samples than in self-collected samples. HPV infections of multiple types were detected in 20.5% of clinician-collected samples and 15.5% of self-collected samples. In this study, we demonstrated that the HPV DNA detection rate in self-collected samples has good agreement with that of clinician-collected samples. Self-collected sampling, as a primary prevention strategy in countries with few resources, could be effective for identifying cases of HR-HPV, being more acceptable. The use of this method would enhance the coverage of screening programs for cervical cancer.

  9. AcEST: BP912187 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 9 Definition sp|P70079|KCRU_CHICK Creatine kinase, ubiquitous mitochondrial OS=Ga...gnments: (bits) Value sp|P70079|KCRU_CHICK Creatine kinase, ubiquitous mitochondr...ial O... 34 0.33 sp|Q9TTK8|KCRU_BOVIN Creatine kinase, ubiquitous mitochondrial O... 33 0.74 sp|P46430|GSTT1...NH_SHESA Ribonuclease H OS=Shewanella sp. (strain ANA... 32 1.7 sp|P12532|KCRU_HUMAN Creatine kinase, ubiqui...tous mitochondrial O... 31 2.2 sp|P25809|KCRU_RAT Creatine kinase, ubiquitous mitochondrial OS=... 31 2.8 sp|P30275|KCRU_MOUSE Creati

  10. AcEST: DK956834 [AcEST

    Lifescience Database Archive (English)

    Full Text Available urotrypsin OS=Saguinus labiatus GN=PRSS12... 35 0.31 sp|Q5G268|NETR_HYLLE Neurotr...Y Neurotrypsin OS=Pongo pygmaeus GN=PRSS12 PE... 32 3.5 sp|O13817|SEC7C_SCHPO Protein transport protein sec7...3 OS=Schizos... 31 4.5 sp|Q5G267|NETR_MACMU Neurotrypsin OS=Macaca mulatta GN=PRSS12...HUMAN Forkhead box protein J3 OS=Homo sapiens GN... 30 7.7 >sp|Q5G265|NETR_SAGLB Neurotrypsin OS=Saguinus labiatus GN=PRSS12...YPHYLPTEQRHRRTRPPPPLPRFPRPPRALPALRPHALQAGHTP 86 >sp|Q5G268|NETR_HYLLE Neurotrypsin OS=Hylobates leucogenys GN=PRSS12

  11. AcEST: DK954018 [AcEST

    Lifescience Database Archive (English)

    Full Text Available I8 Definition sp|Q9D0I8|MRT4_MOUSE mRNA turnover protein 4 homolog OS=Mus musculus Align length 152 Score (b...ignments: (bits) Value sp|Q9D0I8|MRT4_MOUSE mRNA turnover protein 4 homolog OS=Mus musc... 142 1e-33 sp|A4FV84|MRT4_BOVIN mRNA turnov...er protein 4 homolog OS=Bos taur... 142 1e-33 sp|Q9UKD2|MRT4_HUMAN mRNA turnover... protein 4 homolog OS=Homo sap... 140 5e-33 sp|Q86HD3|MRT4_DICDI mRNA turnover prote...in 4 homolog OS=Dictyost... 127 3e-29 sp|Q9USZ6|MRT4_SCHPO mRNA turnover protein 4 homolog OS=Schizosa... 10

  12. AcEST: DK952163 [AcEST

    Lifescience Database Archive (English)

    Full Text Available - Swiss-Prot (release 56.9) Link to BlastX Result : Swiss-Prot sp_hit_id A4FV84 Definition sp|A4FV84|MRT4_BOVIN mRNA turnover...............................done Score E Sequences producing significant alignments: (bits) Value sp|A4FV84|MRT4_BOVIN mRNA turnover... protein 4 homolog OS=Bos taur... 147 3e-35 sp|Q9D0I8|MRT4_MOUSE mRNA turnover prote...in 4 homolog OS=Mus musc... 147 4e-35 sp|Q9UKD2|MRT4_HUMAN mRNA turnover protein ...4 homolog OS=Homo sap... 145 1e-34 sp|Q86HD3|MRT4_DICDI mRNA turnover protein 4 homolog OS=Dictyost... 135 2

  13. AcEST: DK954898 [AcEST

    Lifescience Database Archive (English)

    Full Text Available d A4FV84 Definition sp|A4FV84|MRT4_BOVIN mRNA turnover protein 4 homolog OS=Bos taurus Align length 160 Scor...t alignments: (bits) Value sp|A4FV84|MRT4_BOVIN mRNA turnover protein 4 homolog OS=Bos taur... 153 6e-37 sp|...Q9D0I8|MRT4_MOUSE mRNA turnover protein 4 homolog OS=Mus musc... 152 8e-37 sp|Q9UKD2|MRT4_HUMAN mRNA turno...ver protein 4 homolog OS=Homo sap... 151 2e-36 sp|Q86HD3|MRT4_DICDI mRNA turnover p...rotein 4 homolog OS=Dictyost... 140 5e-33 sp|Q7S302|MRT4_NEUCR mRNA turnover protein 4 homolog OS=Neurospo..

  14. A comparison of human papillomavirus testing of clinician-collected and self-collected samples during follow-up after screen-and-treat.

    Science.gov (United States)

    Taylor, Sylvia; Wang, Chunhui; Wright, Thomas C; Denny, Lynette; Kuhn, Louise

    2011-08-15

    Screen-and-treat cervical cancer prevention programs based on high-risk human papillomavirus (HPV) testing and cryotherapy have been shown to be effective in resource-limited settings. However, because cryotherapy is not 100% effective, follow-up is needed after treatment to detect post-treatment failures. We compared the test performances of high-risk HPV testing (Hybrid Capture 2) using self-collected and clinician-collected samples as well as cervical cytology for identifying cervical intraepithelial neoplasia grades 2 or 3 or invasive cervical cancer (CIN2+) among women who did (n=812) and did not (n=1858) undergo cryotherapy in a South African screen-and-treat trial. At 6 months after enrolment (and after cryotherapy, if performed), women were tested using all three screening methods and then underwent colposcopy/biopsy. A predefined subset of women (n=1,455) had extended follow-up with colposcopy/biopsy at 12 months. A total of 33 and 91 cases of CIN2+ were detected among treated and untreated women, respectively. The sensitivity of HPV testing using clinician-collected samples and cervical cytology did not differ by treatment status. HPV testing of clinician-collected samples detected the most cases of CIN2+ among both treated (85%) and untreated (91%) women (p=0.31). Cytology (at a cutoff of atypical squamous cells of undetermined significance or greater) detected 76% of cases among both treated and untreated women. However, the sensitivity of HPV testing using self-collected samples was significantly lower among treated versus untreated women (55% vs. 78%, p=0.01). HPV testing using self-collected vaginal specimens may be useful in primary screening but performs poorly for detecting post-treatment failures. Copyright © 2010 UICC.

  15. Carbon dioxide baited trap catches do not correlate with human landing collections of Anopheles aquasalis in Suriname

    Directory of Open Access Journals (Sweden)

    Hélène Hiwat

    2011-05-01

    Full Text Available Three types of carbon dioxide-baited traps, i.e., the Centers for Disease Control Miniature Light Trap without light, the BioGents (BG Sentinel Mosquito Trap (BG-Sentinel and the Mosquito Magnet® Liberty Plus were compared with human landing collections in their efficiency in collecting Anopheles (Nyssorhynchus aquasalis mosquitoes. Of 13,549 total mosquitoes collected, 1,019 (7.52% were An. aquasalis. Large numbers of Culex spp were also collected, in particular with the (BG-Sentinel. The majority of An. aquasalis (83.8% were collected by the human landing collection (HLC. None of the trap catches correlated with HLC in the number of An. aquasalis captured over time. The high efficiency of the HLC method indicates that this malaria vector was anthropophilic at this site, especially as carbon dioxide was insufficiently attractive as stand-alone bait. Traps using carbon dioxide in combination with human odorants may provide better results.

  16. A new model with an anatomically accurate human renal collecting system for training in fluoroscopy-guided percutaneous nephrolithotomy access.

    Science.gov (United States)

    Turney, Benjamin W

    2014-03-01

    Obtaining renal access is one of the most important and complex steps in learning percutaneous nephrolithotomy (PCNL). Ideally, this skill should be practiced outside the operating room. There is a need for anatomically accurate and cheap models for simulated training. The objective was to develop a cost-effective, anatomically accurate, nonbiologic training model for simulated PCNL access under fluoroscopic guidance. Collecting systems from routine computed tomography urograms were extracted and reformatted using specialized software. These images were printed in a water-soluble plastic on a three-dimensional (3D) printer to create biomodels. These models were embedded in silicone and then the models were dissolved in water to leave a hollow collecting system within a silicone model. These PCNL models were filled with contrast medium and sealed. A layer of dense foam acted as a spacer to replicate the tissues between skin and kidney. 3D printed models of human collecting systems are a useful adjunct in planning PCNL access. The PCNL access training model is relatively low cost and reproduces the anatomy of the renal collecting system faithfully. A range of models reflecting the variety and complexity of human collecting systems can be reproduced. The fluoroscopic triangulation process needed to target the calix of choice can be practiced successfully in this model. This silicone PCNL training model accurately replicates the anatomic architecture and orientation of the human renal collecting system. It provides a safe, clean, and effective model for training in accurate fluoroscopy-guided PCNL access.

  17. New methods for field collection of human skin volatiles and perspectives for their application in the chemical ecology of human-pathogen-vector interactions.

    Science.gov (United States)

    Dormont, Laurent; Bessière, Jean-Marie; McKey, Doyle; Cohuet, Anna

    2013-08-01

    Odours emitted by human skin are of great interest to biologists in many fields, with practical applications in forensics, health diagnostic tools and the ecology of blood-sucking insect vectors of human disease. Convenient methods are required for sampling human skin volatiles under field conditions. We experimentally compared four modern methods for sampling skin odours: solvent extraction, headspace solid-phase micro-extraction (SPME), and two new techniques not previously used for the study of mammal volatiles, contact SPME and dynamic headspace with a chromatoprobe design. These methods were tested and compared both on European subjects under laboratory conditions and on young African subjects under field conditions. All four methods permitted effective trapping of skin odours, including the major known human skin volatile compounds. In both laboratory and field experiments, contact SPME, in which the time of collection was restricted to 3 min, provided results very similar to those obtained with classical headspace SPME, a method that requires 45 min of collection. Chromatoprobe sampling also proved to be very sensitive, rapid and convenient for the collection of human-produced volatiles in natural settings. Both contact SPME and chromatoprobe design may considerably facilitate the study of human skin volatiles under field conditions, opening new possibilities for examining the olfactory cues mediating the host-seeking behaviour of mosquito vectors implicated in the transmission of major diseases.

  18. Violações de direitos humanos, lei e memória coletiva Human rights violations, law and collective memory

    Directory of Open Access Journals (Sweden)

    Joachim J. Savelsberg

    2007-11-01

    Full Text Available Respostas institucionais a violações maciças dos direitos humanos e do direito humanitário podem afetar os registros de direitos humanos futuros, pois, entre outras implicações, contribuem para aviventar a memória coletiva referente aos capítulos sombrios da história de uma nação. Este artigo explora, primeiramente, as idéias teóricas concernentes ao impacto que respostas legais podem ter sobre a memória coletiva e o trauma cultural. Em seguida, procede a um exame das formas de mensuração empírica dos efeitos de processos jurídicos sobre a memória coletiva, discriminando sistematicamente os passos seguidos em estudos recentes acerca da memória coletiva de atrocidades, tomando como exemplos as guerras do Vietnã e dos Bálcãs enquanto reportadas pelo New York Times e em livros de história dos Estados Unidos. Alguns dos resultados desses estudos são relatados, indicando os efeitos condicionais e seletivos de processos criminais incidentes sobre a memória coletiva. Por fim, são elaboradas conclusões visando a pesquisas futuras na América Latina e alhures.Institutional responses to gross violations of human rights and humanitarian law may affect future human rights records, partly by contributing to the collective memory of the dark chapters in a nation's history. This article begins with an exploration of various theoretical ideas concerning the impact of legal responses on collective memory and cultural trauma. It examines ways of empirically measuring the effects of law trials on collective memory, systematically analyzing the procedures adopted in recent studies into the collective memory of atrocities. Here it takes as examples the Vietnam and Balkan wars as reported in the New York Times and described in textbooks on the History of the United States. Some of the findings from these studies are explored, indicating the conditional and selective effects of criminal trials on collective memory. Finally, the article

  19. Clinical manifestations of peripheral nervous system involvement in human chronic chagas disease Manifestaciones clinicas de compromiso del sistema nervioso periférico en el estádio crônico de la enfermedad de Chagas

    Directory of Open Access Journals (Sweden)

    Osvaldo Genovese

    1996-06-01

    Full Text Available We conducted a clinical and electromyographical study in patients with Chagas' disease in the indeterminate or chronic stages of the illness. Altogether 841 patients were examined. Only 511 were admitted within the protocol; the remainder patients were rejected because they showed other causes able to damage the nervous system. Fifty two (10.17% out of the 511 patients showed signs and symptoms of peripheral nervous system involvement in the form of sensory impairment and diminished tendon jerks suggesting the presence of neuropathy. Forty five of them were submitted to a conventional electromyographical examination. Fifteen of mem showed normal results, while the remainder 30 disclosed a reduced interference pattern, being most of the remaining motor unit potentials fragmented or poliphasic, reduced sensory and motor conduction velocities and diminished amplitude of the sensory action potential. The findings suggest that some chagasic patients in the indeterminate or chronic stages of the disease may develop a clinical mild sensory-motor peripheral neuropathy.El estúdio presente fue diseftado con ei objeto de pesquizar Ia existência de manifestaciones clinicas en pacientes afectados por enfermedad de Chagas, en estádio indeterminado o crônico, que tuviesen, ai menos, 2 reacciones serologicas positivas. En total fueron examinados 841 enfermos. De ellos solo 511 fueron admitidos en ei protocolo; los restantes fueron rechazados por mostrar Ia presencia de otras causas que hubiesen podido danar su sistema nervioso. Dentro de los 511 pacientes admitidos, 52 (10.17% evidenciaron alteraciones objetivas y subjetivas de Ia sensibilidad y disminucion de los reflejos osteotendinosos. Estos signos y sintomas, que sugieren la presencia de neuropatia, podian combinarse de diferente manera. Como complemento dei examen clinico, se efectuo estúdio electromiografico convencional en 45 de estos pacientes. En 15 los hallazgos fueron normales, en tanto que en

  20. A natureza e o lugar habitado como âmbitos da experiência estética: novos entendimentos da relação ser humano - ambiente Nature and space as scopes for aesthetic experience: new understanding of the relationship human being - environment

    Directory of Open Access Journals (Sweden)

    Andréia Aparecida Marin

    2009-08-01

    Full Text Available A percepção que o ser humano tem da natureza e do espaço habitado é marcada pela imaginação, pela afetividade, pela memória e pela sensibilidade estética. O significado da experiência estética está presente tanto nas construções do lugar habitado quanto na contemplação dos ambientes preservados. No presente ensaio, propomos um caminho reflexivo que evidencia essa necessidade estética do humano, focando-a nas categorias natureza e espaços do cotidiano como âmbitos de vivência. Tecemos considerações sobre os possíveis significados da teoria estética para a educação ambiental. Para tanto, partimos do resgate de referenciais teóricos da fenomenologia e do campo da filosofia estética, que incluem Merleau-Ponty, Bachelard, Dufrenne e Quintás.Human being's perception of nature and of the inhabited space is marked by imagination, affectivity, memory and aesthetic sensibility. The meaning of aesthetic experience is present in the buildings of the inhabited place as well as in the sight of preserved environments. In the present paper we propose a reflective way that makes evident this aesthetic need of mankind, focusing it in the categories of natural and daily spaces as scopes of life experience. We consider the possible meanings of aesthetic theory for environmental education. Thus we start at the recovery of theoretical references of phenomenology and of aesthetic philosophy that include Merleau-Ponty, Bachelard, Dufrenne, and Quintás.

  1. NEW METHODOLOGY FOR IDENTIFYING POTENTIAL HUMAN BIOMARKERS BY COLLECTION AND CONCENTRATION OF EXHALED BREATH CONDENSATE

    Science.gov (United States)

    In many studies of human exposure, the measurement of pollutant chemicals in the environment (air, water, food, soil, etc.) is being supplemented by their additional measurement in biological media such as human breath, blood, and urine. This allows an unambiguous confirmation...

  2. Evaluation of the Use of Periodicals Collection of the Higher Education Council Documentation and Online Search Center: Arts and Humanities Periodicals

    Directory of Open Access Journals (Sweden)

    Elçin Özbudak

    1995-06-01

    Full Text Available Evaluation of the use perodicals collections in libraries is important as perodicals report the results of the latest scientific research and they are usually more expensive than other types of library materials. In this study we evaluate the use of Arts and Humanities periodicals in the collection of the Higher Education Council Documentation Center. Although the use of Arts and Humanities periodicals was found to be lower than, say, Biomedical periodicals collection, the number of journal titles in Arts and Humanities appears to be quite satisfactory. Some suggestions are made so as to increase the use of Arts and Humanities periodicals collection.

  3. 77 FR 14530 - National Institute of Child Health and Human Development; New Proposed Collection; Comment...

    Science.gov (United States)

    2012-03-12

    ... efficiency (measured by scientific robustness, participant and infrastructure burden, and cost) of...), neurodevelopmental (pending clearance), and study logistic (pending clearance) information collection. Separate and... assess the feasibility, acceptability, and cost of the recruitment strategy, study procedures, and...

  4. High throughput DNA damage quantification of human tissue with home-based collection device

    Energy Technology Data Exchange (ETDEWEB)

    Costes, Sylvain V.; Tang, Jonathan; Yannone, Steven M.

    2018-04-03

    Kits, methods and systems for providing a service to provide a subject with information regarding the state of a subject's DNA damage. Collection, processing and analysis of samples are also described.

  5. High throughput DNA damage quantification of human tissue with home-based collection device

    Science.gov (United States)

    Costes, Sylvain V.; Tang, Jonathan; Yannone, Steven M.

    2018-04-03

    Kits, methods and systems for providing a service to provide a subject with information regarding the state of a subject's DNA damage. Collection, processing and analysis of samples are also described.

  6. Environmental Legionella spp. collected in urban test sites of South East Queensland, Australia, are virulent to human macrophages in vitro.

    Science.gov (United States)

    Lawrence, Amba; Eglezos, Sofroni; Huston, Wilhelmina

    2016-01-01

    Legionellae are frequent contaminants of potable water supplies, resulting in sporadic infections and occasional outbreaks. Isolates of Legionella were collected from urban test sites within South East Queensland and evaluated for their virulence potential in vitro. Two strains (from the species Legionella londiniensis and Legionella quinlivanii) were demonstrated to have the ability to infect human macrophages, while a strain from the species Legionella anisa did not maintain an infection over the same time course. This suggests that the spectrum of urban environmentally associated Legionella with potential to cause human disease might be greater than currently considered. Copyright © 2015 Institut Pasteur. Published by Elsevier Masson SAS. All rights reserved.

  7. 76 FR 16609 - Proposed Information Collection; Comment Request; Identification of Human Cell Lines Project

    Science.gov (United States)

    2011-03-24

    ... differentiate among cell lines, as described in Designation: ASN-0002 Authentication of Human Cell Lines... NIST (contact information above). III. Data OMB Control Number: None. Form Number: None. Type of Review...

  8. A geographically-diverse collection of 418 human gut microbiome pathway genome databases

    KAUST Repository

    Hahn, Aria S.; Altman, Tomer; Konwar, Kishori M.; Hanson, Niels W.; Kim, Dongjae; Relman, David A.; Dill, David L.; Hallam, Steven J.

    2017-01-01

    the Pathway Tools software, empowering researchers and clinicians interested in visualizing and interpreting metabolic pathways encoded by the human gut microbiome. For the first time, GutCyc provides consistent annotations and metabolic pathway predictions

  9. Multisite recruitment and data collection among older adults: exploring methods to conserve human and financial resources.

    Science.gov (United States)

    McCarthy, Valerie Lander; Cassidy, Karen

    2012-01-01

    The purpose of this article is to describe strategies that were effective in recruitment and data collection among older adults in 3 quantitative studies while decreasing costs in terms of time and money. Factors effective in reducing use of investigators' time and expenses included limiting exclusion of data because of abnormal Mini-Cog scores by careful initial screening and avoiding repeated reminders or follow-up, collecting data in small groups, collapsing consent, dementia screening, and data collection into single sessions, as well as accommodating for sensory and literacy deficits. The cross-sectional, descriptive studies were conducted among community-dwelling older adults attending senior citizen centers and among older adults in independent or assisted living apartments within continuing care retirement communities (CCRCs). In the latest study, a convenience sample (N=152) was recruited and data collection was completed in 4 weeks at a total cost of less than $5,000. Methods common to qualitative research and those commonly used in community-based research were adapted to reduce time and costs for recruitment, screening, and data collection. Given limited availability of research funding, other nursing researchers may find one or more of these methods useful.

  10. Increased preoperative collection of autologous blood with recombinant human erythropoietin therapy in tertiary care hospitals of Jammu

    Directory of Open Access Journals (Sweden)

    Kumkum Sharma

    2013-01-01

    Full Text Available Introduction: To study whether the administration of recombinant human erythropoietin increases the amount of autologous blood that can be collected before orthopaedic surgery. Materials and Methods: We conducted a randomized controlled trial of recombinant human erythropoietin in 68 adults scheduled for elective orthopedic procedures. The patients received either erythropoietin 600 units/kg of body weight or placebo intravenously every 5 th day prior to each phlebotomy for 21 days during which time up to 5 units of blood was collected. Patients were excluded from donation when their hematocrit values were less than 33%. All patients received iron sulphate 325mg orally 3 times daily. The mean number of units collected per patient was 4.33 ± 0.4 for erythropoietin group and 3.05± 0.71 for the placebo group. Results: The mean packed red cell volume donated by patients who received erythropoietin was 32% greater than that donated by patients who received placebo (196.3 vs. 169.4 ml, p<0.05. 68% in the placebo group and 9% of patients treated with erythropoietin were unable to donate ≥4 units. No adverse effects were attributed to erythropoietin. While participating in the study, complications developed in 2 patients one in each group necessitating their removal from the study. Conclusion: We conclude that recombinant human erythropoietin increases the ability of the patients about to undergo elective surgery to donate autologous blood units.

  11. Human blood RNA stabilization in samples collected and transported for a large biobank

    Science.gov (United States)

    2012-01-01

    Background The Norwegian Mother and Child Cohort Study (MoBa) is a nation-wide population-based pregnancy cohort initiated in 1999, comprising more than 108.000 pregnancies recruited between 1999 and 2008. In this study we evaluated the feasibility of integrating RNA analyses into existing MoBa protocols. We compared two different blood RNA collection tube systems – the PAXgene™ Blood RNA system and the Tempus™ Blood RNA system - and assessed the effects of suboptimal blood volumes in collection tubes and of transportation of blood samples by standard mail. Endpoints to characterize the samples were RNA quality and yield, and the RNA transcript stability of selected genes. Findings High-quality RNA could be extracted from blood samples stabilized with both PAXgene and Tempus tubes. The RNA yields obtained from the blood samples collected in Tempus tubes were consistently higher than from PAXgene tubes. Higher RNA yields were obtained from cord blood (3 – 4 times) compared to adult blood with both types of tubes. Transportation of samples by standard mail had moderate effects on RNA quality and RNA transcript stability; the overall RNA quality of the transported samples was high. Some unexplained changes in gene expression were noted, which seemed to correlate with suboptimal blood volumes collected in the tubes. Temperature variations during transportation may also be of some importance. Conclusions Our results strongly suggest that special collection tubes are necessary for RNA stabilization and they should be used for establishing new biobanks. We also show that the 50,000 samples collected in the MoBa biobank provide RNA of high quality and in sufficient amounts to allow gene expression analyses for studying the association of disease with altered patterns of gene expression. PMID:22988904

  12. Validation of Cyanoacrylate Method for Collection of Stratum Corneum in Human Skin for Lipid Analysis

    DEFF Research Database (Denmark)

    Jungersted, JM; Hellgren, Lars; Drachmann, Tue

    2010-01-01

    Background and Objective: Lipids in the stratum corneum (SC) are of major importance for the skin barrier function. Many different methods have been used for the collection of SC for the analysis of SC lipids. The objective of the present study was to validate the cyanoacrylate method for the col......Background and Objective: Lipids in the stratum corneum (SC) are of major importance for the skin barrier function. Many different methods have been used for the collection of SC for the analysis of SC lipids. The objective of the present study was to validate the cyanoacrylate method...

  13. 75 FR 32474 - National Institute of Child Health and Human Development; Revision to Proposed Collection...

    Science.gov (United States)

    2010-06-08

    ... more streamlined recruitment process; A provider based recruitment strategy that relies on health care... Study (NCS), Vanguard (Pilot) Study, Recruitment Substudy Phase 1 SUMMARY: Under the provisions of... questioned the value and utility of the proposed data collection, stating that this type of research is not...

  14. Human Rights as Practice: Dalit Women's Collective Action to Secure Livelihood Entitlements in rural South India

    NARCIS (Netherlands)

    Mangubhai, Y.

    2012-01-01

    In this dissertation, I investigate how Dalit women in rural South India secure livelihood entitlements by analysing processes of social exclusion as well as collective action by these women through their perspectives. This problematic requires focus on how caste, class and gender mutually construct

  15. A geographically-diverse collection of 418 human gut microbiome pathway genome databases

    KAUST Repository

    Hahn, Aria S.

    2017-04-11

    Advances in high-throughput sequencing are reshaping how we perceive microbial communities inhabiting the human body, with implications for therapeutic interventions. Several large-scale datasets derived from hundreds of human microbiome samples sourced from multiple studies are now publicly available. However, idiosyncratic data processing methods between studies introduce systematic differences that confound comparative analyses. To overcome these challenges, we developed GutCyc, a compendium of environmental pathway genome databases (ePGDBs) constructed from 418 assembled human microbiome datasets using MetaPathways, enabling reproducible functional metagenomic annotation. We also generated metabolic network reconstructions for each metagenome using the Pathway Tools software, empowering researchers and clinicians interested in visualizing and interpreting metabolic pathways encoded by the human gut microbiome. For the first time, GutCyc provides consistent annotations and metabolic pathway predictions, making possible comparative community analyses between health and disease states in inflammatory bowel disease, Crohn’s disease, and type 2 diabetes. GutCyc data products are searchable online, or may be downloaded and explored locally using MetaPathways and Pathway Tools.

  16. Toward Improved Collections in Medical Humanities: Fiction in Academic Health Sciences Libraries

    Science.gov (United States)

    Dali, Keren; Dilevko, Juris

    2006-01-01

    Although fiction plays a prominent role in the interdisciplinary field of medical humanities (MH), it is physically and intellectually isolated from non-fiction in academic health sciences libraries. Using the Literature, Arts, and Medicine Database (LAMD) as a tool for selection and subject analysis, we suggest a method of integrating fiction…

  17. Human circadian phase estimation from signals collected in ambulatory conditions using an autoregressive model

    NARCIS (Netherlands)

    Gil, Enrique A; Aubert, Xavier L; Møst, Els I S; Beersma, Domien G M

    Phase estimation of the human circadian rhythm is a topic that has been explored using various modeling approaches. The current models range from physiological to mathematical, all attempting to estimate the circadian phase from different physiological or behavioral signals. Here, we have focused on

  18. Collecting big datasets of human activity one checkin at a time

    OpenAIRE

    Hossmann, Theus; Efstratiou, Christos; Mascolo, Cecilia

    2012-01-01

    A variety of cutting edge applications for mobile phones exploit the availability of phone sensors to accurately infer the user activity and location to offer more effective services. To validate and evaluate these new applications, appropriate and extensive datasets are needed: in particular, large sets of traces of sensor data (accelerometer, GPS, micro- phone, etc.), labelled with corresponding user activities. So far, such traces have only been collected in short-lived, small-scale setups...

  19. PAVE: Program for assembling and viewing ESTs

    Directory of Open Access Journals (Sweden)

    Bomhoff Matthew

    2009-08-01

    Full Text Available Abstract Background New sequencing technologies are rapidly emerging. Many laboratories are simultaneously working with the traditional Sanger ESTs and experimenting with ESTs generated by the 454 Life Science sequencers. Though Sanger ESTs have been used to generate contigs for many years, no program takes full advantage of the 5' and 3' mate-pair information, hence, many tentative transcripts are assembled into two separate contigs. The new 454 technology has the benefit of high-throughput expression profiling, but introduces time and space problems for assembling large contigs. Results The PAVE (Program for Assembling and Viewing ESTs assembler takes advantage of the 5' and 3' mate-pair information by requiring that the mate-pairs be assembled into the same contig and joined by n's if the two sub-contigs do not overlap. It handles the depth of 454 data sets by "burying" similar ESTs during assembly, which retains the expression level information while circumventing time and space problems. PAVE uses MegaBLAST for the clustering step and CAP3 for assembly, however it assembles incrementally to enforce the mate-pair constraint, bury ESTs, and reduce incorrect joins and splits. The PAVE data management system uses a MySQL database to store multiple libraries of ESTs along with their metadata; the management system allows multiple assemblies with variations on libraries and parameters. Analysis routines provide standard annotation for the contigs including a measure of differentially expressed genes across the libraries. A Java viewer program is provided for display and analysis of the results. Our results clearly show the benefit of using the PAVE assembler to explicitly use mate-pair information and bury ESTs for large contigs. Conclusion The PAVE assembler provides a software package for assembling Sanger and/or 454 ESTs. The assembly software, data management software, Java viewer and user's guide are freely available.

  20. PAVE: program for assembling and viewing ESTs.

    Science.gov (United States)

    Soderlund, Carol; Johnson, Eric; Bomhoff, Matthew; Descour, Anne

    2009-08-26

    New sequencing technologies are rapidly emerging. Many laboratories are simultaneously working with the traditional Sanger ESTs and experimenting with ESTs generated by the 454 Life Science sequencers. Though Sanger ESTs have been used to generate contigs for many years, no program takes full advantage of the 5' and 3' mate-pair information, hence, many tentative transcripts are assembled into two separate contigs. The new 454 technology has the benefit of high-throughput expression profiling, but introduces time and space problems for assembling large contigs. The PAVE (Program for Assembling and Viewing ESTs) assembler takes advantage of the 5' and 3' mate-pair information by requiring that the mate-pairs be assembled into the same contig and joined by n's if the two sub-contigs do not overlap. It handles the depth of 454 data sets by "burying" similar ESTs during assembly, which retains the expression level information while circumventing time and space problems. PAVE uses MegaBLAST for the clustering step and CAP3 for assembly, however it assembles incrementally to enforce the mate-pair constraint, bury ESTs, and reduce incorrect joins and splits. The PAVE data management system uses a MySQL database to store multiple libraries of ESTs along with their metadata; the management system allows multiple assemblies with variations on libraries and parameters. Analysis routines provide standard annotation for the contigs including a measure of differentially expressed genes across the libraries. A Java viewer program is provided for display and analysis of the results. Our results clearly show the benefit of using the PAVE assembler to explicitly use mate-pair information and bury ESTs for large contigs. The PAVE assembler provides a software package for assembling Sanger and/or 454 ESTs. The assembly software, data management software, Java viewer and user's guide are freely available.

  1. Evaluation of the Use of Periodicals Collection of the Higher Education Council Documentation and Online Search Center: Arts and Humanities Periodicals

    OpenAIRE

    Elçin Özbudak

    1995-01-01

    Evaluation of the use perodicals collections in libraries is important as perodicals report the results of the latest scientific research and they are usually more expensive than other types of library materials. In this study we evaluate the use of Arts and Humanities periodicals in the collection of the Higher Education Council Documentation Center. Although the use of Arts and Humanities periodicals was found to be lower than, say, Biomedical periodicals collection, the number of journal t...

  2. Gene expression profiling and pathway analysis of human bronchial epithelial cells exposed to airborne particulate matter collected from Saudi Arabia

    International Nuclear Information System (INIS)

    Sun, Hong; Shamy, Magdy; Kluz, Thomas; Muñoz, Alexandra B.; Zhong, Mianhua; Laulicht, Freda; Alghamdi, Mansour A.; Khoder, Mamdouh I.; Chen, Lung-Chi; Costa, Max

    2012-01-01

    Epidemiological studies have established a positive correlation between human mortality and increased concentration of airborne particulate matters (PM). However, the mechanisms underlying PM related human diseases, as well as the molecules and pathways mediating the cellular response to PM, are not fully understood. This study aims to investigate the global gene expression changes in human cells exposed to PM 10 and to identify genes and pathways that may contribute to PM related adverse health effects. Human bronchial epithelial cells were exposed to PM 10 collected from Saudi Arabia for 1 or 4 days, and whole transcript expression was profiled using the GeneChip human gene 1.0 ST array. A total of 140 and 230 genes were identified that significantly changed more than 1.5 fold after PM 10 exposure for 1 or 4 days, respectively. Ingenuity Pathway Analysis revealed that different exposure durations triggered distinct pathways. Genes involved in NRF2-mediated response to oxidative stress were up-regulated after 1 day exposure. In contrast, cells exposed for 4 days exhibited significant changes in genes related to cholesterol and lipid synthesis pathways. These observed changes in cellular oxidative stress and lipid synthesis might contribute to PM related respiratory and cardiovascular disease. -- Highlights: ► PM exposure modulated gene expression and associated pathways in BEAS-2B cells. ► One-day exposure to PM induced genes involved in responding to oxidative stress. ► 4-day exposure to PM changed genes associated to cholesterol and lipid synthesis.

  3. Ortodoncia estética invisible

    OpenAIRE

    Chávez Sevillano, Manuel Gustavo; Soldevilla Galarza, Luciano

    2014-01-01

    El adulto suele ofrecer resistencia a los convencionales tratamientos ortodóncicos, debido a la necesidad de llevar brackets visibles, tanto metálicos como estéticos de porcelana. El concepto de Ortodoncia Estética Invisible u Ortodoncia Lingual cubre las expectativas de este tipo de pacientes. La técnica multibrackets con aparatología lingual tiene aproximadamente 25 años de desarrollo y con la experiencia de los casos tratados, se ha llegado a la concepción de una técnica completamente prot...

  4. Wide-field spectral imaging of human ovary autofluorescence and oncologic diagnosis via previously collected probe data

    Science.gov (United States)

    Renkoski, Timothy E.; Hatch, Kenneth D.; Utzinger, Urs

    2012-03-01

    With no sufficient screening test for ovarian cancer, a method to evaluate the ovarian disease state quickly and nondestructively is needed. The authors have applied a wide-field spectral imager to freshly resected ovaries of 30 human patients in a study believed to be the first of its magnitude. Endogenous fluorescence was excited with 365-nm light and imaged in eight emission bands collectively covering the 400- to 640-nm range. Linear discriminant analysis was used to classify all image pixels and generate diagnostic maps of the ovaries. Training the classifier with previously collected single-point autofluorescence measurements of a spectroscopic probe enabled this novel classification. The process by which probe-collected spectra were transformed for comparison with imager spectra is described. Sensitivity of 100% and specificity of 51% were obtained in classifying normal and cancerous ovaries using autofluorescence data alone. Specificity increased to 69% when autofluorescence data were divided by green reflectance data to correct for spatial variation in tissue absorption properties. Benign neoplasm ovaries were also found to classify as nonmalignant using the same algorithm. Although applied ex vivo, the method described here appears useful for quick assessment of cancer presence in the human ovary.

  5. Spontaneous and α-adrenoceptor-induced contractility in human collecting lymphatic vessels require chloride

    DEFF Research Database (Denmark)

    Mohanakumar, Sheyanth; Majgaard, Jens; Telinius, Niklas

    2018-01-01

    - with the impermeant anion aspartate and inhibition of Cl- transport and channels with the clinical diuretics furosemide and bendroflumethiazide, as well as DIDS and NPPB. The molecular expression of calcium-activated chloride channels was investigated by RT-PCR and proteins localized using immunoreactivity....... Spontaneous and norepinephrine-induced contractility in human lymphatic vessels was highly abrogated after Cl- substitution with aspartate. 100‒300µM DIDS or NPPB inhibited spontaneous contractile behavior. Norepinephrine-stimulated tone was furthermore markedly abrogated by 200µM DIDS. Furosemide lowered...

  6. Modified wick method using Weck-Cel sponges for collection of human rectal secretions and analysis of mucosal HIV antibody.

    Science.gov (United States)

    Kozlowski, P A; Lynch, R M; Patterson, R R; Cu-Uvin, S; Flanigan, T P; Neutra, M R

    2000-08-01

    Weck-Cel sponges were examined for suitability as an absorbent material for nontraumatic collection of rectal secretions in humans. Sponges were tested in vitro and determined by quantitative enzyme-linked immunosorbent assay (ELISA) to be capable of releasing 100% of absorbed albumin and all immunoglobulin subtypes after treatment with detergent-supplemented buffer. Protein composition in rectal secretions collected from normal women with dry sponges (DS) or with sponges previously softened by moistening with saline (MS) was subsequently compared. DS secretions showed evidence of contamination with blood and interstitial fluid-derived albumin, immunoglobulin G (IgG), and monomeric IgA. MS secretions appeared to represent local mucosal secretions more accurately because they contained negligible blood, a greater percentage of secretory IgA within the total IgA, and both lower albumin/IgG ratios and more dramatic alterations in IgG subclass distribution compared with corresponding serum. Anti-HIV IgG, IgM, IgA, and antibodies with secretory component could be demonstrated by ELISA in rectal secretions collected with moist sponges from 8 of 8, 1 of 8, 5 of 8, and 3 of 8 HIV-infected women, respectively. The data show that Weck-Cel sponges, if premoistened, can be used to collect rectal fluids nontraumatically and to obtain quantitative information about concentrations of immunoglobulins and specific antibodies on rectal mucosal surfaces.

  7. Setting health research priorities using the CHNRI method: VI. Quantitative properties of human collective opinion.

    Science.gov (United States)

    Yoshida, Sachiyo; Rudan, Igor; Cousens, Simon

    2016-06-01

    Crowdsourcing has become an increasingly important tool to address many problems - from government elections in democracies, stock market prices, to modern online tools such as TripAdvisor or Internet Movie Database (IMDB). The CHNRI method (the acronym for the Child Health and Nutrition Research Initiative) for setting health research priorities has crowdsourcing as the major component, which it uses to generate, assess and prioritize between many competing health research ideas. We conducted a series of analyses using data from a group of 91 scorers to explore the quantitative properties of their collective opinion. We were interested in the stability of their collective opinion as the sample size increases from 15 to 90. From a pool of 91 scorers who took part in a previous CHNRI exercise, we used sampling with replacement to generate multiple random samples of different size. First, for each sample generated, we identified the top 20 ranked research ideas, among 205 that were proposed and scored, and calculated the concordance with the ranking generated by the 91 original scorers. Second, we used rank correlation coefficients to compare the ranks assigned to all 205 proposed research ideas when samples of different size are used. We also analysed the original pool of 91 scorers to to look for evidence of scoring variations based on scorers' characteristics. The sample sizes investigated ranged from 15 to 90. The concordance for the top 20 scored research ideas increased with sample sizes up to about 55 experts. At this point, the median level of concordance stabilized at 15/20 top ranked questions (75%), with the interquartile range also generally stable (14-16). There was little further increase in overlap when the sample size increased from 55 to 90. When analysing the ranking of all 205 ideas, the rank correlation coefficient increased as the sample size increased, with a median correlation of 0.95 reached at the sample size of 45 experts (median of the rank

  8. Open Peer Review: Collective Intelligence as a Framework for Theorizing Approaches to Peer Review in the Humanities

    Directory of Open Access Journals (Sweden)

    Jenna Pack Sheffield

    2013-06-01

    Full Text Available This article takes a moderate approach, balancing suggestions for when open peer review can benefit scholarship in the humanities, while offering important concerns authors and editors must consider before deciding to implement the process. I focus on online commenting functions and how they have been—and can be—used for open peer review to help improve the quality of an author’s scholarly work and change the way publishers go about their peer review processes. While open peer review is not necessarily digital, digital technologies allow for a broader range of participants and faster dissemination of knowledge, which is why this article focuses on online open peer review. Open Peer Review: Collective Intelligence as a Framework for Theorizing Approaches to Peer Review in the Humanities, by Jenna Pack Sheffield

  9. From Collective Adaptive Systems to Human Centric Computation and Back: Spatial Model Checking for Medical Imaging

    Directory of Open Access Journals (Sweden)

    Gina Belmonte

    2016-07-01

    Full Text Available Recent research on formal verification for Collective Adaptive Systems (CAS pushed advancements in spatial and spatio-temporal model checking, and as a side result provided novel image analysis methodologies, rooted in logical methods for topological spaces. Medical Imaging (MI is a field where such technologies show potential for ground-breaking innovation. In this position paper, we present a preliminary investigation centred on applications of spatial model checking to MI. The focus is shifted from pure logics to a mixture of logical, statistical and algorithmic approaches, driven by the logical nature intrinsic to the specification of the properties of interest in the field. As a result, novel operators are introduced, that could as well be brought back to the setting of CAS.

  10. Collection and identification of human remains volatiles by non-contact, dynamic airflow sampling and SPME-GC/MS using various sorbent materials.

    Science.gov (United States)

    DeGreeff, Lauryn E; Furton, Kenneth G

    2011-09-01

    Human remains detection canines are used in locating deceased humans in diverse scenarios and environments based on odor produced during the decay process of the human body. It has been established that human remains detection canines are capable of locating human remains specifically, as opposed to living humans or animal remains, thus suggesting a difference in odor between the different sources. This work explores the collection and determination of such odors using a dynamic headspace concentration device. The airflow rate and three sorbent materials-Dukal cotton gauze, Johnson & Johnson cotton-blend gauze, and polyester material-used for odor collection were evaluated using standard compounds. It was determined that higher airflow rates and openly woven material, e.g., Dukal cotton gauze, yielded significantly less total volatile compounds due to compound breakthrough through the sorbent material. Collection from polymer- and cellulose-based materials demonstrated that the molecular backbone of the material is a factor in compound collection as well. Volatiles, including cyclic and straight-chain hydrocarbons, organic acids, sulfides, aldehydes, ketones, and alcohols, were collected from a population of 27 deceased bodies from two collection locations. The common compounds between the subjects were compared and the odor profiles were determined. These odor profiles were compared with those of animal remains and living human subjects collected in the same manner. Principal component analysis showed that the odor profiles of the three sample types were distinct.

  11. Development and production of an oligonucleotide MuscleChip: use for validation of ambiguous ESTs

    Directory of Open Access Journals (Sweden)

    Lanfranchi Gerolamo

    2002-10-01

    Full Text Available Abstract Background We describe the development, validation, and use of a highly redundant 120,000 oligonucleotide microarray (MuscleChip containing 4,601 probe sets representing 1,150 known genes expressed in muscle and 2,075 EST clusters from a non-normalized subtracted muscle EST sequencing project (28,074 EST sequences. This set included 369 novel EST clusters showing no match to previously characterized proteins in any database. Each probe set was designed to contain 20–32 25 mer oligonucleotides (10–16 paired perfect match and mismatch probe pairs per gene, with each probe evaluated for hybridization kinetics (Tm and similarity to other sequences. The 120,000 oligonucleotides were synthesized by photolithography and light-activated chemistry on each microarray. Results Hybridization of human muscle cRNAs to this MuscleChip (33 samples showed a correlation of 0.6 between the number of ESTs sequenced in each cluster and hybridization intensity. Out of 369 novel EST clusters not showing any similarity to previously characterized proteins, we focused on 250 EST clusters that were represented by robust probe sets on the MuscleChip fulfilling all stringent rules. 102 (41% were found to be consistently "present" by analysis of hybridization to human muscle RNA, of which 40 ESTs (39% could be genome anchored to potential transcription units in the human genome sequence. 19 ESTs of the 40 ESTs were furthermore computer-predicted as exons by one or more than three gene identification algorithms. Conclusion Our analysis found 40 transcriptionally validated, genome-anchored novel EST clusters to be expressed in human muscle. As most of these ESTs were low copy clusters (duplex and triplex in the original 28,000 EST project, the identification of these as significantly expressed is a robust validation of the transcript units that permits subsequent focus on the novel proteins encoded by these genes.

  12. Exploiting EST databases for the development and characterization of EST-SSR markers in castor bean (Ricinus communis L.

    Directory of Open Access Journals (Sweden)

    Yang Jun-Bo

    2010-12-01

    Full Text Available Abstract Background The castor bean (Ricinus communis L., a monotypic species in the spurge family (Euphorbiaceae, 2n = 20, is an important non-edible oilseed crop widely cultivated in tropical, sub-tropical and temperate countries for its high economic value. Because of the high level of ricinoleic acid (over 85% in its seed oil, the castor bean seed derivatives are often used in aviation oil, lubricants, nylon, dyes, inks, soaps, adhesive and biodiesel. Due to lack of efficient molecular markers, little is known about the population genetic diversity and the genetic relationships among castor bean germplasm. Efficient and robust molecular markers are increasingly needed for breeding and improving varieties in castor bean. The advent of modern genomics has produced large amounts of publicly available DNA sequence data. In particular, expressed sequence tags (ESTs provide valuable resources to develop gene-associated SSR markers. Results In total, 18,928 publicly available non-redundant castor bean EST sequences, representing approximately 17.03 Mb, were evaluated and 7732 SSR sites in 5,122 ESTs were identified by data mining. Castor bean exhibited considerably high frequency of EST-SSRs. We developed and characterized 118 polymorphic EST-SSR markers from 379 primer pairs flanking repeats by screening 24 castor bean samples collected from different countries. A total of 350 alleles were identified from 118 polymorphic SSR loci, ranging from 2-6 per locus (A with an average of 2.97. The EST-SSR markers developed displayed moderate gene diversity (He with an average of 0.41. Genetic relationships among 24 germplasms were investigated using the genotypes of 350 alleles, showing geographic pattern of genotypes across genetic diversity centers of castor bean. Conclusion Castor bean EST sequences exhibited considerably high frequency of SSR sites, and were rich resources for developing EST-SSR markers. These EST-SSR markers would be particularly

  13. Dynamic response and transfer function of social systems: A neuro-inspired model of collective human activity patterns.

    Science.gov (United States)

    Lymperopoulos, Ilias N

    2017-10-01

    The interaction of social networks with the external environment gives rise to non-stationary activity patterns reflecting the temporal structure and strength of exogenous influences that drive social dynamical processes far from an equilibrium state. Following a neuro-inspired approach, based on the dynamics of a passive neuronal membrane, and the firing rate dynamics of single neurons and neuronal populations, we build a state-of-the-art model of the collective social response to exogenous interventions. In this regard, we analyze online activity patterns with a view to determining the transfer function of social systems, that is, the dynamic relationship between external influences and the resulting activity. To this end, first we estimate the impulse response (Green's function) of collective activity, and then we show that the convolution of the impulse response with a time-varying external influence field accurately reproduces empirical activity patterns. To capture the dynamics of collective activity when the generating process is in a state of statistical equilibrium, we incorporate into the model a noisy input convolved with the impulse response function, thus precisely reproducing the fluctuations of stationary collective activity around a resting value. The outstanding goodness-of-fit of the model results to empirical observations, indicates that the model explains human activity patterns generated by time-dependent external influences in various socio-economic contexts. The proposed model can be used for inferring the temporal structure and strength of external influences, as well as the inertia of collective social activity. Furthermore, it can potentially predict social activity patterns. Copyright © 2017 Elsevier Ltd. All rights reserved.

  14. Monitoring cell line identity in collections of human induced pluripotent stem cells

    Directory of Open Access Journals (Sweden)

    Raquel Sarafian

    2018-04-01

    Full Text Available The ability to reprogram somatic cells into induced pluripotent stem cells (hiPSCs has led to the generation of large collections of cell lines from thousands of individuals with specific phenotypes, many of which will be shared among different research groups as invaluable tools for biomedical research. As hiPSC-based research involves extensive culture of many cell lines, the issue periodic cell line identification is particularly important to ensure that cell line identity remains accurate. Here we analyzed the different commercially available genotyping methods considering ease of in-house genotyping, cost and informativeness, and applied one of them in our workflow for hiPSC generation. We show that the chosen STR method was able to establish a unique DNA profile for each of the 35 individuals/hiPSC lines at the examined sites, as well as identify two discrepancies resulting from inadvertently exchanged samples. Our results highlight the importance of hiPSC line genotyping by an in-house method that allows periodic cell line identification and demonstrate that STR is a useful approach to supplement less frequent karyotyping and epigenetic evaluations. Keywords: Induced pluripotent stem cells, Genotyping, Cell line identification, Short tandem repeats, Quality control

  15. A curated transcriptome dataset collection to investigate the functional programming of human hematopoietic cells in early life.

    Science.gov (United States)

    Rahman, Mahbuba; Boughorbel, Sabri; Presnell, Scott; Quinn, Charlie; Cugno, Chiara; Chaussabel, Damien; Marr, Nico

    2016-01-01

    Compendia of large-scale datasets made available in public repositories provide an opportunity to identify and fill gaps in biomedical knowledge. But first, these data need to be made readily accessible to research investigators for interpretation. Here we make available a collection of transcriptome datasets to investigate the functional programming of human hematopoietic cells in early life. Thirty two datasets were retrieved from the NCBI Gene Expression Omnibus (GEO) and loaded in a custom web application called the Gene Expression Browser (GXB), which was designed for interactive query and visualization of integrated large-scale data. Quality control checks were performed. Multiple sample groupings and gene rank lists were created allowing users to reveal age-related differences in transcriptome profiles, changes in the gene expression of neonatal hematopoietic cells to a variety of immune stimulators and modulators, as well as during cell differentiation. Available demographic, clinical, and cell phenotypic information can be overlaid with the gene expression data and used to sort samples. Web links to customized graphical views can be generated and subsequently inserted in manuscripts to report novel findings. GXB also enables browsing of a single gene across projects, thereby providing new perspectives on age- and developmental stage-specific expression of a given gene across the human hematopoietic system. This dataset collection is available at: http://developmentalimmunology.gxbsidra.org/dm3/geneBrowser/list.

  16. Computer simulation of leadership, consensus decision making and collective behaviour in humans.

    Directory of Open Access Journals (Sweden)

    Song Wu

    Full Text Available The aim of this study is to evaluate the reliability of a crowd simulation model developed by the authors by reproducing Dyer et al.'s experiments (published in Philosophical Transactions in 2009 on human leadership and consensus decision making in a computer-based environment. The theoretical crowd model of the simulation environment is presented, and its results are compared and analysed against Dyer et al.'s original experiments. It is concluded that the simulation results are largely consistent with the experiments, which demonstrates the reliability of the crowd model. Furthermore, the simulation data also reveals several additional new findings, namely: 1 the phenomena of sacrificing accuracy to reach a quicker consensus decision found in ants colonies was also discovered in the simulation; 2 the ability of reaching consensus in groups has a direct impact on the time and accuracy of arriving at the target position; 3 the positions of the informed individuals or leaders in the crowd could have significant impact on the overall crowd movement; and 4 the simulation also confirmed Dyer et al.'s anecdotal evidence of the proportion of the leadership in large crowds and its effect on crowd movement. The potential applications of these findings are highlighted in the final discussion of this paper.

  17. Turismo y estética formativa

    Directory of Open Access Journals (Sweden)

    Clara Inés Sánchez Arciniegas

    2002-11-01

    Full Text Available ¿Existe alguna armonía entre el conocimiento y la estética? Sin duda alguna el hombre con conocimiento y sin virtud de la estética es un autómata; este necesita de las diferentes manifestaciones en las que se encuentra plasmada y necesita recordarlas continuamente. La estética como doctrina de conocimiento no es reciente, en el siglo xviii cuando por primera vez se define teóricamente hasta nuestros días en la Universidad actual. Esta última aparentemente menos evidente debido a las nuevas formas de aprendizaje con herramientas tecnológicas muy avanzadas y contraria a la imagen del universitario que hace dos siglos como complemento a su educación se distraía a través del Gran Tour, partida que tiene el turismo para fomentar el goce estético. ¿Cuál es entonces la relación entre distracción y formación? Se debe entonces reflexionar y comprender que el conocimiento interdisciplinario y la metodología debe procurar en los hombres actitudes adecuadas frente a la cultura y el arte a través del conocimiento.

  18. EST-PAC a web package for EST annotation and protein sequence prediction

    Directory of Open Access Journals (Sweden)

    Strahm Yvan

    2006-10-01

    Full Text Available Abstract With the decreasing cost of DNA sequencing technology and the vast diversity of biological resources, researchers increasingly face the basic challenge of annotating a larger number of expressed sequences tags (EST from a variety of species. This typically consists of a series of repetitive tasks, which should be automated and easy to use. The results of these annotation tasks need to be stored and organized in a consistent way. All these operations should be self-installing, platform independent, easy to customize and amenable to using distributed bioinformatics resources available on the Internet. In order to address these issues, we present EST-PAC a web oriented multi-platform software package for expressed sequences tag (EST annotation. EST-PAC provides a solution for the administration of EST and protein sequence annotations accessible through a web interface. Three aspects of EST annotation are automated: 1 searching local or remote biological databases for sequence similarities using Blast services, 2 predicting protein coding sequence from EST data and, 3 annotating predicted protein sequences with functional domain predictions. In practice, EST-PAC integrates the BLASTALL suite, EST-Scan2 and HMMER in a relational database system accessible through a simple web interface. EST-PAC also takes advantage of the relational database to allow consistent storage, powerful queries of results and, management of the annotation process. The system allows users to customize annotation strategies and provides an open-source data-management environment for research and education in bioinformatics.

  19. Bridging the gap between sample collection and laboratory analysis: using dried blood spots to identify human exposure to chemical agents

    Science.gov (United States)

    Hamelin, Elizabeth I.; Blake, Thomas A.; Perez, Jonas W.; Crow, Brian S.; Shaner, Rebecca L.; Coleman, Rebecca M.; Johnson, Rudolph C.

    2016-05-01

    Public health response to large scale chemical emergencies presents logistical challenges for sample collection, transport, and analysis. Diagnostic methods used to identify and determine exposure to chemical warfare agents, toxins, and poisons traditionally involve blood collection by phlebotomists, cold transport of biomedical samples, and costly sample preparation techniques. Use of dried blood spots, which consist of dried blood on an FDA-approved substrate, can increase analyte stability, decrease infection hazard for those handling samples, greatly reduce the cost of shipping/storing samples by removing the need for refrigeration and cold chain transportation, and be self-prepared by potentially exposed individuals using a simple finger prick and blood spot compatible paper. Our laboratory has developed clinical assays to detect human exposures to nerve agents through the analysis of specific protein adducts and metabolites, for which a simple extraction from a dried blood spot is sufficient for removing matrix interferents and attaining sensitivities on par with traditional sampling methods. The use of dried blood spots can bridge the gap between the laboratory and the field allowing for large scale sample collection with minimal impact on hospital resources while maintaining sensitivity, specificity, traceability, and quality requirements for both clinical and forensic applications.

  20. Rapid in silico cloning of genes using expressed sequence tags (ESTs).

    Science.gov (United States)

    Gill, R W; Sanseau, P

    2000-01-01

    Expressed sequence tags (ESTs) are short single-pass DNA sequences obtained from either end of cDNA clones. These ESTs are derived from a vast number of cDNA libraries obtained from different species. Human ESTs are the bulk of the data and have been widely used to identify new members of gene families, as markers on the human chromosomes, to discover polymorphism sites and to compare expression patterns in different tissues or pathologies states. Information strategies have been devised to query EST databases. Since most of the analysis is performed with a computer, the term "in silico" strategy has been coined. In this chapter we will review the current status of EST databases, the pros and cons of EST-type data and describe possible strategies to retrieve meaningful information.

  1. National ethics guidance in Sub-Saharan Africa on the collection and use of human biological specimens: a systematic review.

    Science.gov (United States)

    Barchi, Francis; Little, Madison T

    2016-10-22

    Ethical and regulatory guidance on the collection and use of human biospecimens (HBS) for research forms an essential component of national health systems in Sub-Saharan Africa (SSA), where rapid advances in genetic- and genomic-based technologies are fueling clinical trials involving HBS and the establishment of large-scale biobanks. An extensive multi-level search for publicly available ethics regulatory guidance was conducted for each SSA country. A second review documented active trials listed in the WHO International Clinical Trials Registry Platform as of January 2015 in which HBS collection was specified in the protocol. Findings were combined to determine the extent to which countries that are study sites for HBS-related research are supported by regulatory guidance language on the collection, use, ownership and storage of biospecimens. Of the 49 SSA countries, 29 had some form of national ethics guidance, yet only 17 provided language relating to HBS-related research, with specific guidance on consent (14), ownership (6), reuse (10), storage (9), and export/import/transfer (13). Ten countries accounted for 84 % of the active clinical trials involving the collection of HBS in SSA. All except one of these countries were found to have some national guidance in the form of regulations, codes of ethics, and/or standard operating procedures; however, only seven of the ten offered any language specific to HBS. Despite the fact that the bulk of registered clinical trials in SSA involving HBS, as well as existing and proposed sites for biorepositories under the H3Africa Initiative, are currently situated in countries with the most complete ethics and regulatory guidance, variability in the regulations themselves may create challenges for planned and future pan-African collaborations and may require legislative action at the national level to revise. Countries in SSA that still lack regulatory guidance on HBS will require extensive health system strengthening in

  2. Development of EST-derived markers in Dendrobium from EST of related taxa

    OpenAIRE

    Narisa Juejun; Chataporn Chunwongse; Julapark Chunwongse

    2013-01-01

    Public databases are useful for molecular marker development. The major aim of this study was to develop expressedsequence tag (EST)-derived markers in Dendrobium from available ESTs of Phalaenopsis and Dendrobium. A total of 6063sequences were screened for simple sequence repeats (SSRs) and introns. Primers flanking these regions were generated andtested on genomic DNAs of Phalaenopsis and Dendrobium. Twenty-three percent of amplifiable Phalaenopsis EST-derivedmarkers were cross-genera trans...

  3. The history and composition of the Raymond A. Dart Collection of Human Skeletons at the University of the Witwatersrand, Johannesburg, South Africa.

    Science.gov (United States)

    Dayal, Manisha R; Kegley, Anthony D T; Strkalj, Goran; Bidmos, Mubarak A; Kuykendall, Kevin L

    2009-10-01

    The Raymond A. Dart Collection of Human Skeletons (Dart Collection) is housed in the School of Anatomical Sciences at the University of the Witwatersrand, Johannesburg, South Africa, and comprises one of the largest documented cadaver-derived human skeletal assemblages in the world. This collection originated in the early 1920s as a result of the efforts of Raymond Dart and continues to grow. The skeletons included represent varied indigenous and immigrant populations from southern Africa, Europe and Asia. This contribution documents the history of the collection and provides an updated inventory and demographic assessment of this valuable research collection. According to a recent inventory the Dart Collection currently comprises 2,605 skeletons representing individuals from regional SA African (76%), White (15%), Coloured (4%) and Indian (0.3%) populations. A large proportion of the skeletons (71%) represent males. The recorded ages at death range from the first year to over 100 years of age, but the majority of individuals died between the ages of 20 and 70. The Dart Collection has been affected by collection procedures based on availability. All of the cadavers collected before 1958, and large proportions subsequently, were derived from unclaimed bodies in regional South African hospitals. Some details of documentation (age at death, population group) are estimates and some aspects of the collection demographics (sex ratios) do not closely reflect any living South African population. Our inventory and analysis of the Dart Collection is aimed to assist researchers planning research on the materials from this collection.

  4. ESAP plus: a web-based server for EST-SSR marker development.

    Science.gov (United States)

    Ponyared, Piyarat; Ponsawat, Jiradej; Tongsima, Sissades; Seresangtakul, Pusadee; Akkasaeng, Chutipong; Tantisuwichwong, Nathpapat

    2016-12-22

    Simple sequence repeats (SSRs) have become widely used as molecular markers in plant genetic studies due to their abundance, high allelic variation at each locus and simplicity to analyze using conventional PCR amplification. To study plants with unknown genome sequence, SSR markers from Expressed Sequence Tags (ESTs), which can be obtained from the plant mRNA (converted to cDNA), must be utilized. With the advent of high-throughput sequencing technology, huge EST sequence data have been generated and are now accessible from many public databases. However, SSR marker identification from a large in-house or public EST collection requires a computational pipeline that makes use of several standard bioinformatic tools to design high quality EST-SSR primers. Some of these computational tools are not users friendly and must be tightly integrated with reference genomic databases. A web-based bioinformatic pipeline, called EST Analysis Pipeline Plus (ESAP Plus), was constructed for assisting researchers to develop SSR markers from a large EST collection. ESAP Plus incorporates several bioinformatic scripts and some useful standard software tools necessary for the four main procedures of EST-SSR marker development, namely 1) pre-processing, 2) clustering and assembly, 3) SSR mining and 4) SSR primer design. The proposed pipeline also provides two alternative steps for reducing EST redundancy and identifying SSR loci. Using public sugarcane ESTs, ESAP Plus automatically executed the aforementioned computational pipeline via a simple web user interface, which was implemented using standard PHP, HTML, CSS and Java scripts. With ESAP Plus, users can upload raw EST data and choose various filtering options and parameters to analyze each of the four main procedures through this web interface. All input EST data and their predicted SSR results will be stored in the ESAP Plus MySQL database. Users will be notified via e-mail when the automatic process is completed and they can

  5. Estimation of the Human Extrathoracic Deposition Fraction of Inhaled Particles Using a Polyurethane Foam Collection Substrate in an IOM Sampler

    Directory of Open Access Journals (Sweden)

    Darrah K. Sleeth

    2016-03-01

    Full Text Available Extrathoracic deposition of inhaled particles (i.e., in the head and throat is an important exposure route for many hazardous materials. Current best practices for exposure assessment of aerosols in the workplace involve particle size selective sampling methods based on particle penetration into the human respiratory tract (i.e., inhalable or respirable sampling. However, the International Organization for Standardization (ISO has recently adopted particle deposition sampling conventions (ISO 13138, including conventions for extrathoracic (ET deposition into the anterior nasal passage (ET1 and the posterior nasal and oral passages (ET2. For this study, polyurethane foam was used as a collection substrate inside an inhalable aerosol sampler to provide an estimate of extrathoracic particle deposition. Aerosols of fused aluminum oxide (five sizes, 4.9 µm–44.3 µm were used as a test dust in a low speed (0.2 m/s wind tunnel. Samplers were placed on a rotating mannequin inside the wind tunnel to simulate orientation-averaged personal sampling. Collection efficiency data for the foam insert matched well to the extrathoracic deposition convention for the particle sizes tested. The concept of using a foam insert to match a particle deposition sampling convention was explored in this study and shows promise for future use as a sampling device.

  6. Estimation of the Human Extrathoracic Deposition Fraction of Inhaled Particles Using a Polyurethane Foam Collection Substrate in an IOM Sampler.

    Science.gov (United States)

    Sleeth, Darrah K; Balthaser, Susan A; Collingwood, Scott; Larson, Rodney R

    2016-03-07

    Extrathoracic deposition of inhaled particles (i.e., in the head and throat) is an important exposure route for many hazardous materials. Current best practices for exposure assessment of aerosols in the workplace involve particle size selective sampling methods based on particle penetration into the human respiratory tract (i.e., inhalable or respirable sampling). However, the International Organization for Standardization (ISO) has recently adopted particle deposition sampling conventions (ISO 13138), including conventions for extrathoracic (ET) deposition into the anterior nasal passage (ET₁) and the posterior nasal and oral passages (ET₂). For this study, polyurethane foam was used as a collection substrate inside an inhalable aerosol sampler to provide an estimate of extrathoracic particle deposition. Aerosols of fused aluminum oxide (five sizes, 4.9 µm-44.3 µm) were used as a test dust in a low speed (0.2 m/s) wind tunnel. Samplers were placed on a rotating mannequin inside the wind tunnel to simulate orientation-averaged personal sampling. Collection efficiency data for the foam insert matched well to the extrathoracic deposition convention for the particle sizes tested. The concept of using a foam insert to match a particle deposition sampling convention was explored in this study and shows promise for future use as a sampling device.

  7. Estágio na Compta

    OpenAIRE

    Mendes, Dário Miguel dos Santos

    2017-01-01

    O presente documento descreve o trabalho realizado no segundo ano letivo do Mestrado em Produção de Conteúdos Digitais. Relatando um estágio decorrido na empresa tecnológica Compta S.A. Neste relatório é feita uma apresentação da empresa, bem como os seus objetivos como tal. De seguida, efetua-se um enquadramento do estágio no âmbito contextual dos conteúdos digitais, descrevendo as tecnologias utilizadas, necessárias à criação de aplicações para dispositivos móveis. São ainda apresentados...

  8. Estética, Subjetividad y Conocimiento

    Directory of Open Access Journals (Sweden)

    López Avendaño, Olimpia

    2002-12-01

    Full Text Available Este artículo trata de la tradicional dicotomía conocimiento objetivo-subjetivo. En él se analiza la posición de diferentes autores en búsqueda de los elementos que conducen al nacimiento de un nuevo paradigma, integrador, que supere la antinomia y permita visualizar al conocimiento pero sobre todo al individuo que lo produce, integralmente.

  9. Amar por cartas - este inferno de amara

    Directory of Open Access Journals (Sweden)

    Matildes Demetrio dos Santos

    1999-10-01

    Full Text Available Este trabalho tem por objetivo estudar o amor nas Folhas caídas e nas Cartas de amor à Viscondessa da Luz, de Almeida Garrett.Seus poemas cheios de erotismo e sensua lidade, inspirados numa mulher casada, Rosa Montúrar Infante, escandalizaram a sociedade portuguesado sécu lo XIX. Suas cartas de amor, em segredo, criavam uma ficção de características místicas.

  10. Screening in a Lactobacillus delbrueckii subsp. bulgaricus collection to select a strain able to survive to the human intestinal tract.

    Science.gov (United States)

    Vázquez, Clotilde; Botella-Carretero, José I; García-Albiach, Raimundo; Pozuelo, María J; Rodríguez-Baños, Mercedes; Baquero, Fernando; Baltadjieva, María A; del Campo, Rosa

    2013-01-01

    Genetic diversity and resistance of Lactobacillus bulgaricus sbsp. delbrueckii collection with 100 isolates from different home-made yogurt in rural Bulgarian areas were determined. The strain K98 was the most resistant to bile salts and low pH. Survival and effects on short chain fatty acids production were tested in 20 healthy volunteers. High genetic diversity was observed in the L. bulgaricus collection by RAPD, whereas the ability of tolerate high deoxycholic acid concentrations, and different acid pHs was variable. The strain K98 was selected and used to prepare a homemade yogurt which was administered to 20 healthy volunteers (500 ml/day during 15d). A basal faecal sample and another after yogurt intake were recovered. DGGE experiments, using both universal and Lactic Acid Bacteria (LAB) primers, demonstrated no significant changes in the qualitative composition of gut microbiota. A band corresponding to L. bulgaricus was observed in all 20 samples. Viable L. bulgaricus K98 strain was only recovered in one volunteer. After yogurt intake we found an increase of LAB and Clostridium perfringens, and a decrease of Bacteroides- Prevotella-Porphyromonas. In addition, increases of acetic, butyric and 2-hydroxy-butyric acids in faeces were detected. Genetic diversity of L. delbrueckii subsp. bulgaricus especie is high We have isolated a probiotic resistant strain to bile and high acidity, L. delbrueckii subsp. bulgaricus-K98. Qualitative and quantitative changes in the intestinal microbiota are found after ingestion of a homemade yogurt containing this strain, with a concomitant increase in faecal SCFA. Our findings support the interest in developing further studies providing different amounts of L. delbrueckii subsp. bulgaricus-K98, and should evaluate its clinical effects in human disease. Copyright © AULA MEDICA EDICIONES 2013. Published by AULA MEDICA. All rights reserved.

  11. REDVET está indexada en Scirus

    OpenAIRE

    veterinaria.org

    2009-01-01

    ResumenA veces, la búsqueda en Internet de artículos científicos se convierte en una pesadilla, por lo que es conveniente recurrir a buscadores temáticos y en este aspecto Scirus es una buena opción ya que es uno de los mejores buscadores de temática científica de la Red pues busca en más de 450 millones de páginas web científicas con una búsqueda muy rápida y con resultados sorprendentes.

  12. Le bonheur est dans les airs

    OpenAIRE

    Robène, Luc; Bodin, Dominique; Héas, Stéphane

    2010-01-01

    A partir des années 1880, en France, la dimension touristique des ascensions en ballon prend une importance croissante. En marge des pratiques strictement utilitaires de l'aérostation s’élabore un univers davantage tourné vers la communion et / ou vers le face-à-face de l'homme avec la nature en altitude. L'observation du milieu aérien, la confrontation avec la sauvagerie des éléments et le bien-être que l'environnement vierge des hauteurs est susceptible de procurer aux aéronautes constituen...

  13. Monitoring the environment and human sentiment on the Great Barrier Reef: Assessing the potential of collective sensing.

    Science.gov (United States)

    Becken, Susanne; Stantic, Bela; Chen, Jinyan; Alaei, Ali Reza; Connolly, Rod M

    2017-12-01

    With the growth of smartphone usage the number of social media posts has significantly increased and represents potentially valuable information for management, including of natural resources and the environment. Already, evidence of using 'human sensor' in crises management suggests that collective knowledge could be used to complement traditional monitoring. This research uses Twitter data posted from the Great Barrier Reef region, Australia, to assess whether the extent and type of data could be used to Great Barrier Reef organisations as part of their monitoring program. The analysis reveals that large amounts of tweets, covering the geographic area of interest, are available and that the pool of information providers is greatly enhanced by the large number of tourists to this region. A keyword and sentiment analysis demonstrates the usefulness of the Twitter data, but also highlights that the actual number of Reef-related tweets is comparatively small and lacks specificity. Suggestions for further steps towards the development of an integrative data platform that incorporates social media are provided. Copyright © 2017 Elsevier Ltd. All rights reserved.

  14. Signaling pathways in a Citrus EST database

    Directory of Open Access Journals (Sweden)

    Angela Mehta

    2007-01-01

    Full Text Available Citrus spp. are economically important crops, which in Brazil are grown mainly in the State of São Paulo. Citrus cultures are attacked by several pathogens, causing severe yield losses. In order to better understand this culture, the Millenium Project (IAC Cordeirópolis was launched in order to sequence Citrus ESTs (expressed sequence tags from different tissues, including leaf, bark, fruit, root and flower. Plants were submitted to biotic and abiotic stresses and investigated under different development stages (adult vs. juvenile. Several cDNA libraries were constructed and the sequences obtained formed the Citrus ESTs database with almost 200,000 sequences. Searches were performed in the Citrus database to investigate the presence of different signaling pathway components. Several of the genes involved in the signaling of sugar, calcium, cytokinin, plant hormones, inositol phosphate, MAPKinase and COP9 were found in the citrus genome and are discussed in this paper. The results obtained may indicate that similar mechanisms described in other plants, such as Arabidopsis, occur in citrus. Further experimental studies must be conducted in order to understand the different signaling pathways present.

  15. AcEST(EST sequences of Adiantum capillus-veneris and their annotation) - AcEST | LSDB Archive [Life Science Database Archive metadata

    Lifescience Database Archive (English)

    Full Text Available List Contact us AcEST AcEST(EST sequences of Adiantum capillus-veneris and their annotation) Data detail Dat...a name AcEST(EST sequences of Adiantum capillus-veneris and their annotation) DOI 10.18908/lsdba.nbdc00839-0...01 Description of data contents EST sequence of Adiantum capillus-veneris and its annotation (clone ID, libr...le search URL http://togodb.biosciencedbc.jp/togodb/view/archive_acest#en Data acquisition method Capillary ...ainst UniProtKB/Swiss-Prot and UniProtKB/TrEMBL databases) Number of data entries Adiantum capillus-veneris

  16. A salmonid EST genomic study: genes, duplications, phylogeny and microarrays

    Directory of Open Access Journals (Sweden)

    Brahmbhatt Sonal

    2008-11-01

    Full Text Available Abstract Background Salmonids are of interest because of their relatively recent genome duplication, and their extensive use in wild fisheries and aquaculture. A comprehensive gene list and a comparison of genes in some of the different species provide valuable genomic information for one of the most widely studied groups of fish. Results 298,304 expressed sequence tags (ESTs from Atlantic salmon (69% of the total, 11,664 chinook, 10,813 sockeye, 10,051 brook trout, 10,975 grayling, 8,630 lake whitefish, and 3,624 northern pike ESTs were obtained in this study and have been deposited into the public databases. Contigs were built and putative full-length Atlantic salmon clones have been identified. A database containing ESTs, assemblies, consensus sequences, open reading frames, gene predictions and putative annotation is available. The overall similarity between Atlantic salmon ESTs and those of rainbow trout, chinook, sockeye, brook trout, grayling, lake whitefish, northern pike and rainbow smelt is 93.4, 94.2, 94.6, 94.4, 92.5, 91.7, 89.6, and 86.2% respectively. An analysis of 78 transcript sets show Salmo as a sister group to Oncorhynchus and Salvelinus within Salmoninae, and Thymallinae as a sister group to Salmoninae and Coregoninae within Salmonidae. Extensive gene duplication is consistent with a genome duplication in the common ancestor of salmonids. Using all of the available EST data, a new expanded salmonid cDNA microarray of 32,000 features was created. Cross-species hybridizations to this cDNA microarray indicate that this resource will be useful for studies of all 68 salmonid species. Conclusion An extensive collection and analysis of salmonid RNA putative transcripts indicate that Pacific salmon, Atlantic salmon and charr are 94–96% similar while the more distant whitefish, grayling, pike and smelt are 93, 92, 89 and 86% similar to salmon. The salmonid transcriptome reveals a complex history of gene duplication that is

  17. Judy Estes Hall (1940-2015).

    Science.gov (United States)

    Sammons, Morgan T; Boucher, Andrew

    2016-01-01

    Presents an obituary for Judy Estes Hall, who passed away on November 24, 2015. Hall served as the Executive Officer of the National Register of Health Service Psychologists until her retirement in 2013. She is a recognized expert in the development of education and training standards for the profession of psychology, she also made significant contributions in the field of international psychology, where she was a renowned expert in cross-national credentialing and an advocate for commonality in licensing standards. She was the coauthor of one edited volume and author of more than 60 journal articles, book chapters, and professional publications. A passionate advocate for the advancement of women in psychology, a devoted mother and grandmother, a connoisseur of wine and international traveler extraordinaire, she touched the personal and professional lives of many. (PsycINFO Database Record (c) 2016 APA, all rights reserved).

  18. Marketing! Onde está o Paradigma?

    Directory of Open Access Journals (Sweden)

    Deosir Flávio Lobo de Castro Júnior

    2015-09-01

    Full Text Available O debate quantitativo-qualitativo, não é uma discussão recente. O objetivo desse trabalho, portanto, é verificar por meio do conceito de paradigma, novas perspectivas de compreender as pesquisas acadêmicas em marketing, a evolução do pensamento de marketing e as metodologias utilizadas nos estudos da qualidade de serviço. Sem a pretensão de esgotar este assunto e apresentar uma conclusão final, são apresentadas pesquisas que apontam para a necessidade e a importância da pesquisa qualitativa, uma vez que auxilia ao pesquisador uma melhor compreensão da natureza complexa do mundo social em que vivemos. Segundo Santana e Gomes (2007, após análise da discussão de Hegel e Kant, concluem que a razão e a própria epistemologia são construções históricas e evoluem a partir de contradições. O presente artigo está dividido em cinco momentos. Na primeira parte apresenta-se além da introdução a constituição dos objetivos desse ensaio teórico. Na segunda parte apresenta-se uma breve discussão a respeito do conceito de paradigma e o marketing. Na terceira parte apresenta-se uma retrospectiva histórica do marketing e sua evolução de suas escolas a partir dos estudos de Miranda e Arruda (2004. Na quarta parte, são apresentadas as metodologias dos estudos sobre qualidade de serviços e finalmente na quinta parte apresenta-se as considerações finais.

  19. Crystallization and preliminary X-ray crystallographic analysis of EstE1, a new and thermostable esterase cloned from a metagenomic library

    Energy Technology Data Exchange (ETDEWEB)

    Byun, Jung-Sue [Department of Biology, Yonsei University, Seoul 120-749 (Korea, Republic of); Protein Network Research Center, Yonsei University, Seoul 120-749 (Korea, Republic of); Rhee, Jin-Kyu [Department of Biotechnology, Yonsei University, Seoul 120-749 (Korea, Republic of); Kim, Dong-Uk [Department of Biology, Yonsei University, Seoul 120-749 (Korea, Republic of); Oh, Jong-Won [Department of Biotechnology, Yonsei University, Seoul 120-749 (Korea, Republic of); Cho, Hyun-Soo, E-mail: hscho8@yonsei.ac.kr [Department of Biology, Yonsei University, Seoul 120-749 (Korea, Republic of); Protein Network Research Center, Yonsei University, Seoul 120-749 (Korea, Republic of)

    2006-02-01

    Recombinant EstE1 protein with a histidine tag at the C-terminus was overexpressed in Escherichia coli strain BL21(DE3) and then purified by affinity chromatography. The protein was then crystallized at 290 K by the hanging-drop vapour-diffusion method. EstE1, a new thermostable esterase, was isolated by functional screening of a metagenomic DNA library from thermal environment samples. This enzyme showed activity towards short-chain acyl derivatives of length C4–C6 at a temperature of 303–363 K and displayed a high thermostability above 353 K. EstE1 has 64 and 57% amino-acid sequence similarity to est{sub pc}-encoded carboxylesterase from Pyrobaculum calidifontis and AFEST from Archaeoglobus fulgidus, respectively. The recombinant protein with a histidine tag at the C-terminus was overexpressed in Escherichia coli strain BL21(DE3) and then purified by affinity chromatography. The protein was crystallized at 290 K by the hanging-drop vapour-diffusion method. X-ray diffraction data were collected to 2.3 Å resolution from an EstE1 crystal; the crystal belongs to space group P4{sub 1}2{sub 1}2, with unit-cell parameters a = b = 73.71, c = 234.23 Å. Assuming the presence of four molecules in the asymmetric unit, the Matthews coefficient V{sub M} is calculated to be 2.2 Å{sup 3} Da{sup −1} and the solvent content is 44.1%.

  20. Collection and classification of human reliability data for use in probabilistic safety assessments. Final report of a co-ordinated research programme 1995-1998

    International Nuclear Information System (INIS)

    1998-10-01

    One of the most important lessons from abnormal events in NPPs is that they often result from incorrect human action. The awareness of the importance of human factors and human reliability has increased significantly over 10-15 years primarily owing to the fact that some major incidents (nuclear or non-nuclear) have had significant human error contributions. Each of these incidents have revealed different types of human errors, some of which were not generally recognized prior to the incident. The analysis of these events led to wide recognition of the fact that more information about human actions and errors is needed to improve the safety and operation of nuclear power plants. At the same time, the need or proper human reliability data was recognised in view of probabilistic safety assessment (PSA). No PSA study can be regarded as complete and accurate without adequate incorporation of human reliability analysis (HRA). In order to support incorporation of human reliability data into PSA the IAEA established a coordinated research programme with the objective to develop a common data base structure for human errors that might have important contributions to risk in different types of reactors. This report is a product of four years of coordinated research and describes the data collection and classification schemes currently in use in Member States as well as an outlook into future, discussing what types of data might be needed to support the new improved HRA methods which are currently under development

  1. [Parasitological study of 78 cases of human cystic echinococcosis collected between 2005 to 2012 in Mustapha hospital center of Algiers].

    Science.gov (United States)

    Zait, H; Boulahbel, M; Normand, A C; Zait, F; Achir, I; Guerchani, M K; Chaouche, H; Ladjadj, Y; Hamrioui, B

    2014-12-01

    The aim of this work is to know the fertility rate of the metacestodes resulting from patients suffering from hydatidosis, the one of protoscoleces's viability and by comparing the results obtained with those found elsewhere. It reports, also, the epidemiological, clinical and diagnostically aspects of the studied patients. This study has carried on 78 hydatics samples resulting from 78 patients collected between 2005 and 2012 at the laboratory of parasitology of the Mustapha hospital center of Algiers. A questionnaire on the epidemiological context (contact with an animal-host of the cycle, place of residence, presence of family cases reached of hydatidosis and knowledge on the hydatic disease) concerned 69 patients. For each sample, a direct microscopic examination is made with or without vital staining. The presence of protoscoleces made qualified the fertile cyst. Those visualized moving or resistant to eosin at 0.2% are considered viables. Indirect diagnosis is based on the techniques: passive hemagglutination, electrophoresis, Elisa IgG Echinococcus granulosus and immunoblotting IgG "Echinococcus". Molecular analysis is based on PCR and sequencing the partials fragments of two mitochondrial genes with the primers COX1 and ND1. The results obtained show that the surgical frequency of hydatidosis is significant at the young adult and at the child. The epidemiological context associated at the disease is the conjointly presence of a dog and herbivores. The fertility rate of human hydatid cysts is 88.4% and the ones of viability of the protoscoleces is 74.5%. In this series, the serology shows global positivity at 70%. The molecular characterization of five samples identify the species: E. granulosus ss. Finally, the viability and fertility rates found here are raised. Sometimes viables protoscoleses are found after use of scolicidal solution. In front of these results, the parasitical treatment is more than necessary in order to minimize the risk of occurred of

  2. Crystal structure of hyperthermophilic esterase EstE1 and the relationship between its dimerization and thermostability properties

    Directory of Open Access Journals (Sweden)

    Koh Eunhee

    2007-07-01

    Full Text Available Abstract Background EstE1 is a hyperthermophilic esterase belonging to the hormone-sensitive lipase family and was originally isolated by functional screening of a metagenomic library constructed from a thermal environmental sample. Dimers and oligomers may have been evolutionally selected in thermophiles because intersubunit interactions can confer thermostability on the proteins. The molecular mechanisms of thermostabilization of this extremely thermostable esterase are not well understood due to the lack of structural information. Results Here we report for the first time the 2.1-Å resolution crystal structure of EstE1. The three-dimensional structure of EstE1 exhibits a classic α/β hydrolase fold with a central parallel-stranded beta sheet surrounded by alpha helices on both sides. The residues Ser154, Asp251, and His281 form the catalytic triad motif commonly found in other α/β hydrolases. EstE1 exists as a dimer that is formed by hydrophobic interactions and salt bridges. Circular dichroism spectroscopy and heat inactivation kinetic analysis of EstE1 mutants, which were generated by structure-based site-directed mutagenesis of amino acid residues participating in EstE1 dimerization, revealed that hydrophobic interactions through Val274 and Phe276 on the β8 strand of each monomer play a major role in the dimerization of EstE1. In contrast, the intermolecular salt bridges contribute less significantly to the dimerization and thermostability of EstE1. Conclusion Our results suggest that intermolecular hydrophobic interactions are essential for the hyperthermostability of EstE1. The molecular mechanism that allows EstE1 to endure high temperature will provide guideline for rational design of a thermostable esterase/lipase using the lipolytic enzymes showing structural similarity to EstE1.

  3. Development of EST-derived markers in Dendrobium from EST of related taxa

    Directory of Open Access Journals (Sweden)

    Narisa Juejun

    2013-04-01

    Full Text Available Public databases are useful for molecular marker development. The major aim of this study was to develop expressedsequence tag (EST-derived markers in Dendrobium from available ESTs of Phalaenopsis and Dendrobium. A total of 6063sequences were screened for simple sequence repeats (SSRs and introns. Primers flanking these regions were generated andtested on genomic DNAs of Phalaenopsis and Dendrobium. Twenty-three percent of amplifiable Phalaenopsis EST-derivedmarkers were cross-genera transferable to Dendrobium. Forty-one markers from both Phalaenopsis and Dendrobium thatamplified in Dendrobium were assessed on six commercial cultivars and six wild accessions. All of them were transferableamong Dendrobium species. High polymorphism and heterozygosity were observed within wild accessions. Sixteen polymorphic markers were evaluated for linkage analysis on an F1 segregating population. Seven markers were mapped into threelinkage groups, two of which showed syntenic relationship between dendrobium and rice. This relationship will facilitatefurther quantitative trait loci (QTL mapping and comparative genomic studies of Dendrobium. Our results indicate thatPhalaenopsis EST-derived markers are valuable tools for genetic research and breeding applications in Dendrobium.

  4. Punta del Este terrane : a better knowledge

    International Nuclear Information System (INIS)

    Preciozzi, F.; Sanchez Bettucci, L; Basei, M.

    2002-01-01

    Field Punta del Este (TPE) is constituted by a series of gneisses and migmatites formed in the range of 1000 and 900 Ma, and have been intensely reworked during Rio Doce orogeny (ca. 600-500 Ma). This cortical segment represents high-grade metamorphic terrain, correlatable with complex gneiss Southwest Africa, particularly with Kibariáno Belt - Namaqualanos recognized in the southwestern portion of Africa (Namibia). U-Pb zircon ages in tonalite granitoids indicate values ​​between 1000 and 900 Ma and were interpreted as indicating the time of generation of these rocks. This should also be the age of high-grade metamorphism that affected a large part of the gneissic rocks of the region. Moreover, the anatectic related mobilized leucosomes ages of migmatites gave ca. 520-540 Ma, indicating that the metamorphic conditions (overlapping) during the Rio Doce orogeny reached at least the amphibolite facies. The metasedimentary cover TPE occurs in the vicinity of the towns of La Paloma Rocha. These are represented by a siliciclastic metasedimentary sequence represented by Rocha Formation. Despite the poly phase deformation and low grade metamorphism affecting this training, primary structures are common such as stratification plano-parallel, cross-bedding, hummock y and massive levels with gradational stratification

  5. Construction of a highly flexible and comprehensive gene collection representing the ORFeome of the human pathogen Chlamydia pneumoniae

    Directory of Open Access Journals (Sweden)

    Maier Christina J

    2012-11-01

    Full Text Available Abstract Background The Gram-negative bacterium Chlamydia pneumoniae (Cpn is the leading intracellular human pathogen responsible for respiratory infections such as pneumonia and bronchitis. Basic and applied research in pathogen biology, especially the elaboration of new mechanism-based anti-pathogen strategies, target discovery and drug development, rely heavily on the availability of the entire set of pathogen open reading frames, the ORFeome. The ORFeome of Cpn will enable genome- and proteome-wide systematic analysis of Cpn, which will improve our understanding of the molecular networks and mechanisms underlying and governing its pathogenesis. Results Here we report the construction of a comprehensive gene collection covering 98.5% of the 1052 predicted and verified ORFs of Cpn (Chlamydia pneumoniae strain CWL029 in Gateway® ‘entry’ vectors. Based on genomic DNA isolated from the vascular chlamydial strain CV-6, we constructed an ORFeome library that contains 869 unique Gateway® entry clones (83% coverage and an additional 168 PCR-verified ‘pooled’ entry clones, reaching an overall coverage of ~98.5% of the predicted CWL029 ORFs. The high quality of the ORFeome library was verified by PCR-gel electrophoresis and DNA sequencing, and its functionality was demonstrated by expressing panels of recombinant proteins in Escherichia coli and by genome-wide protein interaction analysis for a test set of three Cpn virulence factors in a yeast 2-hybrid system. The ORFeome is available in different configurations of resource stocks, PCR-products, purified plasmid DNA, and living cultures of E. coli harboring the desired entry clone or pooled entry clones. All resources are available in 96-well microtiterplates. Conclusion This first ORFeome library for Cpn provides an essential new tool for this important pathogen. The high coverage of entry clones will enable a systems biology approach for Cpn or host–pathogen analysis. The high yield of

  6. Onde está a antropologia?

    Directory of Open Access Journals (Sweden)

    Mariza G. S. Peirano

    1997-10-01

    Full Text Available Este artigo examina o cenário da antropologia contemporânea mediante o contraste entre quatro livros publicados nos últimos anos, dois nos Estados Unidos (After the Fact, de Clifford Geertz, e Making PCR, de Paul Rabinow e dois na Índia (Pathways, de T. N. Madan, e Critical Events, de Veena Das. A comparação é realizada no contexto de uma breve etnografia das livrarias norte-americanas, na qual se avaliam algumas publicações recentes, assim como a reclassificação de disciplinas tradicionais. O papel indispensável dos autores e obras considerados clássicos é examinado no contexto atual, finalizando com uma agenda para reflexão sobre as possibilidades de comunicação entre antropólogos de várias origens e vertentes.This article examines the setting of contemporary anthropology by means of the contrast between four books recently published in the United States (After the Fact by Clifford Geertz and Making PCR by Paul Rabinow and India (Pathways by T. N. Madan and Critical Events by Veena Das. The comparison is made in the context of a brief ethnographic study of bookstores in the United States which evaluates several recent publications, as well as the reclassification of traditional disciplines. The indispensable role of the authors in works considered classics is examined in present-day context, concluding with a reflection on the possibility of communication between anthropologists of diverse backgrounds and perspectives.

  7. T Cell Genesis: In Vitro Veritas Est?

    OpenAIRE

    Brauer, Patrick M.; Singh, Jastaranpreet; Xhiku, Sintia; Zúñiga-Pflücker, Juan Carlos

    2016-01-01

    T cells, as orchestrators of the adaptive immune response, serve important physiological and potentially therapeutic roles, for example in cancer immunotherapy. T cells are readily isolated from patients; however, the yield of antigen-specific T cells is limited, thus making their clinical use challenging. Therefore, the generation of T lymphocytes from hematopoietic stem/progenitor cells (HSPCs) and human pluripotent stem cells (PSCs) in vitro provides an attractive method for large-scale pr...

  8. “OMNE, QUOD NON EST EX FIDE, PECCATUM EST" THE RELEVANCE OF GOOD FAITH IN CANONICAL TRANSACTIO

    Directory of Open Access Journals (Sweden)

    Sara Parini Vincenti

    2016-06-01

    Full Text Available It is quite clear that there is a canonical foundation underlying the institute of transactio. Indeed, a compromise is often reached when a dispute has already entered the litigation phase, and as such legal doctrine tends to separate the economic aspect from the ethical aspect in its interpretation. Though the Church has a necessarily imperfect system of legal sanctions at its disposal, over the centuries it has in fact played a fundamental role in the ethical aspect of compromise. Indeed, the Gospel teaches that every human relationship must be based on concordia, as concordia mater est unitatis: if parties have ignored such morals and are about to litigate, or have already started legal proceedings, the Church must exhort them to settle the dispute. This article aims to examine the relevance of two of the essential requirements of transactio –namely lis and res dubia – within the Decretals (X 1.36. 1-11 de transactionibus. The framework of this analysis is provided by the tenet Effectus transactionis est, ut ei stetur, which sanctions the effectiveness of transactio as a juristic act. The goal is to evaluate how the uncertainty of legal proceedings relates to the principle of good faith in canon law.

  9. The use of spectral skin reflectivity and laser doppler vibrometry data to determine the optimal site and wavelength to collect human vital sign signatures

    Science.gov (United States)

    Byrd, Kenneth A.; Kaur, Balvinder; Hodgkin, Van A.

    2012-06-01

    The carotid artery has been used extensively by researchers to demonstrate that Laser Doppler Vibrometry (LDV) is capable of exploiting vital sign signatures from cooperative human subjects at stando. Research indicates that, the carotid, although good for cooperative and non-traumatic scenarios, is one of the first vital signs to become absent or irregular when a casualty is hemorrhaging and in progress to circulatory (hypovolemic) shock. In an effort to determine the optimal site and wavelength to measure vital signs off human skin, a human subject data collection was executed whereby 14 subjects had their spectral skin reflectivity and vital signs measured at five collection sites (carotid artery, chest, back, right wrist and left wrist). In this paper, we present our findings on using LDV and re ectivity data to determine the optimal collection site and wavelength that should be used to sense pulse signals from quiet and relatively motionless human subjects at stando. In particular, we correlate maximum levels of re ectivity across the ensemble of 14 subjects with vital sign measurements made with an LDV at two ranges, for two scenarios.

  10. ESTE EMO and ESTE EBO - emergency response system for NPP Mochovce and NPP Bohunice V-2

    International Nuclear Information System (INIS)

    Caeny, P.; Chyly, M.; Suchon, D.; Smejkalova, E.; Fabova, V.; Mancikova, M.; Muller, P.

    2009-01-01

    Programs ESTE EMO and ESTE EBO are emergency response systems that help the crisis staff of the NPP in assessing the source term (predicted possible release of radionuclides to the atmosphere ), in assessing the urgent protective measures and sectors under threat, in assessing real release (symptoms of release really detected and observed), in calculating radiological impacts of real release, averted or avertable doses, potential doses and doses during transport or evacuation on specified routes. Both systems serve as instruments in case of severe accident (DBA or BDBA) at NPP Mochovce or NPP Bohunice, accidents with threat of release of radioactivity to the atmosphere. Systems are implemented at emergency centre of Mochovce NPP and Bohunice NPP and connected online to the sources of technological and radiological data from the reactor, primary circuit, confinement, secondary circuit, ventilation stack, from the area of NPP (TDS 1) and from the emergency planning zone (TDS 11). Systems are connected online to the sources of meteorological data, too. (authors)

  11. ESTE EMO and ESTE EBO - emergency response system for NPP Mochovce and NPP Bohunice V-2

    International Nuclear Information System (INIS)

    Caeny, P.; Chyly, M.; Suchon, D.; Smejkalova, E.; Fabova, V.; Mancikova, M.; Muller, P.

    2008-01-01

    Programs ESTE EMO and ESTE EBO are emergency response systems that help the crisis staff of the NPP in assessing the source term (predicted possible release of radionuclides to the atmosphere ), in assessing the urgent protective measures and sectors under threat, in assessing real release (symptoms of release really detected and observed), in calculating radiological impacts of real release, averted or avertable doses, potential doses and doses during transport or evacuation on specified routes. Both systems serve as instruments in case of severe accident (DBA or BDBA) at NPP Mochovce or NPP Bohunice, accidents with threat of release of radioactivity to the atmosphere. Systems are implemented at emergency centre of Mochovce NPP and Bohunice NPP and connected online to the sources of technological and radiological data from the reactor, primary circuit, confinement, secondary circuit, ventilation stack, from the area of NPP (TDS 1) and from the emergency planning zone (TDS 11). Systems are connected online to the sources of meteorological data, too. (authors)

  12. Audio-visual Collections and the User Needs of Scholars in the Humanities: a Case for Co-Development

    NARCIS (Netherlands)

    de Jong, Franciska M.G.; Ordelman, Roeland J.F.; Scagliola, Stef

    2011-01-01

    The aim of this paper is to reflect on the factors that impede a clear communication and a more fruitful collaboration between humanities scholars and ICT developers. One of the observations is that ICT-researchers who design tools for humanities researchers, are less inclined to take into account

  13. Kohvik-restoran C'est La Vie = Cafe-restaurant C'est La Vie

    Index Scriptorium Estoniae

    2008-01-01

    Kohvik-restorani C'est La Vie (Suur-Karja 5, Tallinn) sisekujundusest. Sisearhitekt: Maile Grünberg, kes kavandas ka valdavalt mööbli. Laevalgusti disainis Tõnis Vellama. Skulptuuride (koopiad) autor on keraamik Ülle Rajasalu. Maile Grünbergist, tema viimased tööd. Keldrikorruse ja I korruse plaan, 8 värv. vaadet, foto M. Grünbergist

  14. Levels of persistent fluorinated, chlorinated and brominated compounds in human blood collected in Sweden in 1997-2000

    Energy Technology Data Exchange (ETDEWEB)

    Lindstroem, G.; Kaerrman, A.; Bavel, B. van [MTM Research Centre, Oerebro Univ. (Sweden); Hardell, L. [Dept. of Oncology, Univ. Hospital, Oerebro (Sweden); Hedlund, B. [Environmental Monitoring Section, Swedish EPA, Stockholm (Sweden)

    2004-09-15

    Levels of persistent fluorinated, chlorinated and brominated compounds in blood collected from the Swedish population have been determined in connection with several exposure and monitoring studies at the MTM Research Centre. A data base with 631 individual congener specific measurements on halogenated POPs such as dioxins, PCBs, HCB, DDE, chlordanes, PBDEs and PFAs including information on residency, age, BMI, diet, occupation, number of children, smoking habits, immunological status etc. has been compiled from samples collected between 1994 and 2004. A brief overview focusing on levels of some persistent chlorinated, brominated and fluorinated, compounds in blood collected in a background population group (n=83) in 1997-2000 is given here.

  15. EST Express: PHP/MySQL based automated annotation of ESTs from expression libraries.

    Science.gov (United States)

    Smith, Robin P; Buchser, William J; Lemmon, Marcus B; Pardinas, Jose R; Bixby, John L; Lemmon, Vance P

    2008-04-10

    Several biological techniques result in the acquisition of functional sets of cDNAs that must be sequenced and analyzed. The emergence of redundant databases such as UniGene and centralized annotation engines such as Entrez Gene has allowed the development of software that can analyze a great number of sequences in a matter of seconds. We have developed "EST Express", a suite of analytical tools that identify and annotate ESTs originating from specific mRNA populations. The software consists of a user-friendly GUI powered by PHP and MySQL that allows for online collaboration between researchers and continuity with UniGene, Entrez Gene and RefSeq. Two key features of the software include a novel, simplified Entrez Gene parser and tools to manage cDNA library sequencing projects. We have tested the software on a large data set (2,016 samples) produced by subtractive hybridization. EST Express is an open-source, cross-platform web server application that imports sequences from cDNA libraries, such as those generated through subtractive hybridization or yeast two-hybrid screens. It then provides several layers of annotation based on Entrez Gene and RefSeq to allow the user to highlight useful genes and manage cDNA library projects.

  16. EST Express: PHP/MySQL based automated annotation of ESTs from expression libraries

    Directory of Open Access Journals (Sweden)

    Pardinas Jose R

    2008-04-01

    Full Text Available Abstract Background Several biological techniques result in the acquisition of functional sets of cDNAs that must be sequenced and analyzed. The emergence of redundant databases such as UniGene and centralized annotation engines such as Entrez Gene has allowed the development of software that can analyze a great number of sequences in a matter of seconds. Results We have developed "EST Express", a suite of analytical tools that identify and annotate ESTs originating from specific mRNA populations. The software consists of a user-friendly GUI powered by PHP and MySQL that allows for online collaboration between researchers and continuity with UniGene, Entrez Gene and RefSeq. Two key features of the software include a novel, simplified Entrez Gene parser and tools to manage cDNA library sequencing projects. We have tested the software on a large data set (2,016 samples produced by subtractive hybridization. Conclusion EST Express is an open-source, cross-platform web server application that imports sequences from cDNA libraries, such as those generated through subtractive hybridization or yeast two-hybrid screens. It then provides several layers of annotation based on Entrez Gene and RefSeq to allow the user to highlight useful genes and manage cDNA library projects.

  17. Impact of collection conditions on the metabolite content of human urine samples as analyzed by liquid chromatography coupled to mass spectrometry and nuclear magnetic resonance spectroscopy

    OpenAIRE

    Roux, Aurélie; Thévenot, Etienne A.; Seguin, François; Olivier, Marie-Françoise; Junot, Christophe

    2014-01-01

    There is a lack of comprehensive studies documenting the impact of sample collection conditions on metabolic composition of human urine. To address this issue, two experiments were performed at a 3-month interval, in which midstream urine samples from healthy individuals were collected, pooled, divided into several aliquots and kept under specific conditions (room temperature, 4 °C, with or without preservative) up to 72 h before storage at −80 °C. Samples were analyzed by high-performance li...

  18. Graphic and movie illustrations of human prenatal development and their application to embryological education based on the human embryo specimens in the Kyoto collection.

    Science.gov (United States)

    Yamada, Shigehito; Uwabe, Chigako; Nakatsu-Komatsu, Tomoko; Minekura, Yutaka; Iwakura, Masaji; Motoki, Tamaki; Nishimiya, Kazuhiko; Iiyama, Masaaki; Kakusho, Koh; Minoh, Michihiko; Mizuta, Shinobu; Matsuda, Tetsuya; Matsuda, Yoshimasa; Haishi, Tomoyuki; Kose, Katsumi; Fujii, Shingo; Shiota, Kohei

    2006-02-01

    Morphogenesis in the developing embryo takes place in three dimensions, and in addition, the dimension of time is another important factor in development. Therefore, the presentation of sequential morphological changes occurring in the embryo (4D visualization) is essential for understanding the complex morphogenetic events and the underlying mechanisms. Until recently, 3D visualization of embryonic structures was possible only by reconstruction from serial histological sections, which was tedious and time-consuming. During the past two decades, 3D imaging techniques have made significant advances thanks to the progress in imaging and computer technologies, computer graphics, and other related techniques. Such novel tools have enabled precise visualization of the 3D topology of embryonic structures and to demonstrate spatiotemporal 4D sequences of organogenesis. Here, we describe a project in which staged human embryos are imaged by the magnetic resonance (MR) microscope, and 3D images of embryos and their organs at each developmental stage were reconstructed based on the MR data, with the aid of computer graphics techniques. On the basis of the 3D models of staged human embryos, we constructed a data set of 3D images of human embryos and made movies to illustrate the sequential process of human morphogenesis. Furthermore, a computer-based self-learning program of human embryology is being developed for educational purposes, using the photographs, histological sections, MR images, and 3D models of staged human embryos. Copyright 2005 Wiley-Liss, Inc.

  19. In vitro cellular adaptations of indicators of longevity in response to treatment with serum collected from humans on calorie restricted diets.

    Directory of Open Access Journals (Sweden)

    Joanne S Allard

    2008-09-01

    Full Text Available Calorie restriction (CR produces several health benefits and increases lifespan in many species. Studies suggest that alternate-day fasting (ADF and exercise can also provide these benefits. Whether CR results in lifespan extension in humans is not known and a direct investigation is not feasible. However, phenotypes observed in CR animals when compared to ad libitum fed (AL animals, including increased stress resistance and changes in protein expression, can be simulated in cells cultured with media supplemented with blood serum from CR and AL animals. Two pilot studies were undertaken to examine the effects of ADF and CR on indicators of health and longevity in humans. In this study, we used sera collected from those studies to culture human hepatoma cells and assessed the effects on growth, stress resistance and gene expression. Cells cultured in serum collected at the end of the dieting period were compared to cells cultured in serum collected at baseline (before the dieting period. Cells cultured in serum from ADF participants, showed a 20% increase in Sirt1 protein which correlated with reduced triglyceride levels. ADF serum also induced a 9% decrease in proliferation and a 25% increase in heat resistance. Cells cultured in serum from CR participants induced an increase in Sirt1 protein levels by 17% and a 30% increase in PGC-1alpha mRNA levels. This first in vitro study utilizing human serum to examine effects on markers of health and longevity in cultured cells resulted in increased stress resistance and an up-regulation of genes proposed to be indicators of increased longevity. The use of this in vitro technique may be helpful for predicting the potential of CR, ADF and other dietary manipulations to affect markers of longevity in humans.

  20. Genome-wide analysis of immune system genes by EST profiling

    Science.gov (United States)

    Giallourakis, Cosmas; Benita, Yair; Molinie, Benoit; Cao, Zhifang; Despo, Orion; Pratt, Henry E.; Zukerberg, Lawrence R.; Daly, Mark J.; Rioux, John D.; Xavier, Ramnik J.

    2013-01-01

    Profiling studies of mRNA and miRNA, particularly microarray-based studies, have been extensively used to create compendia of genes that are preferentially expressed in the immune system. In some instances, functional studies have been subsequently pursued. Recent efforts such as ENCODE have demonstrated the benefit of coupling RNA-Seq analysis with information from expressed sequence tags (ESTs) for transcriptomic analysis. However, the full characterization and identification of transcripts that function as modulators of human immune responses remains incomplete. In this study, we demonstrate that an integrated analysis of human ESTs provides a robust platform to identify the immune transcriptome. Beyond recovering a reference set of immune-enriched genes and providing large-scale cross-validation of previous microarray studies, we discovered hundreds of novel genes preferentially expressed in the immune system, including non-coding RNAs. As a result, we have established the Immunogene database, representing an integrated EST “road map” of gene expression in human immune cells, which can be used to further investigate the function of coding and non-coding genes in the immune system. Using this approach, we have uncovered a unique metabolic gene signature of human macrophages and identified PRDM15 as a novel overexpressed gene in human lymphomas. Thus we demonstrate the utility of EST profiling as a basis for further deconstruction of physiologic and pathologic immune processes. PMID:23616578

  1. Evaluation of human papillomavirus detection by Abbott m2000 system on samples collected by FTA Elute™ Card in a Chinese HIV-1 positive population.

    Science.gov (United States)

    Qin, Yu; Zhang, Hongyun; Marlowe, Natalia; Fei, Mandong; Yu, Judy; Lei, Xiaoqin; Yu, Lulu; Zhang, Jia; Cao, Di; Ma, Li; Chen, Wen

    2016-12-01

    HIV+/AIDS women have an increased risk of developing into CIN and cervical cancer compared to the general population. Limited medical resource and the lack of AIDS relevant knowledge impair the coverage and efficiency of cervical cancer screening. To compare the clinical performance of self-collected dry storage medium (FTA Elute card) and physician-collected PreservCyt medium in detection of high risk human papillomavirus (HR HPV) among HIV-1 positive population. Three hundred HIV-1 positive women (aged 25-65) were recruited from Yunnan infectious hospital. Two cervicovaginal samples were collected from each participant: one was collected by the women themselves and applied on a FTA Elute card; the other one was collected by a physician and stored in PreservCyt solution. All the samples were tested for 14 HR HPV using Abbott RealTime High Risk HPV assay. Biopsies were taken for histological diagnosis if any abnormal impression was noticed under colposcopy. 291 (97.0%) of participants were eligible for this study. 101 (34.70%) participants were found HR HPV positive in both FTA card and PreservCyt samples, and 19 (6.53%) women were diagnosed as CIN2+. The HR HPV positive rate on samples collected by FTA Elute card and PreservCyt solution was 42.61% and 39.86%, respectively. The overall agreement was 87% (kappa=0.731) between FTA card and PreservCyt. The clinical sensitivity and specificity of FTA card and PreservCyt were 100%, 61.39% and 100%, 64.33%, respectively. In this study, FTA Elute card demonstrated a good performance on self-collected sample for HR HPV detection in HIV-1 positive population. For the women from low-resource area with HIV-1 infection, FTA Elute card could be an attractive sample collection method for cervical cancer screening. Copyright © 2016 Elsevier B.V. All rights reserved.

  2. PCR-Based EST Mapping in Wheat (Triticum aestivum L.

    Directory of Open Access Journals (Sweden)

    J. PERRY GUSTAFSON

    2009-04-01

    Full Text Available Mapping expressed sequence tags (ESTs to hexaploid wheat is aimed to reveal the structure and function of the hexaploid wheat genome. Sixty eight ESTs representing 26 genes were mapped into all seven homologous chromosome groups of wheat (Triticum aestivum L using a polymerase chain reaction technique. The majority of the ESTs were mapped to homologous chromosome group 2, and the least were mapped to homologous chromosome group 6. Comparative analysis between the EST map from this study and the EST map based on RFLPs showed 14 genes that have been mapped by both approaches were mapped to the same arm of the same homologous chromosome, which indicated that using PCR-based ESTs was a reliable approach in mapping ESTs in hexaploid wheat.

  3. Comparative Activity of Pradofloxacin, Enrofloxacin, and Azithromycin against Bartonella henselae Isolates Collected from Cats and a Human

    Science.gov (United States)

    Biswas, Silpak; Maggi, Ricardo G.; Papich, Mark G.; Keil, Daniel; Breitschwerdt, Edward B.

    2010-01-01

    Using Bartonella henselae isolates from cats and a human, the activity of pradofloxacin was compared with those of enrofloxacin and azithromycin. By Etest and disc diffusion assay, pradofloxacin showed greater antimicrobial activity than did other antibiotics. We conclude that pradofloxacin may prove useful for the treatment of B. henselae infections. PMID:20007401

  4. Cervical Cancer Screening Preferences Among Trans-Masculine Individuals: Patient-Collected Human Papillomavirus Vaginal Swabs Versus Provider-Administered Pap Tests.

    Science.gov (United States)

    McDowell, Michal; Pardee, Dana J; Peitzmeier, Sarah; Reisner, Sari L; Agénor, Madina; Alizaga, Natalie; Bernstein, Ida; Potter, Jennifer

    2017-08-01

    Trans-masculine (TM, i.e., persons who have a masculine spectrum gender identity, but were assigned female sex at birth) individuals face disparities in cervical cancer screening rates compared to cisgender women. Some unique barriers to screening in this population are specific to Pap tests. Introduction of self-collected frontal (i.e., vaginal) swabs for human papillomavirus (HPV) testing as a screening strategy may obviate these barriers. This study elucidates cervical cancer screening preferences among TM individuals. TM individuals participated in in-depth interviews (n = 31) and online surveys (n = 32) to explore perceptions and experiences regarding cervical cancer screening, including the acceptability of self-collected frontal HPV swabs for cervical cancer screening compared to provider-administered Pap tests. Provider-collected frontal HPV swab acceptability was also explored. Most TM individuals (94% in-person and 91% online participants) preferred either the self- or provider-collected frontal HPV swab to the Pap test. Participants perceived self- and provider-collected frontal HPV swabs to be less invasive, provoke less gender discordance, and promote a greater sense of agency compared to Pap tests. However, some participants expressed concern about HPV swab accuracy and, regarding the self-collected swab, discomfort about the need to engage with genitals they may not want to acknowledge. Individuals who reported positive provider relationships found Pap tests and provider-collected frontal swabs more acceptable than those who did not. Frontal HPV swabs have the potential to promote regular cervical cancer screening among TM individuals and to narrow screening disparities. Work is ongoing to establish swab accuracy and develop shared decision-making tools.

  5. How can Human Intelligence Enhance Collection in an Era of Un-manned Technology and Reduced Personnel?

    Science.gov (United States)

    2014-12-12

    nexus of intelligence and technology is like a new toy for a small child . The President, the CIA, and the entire intelligence community have become...that could. The espionage trade was developed by using the technology available at the time, and incorporating any means available to collect relevant...reduced immediate need, such as an ongoing or developing conflict or war, is it responsible to maintain a capability just in case, where there may be an

  6. Generation of EST and Microarray Resources for Functional Genomic Studies on Chicken Intestinal Health

    NARCIS (Netherlands)

    Hemert, van S.; Ebbelaar, B.H.; Smits, M.A.; Rebel, J.M.J.

    2003-01-01

    Expressed sequenced tags (ESTs) and microarray resources have a great impact on the ability to study host response in mice and humans. Unfortunately, these resources are not yet available for domestic farm animals. The aim of this study was to provide genomic resources to study chicken intestinal

  7. The UK Biobank sample handling and storage protocol for the collection, processing and archiving of human blood and urine.

    Science.gov (United States)

    Elliott, Paul; Peakman, Tim C

    2008-04-01

    UK Biobank is a large prospective study in the UK to investigate the role of genetic factors, environmental exposures and lifestyle in the causes of major diseases of late and middle age. Extensive data and biological samples are being collected from 500,000 participants aged between 40 and 69 years. The biological samples that are collected and how they are processed and stored will have a major impact on the future scientific usefulness of the UK Biobank resource. The aim of the UK Biobank sample handling and storage protocol is to specify methods for the collection and storage of participant samples that give maximum scientific return within the available budget. Processing or storage methods that, as far as can be predicted, will preclude current or future assays have been avoided. The protocol was developed through a review of the literature on sample handling and processing, wide consultation within the academic community and peer review. Protocol development addressed which samples should be collected, how and when they should be processed and how the processed samples should be stored to ensure their long-term integrity. The recommended protocol was extensively tested in a series of validation studies. UK Biobank collects about 45 ml blood and 9 ml of urine with minimal local processing from each participant using the vacutainer system. A variety of preservatives, anti-coagulants and clot accelerators is used appropriate to the expected end use of the samples. Collection of other material (hair, nails, saliva and faeces) was also considered but rejected for the full cohort. Blood and urine samples from participants are transported overnight by commercial courier to a central laboratory where they are processed and aliquots of urine, plasma, serum, white cells and red cells stored in ultra-low temperature archives. Aliquots of whole blood are also stored for potential future production of immortalized cell lines. A standard panel of haematology assays is

  8. Assessment of high-risk human papillomavirus infections using clinician- and self-collected cervical sampling methods in rural women from far western Nepal.

    Directory of Open Access Journals (Sweden)

    Derek C Johnson

    Full Text Available Nepal has one of the highest cervical cancer rates in South Asia. Only a few studies in populations from urban areas have investigated type specific distribution of human papillomavirus (HPV in Nepali women. Data on high-risk HPV (HR-HPV types are not currently available for rural populations in Nepal. We aimed to assess the distribution of HR- HPV among rural Nepali women while assessing self-collected and clinician-collected cervico-vaginal specimens as sample collection methods for HPV screening.Study participants were recruited during a health camp conducted by Nepal Fertility Care Center in Achham District of rural far western Nepal. Women of reproductive age completed a socio-demographic and clinical questionnaire, and provided two specimens; one cervical-vaginal specimen using a self-collection method and another cervical specimen collected by health camp auxiliary nurse midwives during a pelvic examination. All samples were tested for 14 different HR-HPV mRNA and also specific for HPV16/18/45 mRNA.Of 261 women with both clinician- and self-collected cervical samples, 25 tested positive for HR-HPV, resulting in an overall HR-HPV prevalence of 9.6% (95% confidence Interval [CI]: 6.3-13.8. The overall Kappa value assessing agreement between clinician- and self-collected tests was 0.62 (95% CI: 0.43-0.81, indicating a "good" level of agreement. Abnormal cytology was reported for 8 women. One woman identified with squamous cell carcinoma (SCC, and 7 women with high grade squamous intraepithelial lesions (HSIL. Seven of the 8 women tested positive for HR-HPV (87.5% in clinician-collected samples and 6 in self-collected samples (75.0%.This is the first study to assess HR-HPV among rural Nepali women. Self-collected sampling methods should be the subject of additional research in Nepal for screening HR-HPV, associated with pre-cancer lesions and cancer, in women in rural areas with limited access to health services.

  9. Ceci n'est pas une pipe

    Directory of Open Access Journals (Sweden)

    Luis Rojo de Castro

    2012-12-01

    reflection on the processes of decontextualization of objects pertaining to modern culture. It starts its journey with images of the Ethnographic Museum at the Trocadero in Paris, founded in 1878 and transformed into the  Museum of Man in 1930. The thesis of the article is about  uncovering the cultural and productive mechanisms of  decontextualization and re‐contextualization characteristic of the 20th century, based on the original images of the Ethnographic Museum and of artists such as Braque, Breton or Picasso, along with images of urban spaces from that particular period of time  (galleries and arcades.
    All these photographs have something in common: they offer us interior and interiorized spaces in which objects are grouped together and float with a surprising degree of autonomy. They  are fragments from other cultures, other systems, that are now “collected” together next to other fragments. Alien to their  original function, decontextualized from their original  environment, they now share a common space, forced to  participate in a system of relations that turns them into objects, makes them opaque, and separates them from their origin and  “nature.” From an active role (cultural, semiotic, social, etc., they have gone to play a passive role. They have lost the meaning that belonged to them, and now they wait for the  observer to endow them with the new fruit of the relationship created between them, which will take them to a new place.
    This technique of 'strangeness and fragmentation' causes the dismemberment underlying "system objects" of our own time, in which coherence of relations systems (specific to each place has been replaced by the exuberance of simulating production and  experience.

    Key words

    decontextualization, images, mechanisms, collection, place

  10. BKE: The catalogue of Bunker-Est Vesuvian station

    International Nuclear Information System (INIS)

    Sarao, A.; Peresan, A.; Vaccari, F.; De Natale, G.; Mariano, A.

    2002-06-01

    A catalogue of 9003 earthquakes associated to the Vesuvian volcano activity as recorded at Bunker Est station (BKE), located on Mt. Vesuvius and operated by the Osservatorio Vesuviano (OV), is presented here. The aim of this catalogue is to integrate the information collected in the catalogue compiled by OV that contains the volcanic earthquakes recorded at station OVO (OVO catalogue) since February 1972. A brief statistical description of the data included in the catalogue BKE and of the empirical relations used for the estimate of the magnitude MBKE from the duration is provided, together with the essential information about the catalogue source. A complete list of the events reported in the catalogue BKE and a description of its format is given in the Appendix. The catalogue BKE has been realized with the cooperation of the University of Trieste - Department of Earth Sciences, the International Centre for Theoretical Physics (ICTP) - Structure and Non-linear Dynamics of the earth (SAND) Group, and the Osservatorio Vesuviano of Naples in the framework of the project 'Eruptive Scenarios from Physical Modeling and Experimental Volcanology' funded by INGV. (author)

  11. Characterization and multiplexing of EST-SSR primers in Cynodon (Poaceae) species1.

    Science.gov (United States)

    Jewell, Margaret C; Frere, Celine H; Prentis, Peter J; Lambrides, Christopher J; Godwin, Ian D

    2010-10-01

    Cynodon species are multiple-use grasses that display varying levels of adaptation to biotic and abiotic stress. Previously identified EST-SSR primers were characterized and multiplexed to assess the level of genetic diversity present within a collection of almost 1200 Cynodon accessions from across Australia. • Two multiplex reactions were developed comprising a total of 16 EST-SSR markers. All SSR markers amplified across different Cynodon species and different levels of ploidy. The number of alleles ranged from one to eight per locus and the total number of alleles for the germplasm collection was 79. • The 16 markers show sufficient variation for the characterization of Cynodon core collections and analysis of population genetic diversity in Cynodon grasses.

  12. Impact of collection conditions on the metabolite content of human urine samples as analyzed by liquid chromatography coupled to mass spectrometry and nuclear magnetic resonance spectroscopy.

    Science.gov (United States)

    Roux, Aurélie; Thévenot, Etienne A; Seguin, François; Olivier, Marie-Françoise; Junot, Christophe

    There is a lack of comprehensive studies documenting the impact of sample collection conditions on metabolic composition of human urine. To address this issue, two experiments were performed at a 3-month interval, in which midstream urine samples from healthy individuals were collected, pooled, divided into several aliquots and kept under specific conditions (room temperature, 4 °C, with or without preservative) up to 72 h before storage at -80 °C. Samples were analyzed by high-performance liquid chromatography coupled to high-resolution mass spectrometry and bacterial contamination was monitored by turbidimetry. Multivariate analyses showed that urinary metabolic fingerprints were affected by the presence of preservatives and also by storage at room temperature from 24 to 72 h, whereas no change was observed for urine samples stored at 4 °C over a 72-h period. Investigations were then focused on 280 metabolites previously identified in urine: 19 of them were impacted by the kind of sample collection protocol in both experiments, including 12 metabolites affected by bacterial contamination and 7 exhibiting poor chemical stability. Finally, our results emphasize that the use of preservative prevents bacterial overgrowth, but does not avoid metabolite instability in solution, whereas storage at 4 °C inhibits bacterial overgrowth at least over a 72-h period and slows the chemical degradation process. Consequently, and for further LC/MS analyses, human urine samples should be kept at 4 °C if their collection is performed over 24 h.

  13. Palaeo-ethnology, palaeo-environment and palaeo-climatology of Piaui, Brazil: palynological studies on human coprolites collected at the ''Pedra Furada'' site

    International Nuclear Information System (INIS)

    Chaves, S.; Renault-Miskovsky, J.

    1996-01-01

    Fossil human faeces were collected from the rock-shelter of ''Pedra Furada'' (Piaui, Brazil), which is considered nowadays as one of the most ancient prehistoric sites in America. These dated coprolites range from 8,500 to 7,000 BP and are evidence of an occupation phase connected with ''Serra Talhada'' cultural traditions I and II. These coprolites were analysed by palynological studies. The results have given palaeo-climatological and palaeo-environmental data with an emphasis on palaeo-ethnological aspects. Evidence emerges regarding the range of medicinal and food plants of the prehistoric humans who inhabited the site for some 1,500 years. (authors). 32 refs., 3 figs

  14. Relatório de Estágio Curricular – Coficab Portugal (Guarda)

    OpenAIRE

    Antunes, Maria

    2014-01-01

    O estágio desenvolveu-se a partir de um plano de atividades previamente definidas. A saber: Acompanhamento da implementação da nova plataforma de recursos humanos – Global Human Resources (GHR) – passando pelas seguintes áreas de recursos humanos: · Processamento salarial (Controlo de Ponto); · Gestão da Formação; · Higiene, Saúde e Segurança no Trabalho; · Self-Service O estágio englobou também outras tarefas noutras áreas, nomeadamente: · Recrutamento e Seleção; · Av...

  15. EST data - RED | LSDB Archive [Life Science Database Archive metadata

    Lifescience Database Archive (English)

    Full Text Available switchLanguage; BLAST Search Image Search Home About Archive Update History Data ...st.zip File URL: ftp://ftp.biosciencedbc.jp/archive/red/LATEST/red_est.zip File size: 629 KB Simple search U...ase Database Description Download License Update History of This Database Site Policy | Contact Us EST data - RED | LSDB Archive ...

  16. Analysis of SSR information in EST resources of sugarcane

    Science.gov (United States)

    Expressed sequence tags ( ESTs) offer the opportunity to exploit single, low -copy, conserved sequence motifs for the development of simple sequence repeats ( SSRs). The total of 262 113 ESTs of sugarcane (Saccharum officinarum) in the database of NCBI were downloaded and analyzed, which resulted in...

  17. ConiferEST: an integrated bioinformatics system for data reprocessing and mining of conifer expressed sequence tags (ESTs

    Directory of Open Access Journals (Sweden)

    Carter Kikia

    2007-05-01

    Full Text Available Abstract Background With the advent of low-cost, high-throughput sequencing, the amount of public domain Expressed Sequence Tag (EST sequence data available for both model and non-model organism is growing exponentially. While these data are widely used for characterizing various genomes, they also present a serious challenge for data quality control and validation due to their inherent deficiencies, particularly for species without genome sequences. Description ConiferEST is an integrated system for data reprocessing, visualization and mining of conifer ESTs. In its current release, Build 1.0, it houses 172,229 loblolly pine EST sequence reads, which were obtained from reprocessing raw DNA sequencer traces using our software – WebTraceMiner. The trace files were downloaded from NCBI Trace Archive. ConiferEST provides biologists unique, easy-to-use data visualization and mining tools for a variety of putative sequence features including cloning vector segments, adapter sequences, restriction endonuclease recognition sites, polyA and polyT runs, and their corresponding Phred quality values. Based on these putative features, verified sequence features such as 3' and/or 5' termini of cDNA inserts in either sense or non-sense strand have been identified in-silico. Interestingly, only 30.03% of the designated 3' ESTs were found to have an authenticated 5' terminus in the non-sense strand (i.e., polyT tails, while fewer than 5.34% of the designated 5' ESTs had a verified 5' terminus in the sense strand. Such previously ignored features provide valuable insight for data quality control and validation of error-prone ESTs, as well as the ability to identify novel functional motifs embedded in large EST datasets. We found that "double-termini adapters" were effective indicators of potential EST chimeras. For all sequences with in-silico verified termini/terminus, we used InterProScan to assign protein domain signatures, results of which are available

  18. ConiferEST: an integrated bioinformatics system for data reprocessing and mining of conifer expressed sequence tags (ESTs).

    Science.gov (United States)

    Liang, Chun; Wang, Gang; Liu, Lin; Ji, Guoli; Fang, Lin; Liu, Yuansheng; Carter, Kikia; Webb, Jason S; Dean, Jeffrey F D

    2007-05-29

    With the advent of low-cost, high-throughput sequencing, the amount of public domain Expressed Sequence Tag (EST) sequence data available for both model and non-model organism is growing exponentially. While these data are widely used for characterizing various genomes, they also present a serious challenge for data quality control and validation due to their inherent deficiencies, particularly for species without genome sequences. ConiferEST is an integrated system for data reprocessing, visualization and mining of conifer ESTs. In its current release, Build 1.0, it houses 172,229 loblolly pine EST sequence reads, which were obtained from reprocessing raw DNA sequencer traces using our software--WebTraceMiner. The trace files were downloaded from NCBI Trace Archive. ConiferEST provides biologists unique, easy-to-use data visualization and mining tools for a variety of putative sequence features including cloning vector segments, adapter sequences, restriction endonuclease recognition sites, polyA and polyT runs, and their corresponding Phred quality values. Based on these putative features, verified sequence features such as 3' and/or 5' termini of cDNA inserts in either sense or non-sense strand have been identified in-silico. Interestingly, only 30.03% of the designated 3' ESTs were found to have an authenticated 5' terminus in the non-sense strand (i.e., polyT tails), while fewer than 5.34% of the designated 5' ESTs had a verified 5' terminus in the sense strand. Such previously ignored features provide valuable insight for data quality control and validation of error-prone ESTs, as well as the ability to identify novel functional motifs embedded in large EST datasets. We found that "double-termini adapters" were effective indicators of potential EST chimeras. For all sequences with in-silico verified termini/terminus, we used InterProScan to assign protein domain signatures, results of which are available for in-depth exploration using our biologist

  19. Multiple Zoonotic Parasites Identified in Dog Feces Collected in Ponte de Lima, Portugal — A Potential Threat to Human Health

    Science.gov (United States)

    Letra Mateus, Teresa; Castro, António; Niza Ribeiro, João; Vieira-Pinto, Madalena

    2014-01-01

    Dogs play many roles and their presence within people’s houses has increased. In rural settings dog faeces are not removed from the streets, representing an environmental pollution factor. Our aim was to evaluate the occurrence of environmental contamination with zoonotic intestinal parasites of three groups of dogs in Ponte de Lima, Portugal, with a particular emphasis on Echinococcus granulosus. We collected 592 dog faecal samples from the environment, farm and hunting dogs. Qualitative flotation coprological analysis was performed and the frequency in the positive samples ranged between 57.44% and 81.19% in different groups. We isolated up to four different parasites in one sample and detected seven intestinal parasitic species, genera or families overall. Ancylostomatidae was the most prevalent parasite, followed by Trichuris spp., Toxocara spp., Isospora spp., Dipylidium caninum, Taeniidae and Toxascaris leonina. Taeniidae eggs were analyzed with the PCR technique and revealed not to be from Echinococcus. The parasite prevalence and the diversity of zoonotic parasites found were high, which calls for a greater awareness of the problem among the population, especially hunters. Promoting research at the local level is important to plan control strategies. Health education should be developed with regard to farmers and hunters, and a closer collaboration between researchers, practitioners and public health authorities is needed. PMID:25257358

  20. Multiple Zoonotic Parasites Identified in Dog Feces Collected in Ponte de Lima, Portugal—A Potential Threat to Human Health

    Directory of Open Access Journals (Sweden)

    Teresa Letra Mateus

    2014-09-01

    Full Text Available Dogs play many roles and their presence within people’s houses has increased. In rural settings dog faeces are not removed from the streets, representing an environmental pollution factor. Our aim was to evaluate the occurrence of environmental contamination with zoonotic intestinal parasites of three groups of dogs in Ponte de Lima, Portugal, with a particular emphasis on Echinococcus granulosus. We collected 592 dog faecal samples from the environment, farm and hunting dogs. Qualitative flotation coprological analysis was performed and the frequency in the positive samples ranged between 57.44% and 81.19% in different groups. We isolated up to four different parasites in one sample and detected seven intestinal parasitic species, genera or families overall. Ancylostomatidae was the most prevalent parasite, followed by Trichuris spp., Toxocara spp., Isospora spp., Dipylidium caninum, Taeniidae and Toxascaris leonina. Taeniidae eggs were analyzed with the PCR technique and revealed not to be from Echinococcus. The parasite prevalence and the diversity of zoonotic parasites found were high, which calls for a greater awareness of the problem among the population, especially hunters. Promoting research at the local level is important to plan control strategies. Health education should be developed with regard to farmers and hunters, and a closer collaboration between researchers, practitioners and public health authorities is needed.

  1. Microparticles and human health: particulate materials, trace metals elements and black carbon in aerosols collected at Andravoahangy-Antananarivo, Madagascar

    International Nuclear Information System (INIS)

    Rasoazanany, E. O.; Andriamahenina, N. N.; Harinoely, M.; Ravoson, H. N.; Randriamanivo, L. V.; Raoelina Andriambololona; Ramaherison, H.

    2013-01-01

    The present work is to determine the concentrations of microparticles having diameter inferior to 10 μm (PM 10 ), the metal trace elements and the black carbon in the aerosols sampled in Andravoahangy-Antananarivo, Madagascar in 2008. The air sampler GENT is used to collect aerosol samples. The total reflection X-ray fluorescence spectrometer is used for qualitative and quantitative analysis of simultaneous way all metallic trace elements contained in the aerosols. The M43D reflectometer permits to measure the reflectances in order to determine the black carbon concentrations. The results show that the average concentrations of the particulate matters PM 2,5-10 are higher than those of PM 2,5 . The average concentrations of PM 10 in the aerosols are exceeding the World Health Organisation (WHO) and European Union guidelines, set at 50 μg.m -3 and those of PM 2,5 are higher than the 2005 WHO (25 μg.m-3) and the United States Environment Protection Agency (35 μg.m -3 ) guidelines. Consequently, air quality in Andravoahangy does not respect these daily guidelines. The identified metallic trace elements in the aerosols are Ti, Cr, Mn, Fe, Ni, Cu, Zn and Pb. The average concentrations of these elements are also higher in the coarse particles than in the fine particles. The concentrations of black carbon are higher in the fine particles. The maximum value is 9.12 μg.m -3 . [fr

  2. Proinflammatory effects and oxidative stress within human bronchial epithelial cells exposed to atmospheric particulate matter (PM2.5 and PM>2.5) collected from Cotonou, Benin

    International Nuclear Information System (INIS)

    Cachon, Boris Fresnel; Firmin, Stéphane; Verdin, Anthony; Ayi-Fanou, Lucie

    2014-01-01

    After particulate matter (PM) collection in Cotonou (Benin), a complete physicochemical characterization of PM 2.5 and PM >2.5 was led. Then, their adverse health effects were evaluated by using in vitro culture of human lung cells. BEAS-2B (bronchial epithelial cells) were intoxicated during short-term exposure at increasing PM concentrations (1.5–96 μg/cm 2 ) to determine global cytotoxicity. Hence, cells were exposed to 3 and 12 μg/cm 2 to investigate the potential biological imbalance generated by PM toxicity. Our findings showed the ability of both PM to induce oxidative stress and to cause inflammatory cytokines/chemokines gene expression and secretion. Furthermore, PM were able to induce gene expression of enzymes involved in the xenobiotic metabolism pathway. Strong correlations between gene expression of metabolizing enzymes, proinflammatory responses and cell cycle alteration were found, as well as between proinflammatory responses and cell viability. Stress oxidant parameters were highly correlated with expression and protein secretion of inflammatory mediators. Highlights: • The aim of this study was to investigate the toxic potential of collected particles. • Toxicological effects were determined by using human bronchial epithelial cells. • Both particles induced oxidative stress, proinflammatory response and cell alterations. • Metabolizing enzymes were linked to proinflammatory responses and cell alterations. • Oxidative stress was highly correlated to the proinflammatory mediators. -- This study evidences the toxic potential of African fine and coarse particulate matters on respiratory epithelial cells

  3. A collection of annotated and harmonized human breast cancer transcriptome datasets, including immunologic classification [version 2; referees: 2 approved

    Directory of Open Access Journals (Sweden)

    Jessica Roelands

    2018-02-01

    Full Text Available The increased application of high-throughput approaches in translational research has expanded the number of publicly available data repositories. Gathering additional valuable information contained in the datasets represents a crucial opportunity in the biomedical field. To facilitate and stimulate utilization of these datasets, we have recently developed an interactive data browsing and visualization web application, the Gene Expression Browser (GXB. In this note, we describe a curated compendium of 13 public datasets on human breast cancer, representing a total of 2142 transcriptome profiles. We classified the samples according to different immune based classification systems and integrated this information into the datasets. Annotated and harmonized datasets were uploaded to GXB. Study samples were categorized in different groups based on their immunologic tumor response profiles, intrinsic molecular subtypes and multiple clinical parameters. Ranked gene lists were generated based on relevant group comparisons. In this data note, we demonstrate the utility of GXB to evaluate the expression of a gene of interest, find differential gene expression between groups and investigate potential associations between variables with a specific focus on immunologic classification in breast cancer. This interactive resource is publicly available online at: http://breastcancer.gxbsidra.org/dm3/geneBrowser/list.

  4. Efficient Serial and Parallel Algorithms for Selection of Unique Oligos in EST Databases.

    Science.gov (United States)

    Mata-Montero, Manrique; Shalaby, Nabil; Sheppard, Bradley

    2013-01-01

    Obtaining unique oligos from an EST database is a problem of great importance in bioinformatics, particularly in the discovery of new genes and the mapping of the human genome. Many algorithms have been developed to find unique oligos, many of which are much less time consuming than the traditional brute force approach. An algorithm was presented by Zheng et al. (2004) which finds the solution of the unique oligos search problem efficiently. We implement this algorithm as well as several new algorithms based on some theorems included in this paper. We demonstrate how, with these new algorithms, we can obtain unique oligos much faster than with previous ones. We parallelize these new algorithms to further improve the time of finding unique oligos. All algorithms are run on ESTs obtained from a Barley EST database.

  5. Direct PCR amplification of DNA from human bloodstains, saliva, and touch samples collected with microFLOQ® swabs.

    Science.gov (United States)

    Ambers, Angie; Wiley, Rachel; Novroski, Nicole; Budowle, Bruce

    2018-01-01

    Previous studies have shown that nylon flocked swabs outperform traditional fiber swabs in DNA recovery due to their innovative design and lack of internal absorbent core to entrap cellular materials. The microFLOQ ® Direct swab, a miniaturized version of the 4N6 FLOQSwab ® , has a small swab head that is treated with a lysing agent which allows for direct amplification and DNA profiling from sample collection to final result in less than two hours. Additionally, the microFLOQ ® system subsamples only a minute portion of a stain and preserves the vast majority of the sample for subsequent testing or re-analysis, if desired. The efficacy of direct amplification of DNA from dilute bloodstains, saliva stains, and touch samples was evaluated using microFLOQ ® Direct swabs and the GlobalFiler™ Express system. Comparisons were made to traditional methods to assess the robustness of this alternate workflow. Controlled studies with 1:19 and 1:99 dilutions of bloodstains and saliva stains consistently yielded higher STR peak heights than standard methods with 1ng input DNA from the same samples. Touch samples from common items yielded single source and mixed profiles that were consistent with primary users of the objects. With this novel methodology/workflow, no sample loss occurs and therefore more template DNA is available during amplification. This approach may have important implications for analysis of low quantity and/or degraded samples that plague forensic casework. Copyright © 2017 The Authors. Published by Elsevier B.V. All rights reserved.

  6. Recovery of extracellular vesicles from human breast milk is influenced by sample collection and vesicle isolation procedures

    Directory of Open Access Journals (Sweden)

    Marijke I. Zonneveld

    2014-08-01

    Full Text Available Extracellular vesicles (EV in breast milk carry immune relevant proteins and could play an important role in the instruction of the neonatal immune system. To further analyze these EV and to elucidate their function it is important that native populations of EV can be recovered from (stored breast milk samples in a reproducible fashion. However, the impact of isolation and storage procedures on recovery of breast milk EV has remained underexposed. Here, we aimed to define parameters important for EV recovery from fresh and stored breast milk. To compare various protocols across different donors, breast milk was spiked with a well-defined murine EV population. We found that centrifugation of EV down into density gradients largely improved density-based separation and isolation of EV, compared to floatation up into gradients after high-force pelleting of EV. Using cryo-electron microscopy, we identified different subpopulations of human breast milk EV and a not previously described population of lipid tubules. Additionally, the impact of cold storage on breast milk EV was investigated. We determined that storing unprocessed breast milk at −80°C or 4°C caused death of cells present in breast milk, leading to contamination of the breast milk EV population with storage-induced EV. Here, an alternative method is proposed to store breast milk samples for EV analysis at later time points. The proposed adaptations to the breast milk storage and EV isolation procedures can be applied for EV-based biomarker profiling of breast milk and functional analysis of the role of breast milk EV in the development of the neonatal immune system.

  7. The collective capabilities as a methodological tool for assessing human welfare in indigenous territories of the Colombian Amazon

    Directory of Open Access Journals (Sweden)

    Luis Eduardo Acosta Muñoz

    2016-01-01

    Full Text Available The paper presents an integrating approach of conceptual issues to evaluate the wellbeing in indigenous communities. The approach recognizes the consensual absence of a “wellbeing” definition. Therefore, understanding the local concepts of wellbeing could help develop planning tools for decision-makers in indigenous societies contexts. The approach is based on the concept of capacities developed by A. Sen in which a group of human wellbeing indicators are constructed and where cultural issues might be included without affecting the power of the indicator. A study with Uitoto (múrui-muina-mɨnɨka and the called People of the Center indigenous groups of the Northern Amazonia has been done to discuss their particular idea of what wellbeing is. It is a concept the People of the Center summarizes in the word monifue (abundance. This concept is the result of the analysis of their symbolic and ritual contexts. The concept has been actualized through the time and today integrate issues of their contemporary life style. The paper describes some elements derived of this concept, and contributes to the conceptualization of issues that might be used in a valid model to describe the life style of these indigenous societies. The discussion of the paper is not based on technical issues of the model yet. The discussion define some limits where the variables to measure and relate should be placed. This is an important result about the understanding of the concept wellbeing of these indigenous societies and the elements that require to be transformed in concrete indicators.

  8. En torno a una estética del deporte

    OpenAIRE

    Javier Olivera Betrán*

    2006-01-01

    Aunque el término estética tiene varios significados especiales, en el contexto de las ciencias sociales se emplea preferentemente para designar el conjunto de investigaciones que están relacionadas con las artes. Estética es el estudio del comportamiento y la experiencia del hombre al crear arte, al percibir y comprender el arte y al ser influido por el arte. El arte es el medio que promueve una fusión del individuo con el todo, el hombre para rebasar los límites que le impone la individuali...

  9. Purification, crystallization and preliminary crystallographic analysis of Est25: a ketoprofen-specific hormone-sensitive lipase

    International Nuclear Information System (INIS)

    Kim, SeungBum; Joo, Sangbum; Yoon, Hyun C.; Ryu, Yeonwoo; Kim, Kyeong Kyu; Kim, T. Doohun

    2007-01-01

    Est25, a ketoprofen-specific hormone-sensitive lipase from a metagenomic library, was crystallized and diffraction data were collected to 1.49 Å resolution. Ketoprofen, a nonsteroidal anti-inflammatory drug, inhibits the synthesis of prostaglandin. A novel hydrolase (Est25) with high ketoprofen specificity has previously been identified using a metagenomic library from environmental samples. Recombinant Est25 protein with a histidine tag at the N-terminus was expressed in Escherichia coli and purified in a homogenous form. Est25 was crystallized from 2.4 M sodium malonate pH 7.0 and X-ray diffraction data were collected to 1.49 Å using synchrotron radiation. The crystals belong to the monoclinic space group C2, with unit-cell parameters a = 197.8, b = 95.2, c = 99.4 Å, β = 97.1°

  10. Is there an efficient trap or collection method for sampling Anopheles darlingi and other malaria vectors that can describe the essential parameters affecting transmission dynamics as effectively as human landing catches? - A Review

    Directory of Open Access Journals (Sweden)

    José Bento Pereira Lima

    2014-08-01

    Full Text Available Distribution, abundance, feeding behaviour, host preference, parity status and human-biting and infection rates are among the medical entomological parameters evaluated when determining the vector capacity of mosquito species. To evaluate these parameters, mosquitoes must be collected using an appropriate method. Malaria is primarily transmitted by anthropophilic and synanthropic anophelines. Thus, collection methods must result in the identification of the anthropophilic species and efficiently evaluate the parameters involved in malaria transmission dynamics. Consequently, human landing catches would be the most appropriate method if not for their inherent risk. The choice of alternative anopheline collection methods, such as traps, must consider their effectiveness in reproducing the efficiency of human attraction. Collection methods lure mosquitoes by using a mixture of olfactory, visual and thermal cues. Here, we reviewed, classified and compared the efficiency of anopheline collection methods, with an emphasis on Neotropical anthropophilic species, especially Anopheles darlingi, in distinct malaria epidemiological conditions in Brazil.

  11. activismo y estéticas en experimento

    Directory of Open Access Journals (Sweden)

    Omar Rincón

    2005-01-01

    Full Text Available Podemos comunicarlo todo: tenemos las tecnologías de la comunicación cada vez más cerca; pero no podemos contar nada, porque no tenemos nada qué decir, ni sabemos cómo decirlo. Hay que inventarlo todo, intervenir de nuevo la sociedad desde la comunicación. Es necesario convertir los medios en experiencia estética, social y política. ¿Cómo? Usando a las tecnologías para el activismo y el experimento; recurriendo a los llamado retro, porque no es lo más actual, lo más mercado, como experiencia de inspiración y emoción. Hay que volver a las estéticas, a los modos de narrar y a las historias que están inscritas en nuestras identidades locales; en nuestras sensibilidades femeninas, juveniles o sexuales; en nuestras tradiciones étnicas, o en nuestros modos urbanos. Sólo basta una minicámara para inventar el universo. En este ensayo se realiza un alegato contra los universos estético-narrativopolíticos construidos por la máquina televisiva y la homogeneidad del mercado. En este texto se argumenta a favor del activismo comunicativo, de la exploración tecnológica y de la inspiración étnica como estrategias para generar una mayor conciencia sobre el valor social de la comunicación, la intervención estético-narrativa de la sociedad y la importancia política de los medios de la gente.

  12. Aproximaciones a una estética de lo americano

    Directory of Open Access Journals (Sweden)

    María del Milagro Casalla

    2010-01-01

    Full Text Available El legado filosófico que nos ha dejado Rodolfo Kusch tiene cada vez más presencia y valor en este largo itinerario de descubrirnos como americanos. La pasión de este pensador por la América profunda es una fuente de ins- piración para quienes creemos que vivir en América no es simplemente un episodio geográfico sino un horizonte desde y a partir del cual construimos nuestra identidad. En este trabajo se pretende recrear sus consideracio - nes estéticas recogidas en su ensayo “Anotaciones para una estética de lo americano”, escrito en el año 1955. Aunque se trata de uno de los primeros escritos de Rodolfo Kusch, en el mismo se encuentran presentes numerosos conceptos que luego serán tematizados extensamente a lo largo de toda su obra. Considero que el abordaje a sus consideraciones estéticas no ha sido tan frecuentado como sí otros aspectos de su pensamiento (ser-estar, geocultura, símbolo y religión, etc.. Por ello, creo que este trabajo puede constituir una orientación preeliminar para futuras interpretaciones y, a la vez, ser un humilde homenaje a su filosofía, que, a lo largo de los años, sigue estimulando a antiguas y nuevas generaciones de pensadores dedicados a la filosofía latinoamericana.

  13. Wheat EST resources for functional genomics of abiotic stress

    Directory of Open Access Journals (Sweden)

    Links Matthew G

    2006-06-01

    Full Text Available Abstract Background Wheat is an excellent species to study freezing tolerance and other abiotic stresses. However, the sequence of the wheat genome has not been completely characterized due to its complexity and large size. To circumvent this obstacle and identify genes involved in cold acclimation and associated stresses, a large scale EST sequencing approach was undertaken by the Functional Genomics of Abiotic Stress (FGAS project. Results We generated 73,521 quality-filtered ESTs from eleven cDNA libraries constructed from wheat plants exposed to various abiotic stresses and at different developmental stages. In addition, 196,041 ESTs for which tracefiles were available from the National Science Foundation wheat EST sequencing program and DuPont were also quality-filtered and used in the analysis. Clustering of the combined ESTs with d2_cluster and TGICL yielded a few large clusters containing several thousand ESTs that were refractory to routine clustering techniques. To resolve this problem, the sequence proximity and "bridges" were identified by an e-value distance graph to manually break clusters into smaller groups. Assembly of the resolved ESTs generated a 75,488 unique sequence set (31,580 contigs and 43,908 singletons/singlets. Digital expression analyses indicated that the FGAS dataset is enriched in stress-regulated genes compared to the other public datasets. Over 43% of the unique sequence set was annotated and classified into functional categories according to Gene Ontology. Conclusion We have annotated 29,556 different sequences, an almost 5-fold increase in annotated sequences compared to the available wheat public databases. Digital expression analysis combined with gene annotation helped in the identification of several pathways associated with abiotic stress. The genomic resources and knowledge developed by this project will contribute to a better understanding of the different mechanisms that govern stress tolerance in

  14. Hormone-dependent bacterial growth, persistence and biofilm formation--a pilot study investigating human follicular fluid collected during IVF cycles.

    Directory of Open Access Journals (Sweden)

    Elise S Pelzer

    Full Text Available Human follicular fluid, considered sterile, is aspirated as part of an in vitro fertilization (IVF cycle. However, it is easily contaminated by the trans-vaginal collection route and little information exists in its potential to support the growth of microorganisms. The objectives of this study were to determine whether human follicular fluid can support bacterial growth over time, whether the steroid hormones estradiol and progesterone (present at high levels within follicular fluid contribute to the in vitro growth of bacterial species, and whether species isolated from follicular fluid form biofilms. We found that bacteria in follicular fluid could persist for at least 28 weeks in vitro and that the steroid hormones stimulated the growth of some bacterial species, specifically Lactobacillus spp., Bifidobacterium spp. Streptococcus spp. and E. coli. Several species, Lactobacillus spp., Propionibacterium spp., and Streptococcus spp., formed biofilms when incubated in native follicular fluids in vitro (18/24, 75%. We conclude that bacteria aspirated along with follicular fluid during IVF cycles demonstrate a persistent pattern of growth. This discovery is important since it can offer a new avenue for investigation in infertile couples.

  15. Accumulation of organic and inorganic contaminants in shellfish collected in estuarine waters near Pensacola, Florida: Contamination profiles and risks to human consumers

    International Nuclear Information System (INIS)

    Karouna-Renier, Natalie K.; Snyder, Richard A.; Allison, Jeffrey G.; Wagner, Matthew G.; Ranga Rao, K.

    2007-01-01

    We conducted a screening level assessment of contaminants in blue crabs (Callinectes sapidus) and oysters (Crassostrea virginica) from bays and bayous in the Pensacola, FL area. Tissue samples were analyzed for 17 dioxins/furans, 12 dioxin-like PCB (DL-PCBs) congeners, mercury, and various metals. Contaminant levels were compared to screening values (SV) calculated using U.S. EPA recommendations for establishing consumption advisories. All sampling locations exceeded the SV (0.098 pg g -1 ) for dioxins/furans/DL-PCBs, based on a Florida-specific consumption rate (46 g day -1 ). Arsenic (inorganic), mercury, cadmium, and zinc levels exceeded SVs in samples from select locations, and with the exception of mercury, these locations were generally downstream of known contaminated areas. We also assessed potential human health risks from consumption of these species. Risks to human health were greatest from consumption of crab hepatopancreas, suggesting that consumption of hepatopancreas, whether directly or indirectly, from crabs collected anywhere in the Pensacola Bay region should be avoided. - Elevated levels of dioxins/furans and dioxin-like PCBs were detected in blue crabs and oysters from select locations in the Pensacola Bay region

  16. HOCOMOCO: towards a complete collection of transcription factor binding models for human and mouse via large-scale ChIP-Seq analysis

    KAUST Repository

    Kulakovskiy, Ivan V.; Vorontsov, Ilya E.; Yevshin, Ivan S.; Sharipov, Ruslan N.; Fedorova, Alla D.; Rumynskiy, Eugene I.; Medvedeva, Yulia A.; Magana-Mora, Arturo; Bajic, Vladimir B.; Papatsenko, Dmitry A.; Kolpakov, Fedor A.; Makeev, Vsevolod J.

    2017-01-01

    We present a major update of the HOCOMOCO collection that consists of patterns describing DNA binding specificities for human and mouse transcription factors. In this release, we profited from a nearly doubled volume of published in vivo experiments on transcription factor (TF) binding to expand the repertoire of binding models, replace low-quality models previously based on in vitro data only and cover more than a hundred TFs with previously unknown binding specificities. This was achieved by systematic motif discovery from more than five thousand ChIP-Seq experiments uniformly processed within the BioUML framework with several ChIP-Seq peak calling tools and aggregated in the GTRD database. HOCOMOCO v11 contains binding models for 453 mouse and 680 human transcription factors and includes 1302 mononucleotide and 576 dinucleotide position weight matrices, which describe primary binding preferences of each transcription factor and reliable alternative binding specificities. An interactive interface and bulk downloads are available on the web: http://hocomoco.autosome.ru and http://www.cbrc.kaust.edu.sa/hocomoco11. In this release, we complement HOCOMOCO by MoLoTool (Motif Location Toolbox, http://molotool.autosome.ru) that applies HOCOMOCO models for visualization of binding sites in short DNA sequences.

  17. HOCOMOCO: towards a complete collection of transcription factor binding models for human and mouse via large-scale ChIP-Seq analysis

    KAUST Repository

    Kulakovskiy, Ivan V.

    2017-10-31

    We present a major update of the HOCOMOCO collection that consists of patterns describing DNA binding specificities for human and mouse transcription factors. In this release, we profited from a nearly doubled volume of published in vivo experiments on transcription factor (TF) binding to expand the repertoire of binding models, replace low-quality models previously based on in vitro data only and cover more than a hundred TFs with previously unknown binding specificities. This was achieved by systematic motif discovery from more than five thousand ChIP-Seq experiments uniformly processed within the BioUML framework with several ChIP-Seq peak calling tools and aggregated in the GTRD database. HOCOMOCO v11 contains binding models for 453 mouse and 680 human transcription factors and includes 1302 mononucleotide and 576 dinucleotide position weight matrices, which describe primary binding preferences of each transcription factor and reliable alternative binding specificities. An interactive interface and bulk downloads are available on the web: http://hocomoco.autosome.ru and http://www.cbrc.kaust.edu.sa/hocomoco11. In this release, we complement HOCOMOCO by MoLoTool (Motif Location Toolbox, http://molotool.autosome.ru) that applies HOCOMOCO models for visualization of binding sites in short DNA sequences.

  18. El leviatán estético

    Directory of Open Access Journals (Sweden)

    Jorge Peñuela

    2011-05-01

    Full Text Available En este ensayo exploro algunos argumentos de Hannah Arendt, con el fin de mostrar las razones que explican el odio que se manifestaba en las discusiones artísticas de comienzos del siglo XX, odio que persiste aún en muchos escenarios artísticos actuales. Con Arendt sostengo que este fenómeno no está superado, porque el odio es la herramienta que despliega el Capital, para amalgamar a todos los desheredados que ha creado. Contextualizo en la práctica artística colombiana el siguiente argumento de Arendt: el capitalismo creó una amalgama de frustrados sociales, políticos y estéticos que destruye la esfera pública como lugar para el acontecer de la política, amalgama que denominó populacho. Introduzco la categoría de populacho estético, para hablar del odio que ha animado las prácticas artísticas en Colombia desde 1940.

  19. Construction, database integration, and application of an Oenothera EST library.

    Science.gov (United States)

    Mrácek, Jaroslav; Greiner, Stephan; Cho, Won Kyong; Rauwolf, Uwe; Braun, Martha; Umate, Pavan; Altstätter, Johannes; Stoppel, Rhea; Mlcochová, Lada; Silber, Martina V; Volz, Stefanie M; White, Sarah; Selmeier, Renate; Rudd, Stephen; Herrmann, Reinhold G; Meurer, Jörg

    2006-09-01

    Coevolution of cellular genetic compartments is a fundamental aspect in eukaryotic genome evolution that becomes apparent in serious developmental disturbances after interspecific organelle exchanges. The genus Oenothera represents a unique, at present the only available, resource to study the role of the compartmentalized plant genome in diversification of populations and speciation processes. An integrated approach involving cDNA cloning, EST sequencing, and bioinformatic data mining was chosen using Oenothera elata with the genetic constitution nuclear genome AA with plastome type I. The Gene Ontology system grouped 1621 unique gene products into 17 different functional categories. Application of arrays generated from a selected fraction of ESTs revealed significantly differing expression profiles among closely related Oenothera species possessing the potential to generate fertile and incompatible plastid/nuclear hybrids (hybrid bleaching). Furthermore, the EST library provides a valuable source of PCR-based polymorphic molecular markers that are instrumental for genotyping and molecular mapping approaches.

  20. Relaciones de equivalencia con estímulos compuestos

    Directory of Open Access Journals (Sweden)

    Aldo Hernández, Sonia Céspedes, Leonardo Prieto

    2007-03-01

    Full Text Available El propósito de la presente investigación fue identificar las relaciones emergentes de entrenamientos entre estímulos muestra simples con estímulos de comparación compuestos. El estudio realizado corresponde a una investigación de tipo intrasujeto. Se contó con diez estudiantes universitarios, seis hombres y cuatro mujeres, con edades entre los 17 y 22 años de edad fueron escogidos por conveniencia y recibieron entrenamiento en discriminación condicional a través de tareas de igualación a la muestra arbitraria de tres elecciones por medio de un aplicativo en Visual Basic. En el primer y segundo bloque de entrenamiento se establecieron las relaciones condicionales entre estímulos muestra simples y estÌmulos de comparación compuestos (ej., A1-B1B1; A2-B2B2; A3-C3C3 y B1-C1C1; B2-C2C2; B3-C3C3 y se conformaron tres clases equivalentes de tres miembros cada una (ej., A1A1-B1B1-C1C1, asÌ como relaciones equivalencia-equivalencia (ej. A1A2- B1B2-C1C2. Cuatro de los diez participantes mostraron relaciones emergentes de simetrÌa, transitividad y equivalencia junto con relaciones equivalencia-equivalencia. Estos hallazgos indican que los entrenamientos entre estímulos simples y compuestos o viceversa producen relaciones emergentes propias de la equivalencia de estímulos.

  1. Estéticas de las culturas de ocio

    OpenAIRE

    Sañudo Vélez, Luis Guillermo

    2009-01-01

    El presente trabajo tiene como propósito explorar el significado estético del ocio en la cultura contemporánea. Para cumplir este objetivo ha sido necesario hacer un breve balance de la manera como el concepto de ocio se ha entendido tanto en los escritos de algunos destacados filósofos (Aristóteles, Séneca y Kant) como en los escritos de algunos pensadores sociales modernos (Thorstein Veblen) y contemporáneos (Jean Baudrillard, Erich Weber, Joffre Dumazedier, Gilles Lipovetsky, Vicente Verdú...

  2. Dia mundial da espirometria na ESTeSL

    OpenAIRE

    Dias, Hermínia Brites; Carolino, Elisabete

    2011-01-01

    Objectivos do estudo: associar a ESTeSL e a AC de CPL às comemorações do Dia Mundial da Espirometria promovidas pela Fundação Europeia do Pulmão; realizar o maior número possível de espirometrias; consciencializar a comunidade para o papel da espirometria no diagnóstico precoce da patologia respiratória; colocar a ESTeSL, enquanto entidade formadora de Técnicos de Cardiopneumologia, na primeira linha das iniciativas relacionadas com o estudo espirométrico; identificar possíveis alter...

  3. El "cerco-muro" que está construyendo Israel

    OpenAIRE

    Frediani, Valeria

    2004-01-01

    Israel está construyendo un "cerco-muro" en la Ribera Occidental o "Cisjordania", con una extensión de 728 kilómetros, que aislará a 81 pueblos palestinos con 163.000 habitantes y a otros 210.000 que viven en el este de Jerusalén. Se extiende de norte a sur, violando la llamada "línea verde" que separaba Cisjordania del territorio israelí desde 1967. El gobierno de Ariel Sharon dice que el "cerco de seguridad" tiene por finalidad impedir el ingreso de suicidas palestinos. Los palestinos sosti...

  4. NLM Digital Collections

    Data.gov (United States)

    U.S. Department of Health & Human Services — The National Library of Medicine's (NLM) Digital Collections offers a search-based Web service that provides access to the Dublin Core metadata and full-text OCR of...

  5. Expressed Sequence Tag-Simple Sequence Repeat (EST-SSR Marker Resources for Diversity Analysis of Mango (Mangifera indica L.

    Directory of Open Access Journals (Sweden)

    Natalie L. Dillon

    2014-01-01

    Full Text Available In this study, a collection of 24,840 expressed sequence tags (ESTs generated from five mango (Mangifera indica L. cDNA libraries was mined for EST-based simple sequence repeat (SSR markers. Over 1,000 ESTs with SSR motifs were detected from more than 24,000 EST sequences with di- and tri-nucleotide repeat motifs the most abundant. Of these, 25 EST-SSRs in genes involved in plant development, stress response, and fruit color and flavor development pathways were selected, developed into PCR markers and characterized in a population of 32 mango selections including M. indica varieties, and related Mangifera species. Twenty-four of the 25 EST-SSR markers exhibited polymorphisms, identifying a total of 86 alleles with an average of 5.38 alleles per locus, and distinguished between all Mangifera selections. Private alleles were identified for Mangifera species. These newly developed EST-SSR markers enhance the current 11 SSR mango genetic identity panel utilized by the Australian Mango Breeding Program. The current panel has been used to identify progeny and parents for selection and the application of this extended panel will further improve and help to design mango hybridization strategies for increased breeding efficiency.

  6. Novel expressed sequence tag- simple sequence repeats (EST ...

    African Journals Online (AJOL)

    Using different bioinformatic criteria, the SUCEST database was used to mine for simple sequence repeat (SSR) markers. Among 42,189 clusters, 1,425 expressed sequence tag- simple sequence repeats (EST-SSRs) were identified in silico. Trinucleotide repeats were the most abundant SSRs detected. Of 212 primer pairs ...

  7. La Naturaleza de la Experiencia Estética

    Directory of Open Access Journals (Sweden)

    George Herbert Mead

    2001-04-01

    Full Text Available El texto que presentamos en este número de Athenea Digital es "La Naturaleza de la Experiencia Estética" escrito por G.H.Mead en 1926, traducido e introducido por Estaban Laso y Anna Vitores. Como los mismos traductores explican en la introducción que precede al texto de Mead: El artículo ?La Naturaleza de la Experiencia Estética? (1926 que presentamos en este mismo número ?y que como la inmensa mayoría de los escritos de Mead es muy breve? se inscribe dentro de la orientación hacia la crítica cultural de su obra tardía. En tanto que parte de la brecha entre la esfera instrumental y la de los valores que caracteriza a la actividad y al pensamiento humano en la sociedad moderna, ofrece una buena oportunidad para pensar acerca de la tensión meadiana entre creatividad y normatividad. Y quizás también, para ir más allá y reflexionar sobre la tensión entre cambio y reproducción social, y sobre las formas en que podríamos ofrecer un concepto de acción y de experiencia no individualistas que permitieran articular esta tensión.

  8. GrowInclusive : la plateforme tant attendue est en construction ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    4 janv. 2018 ... La croissance inclusive est devenue une idée centrale dans la plupart des plans de développement nationaux, mais pour beaucoup, elle reste avant tout une aspiration. Les gouvernements, les bailleurs de fonds internationaux et les organisations de la société civile manquent de mécanismes éprouvés ...

  9. Releyendo Frankfurt: la Experiencia Estética en Adorno

    Directory of Open Access Journals (Sweden)

    Stra, Sebastián Matías

    2013-01-01

    Full Text Available [es]Intentaremos en este trabajo explorar la noción de Experiencia Estética en la obra de Theodor Adorno, entendiéndola como una compleja mediación conceptual que nos puede permitir dar cuenta de las oscuras configuraciones de la relación entre arte, cultura y conocimiento en la producción del pensador de Frankfurt. En este marco, cruzaremos las reflexiones estéticas adornianas con lecturas más cercanas a nuestro campo disciplinar, como la noción de Industria Cultural y la interpretación del mito y su derivación en la conformación de la racionalidad moderna. [en] In this work, we will try to explore the notion of Aesthetic Experience in Theodor Adorno`s work, understanding it as a complex conceptual mediation that can allow us getting in the dark settings of the relationship between art, culture and knowledge in the production of Frankfurt`s thinker. Like this, we are going to cross adornians aesthetic reflections with readings that are going to be closer to our disciplinary field, as the notion of cultural industry and the interpretation of myth and its derivation in the configuration of modern rationality.

  10. Exploiting a wheat EST database to assess genetic diversity.

    Science.gov (United States)

    Karakas, Ozge; Gurel, Filiz; Uncuoglu, Ahu Altinkut

    2010-10-01

    Expressed sequence tag (EST) markers have been used to assess variety and genetic diversity in wheat (Triticum aestivum). In this study, 1549 ESTs from wheat infested with yellow rust were used to examine the genetic diversity of six susceptible and resistant wheat cultivars. The aim of using these cultivars was to improve the competitiveness of public wheat breeding programs through the intensive use of modern, particularly marker-assisted, selection technologies. The F(2) individuals derived from cultivar crosses were screened for resistance to yellow rust at the seedling stage in greenhouses and adult stage in the field to identify DNA markers genetically linked to resistance. Five hundred and sixty ESTs were assembled into 136 contigs and 989 singletons. BlastX search results showed that 39 (29%) contigs and 96 (10%) singletons were homologous to wheat genes. The database-matched contigs and singletons were assigned to eight functional groups related to protein synthesis, photosynthesis, metabolism and energy, stress proteins, transporter proteins, protein breakdown and recycling, cell growth and division and reactive oxygen scavengers. PCR analyses with primers based on the contigs and singletons showed that the most polymorphic functional categories were photosynthesis (contigs) and metabolism and energy (singletons). EST analysis revealed considerable genetic variability among the Turkish wheat cultivars resistant and susceptible to yellow rust disease and allowed calculation of the mean genetic distance between cultivars, with the greatest similarity (0.725) being between Harmankaya99 and Sönmez2001, and the lowest (0.622) between Aytin98 and Izgi01.

  11. L'internet nouveau est dans les "starting-blocks"

    CERN Multimedia

    Jennotte, A

    2001-01-01

    De nombreux chercheurs trouvent internet trop lent et limité. C'est pourquoi, ils travaillent sur un nouveau réseau : le Grid. Le Grid permettra de mieux partager les ressources informatiques en réseau (1 page).

  12. A estética como factor promotor da aprendizagem

    Directory of Open Access Journals (Sweden)

    Fátima Maria BEZERRA BARBOSA

    2012-02-01

    Full Text Available La reflexión filosófica sobre el arte, lo hermoso, lo bueno, lo verdadero y su capacidad de promover el desarrollo humano es un tema que remonta a Platón en la cultura occidental. Considerando que la educación debe ser entendida como un fenómeno integral, que abarca no sólo las dimensiones intelectuales sino también las dimensiones sensibles, la intuición y el raciocinio, las capacidades imaginativas y creativas, el «saber ser» y el «saber estar» parejas del «conocer» y del «saber hacer», pensamos que es incuestionable la importancia de la estética en el fenómeno educativo. El objetivo de este trabajo es demostrar la importancia de la educación estética como motor fundamental de desarrollo humano y, en este sentido, como catalizador de la motivación y del aprendizaje, para que, a través de la imaginación y de la creatividad, sea posible la innovación en la construcción de vías alternativas para un mundo más humano y placentero.

  13. Construction of an EST-SSR-based interspecific transcriptome ...

    Indian Academy of Sciences (India)

    Construction of an EST-SSR-based interspecific transcriptome linkage map of fibre development in cotton. CHUANXIANG LIU, DAOJUN YUAN and ZHONGXU LIN. ∗. National Key Laboratory of Crop Genetic Improvement and National Centre of Plant Gene Research (Wuhan),. Huazhong Agricultural University, Wuhan ...

  14. Si usted está embarazada, no fume

    Centers for Disease Control (CDC) Podcasts

    Este podcast explica los peligros de fumar durante el embarazo, tanto para la madre como para el bebé en desarrollo, y ofrece información sobre cómo buscar ayuda para dejar de fumar para siempre.

  15. Las afecciones estéticas: un problema para prevenir

    Directory of Open Access Journals (Sweden)

    Yulisa Otero Baxter

    2001-08-01

    Full Text Available La estética facial asociada con los dientes ha preocupado a la sociedad desde la antigüedad. El temor al rechazo social por cambios de forma, color o posiciones dentales, puede producir un gran impacto psicológico en los pacientes. Con el objetivo de valorar la repercusión psicosocial de las alteraciones estéticas faciales, de determinar el nivel de prioridad que ocupan los tratamientos estéticos dentales y demostrar así la necesidad de intensificar nuestra labor educativa encaminada a evitar aquellas afecciones estéticas que más inciden en nuestra población, procedimos a la aplicación de una encuesta anónima en 110 pacientes que acudieron al Servicio de Estomatología Integral de la Facultad de Estomatología entre noviembre de 1999 y abril del 2000. Se recogió información sobre: actitud asumida por pacientes afectados, prioridades de tratamientos, etcétera. Dicha información fue procesada en tablas estadísticas. Los resultados del trabajo nos permiten concluir que las afecciones estéticas dentales tienen gran repercusión psicosocial, lo que unido al haber encontrado las lesiones traumáticas como las afecciones estéticas de mayor prevalencia, nos evidencia la necesidad de enfatizar nuestra labor educativa en este aspecto.Society has worried about facial esthetics associated with teeth since ancient times. Being afraid of social rejection due to changes of dental form, color or positions may produce a great psychological impact on patients. In order to assess the psychosocial repercussion of the facial esthetic alterations, to determine the priorty level of the esthetic dental treatments and to show the need of intensifying our educative work directed to prevent the most common esthetic affections in our population, we did an anonimous survey among 110 patients that received attention at the Service of Comprehensive Stomatology of the Faculty of Stomatology between November, 1999, and April, 2000. Information was gathered

  16. Analysis of cassava (Manihot esculenta) ESTs: A tool for the discovery of genes

    International Nuclear Information System (INIS)

    Zapata, Andres; Neme, Rafik; Sanabria, Carolina; Lopez, Camilo

    2011-01-01

    Cassava (Manihot esculenta) is the main source of calories for more than 1,000 millions of people around the world and has been consolidated as the fourth most important crop after rice, corn and wheat. Cassava is considered tolerant to abiotic and biotic stress conditions; nevertheless these characteristics are mainly present in non-commercial varieties. Genetic breeding strategies represent an alternative to introduce the desirable characteristics into commercial varieties. A fundamental step for accelerating the genetic breeding process in cassava requires the identification of genes associated to these characteristics. One rapid strategy for the identification of genes is the possibility to have a large collection of ESTs (expressed sequence tag). In this study, a complete analysis of cassava ESTs was done. The cassava ESTs represent 80,459 sequences which were assembled in a set of 29,231 unique genes (unigen), comprising 10,945 contigs and 18,286 singletones. These 29,231 unique genes represent about 80% of the genes of the cassava's genome. Between 5% and 10% of the unigenes of cassava not show similarity to any sequences present in the NCBI database and could be consider as cassava specific genes. a functional category was assigned to a group of sequences of the unigen set (29%) following the Gene Ontology Vocabulary. the molecular function component was the best represented with 43% of the sequences, followed by the biological process component (38%) and finally the cellular component with 19%. in the cassava ESTs collection, 3,709 microsatellites were identified and they could be used as molecular markers. this study represents an important contribution to the knowledge of the functional genomic structure of cassava and constitutes an important tool for the identification of genes associated to agricultural characteristics of interest that could be employed in cassava breeding programs.

  17. Strengths and weaknesses of EST-based prediction of tissue-specific alternative splicing

    Directory of Open Access Journals (Sweden)

    Vingron Martin

    2004-09-01

    Full Text Available Abstract Background Alternative splicing contributes significantly to the complexity of the human transcriptome and proteome. Computational prediction of alternative splice isoforms are usually based on EST sequences that also allow to approximate the expression pattern of the related transcripts. However, the limited number of tissues represented in the EST data as well as the different cDNA construction protocols may influence the predictive capacity of ESTs to unravel tissue-specifically expressed transcripts. Methods We predict tissue and tumor specific splice isoforms based on the genomic mapping (SpliceNest of the EST consensus sequences and library annotation provided in the GeneNest database. We further ascertain the potentially rare tissue specific transcripts as the ones represented only by ESTs derived from normalized libraries. A subset of the predicted tissue and tumor specific isoforms are then validated via RT-PCR experiments over a spectrum of 40 tissue types. Results Our strategy revealed 427 genes with at least one tissue specific transcript as well as 1120 genes showing tumor specific isoforms. While our experimental evaluation of computationally predicted tissue-specific isoforms revealed a high success rate in confirming the expression of these isoforms in the respective tissue, the strategy frequently failed to detect the expected restricted expression pattern. The analysis of putative lowly expressed transcripts using normalized cDNA libraries suggests that our ability to detect tissue-specific isoforms strongly depends on the expression level of the respective transcript as well as on the sensitivity of the experimental methods. Especially splice isoforms predicted to be disease-specific tend to represent transcripts that are expressed in a set of healthy tissues rather than novel isoforms. Conclusions We propose to combine the computational prediction of alternative splice isoforms with experimental validation for

  18. Purification, crystallization and preliminary crystallographic analysis of Est-Y29: a novel oligomeric β-lactamase

    International Nuclear Information System (INIS)

    Kim, SeungBum; Joo, Sangbum; Yoon, Sangyoung; Kim, Sungsoo; Moon, Jongkook; Ryu, Yeonwoo; Kim, Kyeong Kyu; Kim, T. Doohun

    2009-01-01

    Est-Y29, a novel oligomeric class C β-lactamase from a metagenomic library, was crystallized in space group I4 1 and diffraction data were collected to 1.49 Å resolution. β-Lactam antibiotics such as penicillins and cephalosporins have a four-atom ring as a common element in their structure. The β-lactamases, which catalyze the inactivation of these antibiotics, are of great interest because of their high incidence in pathogenic bacteria. A novel oligomeric class C β-lactamase (Est-Y29) from a metagenomic library was expressed, purified and crystallized. The recombinant protein was expressed in Escherichia coli with an N-terminal 6×His tag and purified to homogeneity. EstY-29 was crystallized and X-ray intensity data were collected to 1.49 Å resolution using synchrotron radiation

  19. Development of ESTs from chickpea roots and their use in diversity analysis of the Cicer genus

    Directory of Open Access Journals (Sweden)

    Eshwar K

    2005-08-01

    present in one or two of the accessions tested whilst the others were represented in up to twelve of the accessions tested. Conclusion Gene-based markers have proven to be effective tools for diversity analysis in Cicer and EST diversity analysis may be useful in identifying promising candidates for interspecific hybridization programs. The EST markers generated in this study have detected high levels of polymorphism amongst both common and rare alleles. This suggests that they would be useful for allele-mining of germplasm collections for identification of candidate accessions in the search for new sources of resistance to pests / diseases, and tolerance to abiotic stresses.

  20. From biomedicine to natural history research: EST resources for ambystomatid salamanders

    Directory of Open Access Journals (Sweden)

    Bryant Susan V

    2004-08-01

    Full Text Available Abstract Background Establishing genomic resources for closely related species will provide comparative insights that are crucial for understanding diversity and variability at multiple levels of biological organization. We developed ESTs for Mexican axolotl (Ambystoma mexicanum and Eastern tiger salamander (A. tigrinum tigrinum, species with deep and diverse research histories. Results Approximately 40,000 quality cDNA sequences were isolated for these species from various tissues, including regenerating limb and tail. These sequences and an existing set of 16,030 cDNA sequences for A. mexicanum were processed to yield 35,413 and 20,599 high quality ESTs for A. mexicanum and A. t. tigrinum, respectively. Because the A. t. tigrinum ESTs were obtained primarily from a normalized library, an approximately equal number of contigs were obtained for each species, with 21,091 unique contigs identified overall. The 10,592 contigs that showed significant similarity to sequences from the human RefSeq database reflected a diverse array of molecular functions and biological processes, with many corresponding to genes expressed during spinal cord injury in rat and fin regeneration in zebrafish. To demonstrate the utility of these EST resources, we searched databases to identify probes for regeneration research, characterized intra- and interspecific nucleotide polymorphism, saturated a human – Ambystoma synteny group with marker loci, and extended PCR primer sets designed for A. mexicanum / A. t. tigrinum orthologues to a related tiger salamander species. Conclusions Our study highlights the value of developing resources in traditional model systems where the likelihood of information transfer to multiple, closely related taxa is high, thus simultaneously enabling both laboratory and natural history research.

  1. From biomedicine to natural history research: EST resources for ambystomatid salamanders

    Science.gov (United States)

    Putta, Srikrishna; Smith, Jeramiah J; Walker, John A; Rondet, Mathieu; Weisrock, David W; Monaghan, James; Samuels, Amy K; Kump, Kevin; King, David C; Maness, Nicholas J; Habermann, Bianca; Tanaka, Elly; Bryant, Susan V; Gardiner, David M; Parichy, David M; Voss, S Randal

    2004-01-01

    Background Establishing genomic resources for closely related species will provide comparative insights that are crucial for understanding diversity and variability at multiple levels of biological organization. We developed ESTs for Mexican axolotl (Ambystoma mexicanum) and Eastern tiger salamander (A. tigrinum tigrinum), species with deep and diverse research histories. Results Approximately 40,000 quality cDNA sequences were isolated for these species from various tissues, including regenerating limb and tail. These sequences and an existing set of 16,030 cDNA sequences for A. mexicanum were processed to yield 35,413 and 20,599 high quality ESTs for A. mexicanum and A. t. tigrinum, respectively. Because the A. t. tigrinum ESTs were obtained primarily from a normalized library, an approximately equal number of contigs were obtained for each species, with 21,091 unique contigs identified overall. The 10,592 contigs that showed significant similarity to sequences from the human RefSeq database reflected a diverse array of molecular functions and biological processes, with many corresponding to genes expressed during spinal cord injury in rat and fin regeneration in zebrafish. To demonstrate the utility of these EST resources, we searched databases to identify probes for regeneration research, characterized intra- and interspecific nucleotide polymorphism, saturated a human – Ambystoma synteny group with marker loci, and extended PCR primer sets designed for A. mexicanum / A. t. tigrinum orthologues to a related tiger salamander species. Conclusions Our study highlights the value of developing resources in traditional model systems where the likelihood of information transfer to multiple, closely related taxa is high, thus simultaneously enabling both laboratory and natural history research. PMID:15310388

  2. 'Who is my Jung?' The progressive, though sometimes ambivalent, expansion of Jung's idea of the collective unconscious: from an 'unconscious humanity' to - in all but name - the soul of the world.

    Science.gov (United States)

    Cashford, Jules

    2018-06-01

    This paper discusses Jung's idea of myth as a projection of the collective unconscious, suggesting that the term 'projection' separates human beings from nature, withdrawing nature's life into humanity. Jung's discovery of a realm independent of consciousness - in conversations with his soul in The Red Book, and in synchronicity, began a dialogue which finally brought him, through the Alchemical Mercurius, closer to the idea of a world-soul. © 2018, The Society of Analytical Psychology.

  3. ¿Está en peligro el periodismo?

    Directory of Open Access Journals (Sweden)

    José Rodríguez Elizondo

    2012-07-01

    Full Text Available Debatir sobre este tema tiene una historia propia. En un artículo publicado el año 2000 me referí al futuro de la prensa, las nuevas tecnologías de la comunicación y la hiper y auto-información como eventuales amenazas. El tema, de apariencia imponente y con hipótesis ominosas, tuvo de mi parte una decodificación optimista. Dado que aquel futuro lleva ya más de una década de desarrollo, este nuevo artículo servirá para contrastar las percepciones y los pronósticos de entonces. Lo haré en el disfrute de la mayor libertad crítica que es posible concebir, que es la que se expresa como autocrítica.

  4. Differential Expression ESTs Associated with Fluorosis in Rats Liver

    Directory of Open Access Journals (Sweden)

    Y. Q. He

    2012-01-01

    Full Text Available The fluoride has volcanic activity and abundantly exists in environment combining with other elements as fluoride compounds. Recent researches indicated that the molecular mechanisms of intracellular fluoride toxicity were very complex. However, the molecular mechanisms underlying the effects on gene expression of chronic fluoride-induced damage is unknown, especially the detailed regulatory process of mitochondria. In the present study, we screened the differential expression ESTs associated with fluorosis by DDRT-PCR in rat liver. We gained 8 genes, 3 new ESTs, and 1 unknown function sequence and firstly demonstrated that microsomal glutathione S-transferase 1 (MGST1, ATP synthase H+ transporting mitochondrial F0 complex subunit C1, selenoprotein S, mitochondrial IF1 protein, and mitochondrial succinyl-CoA synthetase alpha subunit were participated in mitochondria metabolism, functional and structural damage process caused by chronic fluorosis. This information will be very helpful for understanding the molecular mechanisms of fluorosis.

  5. Sobre a estética platônica

    Directory of Open Access Journals (Sweden)

    Luis Felipe Bellintani Ribeiro

    2007-04-01

    Full Text Available O texto começa pela consideração da aparente posição desfavorável da estética, entendida tanto como o domínio da arte, quanto como o relativo à sensação, perante a metafísica platônica. A consideração posterior, porém, do caráter ontológico do critério metafísico, que, em tese, poria a arte e a sensação a seu reboque, ensejou, mais que uma reabilitação, uma inversão: a metafísica platônica é que seria fundada numa estética.

  6. Relatório de estágio

    OpenAIRE

    Cerqueira, Paulo Alexandre Narciso

    2010-01-01

    O presente relatório foi desenvolvido com a intenção de satisfazer um dos últimos requisitos do Mestrado em Enfermagem com Especialização em Saúde Mental e Psiquiatria (MESMP) da Universidade Católica Portuguesa (UCP), permitindo a obtenção da pós-licenciatura de especialização em Enfermagem de Saúde Mental e Psiquiatria (ESMP) e após discussão pública, do Mestrado em Enfermagem. Este estágio encontra-se dividido em três módulos, nos quais se procurou atingir os objectivos e...

  7. QuEST: Qualifying Environmentally Sustainable Technologies. Volume 6

    Science.gov (United States)

    Lewis, Pattie

    2011-01-01

    QuEST is a publication of the NASA Technology Evaluation for Environmental Risk Mitigation Principal Center (TEERM). This issue contains brief articles on: Risk Identification and Mitigation, Material Management and Substitution Efforts--Hexavalent Chrome-free Coatings and Low volatile organic compounds (VOCs) Coatings, Lead-Free Electronics, Corn-Based Depainting Media; Alternative Energy Efforts Hydrogen Sensors and Solar Air Conditioning. Other TEERM Efforts include: Energy and Water Management and Remediation Technology Collaboration.

  8. Extra heavy crudes and bitumens in the new EST technology

    International Nuclear Information System (INIS)

    Montanari, R.

    2001-01-01

    Strategic and market reasons dictate for the diversification of the supply sources. The huge reserves of extra heavy crudes and oil sands bitumen will provide the answer in this direction, but it is mandatory the availability of a suitable technology to process these poor quality feedstocks. EST Technology, developed by Snamprogetti and EniTecnologie, allows to get full conversion to produce high quality distillates [it

  9. 28 milliards d’euros, c’est grand comment ?

    OpenAIRE

    Ozer, Pierre; Salmon, Marc; Theunissen, Yannick

    2009-01-01

    J’ouvre mon quotidien. Fortis : 28 milliards d’euros de pertes en 2008. Ma fille de sept ans qui commence à lire et pose sans cesse des questions sur tout me lance : « Dis-moi, papa : 28 milliards d’euros, c’est grand comment ? ». Grande question… Je réfléchis et tente de trouver une parade parlante pour un enfant qui, in fine, se pose les mêmes questions que les grandes personnes.

  10. Exploiting a wheat EST database to assess genetic diversity

    Directory of Open Access Journals (Sweden)

    Ozge Karakas

    2010-01-01

    Full Text Available Expressed sequence tag (EST markers have been used to assess variety and genetic diversity in wheat (Triticum aestivum. In this study, 1549 ESTs from wheat infested with yellow rust were used to examine the genetic diversity of six susceptible and resistant wheat cultivars. The aim of using these cultivars was to improve the competitiveness of public wheat breeding programs through the intensive use of modern, particularly marker-assisted, selection technologies. The F2 individuals derived from cultivar crosses were screened for resistance to yellow rust at the seedling stage in greenhouses and adult stage in the field to identify DNA markers genetically linked to resistance. Five hundred and sixty ESTs were assembled into 136 contigs and 989 singletons. BlastX search results showed that 39 (29% contigs and 96 (10% singletons were homologous to wheat genes. The database-matched contigs and singletons were assigned to eight functional groups related to protein synthesis, photosynthesis, metabolism and energy, stress proteins, transporter proteins, protein breakdown and recycling, cell growth and division and reactive oxygen scavengers. PCR analyses with primers based on the contigs and singletons showed that the most polymorphic functional categories were photosynthesis (contigs and metabolism and energy (singletons. EST analysis revealed considerable genetic variability among the Turkish wheat cultivars resistant and susceptible to yellow rust disease and allowed calculation of the mean genetic distance between cultivars, with the greatest similarity (0.725 being between Harmankaya99 and Sönmez2001, and the lowest (0.622 between Aytin98 and Izgi01.

  11. ¿Está escuchando? ASP (:60)

    Centers for Disease Control (CDC) Podcasts

    2015-09-08

    Este anuncio de servicio público de radio motivan a las mujeres a aprender los síntomas del cáncer ginecológico y a prestar atención a lo que les dice su cuerpo.  Created: 9/8/2015 by National Center for Chronic Disease Prevention and Health Promotion (NCCDPHP).   Date Released: 9/8/2015.

  12. ¿Está escuchando? ASP (:30)

    Centers for Disease Control (CDC) Podcasts

    2015-09-08

    Este anuncio de servicio público de radio motivan a las mujeres a aprender los síntomas del cáncer ginecológico y a prestar atención a lo que les dice su cuerpo.  Created: 9/8/2015 by National Center for Chronic Disease Prevention and Health Promotion (NCCDPHP).   Date Released: 9/8/2015.

  13. Le criquet du Mato Grosso : l'agriculture est-elle responsable ?

    Directory of Open Access Journals (Sweden)

    Lecoq, M.

    1995-01-01

    Full Text Available Le criquet du Mato Grosso : l'agriculture est-elle responsable ?. Investigations through bibliographical references and among the local population provided a collection of documents and evidences showing without any doubt that Rhammatocerus schistocercoides (ReHN, 1906 [Orth. Acrididae Gomphocerinae] outbreaks in Mato Grosso (Brazil are not a new event neither by nature nor by magnitude. Therefore, the present conception on the origin of those outbreaks need to be drastically revised. The previous hypotheses, implying an overrated agricultural development of concerned areas since 1980, must then be rejected.

  14. Whole genome detection of rotavirus mixed infections in human, porcine and bovine samples co-infected with various rotavirus strains collected from sub-Saharan Africa.

    Science.gov (United States)

    Nyaga, Martin M; Jere, Khuzwayo C; Esona, Mathew D; Seheri, Mapaseka L; Stucker, Karla M; Halpin, Rebecca A; Akopov, Asmik; Stockwell, Timothy B; Peenze, Ina; Diop, Amadou; Ndiaye, Kader; Boula, Angeline; Maphalala, Gugu; Berejena, Chipo; Mwenda, Jason M; Steele, A Duncan; Wentworth, David E; Mphahlele, M Jeffrey

    2015-04-01

    Group A rotaviruses (RVA) are among the main global causes of severe diarrhea in children under the age of 5years. Strain diversity, mixed infections and untypeable RVA strains are frequently reported in Africa. We analysed rotavirus-positive human stool samples (n=13) obtained from hospitalised children under the age of 5years who presented with acute gastroenteritis at sentinel hospital sites in six African countries, as well as bovine and porcine stool samples (n=1 each), to gain insights into rotavirus diversity and evolution. Polyacrylamide gel electrophoresis (PAGE) analysis and genotyping with G-(VP7) and P-specific (VP4) typing primers suggested that 13 of the 15 samples contained more than 11 segments and/or mixed G/P genotypes. Full-length amplicons for each segment were generated using RVA-specific primers and sequenced using the Ion Torrent and/or Illumina MiSeq next-generation sequencing platforms. Sequencing detected at least one segment in each sample for which duplicate sequences, often having distinct genotypes, existed. This supported and extended the PAGE and RT-PCR genotyping findings that suggested these samples were collected from individuals that had mixed rotavirus infections. The study reports the first porcine (MRC-DPRU1567) and bovine (MRC-DPRU3010) mixed infections. We also report a unique genome segment 9 (VP7), whose G9 genotype belongs to lineage VI and clusters with porcine reference strains. Previously, African G9 strains have all been in lineage III. Furthermore, additional RVA segments isolated from humans have a clear evolutionary relationship with porcine, bovine and ovine rotavirus sequences, indicating relatively recent interspecies transmission and reassortment. Thus, multiple RVA strains from sub-Saharan Africa are infecting mammalian hosts with unpredictable variations in their gene segment combinations. Whole-genome sequence analyses of mixed RVA strains underscore the considerable diversity of rotavirus sequences and

  15. Collective Improvisation

    Directory of Open Access Journals (Sweden)

    Clare M. Cooper

    2016-08-01

    Full Text Available Collective improvisation as a creative practice is intensely social, trusting, unpopular, anti-hierarchical and, for these reasons, political. Cooper describes the risks and rich rewards of improvising with fellow artists and identifies the parallels between improvising ensembles of musicians in Australia with the collectively painted protest banners of the Taring Padi Collective in Indonesia after a brief visit to Jogjakarta.

  16. Preparing and Analyzing Expressed Sequence Tags (ESTs Library for the Mammary Tissue of Local Turkish Kivircik Sheep

    Directory of Open Access Journals (Sweden)

    Nehir Ozdemir Ozgenturk

    2017-01-01

    Full Text Available Kivircik sheep is an important local Turkish sheep according to its meat quality and milk productivity. The aim of this study was to analyze gene expression profiles of both prenatal and postnatal stages for the Kivircik sheep. Therefore, two different cDNA libraries, which were taken from the same Kivircik sheep mammary gland tissue at prenatal and postnatal stages, were constructed. Total 3072 colonies which were randomly selected from the two libraries were sequenced for developing a sheep ESTs collection. We used Phred/Phrap computer programs for analysis of the raw EST and readable EST sequences were assembled with the CAP3 software. Putative functions of all unique sequences and statistical analysis were determined by Geneious software. Total 422 ESTs have over 80% similarity to known sequences of other organisms in NCBI classified by Panther database for the Gene Ontology (GO category. By comparing gene expression profiles, we observed some putative genes that may be relative to reproductive performance or play important roles in milk synthesis and secretion. A total of 2414 ESTs have been deposited to the NCBI GenBank database (GW996847–GW999260. EST data in this study have provided a new source of information to functional genome studies of sheep.

  17. UCM BH MSS 133: catalogación de los once manuscritos encuadernados en este volumen facticio

    Directory of Open Access Journals (Sweden)

    Durán Barceló, Javier

    2012-01-01

    Full Text Available En 1878 Villa-Amil y Castro publicó el primer catálogo impreso de los manuscritos procedentes del Colegio de San Ildefonso de la Universidad de Alcalá de Henares. Para su trabajo Villa-Amil dependió estrechamente de las catalogaciones efectuadas antes en 1745 y de nuevo en 1800. Recientemente, Paul Oskar Kristeller ha puesto su atención en los manuscritos humanistas de esta colección; la cual es esencial para el estudio del humanismo en la universidad hispana del Renacimiento temprano. Desde este punto de vista se hace necesaria una nueva catalogación de los manuscritos del Colegio de San Ildefonso. Por ejemplo, el volumen facticio MSS 133 contiene once manuscritos de mediados del siglo XV entre los cuales se conserva el único testimonio de una de las obras latinas de Alfonso de Palencia. El objeto de este trabajo es una descripción bibliográfica más detallada de estos once manuscritos encuadernados en UCM BH MSS 133. In 1878 Villa-Amil y Castro published the first printed catalogue of the manuscript collection of the old Colegio de San Ildefonso at the University of Alcalá de Henares. In his work Villa-Amil followed closely the catalogues produced earlier in 1745 and again in 1800. More recently, Paul Oskar Kristeller has focused his interest on the humanistic manuscripts of this collection, as this library becomes essential in the study of humanism in the hispanic universities during the early Renaissance. From this point of view it is necessary a closer examination to the manuscripts belonging to the old Colegio de San Ildefonso. For example, volume MSS 133 contains eleven manuscritpts from the mid 15th century among them a unique testimony of a Latin composition by Alfonso de Palencia. The object of this paper is a more detailed bibliographical description of these eleven manuscripts in UCM BH MSS 133.

  18. Hora do jogo: os professores estão prontos?

    Directory of Open Access Journals (Sweden)

    Eliana Maria Magnani

    2018-04-01

      Hora del juego: ¿los profesores están preparados? RESUMEN Las ideas discutidas en este texto están relacionadas con las actividades de enseñanza, investigación y extensión desarrolladas desde 2012 a través de la Universidad Estadual de Oeste de Paraná – UNIOESTE. El artículo señala la importancia de la clasificación y catalogación de juegos educativos, explicitando qué es un importante conocimiento propuesto a los Centros Municipales de Educación Infantil (CMEIs, localizados en una ciudad del Suroeste de Paraná, CMEIs que, en función de una ley local, empezaron la (re implementación de ludotecas en 2007. La metodología se efectuó en fases, dos de dichas fases fueron significativas para la revisión de la implementación, a saber: diagnóstico de cómo se organizaban los materiales existentes en las ludotecas, curso sobre la importancia de la clasificación y catalogación de diferentes tipos de juegos. Para ello, toda revisión se apoyó en las ideas de Jean Piaget (2010/1946, 1994/1932, quien elaboró una teoría sobre el juego. Dichos conocimientos sirvieron para la comprensión de que los maestros no están preparados para este tipo de actividad didáctico-pedagógica, pues dicha educación es un proceso que demanda toma de conciencia de propia praxis, la cual requiere el (re aprendizaje a respecto de los objetivos de diferentes tipos de juegos y del desarrollo infantil, siendo que ello necesita ocurrir en la formación inicial y en la formación continua de profesores. Por consiguiente, es necesaria la involucración de los (futuros profesores en actividades lúdicas de enseñanza, investigación y extensión realizadas en universidades. Palabras clave: Clasificación de Juegos. Educación Infantil. Formación docente.

  19. Restriction enzyme analysis of the human cytomegalovirus genome in specimens collected from immunodeficient patients in Belém, State of Pará, Brazil

    Directory of Open Access Journals (Sweden)

    Dorotéa Lobato da Silva

    2011-10-01

    Full Text Available INTRODUCTION: Human cytomegalovirus is an opportunistic betaherpesvirus that causes persistent and serious infections in immunodeficient patients. Recurrent infections occur due to the presence of the virus in a latent state in some cell types. It is possible to examine the virus using molecular methods to aid in the immunological diagnosis and to generate a molecular viral profile in immunodeficient patients. The objective of this study was to characterize cytomegalovirus genotypes and to generate the epidemiological and molecular viral profile in immunodeficient patients. METHODS: A total of 105 samples were collected from immunodeficient patients from the City of Belém, including newborns, hemodialysis patients, transplant recipients and HIV+ patients. An IgG and IgM antibody study was completed using ELISA, and enzymatic analysis by restriction fragment length polymorphism (RFLP was performed to characterize viral genotypes. RESULTS: It was observed that 100% of the patients had IgG antibodies, 87% of which were IgG+/IgM-, consistent with a prior infection profile, 13% were IgG+/IgM+, suggestive of recent infection. The newborn group had the highest frequency (27% of the IgG+/IgM+ profile. By RFLP analysis, only one genotype was observed, gB2, which corresponded to the standard AD169 strain. CONCLUSIONS: The presence of IgM antibodies in new borns indicates that HCMV continues to be an important cause of congenital infection. The low observed genotypic diversity could be attributed to the small sample size because newborns were excluded from the RFLP analysis. This study will be continued including samples from newborns to extend the knowledge of the general and molecular epidemiology of HCMV in immunodeficient patients.

  20. GarlicESTdb: an online database and mining tool for garlic EST sequences

    Directory of Open Access Journals (Sweden)

    Choi Sang-Haeng

    2009-05-01

    Full Text Available Abstract Background Allium sativum., commonly known as garlic, is a species in the onion genus (Allium, which is a large and diverse one containing over 1,250 species. Its close relatives include chives, onion, leek and shallot. Garlic has been used throughout recorded history for culinary, medicinal use and health benefits. Currently, the interest in garlic is highly increasing due to nutritional and pharmaceutical value including high blood pressure and cholesterol, atherosclerosis and cancer. For all that, there are no comprehensive databases available for Expressed Sequence Tags(EST of garlic for gene discovery and future efforts of genome annotation. That is why we developed a new garlic database and applications to enable comprehensive analysis of garlic gene expression. Description GarlicESTdb is an integrated database and mining tool for large-scale garlic (Allium sativum EST sequencing. A total of 21,595 ESTs collected from an in-house cDNA library were used to construct the database. The analysis pipeline is an automated system written in JAVA and consists of the following components: automatic preprocessing of EST reads, assembly of raw sequences, annotation of the assembled sequences, storage of the analyzed information into MySQL databases, and graphic display of all processed data. A web application was implemented with the latest J2EE (Java 2 Platform Enterprise Edition software technology (JSP/EJB/JavaServlet for browsing and querying the database, for creation of dynamic web pages on the client side, and for mapping annotated enzymes to KEGG pathways, the AJAX framework was also used partially. The online resources, such as putative annotation, single nucleotide polymorphisms (SNP and tandem repeat data sets, can be searched by text, explored on the website, searched using BLAST, and downloaded. To archive more significant BLAST results, a curation system was introduced with which biologists can easily edit best-hit annotation

  1. GarlicESTdb: an online database and mining tool for garlic EST sequences.

    Science.gov (United States)

    Kim, Dae-Won; Jung, Tae-Sung; Nam, Seong-Hyeuk; Kwon, Hyuk-Ryul; Kim, Aeri; Chae, Sung-Hwa; Choi, Sang-Haeng; Kim, Dong-Wook; Kim, Ryong Nam; Park, Hong-Seog

    2009-05-18

    Allium sativum., commonly known as garlic, is a species in the onion genus (Allium), which is a large and diverse one containing over 1,250 species. Its close relatives include chives, onion, leek and shallot. Garlic has been used throughout recorded history for culinary, medicinal use and health benefits. Currently, the interest in garlic is highly increasing due to nutritional and pharmaceutical value including high blood pressure and cholesterol, atherosclerosis and cancer. For all that, there are no comprehensive databases available for Expressed Sequence Tags(EST) of garlic for gene discovery and future efforts of genome annotation. That is why we developed a new garlic database and applications to enable comprehensive analysis of garlic gene expression. GarlicESTdb is an integrated database and mining tool for large-scale garlic (Allium sativum) EST sequencing. A total of 21,595 ESTs collected from an in-house cDNA library were used to construct the database. The analysis pipeline is an automated system written in JAVA and consists of the following components: automatic preprocessing of EST reads, assembly of raw sequences, annotation of the assembled sequences, storage of the analyzed information into MySQL databases, and graphic display of all processed data. A web application was implemented with the latest J2EE (Java 2 Platform Enterprise Edition) software technology (JSP/EJB/JavaServlet) for browsing and querying the database, for creation of dynamic web pages on the client side, and for mapping annotated enzymes to KEGG pathways, the AJAX framework was also used partially. The online resources, such as putative annotation, single nucleotide polymorphisms (SNP) and tandem repeat data sets, can be searched by text, explored on the website, searched using BLAST, and downloaded. To archive more significant BLAST results, a curation system was introduced with which biologists can easily edit best-hit annotation information for others to view. The Garlic

  2. SNP mining porcine ESTs with MAVIANT, a novel tool for SNP evaluation and annotation

    DEFF Research Database (Denmark)

    Panitz, Frank; Stengaard, Henrik; Hornshoj, Henrik

    2007-01-01

    MOTIVATION: Single nucleotide polymorphisms (SNPs) analysis is an important means to study genetic variation. A fast and cost-efficient approach to identify large numbers of novel candidates is the SNP mining of large scale sequencing projects. The increasing availability of sequence trace data...... manual annotation, which is immediately accessible and can be easily shared with external collaborators. RESULTS: Large-scale SNP mining of polymorphisms bases on porcine EST sequences yielded more than 7900 candidate SNPs in coding regions (cSNPs), which were annotated relative to the human genome. Non...

  3. The use of Open Reading frame ESTs (ORESTES for analysis of the honey bee transcriptome

    Directory of Open Access Journals (Sweden)

    Soares Ademilson EE

    2004-11-01

    Full Text Available Abstract Background The ongoing efforts to sequence the honey bee genome require additional initiatives to define its transcriptome. Towards this end, we employed the Open Reading frame ESTs (ORESTES strategy to generate profiles for the life cycle of Apis mellifera workers. Results Of the 5,021 ORESTES, 35.2% matched with previously deposited Apis ESTs. The analysis of the remaining sequences defined a set of putative orthologs whose majority had their best-match hits with Anopheles and Drosophila genes. CAP3 assembly of the Apis ORESTES with the already existing 15,500 Apis ESTs generated 3,408 contigs. BLASTX comparison of these contigs with protein sets of organisms representing distinct phylogenetic clades revealed a total of 1,629 contigs that Apis mellifera shares with different taxa. Most (41% represent genes that are in common to all taxa, another 21% are shared between metazoans (Bilateria, and 16% are shared only within the Insecta clade. A set of 23 putative genes presented a best match with human genes, many of which encode factors related to cell signaling/signal transduction. 1,779 contigs (52% did not match any known sequence. Applying a correction factor deduced from a parallel analysis performed with Drosophila melanogaster ORESTES, we estimate that approximately half of these no-match ESTs contigs (22% should represent Apis-specific genes. Conclusions The versatile and cost-efficient ORESTES approach produced minilibraries for honey bee life cycle stages. Such information on central gene regions contributes to genome annotation and also lends itself to cross-transcriptome comparisons to reveal evolutionary trends in insect genomes.

  4. Esplenectomía incidental: ¿Está justificada?

    Directory of Open Access Journals (Sweden)

    Eddy Sierra Enrique

    1997-12-01

    Full Text Available Se revisaron 77 historias clínicas de pacientes que presentaban lesiones incidentales del bazo ocurridas entre 1985 y 1994, durante operaciones intraabdominales y por examen laparoscópico. Las funciones inmunológicas del bazo y su papel contra las infecciones están bien definidas, por lo cual al ser suprimido este órgano a consecuencia de lesiones incidentales, favorecen las infecciones en dichos pacientes de por vida. De las 77 lesiones incidentales se realizaron 47(61 % esplenectomías incidentales y 30(39 % cirugías conservadoras. La úlcera duodenal y la hernia hiatal son las causas principales de esplenectomía incidental. Se presentaron 11 infecciones (23,4 % y 1 fallecido (2,1 % en la esplenectomía incidental contra 1 infección (3,3 % y ningún fallecido en la cirugía conservadora. Se llega a la conclusión de que la esplenectomía no está justificada dadas las desventajas que presenta77 medical histories of patients who presented incidental injuries of the spleen occurred between 1985 and 1994, during intraabdominal operations and by laparoscopic examination, were reviewed. The immunological functions of the spleen and its role against infections are well defined, so the removal of this organ due to incidental injuries favors the appearance of infections in these patients for the rest of their lives. Of the 77 incidental injuries 47 (61 % incidental splenectomies and 30 (39 % conservative surgeries were performed. Duodenal ulcer and hiatal hernia proved to be the main causes of incidental splenectomy. There were 11 infections (23.4 % and 1 death (2.1 % in the incidental splenectomy compared with 1 infection (3.3 % and no death in the conservative surgery. It is concluded that splenectomy is not justified because of its disadvantages

  5. Música pop : da estética, conceitos e preconceitos

    OpenAIRE

    Teles, Maria Filipa

    2008-01-01

    Dissertação de Mestrado em Estudos Americanos apresentada à Universidade Aberta O estudo daquilo que é normalmente definido como Cultura Pop tem-se encontrado tradicionalmente dividido em três linhas gerais: a que não a considera como objecto digno de estudo; a que, embora se dedique ao seu estudo, a considera um objecto menor; e a que a reconhece como objecto de estudo académico válido. Este trabalho procura libertar-se dos preconceitos anteriormente expostos, reflectind...

  6. Rahanpesun estäminen – Miten pankkisektoria koulutetaan?

    OpenAIRE

    Peltoniemi, Ville

    2016-01-01

    Tämän opinnäytetyön tavoitteena on selvittää, miten pankkisektoria koulutetaan rahanpesun estämiseksi Suomessa. Ilmiön tutkimiseen on päädytty, koska rahanpesu aiheena on ajankohtainen. Asia puhuttaa mm. pankkien asiakkaita, joilta kysytään runsaasti erilaisia tietoja asiakkaiden tunnistamiseksi rahanpesulainsäädäntöön vedoten. Mediahuomiota ovat saaneet runsaasti myös erilaiset julkisuuteen vuodetut veroparatiisikytkökset. Pankkisektori on joutunut tilanteessa julkisen paineen kohteeksi ja s...

  7. Lo que está bajo nuestros pies

    Directory of Open Access Journals (Sweden)

    Paula C. de A. Maria Castelhano

    2011-01-01

    Full Text Available En este trabajo se pretende demostrar cómo el estudio del comportamiento de las ondas sísmicas llevó a la construcción del modelo físico de la estructura interna de la Tierra en diferentes capas concéntricas. Los modelos analógicos en educación de la ciencias son instrumentos esenciales que hacen los conocimientos científicos más comprensible, facilitando la comprensión de conceptos abstractos y favoreciendo así el interés de los estudiantes.

  8. Distribution of DNA repair-related ESTs in sugarcane

    Directory of Open Access Journals (Sweden)

    W.C. Lima

    2001-12-01

    Full Text Available DNA repair pathways are necessary to maintain the proper genomic stability and ensure the survival of the organism, protecting it against the damaging effects of endogenous and exogenous agents. In this work, we made an analysis of the expression patterns of DNA repair-related genes in sugarcane, by determining the EST (expressed sequence tags distribution in the different cDNA libraries of the SUCEST transcriptome project. Three different pathways - photoreactivation, base excision repair and nucleotide excision repair - were investigated by employing known DNA repair proteins as probes to identify homologous ESTs in sugarcane, by means of computer similarity search. The results showed that DNA repair genes may have differential expressions in tissues, depending on the pathway studied. These in silico data provide important clues on the potential variation of gene expression, to be confirmed by direct biochemical analysis.As vias de reparo de DNA são requeridas para manter a necessária estabilidade genômica e garantir a sobrevivência do organismo, frente aos efeitos deletérios causados por fatores endógenos e exógenos. Neste trabalho, realizamos a análise dos padrões de expressão dos genes de reparo de DNA encontrados na cana-de-açúcar, pela determinação da distribuição de ESTs nas diferentes bibliotecas de cDNA no projeto de transcriptoma SUCEST. Três vias de reparo - fotorreativação, reparo por excisão de bases e reparo por excisão de nucleotídeos - foram estudadas através do uso de proteínas de reparo como sondas para identificação de ESTs homólogos em cana-de-açúcar, com base na procura computacional de similaridade. Os resultados indicam que os genes de reparo de DNA possuem uma expressão diferencial nos tecidos, dependendo da via de reparo analisada. Esses dados in silico fornecem importantes indícios da expressão diferencial, a qual deve ser confirmada por análises bioquímicas diretas.

  9. QuEST: Qualifying Environmentally Sustainable Technologies, Volume 5

    Science.gov (United States)

    Lewis, Pattie

    2010-01-01

    This edition of the QuEST newsletter contains brief articles that discuss the NASA Technology Evaluation for Environmental Risk Mitigation (TEERM) program, and the importance of collaboration, efforts in materials management and substitution for coatings for launch structures, Low volatile organic compound (VOC) Coatings Field Testing, Non-Chrome Coating Systems, Life Cycle Corrosion Testing, Lead-Free Electronics Testing and Corn Based Depainting and efforts in Pollution Control in the area of Hypergolic Propellant Destruction Evaluation, efforts in development of alternative energy in particular Hydrogen Sensors, Energy and Water Management, and efforts in remediation in the removal of Polychlorinated Biphenyl (PCB) contamination

  10. EST and transcriptome analysis of cephalochordate amphioxus--past, present and future.

    Science.gov (United States)

    Wang, Yu-Bin; Chen, Shu-Hwa; Lin, Chun-Yen; Yu, Jr-Kai

    2012-03-01

    The cephalochordates, commonly known as amphioxus or lancelets, are now considered the most basal chordate group, and the studies of these organisms therefore offer important insights into various levels of evolutionary biology. In the past two decades, the investigation of amphioxus developmental biology has provided key knowledge for understanding the basic patterning mechanisms of chordates. Comparative genome studies of vertebrates and amphioxus have uncovered clear evidence supporting the hypothesis of two-round whole-genome duplication thought to have occurred early in vertebrate evolution and have shed light on the evolution of morphological novelties in the complex vertebrate body plan. Complementary to the amphioxus genome-sequencing project, a large collection of expressed sequence tags (ESTs) has been generated for amphioxus in recent years; this valuable collection represents a rich resource for gene discovery, expression profiling and molecular developmental studies in the amphioxus model. Here, we review previous EST analyses and available cDNA resources in amphioxus and discuss their value for use in evolutionary and developmental studies. We also discuss the potential advantages of applying high-throughput, next-generation sequencing (NGS) technologies to the field of amphioxus research.

  11. Descartes, est-ce la France ?

    Directory of Open Access Journals (Sweden)

    Pierre Macherey

    2004-04-01

    Full Text Available Le cas de Descartes présente un intérêt privilégié pour l’examen des conditions dans lesquelles une philosophie vient à être considérée comme représentant un esprit national. Le livre d’A. Glucksman, Descartes, c’est la France, publié en 1987 à l’occasion du 350e anniversaire de la parution du Discours de la méthode, constitue un exemple extrême de ce type d’opération, qui exploite une doctrine en en infléchissant certains enjeux fondamentaux.Descartes’ case is particularly interesting to examine the conditions under which a philosophy comes to the point of being considered to represent a national thought. A. Glucksman’s book, Descartes, c’est la France, published in 1987, for the 350th anniversary of the publication of the Discours de la méthode is an extreme example of that kind of process, which exploits a doctrine inflecting some of its fundamental stakes.

  12. Upgrading Unconventional Oil Resources with the EST Process

    Energy Technology Data Exchange (ETDEWEB)

    Delbianco, Alberto; Meli, Salvatori; Panariti, Nicolleta; Rispoli, Giacomo

    2007-07-01

    We strongly believe that unconventional oils will play a much larger role in the growth of supply than is currently recognized. As a matter of fact, whereas the earth's conventional proven world oil reserves are 1.3 trillion barrels, extra-heavy plus bitumen resources amount to about 4 trillion barrels. The unconventional oils are characterized by low API gravity (<10), high viscosity and high concentration of poisons such as sulphur, nitrogen, metals, and asphaltenes. For this reason, a key role for the full exploitation of these hydrocarbon resources is played by the downstream processes that are required to upgrade and convert them into valuable products. In this scenario, Eni has developed a novel hydrocracking process (EST: Eni Slurry Technology) which is particularly well-suited for the conversion and upgrading of heavy feedstocks (conventional vacuum residues, extra-heavy oils and bitumen). EST employs nano-sized hydrogenation catalysts and an original process scheme that allow complete feedstock conversion to an upgraded synthetic crude oil (SCO) with an API gravity gain greater than 20 and avoid the production of residual by-products, such as pet-coke or heavy fuel oil. A Commercial Demonstration Unit (CDP) of 1200 bbl/d capacity is successfully operating in the Eni's Taranto refinery since November 2005. (auth)

  13. Como antigas estátuas de bronze

    Directory of Open Access Journals (Sweden)

    Oliver Lubrich

    2010-01-01

    Full Text Available A interpretação de América usando motivos classicistas como modelos imperiais de apropriação, "antiquização", é uma das principais estratégias retóricas nos relatos de viagens de Alexander von Humboldt, Relation historique du voyage aux régions équinoxiales du Nouveau Continent (1814-1831. A partir da experiência colonial, esse discurso está carregado de tensão. O conceito de antiguidade é, assim, desautorizado e desconstruído. Os leitores são testemunhas da dissolução do classicismo europeu como dispositivo político-estético produzido pela diferença cultural."Antiquifying" America is a central rhetorical strategy in Alexander von Humboldt's Relation historique du voyage aux régions équinoxiales du Nouveau Continent (1814-1831. Over the course of the colonial experience, tension infuses the discourse and problems in the use of classicist motifs as imperial models of appropriation become apparent: metaphoric and metonymic references collide; positive and negative connotations overlap; incompatible modes of temporalization contrast with one another; colonial and dissident identifications coincide. The concept of "antiquity" is de-authorized, deconstructed. Readers witness the dissolution of European classicism as a politico-aesthetic 'dispositif' due to the experience of cultural difference.

  14. AhR- and ER-mediated activities in human blood samples collected from PCB-contaminated and background region in Slovakia

    Energy Technology Data Exchange (ETDEWEB)

    Pliskova, M. [Veterinary Researcch Institute, Brno (Czech Republic); Canton, R.F.; Duursen, M.B.M. van [Utrecht Univ. (NL). Institute for Risk Assessment Sciences (IRAS)] (and others)

    2004-09-15

    Endocrine disruption mediated through activation of aryl hydrocarbon receptor (AhR) and estrogen receptor (ER) by polychlorinated biphenyls (PCBs) and other persistent organic pollutants (POPs) has been studied extensively both in vivo and in vitro. Non-ortho- and mono-ortho-substituted polychlorinated biphenyls (PCBs) are potent AhR agonists therefore, increased dioxin-like activity of complex blood samples might reflect an increased exposure to PCBs. The induction of expression of CYP1A1 and CYP1B1 in different tissues, including lymphocytes, also depends on activation of AhR and it could be useful as a potential biomarker of exposure to dioxin-like compounds. Using various in vivo and in vitro models, the exposure to PCBs or hydroxy-PCBs has been reported to lead to either induction of ER-mediated activity or to an antiestrogenic effect associated with a suppression of estradiol-induced ER-dependent gene expression. Nevertheless, relative (anti)estrogenic potencies of a large set of prevalent environmental PCBs have not been yet compared in a single bioassay. A cross-talk between AhR and ER has been suggested to lead to a suppression of ER-mediated gene expression. Therefore, presence of dioxin-like compounds in blood could potentially suppress the ER-mediated activity. Additionally, AhR-dependent induction of CYP1A1 and especially CYP1B1, two enzymes involved in oxidative metabolism of estradiol and other estrogens, might enhance the metabolism of estradiol and it has been suggested to cause a potential depression of estrogen levels in the body. The aim of the present study was to determine dioxin-like, estrogenic and antiestrogenic activities in human blood samples collected in two Eastern Slovakia regions differently polluted with PCBs using established in vitro bioassays. We also studied mRNA expression of CYP1A1 and 1B1 in lymphocytes and the genotypes of CYP1B1 as possible biomarkers of exposure for PCBs and related compounds. The biological data obtained

  15. Dual Therapy With Darunavir and Ritonavir Plus Lamivudine vs Triple Therapy With Darunavir and Ritonavir Plus Tenofovir Disoproxil Fumarate and Emtricitabine or Abacavir and Lamivudine for Maintenance of Human Immunodeficiency Virus Type 1 Viral Suppression: Randomized, Open-Label, Noninferiority DUAL-GESIDA 8014-RIS-EST45 Trial.

    Science.gov (United States)

    Pulido, Federico; Ribera, Esteban; Lagarde, María; Pérez-Valero, Ignacio; Palacios, Rosario; Iribarren, José A; Payeras, Antoni; Domingo, Pere; Sanz, José; Cervero, Miguel; Curran, Adrián; Rodríguez-Gómez, Francisco J; Téllez, María J; Ryan, Pablo; Barrufet, Pilar; Knobel, Hernando; Rivero, Antonio; Alejos, Belén; Yllescas, María; Arribas, José R

    2017-11-29

    Our objective was to assess the therapeutic noninferiority of dual therapy with darunavir/ritonavir and lamivudine compared to triple therapy with darunavir/ritonavir plus 2 nucleos(t)ides for maintenance of human immunodeficiency virus type 1 (HIV-1) suppression. This was a multicenter, open-label, noninferiority trial (margin 12%). Patients with HIV-1 RNA dual- and triple-therapy arms was 88.9% (112/126) and 92.7% (114/123; difference, -3.8%; 95% confidence interval, -11.0 to 3.4), respectively. Four participants in the dual-therapy arm and 2 in the triple-therapy arm developed protocol-defined virological failure. Switching to dual therapy was associated with a significant increase in total, low-density lipoprotein, and high-density lipoprotein (HDL) cholesterol, but not in the total-to-HDL cholesterol ratio. Serious adverse events and study drug discontinuations due to adverse events occurred in 4.8% vs 4.9%P = .97) and in 0.8% (1/126) vs 1.6% P = .55) in dual therapy vs triple therapy, respectively. Dual therapy with darunavir/ritonavir and lamivudine demonstrated noninferior therapeutic efficacy and similar tolerability compared to triple therapy. NCT02159599. © The Author 2017. Published by Oxford University Press for the Infectious Diseases Society of America. All rights reserved. For permissions, e-mail: journals.permissions@oup.com.

  16. Comprehensive EST analysis of the symbiotic sea anemone, Anemonia viridis

    Directory of Open Access Journals (Sweden)

    Deleury Emeline

    2009-07-01

    Full Text Available Abstract Background Coral reef ecosystems are renowned for their diversity and beauty. Their immense ecological success is due to a symbiotic association between cnidarian hosts and unicellular dinoflagellate algae, known as zooxanthellae. These algae are photosynthetic and the cnidarian-zooxanthellae association is based on nutritional exchanges. Maintenance of such an intimate cellular partnership involves many crosstalks between the partners. To better characterize symbiotic relationships between a cnidarian host and its dinoflagellate symbionts, we conducted a large-scale EST study on a symbiotic sea anemone, Anemonia viridis, in which the two tissue layers (epiderm and gastroderm can be easily separated. Results A single cDNA library was constructed from symbiotic tissue of sea anemones A. viridis in various environmental conditions (both normal and stressed. We generated 39,939 high quality ESTs, which were assembled into 14,504 unique sequences (UniSeqs. Sequences were analysed and sorted according to their putative origin (animal, algal or bacterial. We identified many new repeated elements in the 3'UTR of most animal genes, suggesting that these elements potentially have a biological role, especially with respect to gene expression regulation. We identified genes of animal origin that have no homolog in the non-symbiotic starlet sea anemone Nematostella vectensis genome, but in other symbiotic cnidarians, and may therefore be involved in the symbiosis relationship in A. viridis. Comparison of protein domain occurrence in A. viridis with that in N. vectensis demonstrated an increase in abundance of some molecular functions, such as protein binding or antioxidant activity, suggesting that these functions are essential for the symbiotic state and may be specific adaptations. Conclusion This large dataset of sequences provides a valuable resource for future studies on symbiotic interactions in Cnidaria. The comparison with the closest

  17. Comprehensive EST analysis of the symbiotic sea anemone, Anemonia viridis.

    Science.gov (United States)

    Sabourault, Cécile; Ganot, Philippe; Deleury, Emeline; Allemand, Denis; Furla, Paola

    2009-07-23

    Coral reef ecosystems are renowned for their diversity and beauty. Their immense ecological success is due to a symbiotic association between cnidarian hosts and unicellular dinoflagellate algae, known as zooxanthellae. These algae are photosynthetic and the cnidarian-zooxanthellae association is based on nutritional exchanges. Maintenance of such an intimate cellular partnership involves many crosstalks between the partners. To better characterize symbiotic relationships between a cnidarian host and its dinoflagellate symbionts, we conducted a large-scale EST study on a symbiotic sea anemone, Anemonia viridis, in which the two tissue layers (epiderm and gastroderm) can be easily separated. A single cDNA library was constructed from symbiotic tissue of sea anemones A. viridis in various environmental conditions (both normal and stressed). We generated 39,939 high quality ESTs, which were assembled into 14,504 unique sequences (UniSeqs). Sequences were analysed and sorted according to their putative origin (animal, algal or bacterial). We identified many new repeated elements in the 3'UTR of most animal genes, suggesting that these elements potentially have a biological role, especially with respect to gene expression regulation. We identified genes of animal origin that have no homolog in the non-symbiotic starlet sea anemone Nematostella vectensis genome, but in other symbiotic cnidarians, and may therefore be involved in the symbiosis relationship in A. viridis. Comparison of protein domain occurrence in A. viridis with that in N. vectensis demonstrated an increase in abundance of some molecular functions, such as protein binding or antioxidant activity, suggesting that these functions are essential for the symbiotic state and may be specific adaptations. This large dataset of sequences provides a valuable resource for future studies on symbiotic interactions in Cnidaria. The comparison with the closest available genome, the sea anemone N. vectensis, as well as

  18. Culture collections.

    Science.gov (United States)

    Smith, David

    2012-01-01

    Culture collections no matter their size, form, or institutional objectives play a role in underpinning microbiology, supplying the resources for study, innovation, and discovery. Their basic roles include providing a mechanism for ex situ conservation of organisms; they are repositories for strains subject to publication, taking in safe, confidential, and patent deposits from researchers. They supply strains for use; therefore, the microorganisms provided must be authentic and preserved well, and any associated information must be valid and sufficient to facilitate the confirmation of their identity and to facilitate their use. The organisms must be collected in compliance with international conventions, international and national legislation and distributed to users indicating clearly the terms and conditions under which they are received and can be used. Collections are harmonizing approaches and characterizing strains to meet user needs. No one single collection can carry out this task alone, and therefore, it is important that output and strategy are coordinated to ensure culture collections deliver the basic resources and services microbiological innovation requires. This chapter describes the types of collection and how they can implement quality management systems and operate to deliver their basic functions. The links to information sources given not only provide support for the practitioners within collections but also provide guidance to users on accessing the huge resource available and how they can help ensure microbiology has the resources and a solid platform for future development. Copyright © 2012 Elsevier Inc. All rights reserved.

  19. Characterization of Posa and Posa-like virus genomes in fecal samples from humans, pigs, rats, and bats collected from a single location in Vietnam

    NARCIS (Netherlands)

    Oude Munnink, Bas B.; Phan, My V. T.; Simmonds, Peter; Koopmans, Marion P. G.; Kellam, Paul; van der Hoek, Lia; Cotten, Matthew

    2017-01-01

    Porcine stool-associated RNA virus (posavirus), and Human stool-associated RNA virus (husavirus) are viruses in the order Picornavirales recently described in porcine and human fecal samples. The tentative group (Posa and Posa-like viruses: PPLVs) also includes fish stool-associated RNA virus

  20. Relatório de estágio

    OpenAIRE

    Sevilha, Joana Isabel Monteiro

    2016-01-01

    No presente relatório de estágio a formanda reflete criticamente o seu percurso de formação respeitante às unidades curriculares de Prática Pedagógica Supervisionada na Educação Pré-Escolar e Prática Pedagógica Supervisionada no 1.º Ciclo do Ensino Básico, sendo parte integrante do Mestrado em Educação Pré-Escolar e Ensino do 1.º Ciclo do Ensino Básico. Assim, relevam-se os processos formativos em questão e evidencia-se a metodologia de investigação-ação como suporte metodol...

  1. Secondary mirror system for the European Solar Telescope (EST)

    Science.gov (United States)

    Cavaller, L.; Siegel, B.; Prieto, G.; Hernandez, E.; Casalta, J. M.; Mercader, J.; Barriga, J.

    2010-07-01

    The European Solar Telescope (EST) is a European collaborative project to build a 4m class solar telescope in the Canary Islands, which is now in its design study phase. The telescope will provide diffraction limited performance for several instruments observing simultaneously at the Coudé focus at different wavelengths. A multi-conjugated adaptive optics system composed of a tip-tilt mirror and several deformable mirrors will be integrated in the telescope optical path. The secondary mirror system is composed of the mirror itself (Ø800mm), the alignment drives and the cooling system needed to remove the solar heat load from the mirror. During the design study the feasibility to provide fast tip-tilt capabilities at the secondary mirror to work as the adaptive optics tip-tilt mirror is also being evaluated.

  2. Inferindo personalidade por meio de estórias

    Directory of Open Access Journals (Sweden)

    Guilherme Gomes Cardoso

    2014-11-01

    Full Text Available Recentemente aspectos sutis do ser humano começaram a ser estudados e utilizados por computadores, um desses é a personalidade. Existem vários estudos que analisam como estruturá-la e extraí-la computacionalmente. No entanto, um dos gargalos no seu estado da arte atual é a forma não sutil para inferir personalidade do usuário. Este trabalho tem como objetivo mostrar o relato de uma experiência que demonstra os passos iniciais e os resultados parciais de uma pesquisa em andamento sobre um método alternativo e mais sutil para inferir a personalidade do usuário. Os resultados apresentam o uso de histórias como uma abordagem promissora, entretanto demanda novos testes baseados em metodologias estatisticamente mais consistentes.

  3. La radio no está amenazada por internet

    Directory of Open Access Journals (Sweden)

    Bruce Girard

    2015-01-01

    Full Text Available La radio es mucho más penetrante y asequible, el uso de los servicios de Internet puede contribuir a informar mejor a sus clientes y establecer interactividad. En vista que por ahora la accesibilidad del Internet es accesible solo a unos pocos, para la radio no es una amenaza el Internet. Enuncia los roles de la radio y señala que está considerada como un vínculo comunitario. Trata además sobre las radio-cadenas satelitales, la radio e Internet: convergencia para la democracia y el crecimiento de la brecha de los que acceden a la información.

  4. Modernismo: ética x estética

    Directory of Open Access Journals (Sweden)

    Maria Tereza Carneiro Lemos

    2017-05-01

    Full Text Available A partir da avaliação do movimento modernista feita por Mario de Andrade e Oswald de Andrade nas conferências “Movimento modernista” e “O caminho percorrido”, na década de 40, busco uma compreensão da questão ética que, segundo os autores, estava ausente na proposta modernista tornando o movimento “gravemente precário”. O desinteresse pelos problemas sociais e políticos de sua geração gerou um “conformismo legítimo”, nas palavras de Mario de Andrade, e acabou por criar, nos seus discursos, um confronto entre o valor estético e ético na arte.

  5. How Questionnaires and Multimedia Measurements collected in the U.S. EPA’s Observational Human Exposure Measurement Studies Inform Exposures

    Science.gov (United States)

    In the last decade, the U.S. EPA has conducted and/or funded numerous observational humanexposure measurement studies where questionnaires were administered to the study participants in addition tothe collection of multimedia measurements. Questionnaire responses provide ancillar...

  6. Collective Efficacy

    DEFF Research Database (Denmark)

    Chen, Ying; Zhou, Xiaohu; Klyver, Kim

    2018-01-01

    at manufacturing companies show that benevolent leadership and moral leadership, both components of paternalistic leadership, are positively related to organizational commitment and further that collective efficacy mediates the moral leadership–organizational commitment relationship. We did not find a relationship...... between authoritarian leadership and organizational commitment. Besides, it was found that team cohesion negatively moderates the relationship between moral leadership and collective efficacy and positively moderates the relationship between collective efficacy and organizational commitment. Explanations......Based on social cognitive theory, we theorize that collective efficacy plays a mediating role in the relationship between paternalistic leadership and organizational commitment and that this mediating role depends on team cohesion. The empirical results from a study of 238 employees from 52 teams...

  7. Los estándares de proyectos en la implementación de los estándares internacionales de información financiera

    Directory of Open Access Journals (Sweden)

    Carlos Augusto Rincón-Soto

    2014-01-01

    Full Text Available La exigencia de la implementación de los estándares internacionales en información financiera está articulada a los términos de otros estándares internacionales, aunque no es una restricción adquirir los estándares contables sin integrar los otros estándares en Colombia, estos se acoplan de manera sistémica, en un apoyo integrador. Realizar una implementación adecuada, requiere de tomar estrategias razonables, este trabajo muestra como los estándares de proyectos ofrecen los fundamentos necesarios para dirigir y gestionar el montaje de un sistema de información contable integral, que incluya las diferentes necesidades de los usuarios.

  8. Towards the understanding of the cocoa transcriptome: Production and analysis of an exhaustive dataset of ESTs of Theobroma cacao L. generated from various tissues and under various conditions

    Science.gov (United States)

    Argout, Xavier; Fouet, Olivier; Wincker, Patrick; Gramacho, Karina; Legavre, Thierry; Sabau, Xavier; Risterucci, Ange Marie; Da Silva, Corinne; Cascardo, Julio; Allegre, Mathilde; Kuhn, David; Verica, Joseph; Courtois, Brigitte; Loor, Gaston; Babin, Regis; Sounigo, Olivier; Ducamp, Michel; Guiltinan, Mark J; Ruiz, Manuel; Alemanno, Laurence; Machado, Regina; Phillips, Wilberth; Schnell, Ray; Gilmour, Martin; Rosenquist, Eric; Butler, David; Maximova, Siela; Lanaud, Claire

    2008-01-01

    Background Theobroma cacao L., is a tree originated from the tropical rainforest of South America. It is one of the major cash crops for many tropical countries. T. cacao is mainly produced on smallholdings, providing resources for 14 million farmers. Disease resistance and T. cacao quality improvement are two important challenges for all actors of cocoa and chocolate production. T. cacao is seriously affected by pests and fungal diseases, responsible for more than 40% yield losses and quality improvement, nutritional and organoleptic, is also important for consumers. An international collaboration was formed to develop an EST genomic resource database for cacao. Results Fifty-six cDNA libraries were constructed from different organs, different genotypes and different environmental conditions. A total of 149,650 valid EST sequences were generated corresponding to 48,594 unigenes, 12,692 contigs and 35,902 singletons. A total of 29,849 unigenes shared significant homology with public sequences from other species. Gene Ontology (GO) annotation was applied to distribute the ESTs among the main GO categories. A specific information system (ESTtik) was constructed to process, store and manage this EST collection allowing the user to query a database. To check the representativeness of our EST collection, we looked for the genes known to be involved in two different metabolic pathways extensively studied in other plant species and important for T. cacao qualities: the flavonoid and the terpene pathways. Most of the enzymes described in other crops for these two metabolic pathways were found in our EST collection. A large collection of new genetic markers was provided by this ESTs collection. Conclusion This EST collection displays a good representation of the T. cacao transcriptome, suitable for analysis of biochemical pathways based on oligonucleotide microarrays derived from these ESTs. It will provide numerous genetic markers that will allow the construction of a high

  9. Towards the understanding of the cocoa transcriptome: Production and analysis of an exhaustive dataset of ESTs of Theobroma cacao L. generated from various tissues and under various conditions.

    Science.gov (United States)

    Argout, Xavier; Fouet, Olivier; Wincker, Patrick; Gramacho, Karina; Legavre, Thierry; Sabau, Xavier; Risterucci, Ange Marie; Da Silva, Corinne; Cascardo, Julio; Allegre, Mathilde; Kuhn, David; Verica, Joseph; Courtois, Brigitte; Loor, Gaston; Babin, Regis; Sounigo, Olivier; Ducamp, Michel; Guiltinan, Mark J; Ruiz, Manuel; Alemanno, Laurence; Machado, Regina; Phillips, Wilberth; Schnell, Ray; Gilmour, Martin; Rosenquist, Eric; Butler, David; Maximova, Siela; Lanaud, Claire

    2008-10-30

    Theobroma cacao L., is a tree originated from the tropical rainforest of South America. It is one of the major cash crops for many tropical countries. T. cacao is mainly produced on smallholdings, providing resources for 14 million farmers. Disease resistance and T. cacao quality improvement are two important challenges for all actors of cocoa and chocolate production. T. cacao is seriously affected by pests and fungal diseases, responsible for more than 40% yield losses and quality improvement, nutritional and organoleptic, is also important for consumers. An international collaboration was formed to develop an EST genomic resource database for cacao. Fifty-six cDNA libraries were constructed from different organs, different genotypes and different environmental conditions. A total of 149,650 valid EST sequences were generated corresponding to 48,594 unigenes, 12,692 contigs and 35,902 singletons. A total of 29,849 unigenes shared significant homology with public sequences from other species.Gene Ontology (GO) annotation was applied to distribute the ESTs among the main GO categories.A specific information system (ESTtik) was constructed to process, store and manage this EST collection allowing the user to query a database.To check the representativeness of our EST collection, we looked for the genes known to be involved in two different metabolic pathways extensively studied in other plant species and important for T. cacao qualities: the flavonoid and the terpene pathways. Most of the enzymes described in other crops for these two metabolic pathways were found in our EST collection.A large collection of new genetic markers was provided by this ESTs collection. This EST collection displays a good representation of the T. cacao transcriptome, suitable for analysis of biochemical pathways based on oligonucleotide microarrays derived from these ESTs. It will provide numerous genetic markers that will allow the construction of a high density gene map of T. cacao

  10. Towards the understanding of the cocoa transcriptome: Production and analysis of an exhaustive dataset of ESTs of Theobroma cacao L. generated from various tissues and under various conditions

    Directory of Open Access Journals (Sweden)

    Ruiz Manuel

    2008-10-01

    Full Text Available Abstract Background Theobroma cacao L., is a tree originated from the tropical rainforest of South America. It is one of the major cash crops for many tropical countries. T. cacao is mainly produced on smallholdings, providing resources for 14 million farmers. Disease resistance and T. cacao quality improvement are two important challenges for all actors of cocoa and chocolate production. T. cacao is seriously affected by pests and fungal diseases, responsible for more than 40% yield losses and quality improvement, nutritional and organoleptic, is also important for consumers. An international collaboration was formed to develop an EST genomic resource database for cacao. Results Fifty-six cDNA libraries were constructed from different organs, different genotypes and different environmental conditions. A total of 149,650 valid EST sequences were generated corresponding to 48,594 unigenes, 12,692 contigs and 35,902 singletons. A total of 29,849 unigenes shared significant homology with public sequences from other species. Gene Ontology (GO annotation was applied to distribute the ESTs among the main GO categories. A specific information system (ESTtik was constructed to process, store and manage this EST collection allowing the user to query a database. To check the representativeness of our EST collection, we looked for the genes known to be involved in two different metabolic pathways extensively studied in other plant species and important for T. cacao qualities: the flavonoid and the terpene pathways. Most of the enzymes described in other crops for these two metabolic pathways were found in our EST collection. A large collection of new genetic markers was provided by this ESTs collection. Conclusion This EST collection displays a good representation of the T. cacao transcriptome, suitable for analysis of biochemical pathways based on oligonucleotide microarrays derived from these ESTs. It will provide numerous genetic markers that will allow

  11. Exploring nervous system transcriptomes during embryogenesis and metamorphosis in Xenopus tropicalis using EST analysis

    Directory of Open Access Journals (Sweden)

    Wegnez Maurice

    2007-05-01

    Full Text Available Abstract Background The western African clawed frog Xenopus tropicalis is an anuran amphibian species now used as model in vertebrate comparative genomics. It provides the same advantages as Xenopus laevis but is diploid and has a smaller genome of 1.7 Gbp. Therefore X. tropicalis is more amenable to systematic transcriptome surveys. We initiated a large-scale partial cDNA sequencing project to provide a functional genomics resource on genes expressed in the nervous system during early embryogenesis and metamorphosis in X. tropicalis. Results A gene index was defined and analysed after the collection of over 48,785 high quality sequences. These partial cDNA sequences were obtained from an embryonic head and retina library (30,272 sequences and from a metamorphic brain and spinal cord library (27,602 sequences. These ESTs are estimated to represent 9,693 transcripts derived from an estimated 6,000 genes. Comparison of these cDNA sequences with protein databases indicates that 46% contain their start codon. Further annotation included Gene Ontology functional classification, InterPro domain analysis, alternative splicing and non-coding RNA identification. Gene expression profiles were derived from EST counts and used to define transcripts specific to metamorphic stages of development. Moreover, these ESTs allowed identification of a set of 225 polymorphic microsatellites that can be used as genetic markers. Conclusion These cDNA sequences permit in silico cloning of numerous genes and will facilitate studies aimed at deciphering the roles of cognate genes expressed in the nervous system during neural development and metamorphosis. The genomic resources developed to study X. tropicalis biology will accelerate exploration of amphibian physiology and genetics. In particular, the model will facilitate analysis of key questions related to anuran embryogenesis and metamorphosis and its associated regulatory processes.

  12. VENOUS AIR-EMBOLISM, PRESERVATION REPERFUSION INJURY, AND THE PRESENCE OF INTRAVASCULAR AIR COLLECTIONS IN HUMAN DONOR LIVERS - A RETROSPECTIVE CLINICAL-STUDY

    NARCIS (Netherlands)

    WOLF, RFE; SLUITER, WJ; BALLAST, A; VANDAM, RM; SLOOFF, MJH

    In human liver transplantation, air embolism is seldom encountered after graft reperfusion. Nevertheless, despite adequate flushing and clamping routines, air emboli have been reported in transesophageal echocardiography (TEE) studies performed during the reperfusion phase, We retrospectively

  13. Estándares para el Sistema de Bibliotecas de la Universidad de Buenos Aires Standards for the Universidad de Buenos Aires Libraries System

    Directory of Open Access Journals (Sweden)

    Elsa Elena Elizalde

    2009-06-01

    internal standards of time, quality, quantity, and costs that reflect the aims and objectives of each particular Academic Unit. Those Standards cover: Organizational aspects of the Academic Library and General Principles of the SISBI; Building and Technological Infrastructure; Human Resources; Services and/or products; Collection development; Technical Processes; Budget; Quality and Innovation Evaluation and Management; Prevention and Conservation; etc.

  14. [Hydatid fertility and protoscolex viability in humans: study of 78 hydatid samples collected between 2005 and 2012 and analyzed at the parasitology laboratory of the Mustapha University Hospital Center of Algiers].

    Science.gov (United States)

    Zait, H; Boulahbel, M; Zait, F; Achir, I; Guerchani, M T; Chaouche, H; Ladjadje, Y; Hamrioui, B

    2013-05-01

    An analysis at the Mustapha University Hospital Center of Algiers examined 78 hydatid samples collected between 2005 and 2012 to determine the fertility rate of metacestodes and the viability of protoscolices. The fertility rate of the hydatid cysts in humans was 88.4% and the protoscolex viability rate 74.5%. The fertility and viability rates found here are high, despite the use of scolicides.

  15. Collective Security

    DEFF Research Database (Denmark)

    Galster, Kjeld

    in worldwide market conditions left perceptible ripples in Danish economy, budget discussions grew in importance over this period. The pacifist stance entailed disinclination to accept that the collective security concept and international treaties and accords signed by Denmark should necessitate credible...... and other international treaties provided arguments for adjusting the foreign and security policy ambitions, and since the general flux in worldwide market conditions left perceptible ripples in Danish economy, budget discussions grew in importance over this period. The pacifist stance entailed......Collective Security: National Egotism (Abstract) In Danish pre-World War I defence debate the notion of collective security is missing. During the early years of the 19th century, the political work is influenced by a pervasive feeling of rising tension and danger on the continent of Europe...

  16. Locals Collection

    Directory of Open Access Journals (Sweden)

    Stephen Hastings-King

    2010-03-01

    Full Text Available A locals collection is a set of parameters that are used to delimit data-mining operations. This piece uses a collection of locals from around Essex Massachusetts to shape and delimit an interrogation of post-reality in contemporary America. It explores the notion of crisis, the possibility of a crisis of empire that may or may not emerge in a media-space that does not allow crisis of empire to be mentioned and relations this maybe-crisis to the various levels of economic dysfunction that have become evident since late 2008. But mostly this piece explores ways in which particular stories about particular people do and do not link/link to these larger-scale narratives. This is the first of a potential series of locals collections that will mine the American post-real.

  17. Biochemical and Structural Analysis of Hormone-sensitive Lipase Homolog EstE7: Insight into the Stabilized Dimerization of HSL-Homolog Proteins

    International Nuclear Information System (INIS)

    Nam, Ki Hyun; Park, Sung Ha; Lee, Won Ho; Hwang, Kwang Yeon

    2010-01-01

    Hormone sensitive lipase (HSL) plays a major role in energy homeostasis and lipid metabolism. Several crystal structures of HSL-homolog proteins have been identified, which has led to a better understanding of its molecular function. HSLhomolog proteins exit as both monomer and dimer, but the biochemical and structural basis for such oligomeric states has not been successfully elucidated. Therefore, we determined the crystal structure of HSL-homolog protein EstE7 from a metagenome library at 2.2 A resolution and characterized the oligomeric states of EstE7 both structurally and biochemically. EstE7 protein prefers the dimeric state in solution, which is supported by its higher enzymatic activity in the dimeric state. In the crystal form, EstE7 protein shows two-types of dimeric interface. Specifically, dimerization via the external β8-strand occurred through tight association between two pseudosymmetric folds via salt bridges, hydrogen bonds and van der Waals interactions. This dimer formation was similar to that of other HSL-homolog protein structures such as AFEST, BEFA, and EstE1. We anticipate that our results will provide insight into the oligomeric state of HSLhomolog proteins

  18. Putative resistance genes in the CitEST database

    Directory of Open Access Journals (Sweden)

    Simone Guidetti-Gonzalez

    2007-01-01

    Full Text Available Disease resistance in plants is usually associated with the activation of a wide variety of defense responses to prevent pathogen replication and/or movement. The ability of the host plant to recognize the pathogen and to activate defense responses is regulated by direct or indirect interaction between the products of plant resistance (R and pathogen avirulence (Avr genes. Attempted infection of plants by avirulent pathogens elicits a battery of defenses often followed by the collapse of the challenged host cells. Localized host cell death may help to prevent the pathogen from spreading to uninfected tissues, known as hypersensitive response (HR. When either the plant or the pathogen lacks its cognate gene, activation of the plant’s defense responses fails to occur or is delayed and does not prevent pathogen colonization. In the CitEST database, we identified 1,300 reads related to R genes in Citrus which have been reported in other plant species. These reads were translated in silico, and alignments of their amino acid sequences revealed the presence of characteristic domains and motifs that are specific to R gene classes. The description of the reads identified suggests that they function as resistance genes in citrus.

  19. Orden de no reanimar, consideraciones sobre este problema

    Directory of Open Access Journals (Sweden)

    Dr. G. Luis Cereceda

    2011-05-01

    Se analizan los principales problemas, comenzando por las dificultades según los diferentes escenarios (servicio de urgencia, pabellón de maternidad, sala de hospitalizados, unidad de intensivo, pabellones quirúrgicos; se analiza la incertidumbre sobre el pronóstico de cada pacientes y sobre quién(es deben tomar las decisiones sobre el fin de la vida. Idealmente debe ser el paciente autónomo quien tome la decisión, pero en otros casos se requieren alternativas, una de ellas es la Orden Unilateral. Otros problemas son la Validez de las órdenes de no-RCP en los diferentes tiempos evolutivos, el problema de la Futilidad y la Validez de las “Directivas Anticipadas”, en este grupo resalta el enfoque POLST (Physician’s Order for Life Sustaining Treatment como más comprehensivo; como complemento ha surgido también el concepto AND (Allow Natural Death, que podría estar destinado a remplazar la orden de no-RCP (DNR.

  20. Estética como fisiologia aplicada em Nietzsche

    Directory of Open Access Journals (Sweden)

    Renato Bittencourt

    2010-07-01

    Full Text Available A proposta deste artigo consiste em pensarmos a relação intrínseca que Nietzsche estabelece entre a estética e a compreensão orgânica da vida humana, associada diretamente a uma perspectiva fisiológica. Cabe ressaltar que a noção de fisiologia em Nietzsche não se fundamenta em parâmetros puramente biológicos ou materiais, mas envolve todos os atos criativos do indivíduo. Por conseguinte, para compreendermos de forma precisa a realização da criatividade artística é de suma importância que se faça valer a importância da fisiologia do artista no processo de elaboração da obra de arte. Onde os instintos vitais se encontram em declínio existencial, haverá uma obra de arte decadente; onde os instintos vitais manifestam exuberância, capacidade de assimilação e saúde, haverá uma glorificação da existência através da arte.

  1. Ciudadanos del este de Europa consumidores de drogas en Barcelona

    Directory of Open Access Journals (Sweden)

    González M.

    2003-01-01

    Full Text Available Desde mayo de 1999 hasta mayo de 2001, hemos contactado en el SAPS (Servicio de Atención Social y Sanitaria de Barcelona con usuarios de drogas de países del este de Europa. Acuden a centros terapéuticos gratuitos, aunque pagan por la organización del viaje unos 500 euros. Son jóvenes entre 18 y 30 años y mantienen el contacto con sus familiares. Conocen los riesgos de transmisión de enfermedades, pero suelen reutilizar las jeringas. Es alta la prevalencia de hepatitis C (92% y B (62% y menor la de infección por el VIH (19%. Si no abandonan las drogas, el retorno es un fracaso y tienen dificultades para proseguir los tratamientos con metadona o antirretrovirales. La respuesta asistencial ha de adecuarse a sus necesidades. Se debe procurar la mediación cultural y la información en los lugares de origen, supervisar los centros terapéuticos y diseñar alternativas a los abandonos. Hay que desarrollar la colaboración internacional, estimular programas de disminución de riesgos derivados del consumo y evitar que del tratamiento se haga un comercio.

  2. Development of 23 novel polymorphic EST-SSR markers for the endangered relict conifer Metasequoia glyptostroboides.

    Science.gov (United States)

    Jin, Yuqing; Bi, Quanxin; Guan, Wenbin; Mao, Jian-Feng

    2015-09-01

    Metasequoia glyptostroboides is an endangered relict conifer species endemic to China. In this study, expressed sequence tag-simple sequence repeat (EST-SSR) markers were developed using transcriptome mining for future genetic and functional studies. We collected 97,565 unigene sequences generated by 454 pyrosequencing. A bioinformatics analysis identified 2087 unique and putative microsatellites, from which 96 novel microsatellite markers were developed. Fifty-three of the 96 primer sets successfully amplified clear fragments of the expected sizes; 23 of those loci were polymorphic. The number of alleles per locus ranged from two to eight, with an average of three, and the observed and expected heterozygosity values ranged from 0 to 1.0 and 0.117 to 0.813, respectively. These microsatellite loci will enrich the genetic resources to develop functional studies and conservation strategies for this endangered relict species.

  3. Las ideas estéticas en Ramiro Maeztu : la función del arte

    Directory of Open Access Journals (Sweden)

    José Luis Bernal Muñoz

    2001-01-01

    Full Text Available La figura de Ramiro de Maeztu se ha visto durante demasiado tiempo vinculada de forma casi exclusiva a su visión política y todo lo más sociológica. Sin embargo su pensamiento fue universal y se ocupó de los más amplieos temas con acierto y precisión, Este estudio trata de aportar una aproximación a su visión estética y al papel que en su opinión interpreta, o debería interpretar, el Arte en el devenir de la sociedad.The spanish writer Ramiro de Maeztu has been considerated during a lot of time linked in a only way with his politic or sociologyc looking. But he had a universal thinking and he looked after about the most extensiva subjects in a proper way. This research try to bring a new approach to his aesthetics ideas and to the role than Art play, or should play, on the developement of the human society.

  4. Collectes à long terme

    CERN Multimedia

    Collectes à long terme

    2014-01-01

    En cette fin d’année 2014 qui approche à grands pas, le Comité des Collectes à Long Terme remercie chaleureusement ses fidèles donatrices et donateurs réguliers pour leurs contributions à nos actions en faveur des plus démunis de notre planète. C’est très important, pour notre Comité, de pouvoir compter sur l’appui assidu que vous nous apportez. Depuis plus de 40 ans maintenant, le modèle des CLT est basé principalement sur des actions à long terme (soit une aide pendant 4-5 ans par projet, mais plus parfois selon les circonstances), et sa planification demande une grande régularité de ses soutiens financiers. Grand MERCI à vous ! D’autres dons nous parviennent au cours de l’année, et ils sont aussi les bienvenus. En particulier, nous tenons à remercier...

  5. The human milk study, HUMIS. Presentation of a birth cohort study which aims to collect milk samples from 6000 mothers, for the assessment of persistent organic pollutants (POPS), relating it to exposure factors and health outcomes

    Energy Technology Data Exchange (ETDEWEB)

    Eggesboe, M.; Stigum, H.; Becher, G.; Magnus, P. [Norwegian Inst. of Public Health, Oslo (Norway); Polder, A.; Skaare, J.U. [The Norwegian School of Veterinay Science, Oslo (Norway); Lindstroem, G. [Orebro Univ., Orebro (Sweden)

    2004-09-15

    Although PCB has been forbidden for more than 20 years now, and its levels in human milk is declining, it remains among the chemicals in human milk causing most concern with regard to its possible detrimental effects on the fetus and the breastfed child. Due to our industry, amongst others, the Norwegian population has been rather heavily exposed to PCB. Furthermore, new environmental toxicants are steadily entering the scene, such as the Brominated flame retardants. The level of Brominated flame retardants in human milk has shown an exponential increase during the last ten years, and this group of chemicals, are causing increasingly more concern. Studies from Sweden has shown that the levels differ greatly between individuals, however, for reasons yet unknown. In Norway, the highest levels of Brominated flame retardants ever measured in the world was reported from fish in Mjoesa. Surprisingly few attempts has been made to identify dietary habits or other life style factors that are associated with the levels of these toxicants in human milk. Such knowledge is needed in order for accurate prophylactic measures to be taken by the population and of special importance to women before and during child bearing age, in order to keep the levels in human milk as low as possible. Furthermore, there is great need for more knowledge of the effects of these toxicants on child health. The need for more research in this field, especially the need for prospective exposure data and the need for interdisciplinary approaches has been specifically targeted. Therefore a research initiative was taken in Norway to establish a prospective birth cohort which aims to recruit 6000 mother/child pairs, in whom human milk samples are collected in infancy and information on health outcomes are collected throughout the child's first seven years of life. The aim of this presentation is to describe this project in more detail and to give some preliminary results.

  6. Detection of RNA structures in porcine EST data and related mammals

    DEFF Research Database (Denmark)

    Seemann, Ernst Stefan; Gilchrist, Michael J.; Hofacker, Ivo L.

    2007-01-01

    % porcine coding transcripts (of 18,600 identified) as well as less than one-third ORF-free transcripts are conserved at least in the closely related bovine genome. Approximately one percent of the coding and 10% of the remaining matches are unique between the PigEST data and cow genome. Based on the pig......BACKGROUND: Non-coding RNAs (ncRNAs) are involved in a wide spectrum of regulatory functions. Within recent years, there have been increasing reports of observed polyadenylated ncRNAs and mRNA like ncRNAs in eukaryotes. To investigate this further, we examined the large data set in the Sino......-cow alignments, we searched for similarities to 16 other organisms by UCSC available alignments, which resulted in a 87% coverage by the human genome for instance. CONCLUSION: Besides recovering several of the already annotated functional RNA structures, we predicted a large number of high confidence conserved...

  7. EST based phylogenomics of Syndermata questions monophyly of Eurotatoria

    Directory of Open Access Journals (Sweden)

    Bucher Gregor

    2008-12-01

    Full Text Available Abstract Background The metazoan taxon Syndermata comprising Rotifera (in the classical sense of Monogononta+Bdelloidea+Seisonidea and Acanthocephala has raised several hypotheses connected to the phylogeny of these animal groups and the included subtaxa. While the monophyletic origin of Syndermata and Acanthocephala is well established based on morphological and molecular data, the phylogenetic position of Syndermata within Spiralia, the monophyletic origin of Monogononta, Bdelloidea, and Seisonidea and the acanthocephalan sister group are still a matter of debate. The comparison of the alternative hypotheses suggests that testing the phylogenetic validity of Eurotatoria (Monogononta+Bdelloidea is the key to unravel the phylogenetic relations within Syndermata. The syndermatan phylogeny in turn is a prerequisite for reconstructing the evolution of the acanthocephalan endoparasitism. Results Here we present our results from a phylogenomic approach studying i the phylogenetic position of Syndermata within Spiralia, ii the monophyletic origin of monogononts and bdelloids and iii the phylogenetic relations of the latter two taxa to acanthocephalans. For this analysis we have generated EST libraries of Pomphorhynchus laevis, Echinorhynchus truttae (Acanthocephala and Brachionus plicatilis (Monogononta. By extending these data with database entries of B. plicatilis, Philodina roseola (Bdelloidea and 25 additional metazoan species, we conducted phylogenetic reconstructions based on 79 ribosomal proteins using maximum likelihood and bayesian approaches. Our findings suggest that the phylogenetic position of Syndermata within Spiralia is close to Platyhelminthes, that Eurotatoria are not monophyletic and that bdelloids are more closely related to acanthocephalans than monogononts. Conclusion Mapping morphological character evolution onto molecular phylogeny suggests the (partial or complete reduction of the corona and the emergence of a retractable

  8. EST and microarray analysis of horn development in Onthophagus beetles

    Directory of Open Access Journals (Sweden)

    Tang Zuojian

    2009-10-01

    Full Text Available Abstract Background The origin of novel traits and their subsequent diversification represent central themes in evo-devo and evolutionary ecology. Here we explore the genetic and genomic basis of a class of traits that is both novel and highly diverse, in a group of organisms that is ecologically complex and experimentally tractable: horned beetles. Results We developed two high quality, normalized cDNA libraries for larval and pupal Onthophagus taurus and sequenced 3,488 ESTs that assembled into 451 contigs and 2,330 singletons. We present the annotation and a comparative analysis of the conservation of the sequences. Microarrays developed from the combined libraries were then used to contrast the transcriptome of developing primordia of head horns, prothoracic horns, and legs. Our experiments identify a first comprehensive list of candidate genes for the evolution and diversification of beetle horns. We find that developing horns and legs show many similarities as well as important differences in their transcription profiles, suggesting that the origin of horns was mediated partly, but not entirely, by the recruitment of genes involved in the formation of more traditional appendages such as legs. Furthermore, we find that horns developing from the head and prothorax differ in their transcription profiles to a degree that suggests that head and prothoracic horns are not serial homologs, but instead may have evolved independently from each other. Conclusion We have laid the foundation for a systematic analysis of the genetic basis of horned beetle development and diversification with the potential to contribute significantly to several major frontiers in evolutionary developmental biology.

  9. Duchamp e a anestesia estética na publicidade

    Directory of Open Access Journals (Sweden)

    João Anzanello Carrascoza

    2008-09-01

    Full Text Available A criação publicitária resulta de uma prática de bricolagem levada a termo pelo redator e pelo diretor de arte – profissionais que atuam em dupla nas agências de propaganda e são os responsáveis pela elaboração das mensagens. Nesse processo, lançam mão de todo tipo de material cultural para criar as peças solicitadas. Ambos se valem sistematicamente, como matéria-prima, de citações de imagens e enunciados fundadores, interferindo em seu significado, o que nos faz pensar nos ready-mades de Duchamp. Este artigo traz uma reflexão sobre o ready-made como método de criação na propaganda e suas implicações no mundo dos signos. Palavras-chave: Publicidade; processo criativo; bricolagem, dialogismo; ready-made. ABSTRACT The creation of advertising is the result of a bricolage process between a writer and an art director leading to an end result. These professional people work as partnership teams in advertising agencies and are responsible for the development of advertising messages. In this process, they use all forms of cultural material to stimulate them in creating the requested pieces. Both individuals systematically draw from the raw material of existing images and phrases to create meaning in the advertising in a way that makes us think of Duchamp’s ready-mades. This article is a reflection on the ready-made as a method of advertisement creation and the implications of it in the world of signs. Keywords: Advertisement; creative process; bricolage, dialogism; ready-made.

  10. An Analysis of Trafficking Receptors Shows that CD44 and P-Selectin Glycoprotein Ligand-1 Collectively Control the Migration of Activated Human T-Cells

    KAUST Repository

    Ali, Amal J.; AbuElela, Ayman; Merzaban, Jasmeen

    2017-01-01

    -selectin ligands, to CD44, a ligand that has not previously been characterized as an E-selectin ligand on activated human T-cells. We showed that CD44 acts as a functional E-selectin ligand when expressed on both CD4+ and CD8+ T-cells. Moreover, the CD44 protein

  11. Radiation-induced progressive decreasing in the expression of reverse transcriptase gene of hEST2 and telomerase activity

    International Nuclear Information System (INIS)

    Zhu Hanneng; Chen Wenying; Xiong Sidong

    2000-01-01

    Telomerase is a ribonucleoprotein complex that adds heximeric repeats called telomeres to the growing ends of chromosomal DNA. Telomerase activity is present in a vast majority of tumors but is repressed in most normal tissues. Human telomerase catalytic subunit gene (hEST2) reverse transcriptase (RT) segment was cloned by PCR according to the sequence published in GeneBank. PCR was used to investigate the expression of the hEST2 RT segment in diverse tumors as well as in various normal tissues. Results indicated that hEST2 RT segment was detectable in tumor cells lines but not in normal cells and tissues. In order to identify the relationship between telomerase and the biological effect of radiation injury, HeLa cells, KB cells and A431 cells were employed to measure the change in telomerase activity after 60 Co-ray irradiation at RNA level and protein level. Quantitative PCR determined that expression of hEST2 RT segment that encodes seven motifs of the human telomeras decreased with increasing dosage of radiation. In addition, a PCR-based telomeric repeat amplification protocol was used to assay telomerase activity after exposure to radiation. The results strongly support the experiments we had made: Telomerase activity decreases with increasing dosage of radiation. We conclude that detection of the hEST2 RT segment by Northern blotting is a new method for detecting telomerase activity. Furthermore, radiation can cause a dose-dependent decrease in telomerase activity. The effect of radiation on telomerase is one possible reason for the death of cancer cells after irradiation. (author)

  12. Comme c'est curieux, comme c'est bizarre et quelle coïncidence ! concours de nouvelles

    CERN Document Server

    2015-01-01

    Elles sont partout : dans la nature, nichées au coeur des tournesols, des cristaux de quartz et des coquilles d'escargot sous la forme du nombre d'or ; dans nos vies ponctuées de rencontres, d'événements qui se font écho. Coïncidences : simples fruits du hasard, vraiment, ou signes d'une causalité cachée ? Un pigeon aux intestins facétieux rencontre un Président de la République malchanceux... Un obus rencontre une chambre à coucher – mais ses occupants ont rendez-vous avec un gâteau… Un dictateur qui abuse son peuple à coups de coïncidences truquées sera démasqué grâce à la rencontre inopinée d'un officier et d'un poisson… Jonglant avec les probabilités, l'Histoire et l'actualité, les lauréats de cette 6e édition ont montré, cette fois encore, que la rigueur scientifique est la meilleure amie de la fantaisie et de l'imagination. Quant à la table ronde qui ouvre ce recueil, elle croise étymologie, chaînes de causalités et lignes d'univers pour arriver à ce constat, partag�...

  13. Pairagon+N-SCAN_EST: a model-based gene annotation pipeline

    DEFF Research Database (Denmark)

    Arumugam, Manimozhiyan; Wei, Chaochun; Brown, Randall H

    2006-01-01

    This paper describes Pairagon+N-SCAN_EST, a gene annotation pipeline that uses only native alignments. For each expressed sequence it chooses the best genomic alignment. Systems like ENSEMBL and ExoGean rely on trans alignments, in which expressed sequences are aligned to the genomic loci...... with de novo gene prediction by using N-SCAN_EST. N-SCAN_EST is based on a generalized HMM probability model augmented with a phylogenetic conservation model and EST alignments. It can predict complete transcripts by extending or merging EST alignments, but it can also predict genes in regions without EST...

  14. QuEST for malware type-classification

    Science.gov (United States)

    Vaughan, Sandra L.; Mills, Robert F.; Grimaila, Michael R.; Peterson, Gilbert L.; Oxley, Mark E.; Dube, Thomas E.; Rogers, Steven K.

    2015-05-01

    Current cyber-related security and safety risks are unprecedented, due in no small part to information overload and skilled cyber-analyst shortages. Advances in decision support and Situation Awareness (SA) tools are required to support analysts in risk mitigation. Inspired by human intelligence, research in Artificial Intelligence (AI) and Computational Intelligence (CI) have provided successful engineering solutions in complex domains including cyber. Current AI approaches aggregate large volumes of data to infer the general from the particular, i.e. inductive reasoning (pattern-matching) and generally cannot infer answers not previously programmed. Whereas humans, rarely able to reason over large volumes of data, have successfully reached the top of the food chain by inferring situations from partial or even partially incorrect information, i.e. abductive reasoning (pattern-completion); generating a hypothetical explanation of observations. In order to achieve an engineering advantage in computational decision support and SA we leverage recent research in human consciousness, the role consciousness plays in decision making, modeling the units of subjective experience which generate consciousness, qualia. This paper introduces a novel computational implementation of a Cognitive Modeling Architecture (CMA) which incorporates concepts of consciousness. We apply our model to the malware type-classification task. The underlying methodology and theories are generalizable to many domains.

  15. An expressed sequence tag (EST) library for Drosophila serrata, a model system for sexual selection and climatic adaptation studies.

    Science.gov (United States)

    Frentiu, Francesca D; Adamski, Marcin; McGraw, Elizabeth A; Blows, Mark W; Chenoweth, Stephen F

    2009-01-21

    The native Australian fly Drosophila serrata belongs to the highly speciose montium subgroup of the melanogaster species group. It has recently emerged as an excellent model system with which to address a number of important questions, including the evolution of traits under sexual selection and traits involved in climatic adaptation along latitudinal gradients. Understanding the molecular genetic basis of such traits has been limited by a lack of genomic resources for this species. Here, we present the first expressed sequence tag (EST) collection for D. serrata that will enable the identification of genes underlying sexually-selected phenotypes and physiological responses to environmental change and may help resolve controversial phylogenetic relationships within the montium subgroup. A normalized cDNA library was constructed from whole fly bodies at several developmental stages, including larvae and adults. Assembly of 11,616 clones sequenced from the 3' end allowed us to identify 6,607 unique contigs, of which at least 90% encoded peptides. Partial transcripts were discovered from a variety of genes of evolutionary interest by BLASTing contigs against the 12 Drosophila genomes currently sequenced. By incorporating into the cDNA library multiple individuals from populations spanning a large portion of the geographical range of D. serrata, we were able to identify 11,057 putative single nucleotide polymorphisms (SNPs), with 278 different contigs having at least one "double hit" SNP that is highly likely to be a real polymorphism. At least 394 EST-associated microsatellite markers, representing 355 different contigs, were also found, providing an additional set of genetic markers. The assembled EST library is available online at http://www.chenowethlab.org/serrata/index.cgi. We have provided the first gene collection and largest set of polymorphic genetic markers, to date, for the fly D. serrata. The EST collection will provide much needed genomic resources for

  16. Concurrent Collections

    OpenAIRE

    Budimlić, Zoran; Burke, Michael; Cavé, Vincent; Knobe, Kathleen; Lowney, Geoff; Newton, Ryan; Palsberg, Jens; Peixotto, David; Sarkar, Vivek; Schlimbach, Frank; Taşırlar, Sağnak

    2010-01-01

    We introduce the Concurrent Collections (CnC) programming model. CnC supports flexible combinations of task and data parallelism while retaining determinism. CnC is implicitly parallel, with the user providing high-level operations along with semantic ordering constraints that together form a CnC graph. We formally describe the execution semantics of CnC and prove that the model guarantees deterministic computation. We evaluate the performance of CnC implementations on several applications an...

  17. An Analysis of Trafficking Receptors Shows that CD44 and P-Selectin Glycoprotein Ligand-1 Collectively Control the Migration of Activated Human T-Cells

    KAUST Repository

    Ali, Amal J.

    2017-05-03

    Selectins guide the traffic of activated T-cells through the blood stream by mediating their tethering and rolling onto inflamed endothelium, in this way acting as beacons to help navigate them to sites of inflammation. Here, we present a comprehensive analysis of E-selectin ligands expressed on activated human T-cells. We identified several novel glycoproteins that function as E-selectin ligands. Specifically, we compared the role of P-selectin glycoprotein ligand-1 (PSGL-1) and CD43, known E-selectin ligands, to CD44, a ligand that has not previously been characterized as an E-selectin ligand on activated human T-cells. We showed that CD44 acts as a functional E-selectin ligand when expressed on both CD4+ and CD8+ T-cells. Moreover, the CD44 protein carries a binding epitope identifying it as hematopoietic cell E- and/or L-selectin ligand (HCELL). Furthermore, by knocking down these ligands individually or together in primary activated human T-cells, we demonstrated that CD44/HCELL, and not CD43, cooperates with PSGL-1 as a major E-selectin ligand. Additionally, we demonstrated the relevance of our findings to chronic autoimmune disease, by showing that CD44/HCELL and PSGL-1, but not CD43, from T-cells isolated from psoriasis patients, bind E-selectin.

  18. Embryonic cardiac morphometry in Carnegie stages 15-23, from the Complutense University of Madrid Institute of Embryology Human Embryo Collection.

    Science.gov (United States)

    Arráez-Aybar, L A; Turrero-Nogués, A; Marantos-Gamarra, D G

    2008-01-01

    We performed a morphometric study of cardiac development on human embryos to complement the scarce data on human embryonic cardiac morphometry and to attempt to establish, from these, algorithms describing cardiac growth during the second month of gestation. Thirty human embryos from Carnegie stages 15-23 were included in the study. Shrinkage and compression effects from fixation and inclusion in paraffin were considered in our calculations. Growth of the cardiac (whole heart) volume and volume of ventricular myocardium through the Carnegie stages were analysed by ANOVA. Linear correlation was used to describe the relationship between the ventricular myocardium and cardiac volumes. Comparisons of models were carried out through the R2 statistic. The relationship volume of ventricular myocardium versus cardiac volume is expressed by the equation: cardiac volume = 0.6266 + 2.4778 volume of ventricular myocardium. The relationship cardiac volume versus crown-rump length is expressed by the equation: cardiac volume = 1.3 e(0.126 CR length), where e is the base of natural logarithms. At a clinical level, these results can contribute towards the establishment of a normogram for cardiac development, useful for the design of strategies for early diagnosis of congenital heart disease. They can also help in the study of embryogenesis, for example in the discussion of ventricular trabeculation. Copyright 2007 S. Karger AG, Basel.

  19. Immersive Technology for Human-Centric Cyberphysical Systems in Complex Manufacturing Processes: A Comprehensive Overview of the Global Patent Profile Using Collective Intelligence

    Directory of Open Access Journals (Sweden)

    Usharani Hareesh Govindarajan

    2018-01-01

    Full Text Available Immersive technology for human-centric cyberphysical systems includes broad concepts that enable users in the physical world to connect with the cyberworld with a sense of immersion. Complex systems such as virtual reality, augmented reality, brain-computer interfaces, and brain-machine interfaces are emerging as immersive technologies that have the potential for improving manufacturing systems. Industry 4.0 includes all technologies, standards, and frameworks for the fourth industrial revolution to facilitate intelligent manufacturing. Industrial immersive technologies will be used for smart manufacturing innovation in the context of Industry 4.0’s human machine interfaces. This research provides a thorough review of the literature, construction of a domain ontology, presentation of patent metatrend statistical analysis, and data mining analysis using a technology function matrix and highlights technical and functional development trends using latent Dirichlet allocation (LDA models. A total of 179 references from the IEEE and IET databases and 2,672 patents are systematically analyzed to identify current trends. The paper establishes an essential foundation for the development of advanced human-centric cyberphysical systems in complex manufacturing processes.

  20. An EST dataset for Metasequoia glyptostroboides buds: the first EST resource for molecular genomics studies in Metasequoia.

    Science.gov (United States)

    Zhao, Ying; Thammannagowda, Shivegowda; Staton, Margaret; Tang, Sha; Xia, Xinli; Yin, Weilun; Liang, Haiying

    2013-03-01

    The "living fossil" Metasequoia glyptostroboides Hu et Cheng, commonly known as dawn redwood or Chinese redwood, is the only living species in the genus and is valued for its essential oil and crude extracts that have great potential for anti-fungal activity. Despite its paleontological significance and economical value as a rare relict species, genomic resources of Metasequoia are very limited. In order to gain insight into the molecular mechanisms behind the formation of reproductive buds and the transition from vegetative phase to reproductive phase in Metasequoia, we performed sequencing of expressed sequence tags from Metasequoia vegetative buds and female buds. By using the 454 pyrosequencing technology, a total of 1,571,764 high-quality reads were generated, among which 733,128 were from vegetative buds and 775,636 were from female buds. These EST reads were clustered and assembled into 114,124 putative unique transcripts (PUTs) with an average length of 536 bp. The 97,565 PUTs that were at least 100 bp in length were functionally annotated by a similarity search against public databases and assigned with Gene Ontology (GO) terms. A total of 59 known floral gene families and 190 isotigs involved in hormone regulation were captured in the dataset. Furthermore, a set of PUTs differentially expressed in vegetative and reproductive buds, as well as SSR motifs and high confidence SNPs, were identified. This is the first large-scale expressed sequence tags ever generated in Metasequoia and the first evidence for floral genes in this critically endangered deciduous conifer species.

  1. Algunas notas sobre Bajo este sol tremendo, de Carlos Busqued

    Directory of Open Access Journals (Sweden)

    María Stegmayer

    2011-11-01

    Full Text Available In Carlos Busqued's first novel, topics around the most disturbing manifestations of violence adopt an unsettling tonality, since they avoid psychological treatment or sociological reflection to situate themselves in a zone of indistinction between subject and object, nature and history, figure and background, animal and human: formless forms bringing news from an underworld whose violence always prevails. The present article aims at exploring that which is involved in the experience of a limit trespassed and its figures -a symptom of social experience in the present

  2. Por um outro princípio da realidade: o sentido formativo da estética em H. Marcuse

    Directory of Open Access Journals (Sweden)

    Vivian Baroni

    2017-04-01

    Full Text Available Tendo por base a filosofia de Herbert Marcuse, o presente artigo objetiva demonstrar a possibilidade de superação do princípio da realidade por meio dos pressupostos fornecidos pela educação estética. Centrada na formação do sujeito como um todo, a educação estética de Marcuse aproxima-se do conceito de Bildung, focando-se na tarefa de trazer de volta à racionalidade moderna as dimensões humanísticas que foram bloqueadas pelo processo da racionalização instrumental. Ao rechaçar a lógica competitiva e dar ênfase à libertação instintual, a educação estética seria capaz ainda de fomentar uma nova estrutura da experiência, que modificaria de modo essencial a relação dos indivíduos com os objetos e com o meio. Desse modo, a educação estética poderia projetar uma tecnologia livre para a realização do seu telos original: a preservação da vida.

  3. 76 FR 17423 - Agency Information Collection Activities: Proposed Collection; Comment Request

    Science.gov (United States)

    2011-03-29

    ... Services Administration publishes summaries of proposed data collection projects for public comment... DEPARTMENT OF HEALTH AND HUMAN SERVICES Health Resources and Services Administration Agency Information Collection Activities: Proposed Collection; Comment Request In compliance with the requirements of...

  4. All 5' EST - KOME | LSDB Archive [Life Science Database Archive metadata

    Lifescience Database Archive (English)

    Full Text Available switchLanguage; BLAST Search Image Search Home About Archive Update History Data ...n of data contents 5' EST sequences Data file File name: CSV: kome_est_5end_all.zip File URL: ftp://ftp.biosciencedbc.jp/archiv...fasta.zip File URL: ftp://ftp.biosciencedbc.jp/archive/kome/LATEST/kome_est_5end_...se Description Download License Update History of This Database Site Policy | Contact Us All 5' EST - KOME | LSDB Archive ...

  5. All 3' EST - KOME | LSDB Archive [Life Science Database Archive metadata

    Lifescience Database Archive (English)

    Full Text Available switchLanguage; BLAST Search Image Search Home About Archive Update History Data ...n of data contents 3' EST sequences Data file File name: CSV: kome_est_3end_all.zip File URL: ftp://ftp.biosciencedbc.jp/archiv...fasta.zip File URL: ftp://ftp.biosciencedbc.jp/archive/kome/LATEST/kome_est_3end_...se Description Download License Update History of This Database Site Policy | Contact Us All 3' EST - KOME | LSDB Archive ...

  6. Collective Success or Collective Failure?

    DEFF Research Database (Denmark)

    Fayyaz, Anjum

    study of soccer village project to learn how various attempts at facilitating joint CSR action in the Pakistani football manufacturing have consistently failed in addressing international CSR compliance demands. I conclude that this form of collective failure – along with technological changes, lack...... of innovation, and government failure - can partly explain why Sialkot has been marginalized in terms of its overall share of world football manufacturing in the last decade....

  7. Development of a multiplex real-time PCR assay for detection of human enteric viruses other than norovirus using samples collected from gastroenteritis patients in Fukui Prefecture, Japan.

    Science.gov (United States)

    Kowada, Kazuaki; Takeuchi, Kenji; Hirano, Eiko; Toho, Miho; Sada, Kiyonao

    2018-01-01

    There are many varieties of gastroenteritis viruses, of which norovirus (NoV) accounts for over 90% of the viral food poisoning incidents in Japan. However, protocols for rapidly identifying other gastroenteritis viruses need to be established to investigate NoV-negative cases intensively. In this study, a multiplex real-time PCR assay targeting rotavirus A, rotavirus C, sapovirus, astrovirus, adenovirus, and enterovirus was developed using stool samples collected from gastroenteritis patients between 2010 and 2013 in Fukui Prefecture, Japan. Of the 126 samples collected sporadically from pediatric patients with suspected infectious gastroenteritis, 51 were positive for non-NoV target viruses, whereas 27 were positive for NoV, showing a high prevalence of non-NoV viruses in pediatric patients. In contrast, testing in 382 samples of 58 gastroenteritis outbreaks showed that non-NoV viruses were detected in 13 samples, with NoV in 267. Of the 267 NoV-positive patients, only two were co-infected with non-NoV target viruses, suggesting that testing for non-NoV gastroenteritis viruses in NoV-positive samples was mostly unnecessary in outbreak investigations. Given these results, multiplex real-time PCR testing for non-NoV gastroenteritis viruses, conducted separately from NoV testing, may be helpful to deal with two types of epidemiological investigations, regular surveillance of infectious gastroenteritis and urgent testing when gastroenteritis outbreaks occur. © 2017 Wiley Periodicals, Inc.

  8. Alicyclobacillus acidocaldarius Thermophilic Esterase EST2's Activity in Milk and Cheese Models

    NARCIS (Netherlands)

    Mandrich, L.; Manco, M.; Rossie, M.; Floris, E.; Jansen-van den Bosch, T.; Smit, G.; Wouters, J.A.

    2006-01-01

    The aim of this work was to investigate the behavior of thermophilic esterase EST2 from Alicyclobacillus acidocaldarius in milk and cheese models. The pure enzyme was used to compare the EST2 hydrolytic activity to the activity of endogenous esterase EstA from Lactococcus lactis. The results

  9. The Fate of Anatomical Collections

    NARCIS (Netherlands)

    Knoeff, Rina; Zwijnenberg, Robert

    Almost every medical faculty possesses anatomical and/or pathological collections: human and animal preparations, wax- and other models, as well as drawings, photographs, documents and archives relating to them. In many institutions these collections are well-preserved, but in others they are poorly

  10. Pepper EST database: comprehensive in silico tool for analyzing the chili pepper (Capsicum annuum transcriptome

    Directory of Open Access Journals (Sweden)

    Kim Woo Taek

    2008-10-01

    Full Text Available Abstract Background There is no dedicated database available for Expressed Sequence Tags (EST of the chili pepper (Capsicum annuum, although the interest in a chili pepper EST database is increasing internationally due to the nutritional, economic, and pharmaceutical value of the plant. Recent advances in high-throughput sequencing of the ESTs of chili pepper cv. Bukang have produced hundreds of thousands of complementary DNA (cDNA sequences. Therefore, a chili pepper EST database was designed and constructed to enable comprehensive analysis of chili pepper gene expression in response to biotic and abiotic stresses. Results We built the Pepper EST database to mine the complexity of chili pepper ESTs. The database was built on 122,582 sequenced ESTs and 116,412 refined ESTs from 21 pepper EST libraries. The ESTs were clustered and assembled into virtual consensus cDNAs and the cDNAs were assigned to metabolic pathway, Gene Ontology (GO, and MIPS Functional Catalogue (FunCat. The Pepper EST database is designed to provide a workbench for (i identifying unigenes in pepper plants, (ii analyzing expression patterns in different developmental tissues and under conditions of stress, and (iii comparing the ESTs with those of other members of the Solanaceae family. The Pepper EST database is freely available at http://genepool.kribb.re.kr/pepper/. Conclusion The Pepper EST database is expected to provide a high-quality resource, which will contribute to gaining a systemic understanding of plant diseases and facilitate genetics-based population studies. The database is also expected to contribute to analysis of gene synteny as part of the chili pepper sequencing project by mapping ESTs to the genome.

  11. Establishment of human iPSC line NCCSi003-A from CD34+cells of peripheral blood collected during apheresis of healthy donor from Indian ethnicity

    Directory of Open Access Journals (Sweden)

    Sophia Fernandes

    2018-03-01

    Full Text Available We present generation of iPSCs from CD34+ cells isolated from peripheral blood, collected during apheresis of a healthy female individual. We nucleofected the CD34+cells by episomal vectors containing Oct4, Sox2, L-Myc, Lin28, Klf4 and p53DD (dominant negative mutation in p53. The resultant colonies showed cobble-stone appearance and stained positive for alkaline phosphatase. The colonies demonstrated presence of pluripotency markers by immunofluorescence, flow-cytometry and PCR. The plasmids were lost from cells subsequently during passages as assessed by PCR. Karyotype analysis demonstrated a stable genome. The cells had capability to differentiate to cells from all three-germ lineages in vitro.

  12. Chemical Genomic Screening of a Saccharomyces cerevisiae Genomewide Mutant Collection Reveals Genes Required for Defense against Four Antimicrobial Peptides Derived from Proteins Found in Human Saliva

    Science.gov (United States)

    Bhatt, Sanjay; Schoenly, Nathan E.; Lee, Anna Y.; Nislow, Corey; Bobek, Libuse A.

    2013-01-01

    To compare the effects of four antimicrobial peptides (MUC7 12-mer, histatin 12-mer, cathelicidin KR20, and a peptide containing lactoferricin amino acids 1 to 11) on the yeast Saccharomyces cerevisiae, we employed a genomewide fitness screen of combined collections of mutants with homozygous deletions of nonessential genes and heterozygous deletions of essential genes. When an arbitrary fitness score cutoffs of 1 (indicating a fitness defect, or hypersensitivity) and −1 (indicating a fitness gain, or resistance) was used, 425 of the 5,902 mutants tested exhibited altered fitness when treated with at least one peptide. Functional analysis of the 425 strains revealed enrichment among the identified deletions in gene groups associated with the Gene Ontology (GO) terms “ribosomal subunit,” “ribosome biogenesis,” “protein glycosylation,” “vacuolar transport,” “Golgi vesicle transport,” “negative regulation of transcription,” and others. Fitness profiles of all four tested peptides were highly similar, particularly among mutant strains exhibiting the greatest fitness defects. The latter group included deletions in several genes involved in induction of the RIM101 signaling pathway, including several components of the ESCRT sorting machinery. The RIM101 signaling regulates response of yeasts to alkaline and neutral pH and high salts, and our data indicate that this pathway also plays a prominent role in regulating protective measures against all four tested peptides. In summary, the results of the chemical genomic screens of S. cerevisiae mutant collection suggest that the four antimicrobial peptides, despite their differences in structure and physical properties, share many interactions with S. cerevisiae cells and consequently a high degree of similarity between their modes of action. PMID:23208710

  13. Development of novel EST-SSR markers for ploidy identification based on de novo transcriptome assembly for Misgurnus anguillicaudatus.

    Science.gov (United States)

    Feng, Bing; Yi, Soojin V; Zhang, Manman; Zhou, Xiaoyun

    2018-01-01

    The co-existence of several ploidy types in natural populations makes the cyprinid loach Misgurnus anguillicaudatus an exciting model system to study the genetic and phenotypic consequences of ploidy variations. A first step in such effort is to identify the specific ploidy of an individual. Currently popular methods of karyotyping via cytological preparation or flow cytometry require a large amount of tissue (such as blood) samples, which can be damaging or fatal to the fishes. Here, we developed novel microsatellite markers (SSR markers) from M. anguillicaudatus and show that they can effectively discriminate ploidy using samples collected in a minimally invasive way. Specifically, we generated whole genome transcriptomes from multiple M. anguillicaudatus using the Illumina paired-end sequencing. Approximately 150 million raw reads were assembled into 76,544 non-redundant unigenes. A total of 8,194 potential SSR markers were identified. We selected 98 pairs with more than five tandem repeats for further assays. Out of 45 putative EST-SSR markers that successfully amplified and harbored polymorphism in diploids, 11 markers displayed high variability in tetraploids. We further demonstrate that a set of five EST-SSR markers selected from these are sufficient to distinguish ploidy levels, by first validating them on 69 reference specimens with known ploidy levels and then subsequently using fresh-collected 96 ploidy-unknown specimens. The results from EST-SSR markers are highly concordant with those from independent flow cytometry analysis. The novel EST-SSR markers developed here should facilitate genetic studies of polyploidy in the emerging model system M. anguillicaudatus.

  14. ESTE AI (Annual Impacts) - the program for calculation of radiation doses caused by effluents in routine releases to the atmosphere and to the hydrosphere

    International Nuclear Information System (INIS)

    Carny, P.; Suchon, D.; Smejkalova, E.; Fabova, V.

    2009-01-01

    ESTE AI is a program for calculation of radiation doses caused by effluents in routine releases to the atmosphere and to the hydrosphere. Doses to the members of critical groups of inhabitants in the vicinity of NPP are calculated and as a result, critical group is determined. The program enables to calculate collective doses as well. Collective doses to the inhabitants living in the vicinity of the NPP are calculated. ESTE AI calculates doses to the whole population of Slovakia from the effluents of the specific plant. In this calculation, global nuclides are included and assumed, as well. The program enables to calculate and to document beyond-border radiological impacts of effluents caused by routine operation of NPP. ESTE AI was approved by the 'Public Health Authority of the Slovak Republic' and is used as legal instrument by Slovenske elektrarne a.s., NPP Bohunice. (authors)

  15. ESTE AI (Annual Impacts) - the program for calculation of radiation doses caused by effluents in routine releases to the atmosphere and to the hydrosphere

    International Nuclear Information System (INIS)

    Carny, P.; Suchon, D.; Smejkalova, E.; Fabova, V.

    2008-01-01

    ESTE AI is a program for calculation of radiation doses caused by effluents in routine releases to the atmosphere and to the hydrosphere. Doses to the members of critical groups of inhabitants in the vicinity of NPP are calculated and as a result, critical group is determined. The program enables to calculate collective doses as well. Collective doses to the inhabitants living in the vicinity of the NPP are calculated. ESTE AI calculates doses to the whole population of Slovakia from the effluents of the specific plant. In this calculation, global nuclides are included and assumed, as well. The program enables to calculate and to document beyond-border radiological impacts of effluents caused by routine operation of NPP. ESTE AI was approved by the 'Public Health Authority of the Slovak Republic' and is used as legal instrument by Slovenske elektrarne a.s., NPP Bohunice. (authors)

  16. Ética y estética (Novenas Conferencias Aranguren, 2000

    Directory of Open Access Journals (Sweden)

    Trías, Eugenio

    2001-12-01

    Full Text Available Wittgenstein's Tractatus contains a mysterious aphorism to the effect that «ethics and aesthetics are the same». The existence of an underlying connivance between ethics and aesthetics has been acknowledged ever since ancient times. Here we try to look into this hard and interesting issue from the open horizon of boundary-philosophy, as put forward in my latest publications. The task will be carried out at three stages. The first one is given over to an elucidation of one core concept of ethics, freedom, in an interactive connection with our fore-understanding of our human condition. Then we raise the (Kantian question about how the ethical «symbolically resounds» through art. The third and last stage brings up the subject of the link between ethics and aesthetics on the ground of several examples, both ancient and modern (from the great tragedies and some artistic manifestations of our modernity.

    Un misterioso aforismo del Tractatus de Wittgenstein enuncia que «ética y estética son lo mismo». Que una corriente de complicidad existe entre ética y estética es reconocido desde la antigüedad. Lo ético se argumenta en la praxis; el arte lo hace a través de la poiésis, o creación, ya definida por Platón y Aristóteles. Aquí se intenta abordar esta interesante y difícil cuestión desde el horizonte abierto, a través de mis últimas publicaciones, por la filosofía del límite, y se realizará en tres etapas. Una primera dedicada a esclarecer uno de los conceptos nucleares de la ética, la libertad, en relación de interacción con la precomprensión que podemos poseer relativa a nuestra humana conditio. Se planteará luego la cuestión (kantiana de que a través del arte «resuena simbólicamente» lo ético. En una tercera y última etapa se desarrolla el tema del nexo entre ética y estética, dándose algunos ejemplos pertinentes, antiguos y modernos (de las grandes

  17. Estéticas tecnológicas en la imagen educativa

    Directory of Open Access Journals (Sweden)

    Kuchen, Regina Elena

    2012-01-01

    Full Text Available [es] Las estéticas tecnológicas son tomadas como puerta de entrada para el estudio de las imágenes destinadas a la transmisión de conocimiento. El análisis de un libro sobre el cuerpo humano es el pretexto para desarrollar la hipótesis de que las estéticas tecnológicas exteriorizan fenómenos más profundos y generales, que lejos de acotarse a la inscripción de éstas en el imaginario técnico contemporáneo, dan cuenta de la dinámica interna de la cultura visual.El propósito de estas observaciones, más allá de la descripción de las estéticas tecnológicas en el entramado de relaciones entre los códigos de la percepción, de la representación y del saber (planos de codificación relevantes en nuestra cultura visual, es contribuir a reconsiderar el potencial cognitivo de las imágenes para pensar proyectivamente la producción de textos visuales que exploten la potencialidad lúdica, heurística y sinérgica de la imagen, en la transmisión de conocimiento. [en] Technological esthetics is considered a door that enables the study of images aimed at knowledge transmission. The analysis of a book about a human body is an excuse for the hypothesis development that techological esthetics externalizes deeper and broader phenomena that far from being restricted to its inscription in contemporary technical representations account for the internal dynamics of the visual culture.The aim of these observations beyond the description of technological esthetics in a web wound round relations among perception, representation and knowledege codes (codification planes relevant to our visual culture is to contribute to a reappraisal of the cognitive potential of images in order to think in a prospective way about the production of visual texts that exploit the playful, heuristic and synergetic potentiality of images for knowledge transmission.

  18. Plastics and microplastics on recreational beaches in Punta del Este (Uruguay): Unseen critical residents?

    Science.gov (United States)

    Lozoya, J P; Teixeira de Mello, F; Carrizo, D; Weinstein, F; Olivera, Y; Cedrés, F; Pereira, M; Fossati, M

    2016-11-01

    Beaches are social-ecological systems that provide several services improving human well-being. However, as one of the major coastal interfaces they are subject to plastic pollution, one of the most significant global environmental threats at present. For the first time for Uruguayan beaches, this study assessed and quantified the accumulation of plastic and microplastic debris on sandy beaches of the major touristic destination Punta del Este during the austral spring of 2013. Aiming to provide valuable information for decision-making, we performed a detailed analysis of plastic debris, their eventual transport pathways to the coast (from land and sea), and the associated persistent pollutants. The results indicated that the smallest size fractions (<20 mm) were the dominant size range, with fragments and resin pellets as types with the highest number of items. PAHs and PCBs were found in plastic debris, and their levels did not differ from baseline values reported for similar locations. The abundance of plastic debris was significantly and positively correlated with both the presence of possible land-based sources (e.g. storm-water drains, beach bars, beach access, car parking, and roads), and dissipative beach conditions. The analysis of coastal currents suggested some potential deposition areas along Punta del Este, and particularly for resin pellets, although modeling was not conclusive. From a local management point of view, the development and use of indices that allow predicting trends in the accumulation of plastic debris would be critically useful. The time dimension (e.g. seasonal) should also be considered for this threat, being crucial for locations such as Uruguay, where the use of beaches increases significantly during the summer. This first diagnosis aims to generate scientific baseline, necessary for improved management of plastic litter on beaches and their watersheds. Copyright © 2016 Elsevier Ltd. All rights reserved.

  19. Salmon louse (Lepeophtheirus salmonis transcriptomes during post molting maturation and egg production, revealed using EST-sequencing and microarray analysis

    Directory of Open Access Journals (Sweden)

    Jonassen Inge

    2008-03-01

    Full Text Available Abstract Background Lepeophtheirus salmonis is an ectoparasitic copepod feeding on skin, mucus and blood from salmonid hosts. Initial analysis of EST sequences from pre adult and adult stages of L. salmonis revealed a large proportion of novel transcripts. In order to link unknown transcripts to biological functions we have combined EST sequencing and microarray analysis to characterize female salmon louse transcriptomes during post molting maturation and egg production. Results EST sequence analysis shows that 43% of the ESTs have no significant hits in GenBank. Sequenced ESTs assembled into 556 contigs and 1614 singletons and whenever homologous genes were identified no clear correlation with homologous genes from any specific animal group was evident. Sequence comparison of 27 L. salmonis proteins with homologous proteins in humans, zebrafish, insects and crustaceans revealed an almost identical sequence identity with all species. Microarray analysis of maturing female adult salmon lice revealed two major transcription patterns; up-regulation during the final molting followed by down regulation and female specific up regulation during post molting growth and egg production. For a third minor group of ESTs transcription decreased during molting from pre-adult II to immature adults. Genes regulated during molting typically gave hits with cuticula proteins whilst transcripts up regulated during post molting growth were female specific, including two vitellogenins. Conclusion The copepod L.salmonis contains high a level of novel genes. Among analyzed L.salmonis proteins, sequence identities with homologous proteins in crustaceans are no higher than to homologous proteins in humans. Three distinct processes, molting, post molting growth and egg production correlate with transcriptional regulation of three groups of transcripts; two including genes related to growth, one including genes related to egg production. The function of the regulated

  20. Estándares de trabajo para bancos de sangre

    Directory of Open Access Journals (Sweden)

    1999-01-01

    Full Text Available This document, which was prepared with the assistance of the American Blood Bank Association and validated by PAHO/WHO's ad hoc Advisory Group for Blood Banks, is intended to provide blood bank managers with quality assurance standards for their units and blood products. The document, which begins by defining the responsibilities of blood bank managers, establishes norms for maintaining a quality assurance system and for the control of (a documents, information, and registries; (b the acquisition of goods and services; (c procedures, including the processing of autologous blood products; (d product storage, distribution, transportation, labeling, measurement, and follow-up; (e the inspection and testing of products and of equipment used to inspect, measure, and test; (f product inspection status; (g unsatisfactory products and services, and (h design of new blood products. In the chapter on process control, which is the longest and most technical, the following are discussed: (a use of informatics programs; (b qualifications for donors of allogeneic products; (c blood collection and storage (d preparation of blood products; (e compatibility tests and tests to be performed on donors' blood; (f labeling, emission, and reemission of products; (g selection of products for transfusion; (h general conditions for transfusion; (i irradiation of blood and blood components; (j procedures for apheresis (plasmapheresis, cytapheresis, and therapeutic apheresis, and (k special considerations regarding transfusions in children under 4 months of age. Also discussed in the document are the following: (a the review of agreements with users and with other institutions and centers; (b corrective action plans or plans to prevent real or potential deficiencies; (c quality assessments; (d personnel training; (e use of statistical methods, and (f safety of donors, recipients, and personnel.

  1. La féte est-elle un jeu?

    Directory of Open Access Journals (Sweden)

    Fribourg, Jeanine

    1999-12-01

    Full Text Available One may ask, are feasts games? Both feasts and games have characteristics in common: both are playful, involve voluntary acts, require rituals and a specific time and space. However, feasts and games also differ. In games, rules are explicit; in feasts, they are implicit. Some games need a single player only, whereas feasts are all collective performances. In a game, the player strives to win, but, in a feast, the participant has something else in his or her mind. Although rituals of a feast may include games, a feast is always more than a game or a set of games; before all else, it is a celebration or a commemoration: of a saint, of an historical event, etc. Furthermore, a feast includes roles that reinforce group identity and cohesión; these roles are lacking in games.Puede uno preguntarse ¿la fiesta es un juego?, pues ambos gozan de características comunes (lúdicas, acto voluntario, precisa ritualidad, espacio y tiempo concretos, etc.. La fiesta, no obstante, difiere del juego, pues mientras las reglas de éste son explícitas, las de la fiesta son implícitas, y hay juegos que pueden realizarse en solitario y la fiesta no; el objetivo de la fiesta no es vencer. La fiesta es más que un juego, por más que dentro de su ritualidad haya numerosos juegos, la fiesta es sobre todo una celebración o conmemoración (fiesta patronal, fiesta histórica..., además en ella existen roles importantes que no tiene el juego (refuerzo de la cohesión y de la identidad del grupo....

  2. Antropologia e filosofia: estética e experiência em Clifford Geertz e Walter Benjamin

    Directory of Open Access Journals (Sweden)

    Relivaldo Pinho de Oliveira

    2012-06-01

    Full Text Available Este artigo estuda as concepções de estética e experiência de Clifford Geertz e Walter Benjamin como possibilidades argumentativas e metodológicas para pensar a realidade e suas formas estéticas. Utiliza-se para isso as discussões metodológicas de Geertz, especialmente a respeito do lugar da estética e de sua relação com os demais âmbitos do humano, que encetaram uma nova forma de concebê-los para a etnografia e antropologia de modo geral, e os estudos de Benjamin a respeito da estética como expressão fisionômica de uma época, de determinada realidade, especialmente os que se referem sobre a modernidade. Constata-se essa possibilidade a partir da observação de que a estética e a experiência, nos autores, são tomadas como dimensões da realidade que se relacionam, não de modo mecânico, e sim como âmbitos que atravessam a realidade, os artefatos estéticos, os discursos, e esses assim devem ser observados.This article study the conceptions of aesthetics and experience of Clifford Geertz and Walter Benjamin as argumentative and methodological possibilities for thinking reality and its aesthetic forms. Uses for this Geertz's methodological discussions, especially regarding the place of aesthetics and its relation to other spheres of the human, which has embarked on a new way of conceiving them to ethnography and anthropology in general, and studies Benjamin about the aesthetics and physiognomical expression of an era, a certain reality, especially those concerning about modernity. There is that possibility from the observation that the aesthetics and experience, in the authors, are taken as the dimensions of reality are related, not mechanically, but as areas that cross the reality, the aesthetic artifacts, the speeches, and so these must be observed.

  3. Fractionation of trace elements and human health risk of submicron particulate matter (PM1) collected in the surroundings of coking plants.

    Science.gov (United States)

    Zajusz-Zubek, Elwira; Radko, Tomasz; Mainka, Anna

    2017-08-01

    Samples of PM1 were collected in the surroundings of coking plants located in southern Poland. Chemical fractionation provided information on the contents of trace elements As, Cd, Co, Cr, Hg, Mn, Ni, Pb, Sb and Se in all mobile (F1-F3) and not mobile (F4) fractions of PM1 in the vicinity of large sources of emissions related to energochemical processing of coal during the summer. The determined enrichment factors indicate the influence of anthropogenic sources on the concentration of the examined elements contained in PM1 in the areas subjected to investigation. The analysis of health risk for the assumed scenario of inhabitant exposure to the toxic effect of elements, based on the values of the hazard index, revealed that the absorption of the examined elements contained in the most mobile fractions of particulate matter via inhalation by children and adults can be considered potentially harmless to the health of people inhabiting the surroundings of coking plants during the summer (HI PM1, approximately four adults and one child out of one million people living in the vicinity of the coking plants may develop cancer.

  4. Assessment of heavy metals contamination and human health risk in shrimp collected from different farms and rivers at Khulna-Satkhira region, Bangladesh

    Directory of Open Access Journals (Sweden)

    T. Sarkar

    Full Text Available This study is aimed to assess the heavy metals contamination and health risk in Shrimp (Macrobrachium rosenbergii and Penaeus monodon collected from Khulna-Satkhira region in Bangladesh. The results showed that the Pb concentrations (0.52–1.16 mg/kg in all shrimp samples of farms were higher than the recommended limit. The Cd levels (0.05–0.13 mg/kg in all samples and Cr levels in all farms except tissue content at Satkhira farm were higher than the permissible limits. The individual concentration of Pb, Cd, and Cr between shrimp tissue and shell in all rivers and farms were not statistically significant (P > 0.05. Target hazard quotient (THQ and hazard index (HI were estimated to assess the non-carcinogenic health risks. Shrimp samples from all locations under the current study were found to be safe for consumption, the possibility of health risk associated with non-carcinogenic effect is very low for continuous consumption for 30 years. Keywords: Lead, Cadmium, Chromium, Shrimp, Health hazard, Noncarcinogenic risk

  5. Tissue distribution of HCH and DDT congeners and human health risk associated with consumption of fish collected from Kabul River, Pakistan.

    Science.gov (United States)

    Aamir, Muhammad; Khan, Sardar; Nawab, Javed; Qamar, Zahir; Khan, Anwarzeb

    2016-03-01

    Distribution of hexachlorocyclohexane (HCH) and dichlorodiphenyltrichloroethane (DDT) congeners in tissues of four different fish species and their associated potential health risks to local consumers are presented in this paper. The average ∑(HCHs+DDTs) concentration in Glyptothorax punjabensis (214ngg(-1) wet weight (ww)) (carnivores) was found higher than Tor putitora (155ngg(-1) ww) (herbivores). The distribution of ∑(HCHs+DDTs) in all fish tissues was found in order of liver>muscle>stomach>gills. The profile of congeners (β-HCH/∑HCH from 0.29-0.47) indicated that all selected fish species were contaminated with HCH because of its recent usage in the study area. Furthermore, DDT profile ((DDE+DDD)/∑DDT from 0.61-0.78) showed that fish contamination with DDT originated from past usage and long-time degradation mechanism. The average estimated daily dietary intake of ∑HCHs (15.0ngkg(-1) day(-1)) was higher than ∑DDTs (12.5ngkg(-1) day(-1)) by the local consumers via fish consumption. On the basis of both 50th and 95th percentile exposure levels, the carcinogenic hazard ratios for DDT and its congeners were exceeded one (safe limit) for all fish species, indicating a great potential cancer risk for local consumers with life time consumption of contaminated fish collected from Kabul River. Copyright © 2015 Elsevier Inc. All rights reserved.

  6. Assessment of heavy metals contamination and human health risk in shrimp collected from different farms and rivers at Khulna-Satkhira region, Bangladesh.

    Science.gov (United States)

    Sarkar, T; Alam, M Masihul; Parvin, N; Fardous, Z; Chowdhury, Alamgir Z; Hossain, S; Haque, M E; Biswas, N

    2016-01-01

    This study is aimed to assess the heavy metals contamination and health risk in Shrimp ( Macrobrachium rosenbergii and Penaeus monodon ) collected from Khulna-Satkhira region in Bangladesh. The results showed that the Pb concentrations (0.52-1.16 mg/kg) in all shrimp samples of farms were higher than the recommended limit. The Cd levels (0.05-0.13 mg/kg) in all samples and Cr levels in all farms except tissue content at Satkhira farm were higher than the permissible limits. The individual concentration of Pb, Cd, and Cr between shrimp tissue and shell in all rivers and farms were not statistically significant (P > 0.05). Target hazard quotient (THQ) and hazard index (HI) were estimated to assess the non-carcinogenic health risks. Shrimp samples from all locations under the current study were found to be safe for consumption, the possibility of health risk associated with non-carcinogenic effect is very low for continuous consumption for 30 years.

  7. Predicted sub-populations in a marine shrimp proteome as revealed by combined EST and cDNA data from multiple Penaeus species

    Directory of Open Access Journals (Sweden)

    Kotewong Rattanawadee

    2010-11-01

    Full Text Available Abstract Background Many species of marine shrimp in the Family Penaeidae, viz. Penaeus (Litopenaeus vannamei, Penaeus monodon, Penaeus (Fenneropenaeus chinensis, and Penaeus (Marsupenaeus japonicus, are animals of economic importance in the aquaculture industry. Yet information about their DNA and protein sequences is lacking. In order to predict their collective proteome, we combined over 270,000 available EST and cDNA sequences from the 4 shrimp species with all protein sequences of Drosophila melanogaster and Caenorhabditis elegans. EST data from 4 other crustaceans, the crab Carcinus maenas, the lobster Homarus americanus (Decapoda, the water flea Daphnia pulex, and the brine shrimp Artemia franciscana were also used. Findings Similarity searches from EST collections of the 4 shrimp species matched 64% of the protein sequences of the fruit fly, but only 45% of nematode proteins, indicating that the shrimp proteome content is more similar to that of an insect than a nematode. Combined results with 4 additional non-shrimp crustaceans increased matching to 78% of fruit fly and 56% of nematode proteins, suggesting that present shrimp EST collections still lack sequences for many conserved crustacean proteins. Analysis of matching data revealed the presence of 4 EST groups from shrimp, namely sequences for proteins that are both fruit fly-like and nematode-like, fruit fly-like only, nematode-like only, and non-matching. Gene ontology profiles of proteins for the 3 matching EST groups were analyzed. For non-matching ESTs, a small fraction matched protein sequences from other species in the UniProt database, including other crustacean-specific proteins. Conclusions Shrimp ESTs indicated that the shrimp proteome is comprised of sub-populations of proteins similar to those common to both insect and nematode models, those present specifically in either model, or neither. Combining small EST collections from related species to compensate for their

  8. Improvements in Modelling Bystander and Resident Exposure to Pesticide Spray Drift: Investigations into New Approaches for Characterizing the 'Collection Efficiency' of the Human Body.

    Science.gov (United States)

    Butler Ellis, M Clare; Kennedy, Marc C; Kuster, Christian J; Alanis, Rafael; Tuck, Clive R

    2018-03-17

    The BREAM (Bystander and Resident Exposure Assessment Model) (Kennedy et al. in BREAM: A probabilistic bystander and resident exposure assessment model of spray drift from an agricultural boom sprayer. Comput Electron Agric 2012;88:63-71) for bystander and resident exposure to spray drift from boom sprayers has recently been incorporated into the European Food Safety Authority (EFSA) guidance for determining non-dietary exposures of humans to plant protection products. The component of BREAM, which relates airborne spray concentrations to bystander and resident dermal exposure, has been reviewed to identify whether it is possible to improve this and its description of variability captured in the model. Two approaches have been explored: a more rigorous statistical analysis of the empirical data and a semi-mechanistic model based on established studies combined with new data obtained in a wind tunnel. A statistical comparison between field data and model outputs was used to determine which approach gave the better prediction of exposures. The semi-mechanistic approach gave the better prediction of experimental data and resulted in a reduction in the proposed regulatory values for the 75th and 95th percentiles of the exposure distribution.

  9. A experiência estética sob um olhar fenomenológico

    Directory of Open Access Journals (Sweden)

    Alice Casanova Reis

    2011-01-01

    Full Text Available Este artículo describe la experiencia estética como un fenómeno centrado en la percepción sensorial. El trabajo se desarrolla a partir de una investigación de la psicología social basado en la fenomenología, sobre todo en los planteamientos de Merleau-Ponty y Dufrenne. Concibe la experiencia estética como un modo de relación mediada por la percepción sensorial de un objeto estético. Se analizan diversos aspectos de la experiencia estética: la dimensión relacional y sensible; ¿cómo se constituye el sujeto y el objeto estético; la dimensión corporal de la experiencia estética; la intencionalidad en la estética; la experiencia estética de la naturaleza. Llegamos a la conclusión de que hay un significado ontológico de la experiencia estética, ya que proporciona una apertura a la diferencia por el contacto con la alteridad, y una nueva mirada a la realidad. Se destaca al final la relevancia de esta experiencia a la Psicología Social.

  10. ¿De qué están hechas las cosas? Modelo estándar de partículas elementales

    OpenAIRE

    Helber Dussán

    2002-01-01

    E - n este articulo se describe la teoria actualmen, te cKeprada sabre la constituci6n de la materia, conocida con el nombre de Modelo EstJndar de Partfcllias Elelllentaies. Se expJica la raz6n y el origen de la c1asificaci6n entre diferenres tipos de pZlrtfcu las, bosones, leptones, quarks, hadrones, mesones, etc. Se hace un anal isis crftico del mode10.

  11. ¿De qué están hechas las cosas? Modelo estándar de partículas elementales

    Directory of Open Access Journals (Sweden)

    Helber Dussán

    2002-01-01

    Full Text Available E - n este articulo se describe la teoria actualmen, te cKeprada sabre la constituci6n de la materia, conocida con el nombre de Modelo EstJndar de Partfcllias Elelllentaies. Se expJica la raz6n y el origen de la c1asificaci6n entre diferenres tipos de pZlrtfcu las, bosones, leptones, quarks, hadrones, mesones, etc. Se hace un anal isis crftico del mode10.

  12. Self- versus physician-collected samples for the follow-up of human papillomavirus-positive women in sub-Saharan Africa

    Directory of Open Access Journals (Sweden)

    Viviano M

    2018-04-01

    Full Text Available Manuela Viviano,1,* Phuong Lien Tran,1,* Bruno Kenfack,2 Rosa Catarino,1 Mohamed Akaaboune,1,† Liliane Temogne,2 Eveline Tincho Foguem,2 Pierre Vassilakos,3 Patrick Petignat1 1Gynecology Division, Geneva University Hospitals, Geneva, Switzerland; 2Department of Biomedical Sciences, University of Dschang, Dschang, Cameroon; 3Geneva Foundation for Medical Education and Research, Geneva, Switzerland *These authors contributed equally to the work †MA passed away on July 31, 2017 Introduction: Human papillomavirus (HPV testing is a suitable tool for primary cervical cancer (CC screening and follow-up in low-resource settings. Vaginal samples taken by women themselves (Self-HPV are an interesting alternative to physician-performed sampling (Dr-HPV. Our aim was to assess the performance of Self-HPV and Dr-HPV at 6 and 12 months following a CC screening campaign. Methods: This study was carried out at the Dschang District Hospital, Cameroon. Women aged 30–49 years were recruited in a CC screening campaign. HPV-positive women, of whom 2/3 were treated with thermoablation because of abnormal results at baseline screening, were invited to participate in a follow-up study. Self- and Dr-HPV, as well as cytology, were performed at 6 and 12 months. HPV samples were analyzed using the Xpert HPV assay. Sensitivity and specificity for the detection of low-grade squamous intraepithelial lesion or worse and of high-grade squamous intraepithelial lesion or worse were calculated for Self-HPV and Dr-HPV, using cytology as the reference diagnosis. Results: Overall, 188 HPV-positive women were invited to attend follow-up. The obtained follow-up visits’ attendance was 154 (81.9% and 131 (69.7% at 6 and 12 months, respectively. While the overall performance of Dr-HPV at 6 months was slightly superior, Self-HPV showed an improved sensitivity for HSIL+ detection at 12 months when compared with Dr-HPV (83.3% [95% CI 41.8–98.9] versus 71.4% [95% CI 21.5–95

  13. Bioaccumulation of 210Po and 210Pb in cephalopods collected from Kudankulam (Southeastern coast of Gulf of Mannar (India)) and assessment of dose in human beings

    International Nuclear Information System (INIS)

    Khan, M. F.; Wesley, S. G.

    2011-01-01

    Activities of 210 Po and 210 Pb in various tissues of two common species of cephalopod molluscs (cuttlefishes) of Kudankulam coast were studied. Of all the tissues, 210 Po and 210 Pb were found accumulated more in the digestive gland, shell gland and intestine. Urotheuthis duvauceli accumulated more 210 Po and 210 Pb in certain organs when compared with Sepiella inermis. The activity ratio of 210 Po/ 210 Pb fell within the range of 0.6-29.3 in the organs. The biological concentration factor for the organs ranged from 1.2x10 3 to 2x10 5 for 210 Po and 3.6x10 2 to 7.6x10 4 for 210 Pb. A significant variation in the accumulation of 210 Po and 210 Pb was noted between species, organs and seasons (p > 0.05). The whole-body internal dose rate due to 210 Po was 1.24 and 0.83 μGy h -1 and it was 2x10 -3 and 3x10 -3 μGy h -1 due to 210 Pb for both the species. The effective dose in humans due to 210 Po intake ranged from 96.3 to 376.6 μSv y -1 and that of 210 Pb ranged from 35.2 to 105.7 μSv y -1 , respectively. The data generated will act as a reference database for these organisms of this coast in which a nuclear power station is under construction. (authors)

  14. Whole genome sequencing analysis of Salmonella enterica serovar Weltevreden isolated from human stool and contaminated food samples collected from the Southern coastal area of China.

    Science.gov (United States)

    Li, Baisheng; Yang, Xingfen; Tan, Hailing; Ke, Bixia; He, Dongmei; Wang, Haiyan; Chen, Qiuxia; Ke, Changwen; Zhang, Yonghui

    2018-02-02

    Salmonella enterica serovar Weltevreden is the most common non-typhoid Salmonella found in South and Southeast Asia. It causes zoonoses worldwide through the consumption of contaminated foods and seafood, and is considered as an important food-borne pathogen in China, especially in the Southern coastal area. We compared the whole genomes of 44 S. Weltevreden strains isolated from human stool and contaminated food samples from Southern Coastal China, in order to investigate their phylogenetic relationships and establish their genetic relatedness to known international strains. ResFinder analysis of the draft genomes of isolated strains detected antimicrobial resistance (AMR) genes in only eight isolates, equivalent to minimum inhibitory concentration assay, and only a few isolates showed resistance to tetracycline, ciprofloxacin or ampicillin. In silico MLST analysis revealed that 43 out of 44 S. Weltevreden strains belonged to sequence type 365 (CC205), the most common sequence type of the serovars. Phylogenetic analysis of the 44 domestic and 26 international isolates suggested that the population of S. Weltevreden could be segregated into six phylogenetic clusters. Cluster I included two strains from food and strains of the "Island Cluster", indicating potential inter-transmission between different countries and regions through foods. The predominant S. Weltevreden isolates obtained from the samples from Southern coastal China were found to be phylogenetically related to strains from Southern East Asia, and formed clusters II-VI. The study has demonstrated that WGS-based analysis may be used to improve our understanding of the epidemiology of this bacterium as part of a food-borne disease surveillance program. The methods used are also more widely applicable to other geographical regions and areas and could therefore be useful for improving our understanding of the international spread of S. Weltevreden on a global scale. Copyright © 2017. Published by Elsevier

  15. Effect through inhalation on human health of PM1 bound polycyclic aromatic hydrocarbons collected from foggy days in northern part of India.

    Science.gov (United States)

    Singh, Dharmendra Kumar; Gupta, Tarun

    2016-04-05

    We investigated the health risk from 16 polycyclic aromatic hydrocarbons (PAHs) adsorbed on submicron particles and also reported their concentrations, spatial distribution and possible sources during foggy days at Kanpur. Twenty-four urban foggy day's samples gathered from Kanpur, an urban center in North India and most densely populated city in the Indo-Gangetic plain of India, were examined for 16 PAHs (2-6 rings).The mean concentration of PM1 was found to be 160.16±37.70μg/m(3). ∑16PAHs concentrations were 529.17ng/m(3) with a mean of 33.07ng/m(3). The compounds of higher molecular weight (4-6 rings) added to 70.67% of ∑PAHs mass concentration in the foggy day's samples. The results of source identification by using principle component analysis (PCA) and diagnostic ratios proposed that the primary sources of PAHs were vehicular emission (primarily driven by diesel fuel) and coal combustion and the secondary source. Exposure to total PAHs in the ambient air resulted in, 95% probability total Incremental Lifetime Cancer Risk (TILCR) 3.57×10(-5) for adults and 2.08×10(-5) for children or (∼35 cancer case per million in adults and ∼20 cancer case per million in children) due to inhalation in terms of ILCR were higher than the baseline value of acceptable risk (one cancer case per million people) suggesting moderate health risk to resident human population. Copyright © 2015 Elsevier B.V. All rights reserved.

  16. L'enseignement de la diversite culturelle, c'est une responsabilite collective (The Teaching of Cultural Pluralism, a Collective Responsibility).

    Science.gov (United States)

    Rivest, Francois

    2002-01-01

    Following September 11, some students in a computer-assisted journalism lab in Canada made disgraceful comments based on ignorance and misinformation regarding the school's Arabic-speaking members. However, a few articles and two news reports helped change the atmosphere as students began to recognize the individuals within stereotyped groups. (TD)

  17. The aesthetics of smells: the sense of smell and nursing Estética de los olores: el sentido del olfato y la enfermería Estética dos odores: o sentido do olfato e a enfermagem

    Directory of Open Access Journals (Sweden)

    Antônio de Miranda Wosny

    2008-04-01

    Full Text Available This study aims to present reflections on the meaning of olfactory sensations and perceptions, as well as their relevance as a phenomenon present in Nursing practice. It stresses the importance of the smells' chemical language in the hospital environment, emphasizing some deductions about the aesthetics of smells from the Nursing perspective. The authors conclude that a deeper aesthetic/philosophical and technical/scientific comprehension of smell emanations will contribute to human care, especially in Nursing diagnoses and prescriptions, environmental quality regulation and therapeutics.Este estudio presenta reflexiones acerca del significado de las percepciones y sensaciones olfativas y suya pertinencia como fenómeno presente en la práctica de la Enfermería. Destaca la importancia de la linguage química de los olores en el ambiente hospitalario, puntuando algunas deducciones sobre la estética de los olores por la enfermería. Concluye que la mayor comprensión estético/filosófica y técnico/científica de las emanaciones odorantes podrá contribuir para el cuidado humano, especialmente en el diagnóstico y prescripción de Enfermería, vigilancia de la calidad ambiental y terapéutica.Este estudo apresenta reflexões acerca do significado das percepções e sensações olfativas e sua pertinência como fenômeno presente na prática da Enfermagem. Destaca a importância da linguagem química dos odores no ambiente hospitalar, pontuando algumas deduções sobre a estética dos odores pela enfermagem. Conclui que a maior compreensão estético/filosófica e técnico/científica das emanações odorantes poderá contribuir para o cuidado humano, especialmente no diagnóstico e prescrição de Enfermagem, vigilância da qualidade ambiental e terapêutica.

  18. Cultural history and aesthetics of nursing care La historia cultural y la estética de los cuidados de enfermería A história cultural e a estética dos cuidados de enfermagem

    Directory of Open Access Journals (Sweden)

    José Siles González

    2011-10-01

    Full Text Available The aim of this study was to clarify the role of aesthetics in the organization and motivation of care through history. The guiding questions were: What values and aesthetic feelings have supported and motivated pre-professional and professional care? and Based on what structures has pre-professional and professional care been historically socialized? Primary and secondary sources were consulted, selected according to established criteria with a view to avoiding search and selection bias. Data analysis was guided by the categories: "habitus" and "logical conformism". It was found that the relation between social structures and pre-professionals (motherhood, religiosity and professional aesthetic standards (professionalism, technologism of care through history is evidenced in the caregiving activity of the functional unit, in the functional framework and the functional element. In conclusion, in social structures, through the socialization process, "logical conformism" and "habitus" constitute the aesthetic standards of care through feelings like motherhood, religiosity, professionalism, technologism and humanism.El objetivo de este artículo fue clarificar el papel de la estética en la organización y la motivación de los cuidados en la historia. La preguntas orientadoras fueron: ¿En qué valores y sentimientos estéticos se han fundamentado y motivado los cuidados preprofesionales y profesionales? y ¿En qué estructuras, los cuidados preprofesionales y profesionales, se han socializado históricamente? Se consultaron fuentes secundarias y primarias seleccionadas de acuerdo con criterios establecidos para evitar sesgos de búsqueda y selección. El análisis de los datos se guió con las categorías: "habitus" y "conformismo lógico". Se encontró que la relación entre las estructuras sociales y los patrones estéticos preprofesionales (maternidad, religiosidad y profesionales (profesionalismo, tecnologicismo de los cuidados a través de la

  19. Lecture actentielle dans Trop c'est trop de Protais Asseng | IKANGA ...

    African Journals Online (AJOL)

    La naissance de cet enfant lui conférait le titre de "Papa national" Bakony symbolise la recherche de bonheur sur le dos d'un humain. C'est de l'exploitation de la femme par l'homme. Mais la multipare Bissabey, son épouse, n'est pas de son avis. Cette instrumentalisation est alors la pomme de discorde entre le couple et ...

  20. Analysis of expressed sequence tags from Actinidia: applications of a cross species EST database for gene discovery in the areas of flavor, health, color and ripening

    Directory of Open Access Journals (Sweden)

    Richardson Annette C

    2008-07-01

    Full Text Available Abstract Background Kiwifruit (Actinidia spp. are a relatively new, but economically important crop grown in many different parts of the world. Commercial success is driven by the development of new cultivars with novel consumer traits including flavor, appearance, healthful components and convenience. To increase our understanding of the genetic diversity and gene-based control of these key traits in Actinidia, we have produced a collection of 132,577 expressed sequence tags (ESTs. Results The ESTs were derived mainly from four Actinidia species (A. chinensis, A. deliciosa, A. arguta and A. eriantha and fell into 41,858 non redundant clusters (18,070 tentative consensus sequences and 23,788 EST singletons. Analysis of flavor and fragrance-related gene families (acyltransferases and carboxylesterases and pathways (terpenoid biosynthesis is presented in comparison with a chemical analysis of the compounds present in Actinidia including esters, acids, alcohols and terpenes. ESTs are identified for most genes in color pathways controlling chlorophyll degradation and carotenoid biosynthesis. In the health area, data are presented on the ESTs involved in ascorbic acid and quinic acid biosynthesis showing not only that genes for many of the steps in these pathways are represented in the database, but that genes encoding some critical steps are absent. In the convenience area, genes related to different stages of fruit softening are identified. Conclusion This large EST resource will allow researchers to undertake the tremendous challenge of understanding the molecular basis of genetic diversity in the Actinidia genus as well as provide an EST resource for comparative fruit genomics. The various bioinformatics analyses we have undertaken demonstrates the extent of coverage of ESTs for genes encoding different biochemical pathways in Actinidia.

  1. Update History of This Database - AcEST | LSDB Archive [Life Science Database Archive metadata

    Lifescience Database Archive (English)

    Full Text Available switchLanguage; BLAST Search Image Search Home About Archive Update History Data ...List Contact us AcEST Update History of This Database Date Update contents 2013/01/10 Errors found on AcEST ...s Database Database Description Download License Update History of This Data...base Site Policy | Contact Us Update History of This Database - AcEST | LSDB Archive ... ...Conting data have been correceted. For details, please refer to the following page. Data correction 2010/03/29 AcEST English archi

  2. O programa Estúdio Móvel da TV Brasil no Facebook

    OpenAIRE

    Rozados, Helen Beatriz Frota; Corrêa, Rochele Tonello Zago

    2013-01-01

    Este artigo trata do uso do Facebook por programa de televisão pública. O objetivo geral é compreender com que finalidade o Estúdio Móvel da TV Brasil utiliza a rede social virtual Facebook, contextualizando a TV Pública Brasileira, a TV Brasil, o Núcleo Multimídia (NUMID) e o programa Estúdio Móvel. Apresenta o conceito de TV Social, convergência transmídia de conteúdos e o Estúdio Móvel no Facebook. Discute a metodologia aplicada e os resultados da pesquisa. Considera que os conteúdos compa...

  3. La estética del entorno y el cognitivismo científico

    OpenAIRE

    Rosa Martínez, María del Mar

    2014-01-01

    Abandonado el estudio de la naturaleza durante casi dos siglos, la estética del entorno entronca hoy con la estética de la naturaleza de Kant y debate sus presupuestos en dos posiciones fundamentales: cognitivismo y no-cognitivismo. En particular, el llamado cognitivismo científico reclama para el juicio estético la mediación imprescindible de conceptos científicos. En el artículo se discute la teoría de Allen Carlson, su principal representante, y se compara con la estética no cognitivista d...

  4. Integración de ética y estética

    OpenAIRE

    Maureen Trebilcock Kelly

    2008-01-01

    Este artículo plantea que si bien la mayoría de los arquitectos coincide en la urgente necesidad de integrar criterios de sustentabilidad ambiental en el proyecto, aún nos encontramos con que el tipo de arquitectura que logra tribuna en los medios está dominada por la imagen, mientras que los ejemplos de arquitectura sustentable son criticados por considerarse estéticamente pobres. Sin embargo, la arquitectura sustentable no implica necesariamente agregar una apariencia estética a un comporta...

  5. S1-luokan elementtiväestönsuojan käyttö asuinkerrostalossa

    OpenAIRE

    Uski, Reijo

    2012-01-01

    Opinnäytetyössä on laadittu ajanmukainen ja tiivis ohje elementtirakenteisen väestönsuojan käytöstä uudisrakentamisessa. Työssä selvitetään kahden erilaisen elementtiväestönsuojan tyypin rakenneperiaatteita sekä käyttöä talonrakentamisessa. Samalla vertaillaan elementtirakenteisen ja perinteisen massiivirakenteisen paikallavaletun väestönsuojan hyviä ja huonoja ominaisuuksia erityisesti työmaan näkökulmasta. Opinnäytetyössä käsitellään lyhyesti väestönsuojan elementtitekniikan ongelmakohtia....

  6. Prime note sulla tutela penale dei culti nei Paesi dell’Est Europa

    Directory of Open Access Journals (Sweden)

    Giovanni Cimbalo

    2011-05-01

    Full Text Available Testo della relazione tenuta al Convegno “La Carta e la Corte” (Ferrara, 27 ottobre 2007 destinata alla pubblicazione negli Atti. SOMMARIO: 1. Alcune considerazioni preliminari sullo status delle Confessioni religiose nei paesi dell’Est Europa - 2. I nuovi orientamenti del diritto penale nell’Est Europa - 3. Le norme statali in materia di tutela penale dei culti e del sentimento religioso. 3. Le norme penali relative ai culti e a al sentimento religioso prima del 1992 nei Paesi dell’Est Europa - 4. Tipologie e tecniche legislative di tutela penale dei culti dopo il 1992 nei Paesi dell’Est Europa - 5. Alcune sommarie considerazioni.

  7. Centennial-scale human alterations, unintended natural-system responses, and event-driven mitigation within a coupled fluvial-coastal system: Lessons for collective management and long-term coastal change planning

    Science.gov (United States)

    Hein, C. J.; Hoagland, P.; Huang, J. C.; Canuel, E. A.; Fitzsimons, G.; Rosen, P.; Shi, W.; Fallon, A. R.; Shawler, J. L.

    2017-12-01

    On decadal to millennial timescales, human modifications of linked riparian and coastal landscapes have altered the natural transport of sediments to the coast, causing time-varying sediment fluxes to estuaries, wetlands, and beaches. This study explored the role of historical changes in land use and river/coastal engineering on patterns of coastal erosion in the coupled system comprising the Merrimack River and the Plum Island barrier beach (northern Massachusetts, USA). Recreational values of the beach, attendant impacts on the local housing market, human perceptions of future beach utilization, and collective management options were investigated. Key historical changes included the installation of dams to benefit industry and control flooding in the early 19th century; river-mouth jetties to maintain navigation and allow for the residential development of a more stable barrier in the early 20th century; and the progressive hardening of the shoreline in response to multi-decadal cyclical erosion and house losses throughout the latter 20th and 21st centuries. The tools of sedimentology, shoreline-change analysis, historic documentation, population surveys, and economic modeling were used to examine these changes and the dynamic linked responses of the natural system and human populations. We found cascading effects of human alterations to the river that changed sediment fluxes to the coastal zone, driving a need for mitigation over centennial timescales. More recently, multidecadal erosion-accretion cycles of the beach have had little impact on the housing market, which is instead more responsive to public shoreline stabilization efforts in response to short-term (sustainable management of coupled fluvial-coastal systems.

  8. Collective Intelligence. Chapter 17

    Science.gov (United States)

    Wolpert, David H.

    2003-01-01

    Many systems of self-interested agents have an associated performance criterion that rates the dynamic behavior of the overall system. This chapter presents an introduction to the science of such systems. Formally, collectives are defined as any system having the following two characteristics: First, the system must contain one or more agents each of which we view as trying to maximize an associated private utility; second, the system must have an associated world utility function that rates the possible behaviors of that overall system. In practice, collectives are often very large, distributed, and support little, if any, centralized communication and control, although those characteristics are not part of their formal definition. A naturally occurring example of a collective is a human economy. One can identify the agents and their private utilities as the human individuals in the economy and the associated personal rewards they are each trying to maximize. One could then identify the world utility as the time average of the gross domestic product. ("World utility" per se is not a construction internal to a human economy, but rather something defined from the outside.) To achieve high world utility it is necessary to avoid having the agents work at cross-purposes lest phenomena like liquidity traps or the Tragedy of the Commons (TOC) occur, in which agents' individually pursuing their private utilities lowers world utility. The obvious way to avoid such phenomena is by modifying the agents utility functions to be "aligned" with the world utility. This can be done via punitive legislation. A real-world example of an attempt to do this was the creation of antitrust regulations designed to prevent monopolistic practices.

  9. Genetic variation patterns of American chestnut populations at EST-SSRs

    Science.gov (United States)

    Oliver Gailing; C. Dana Nelson

    2017-01-01

    The objective of this study is to analyze patterns of genetic variation at genic expressed sequence tag - simple sequence repeats (EST-SSRs) and at chloroplast DNA markers in populations of American chestnut (Castanea dentata Borkh.) to assist in conservation and breeding efforts. Allelic diversity at EST-SSRs decreased significantly from southwest to northeast along...

  10. Development of genomic SSR and potential EST-SSR markers in ...

    African Journals Online (AJOL)

    In addition, forty four EST-SSRs which can be amplified with expected sizes were identified from a B. chinense root cDNA library. The genomic SSR markers and potential EST-SSR markers developed in the present study should be useful for genetic diversity and molecular marker assistant selection breeding research in ...

  11. In silico comparative analysis of EST-SSRs in three cotton genomes ...

    African Journals Online (AJOL)

    The range of repeat number change in each HG was wider in Gr-Gh. The annotation of the SSR-ESTs showed that more Gene Ontology (GO) items targeted by SSR-ESTs of Ga and Gr than those of Gh. This study gave us new insights into the difference between the three cotton genomes, which will be more helpful to ...

  12. In silico comparative analysis of EST-SSRs in three cotton genomes

    African Journals Online (AJOL)

    reading 6

    2012-08-28

    Aug 28, 2012 ... Furthermore, they are polymerase chain reaction (PCR)-based ..... A and AD genomes. Blast (E-value≤1e-15) analysis was performed to search .... absent in Gh-ESTs; 'trans-porter activity' was also absent in Ga-ESTs (Figure ...

  13. Analysis of inheritance mode in chrysanthemum using EST-derived SSR markers

    NARCIS (Netherlands)

    Park, Sang Kun; Arens, Paul; Esselink, Danny; Lim, Jin Hee; Shin, Hak Ki

    2015-01-01

    To study the inheritance mode of hexaploid chrysanthemum (random or preferential chromosome pairing), a segregation analysis was carried out using SSR markers derived from chrysanthemum ESTs in the public domain. A total of 248 EST-SSR primer pairs were screened in chrysanthemum cultivars

  14. Ya no estás más a mi lado, corazón: estética Camp en América Latina

    OpenAIRE

    Hueso Fibla, Silvia

    2012-01-01

    Esta tesis doctoral consta de tres capítulos cuyo recorrido pretende ilustrar que la puerta de entrada a la Estética Camp pasa por una mirada diferente sobre los productos culturales de masas y que su puerta de salida en América Latina atraviesa la Estética Neobarroca; por tanto, el Camp resulta tanto física como conceptualmente central en el trabajo. Se inserta el análisis de tres novelas y una obra teatral para mostrar cuáles son los mecanismos que el Camp adopta en América Latina: Tengo mi...

  15. A estética política das mídias locativas

    Directory of Open Access Journals (Sweden)

    Lucia Santaella

    2008-04-01

    Full Text Available Las prácticas de acceso propiciadas por los dispositivos móviles conectados al Sistema de Posicionamiento Global (GPS están haciendo surgir un nuevo espacio social de combinaciones inextricables entre lo virtual (el ciberespacio y los ambientes físicos en los que se mueve nuestro cuerpo biológico. Este trabajo busca presentar las nuevas modalidades de comunicación, conexión e interacción que están apareciendo bajo el nombre de “medios de comunicación locativos”. Éstos son procesos que están dando origen a una estética políticamente orientada, cuyas principales características se discutirán en el artículo.

  16. Bohunice Simulator Data Collection Project

    International Nuclear Information System (INIS)

    Cillik, Ivan; Prochaska, Jan

    2002-01-01

    The paper describes the way and results of human reliability data analysis collected as a part of the Bohunice Simulator Data Collection Project (BSDCP), which was performed by VUJE Trnava, Inc. with funding support from the U.S. DOE, National Nuclear Security Administration. The goal of the project was to create a methodology for simulator data collection and analysis to support activities in probabilistic safety assessment (PSA) and human reliability assessment for Jaslovske Bohunice nuclear power plant consisting of two sets of twin units: two VVER 440/V-230 (V1) and two VVER 440/V-213 (V2) reactors. During the project training of V-2 control room crews was performed at VUJE-Trnava simulator. The simulator training and the data collection were done in parallel. The main goal of BSDCP was to collect suitable data of human errors under simulated conditions requiring the use of symptom-based emergency operating procedures (SBEOPs). The subjects of the data collection were scenario progress time data, operator errors, and real-time technological parameters. The paper contains three main parts. The first part presents preparatory work and semi-automatic computer-based methods used to collect data and to check technological parameters in order to find hidden errors of operators, to be able to retrace the course of each scenario for purposes of further analysis, and to document the whole training process. The first part gives also an overview of collected data scope, human error taxonomy, and state classifications for SBEOP instructions coding. The second part describes analytical work undertaken to describe time distribution necessary for execution of various kinds of instructions performed by operators according to the classification for coding of SBEOP instructions. It also presents the methods used for determination of probability distribution for different operator errors. Results from the data evaluation are presented in the last part of the paper. An overview of

  17. Bohunice Simulator Data Collection Project

    International Nuclear Information System (INIS)

    Cillik, I.; Prochaska, J.

    2002-01-01

    The paper describes the way and results of human reliability data analysis collected as a part of the Bohunice Simulator Data Collection Project (BSDCP), which was performed by VUJE Trnava, Inc. with funding support from the U.S. DOE, National Nuclear Security Administration. The goal of the project was to create a methodology for simulator data collection and analysis to support activities in probabilistic safety assessment (PSA) and human reliability assessment for Jaslovske Bohunice nuclear power plant consisting of two sets of twin units: two VVER 440/V-230 (V1) and two VVER 440/V-213 (V2) reactors. During the project, training of V-2 control room crews was performed at VUJE Trnava simulator. The simulator training and the data collection were done in parallel. The main goal of BSDCP was to collect suitable data of human errors under simulated conditions requiring the use of symptom-based emergency operating procedures (SBEOPs). The subjects of the data collection were scenario progress time data, operator errors, and real-time technological parameters. The paper contains three main parts. The first part presents preparatory work and semi-automatic computer-based methods used to collect data and to check technological parameters in order to find hidden errors of operators, to be able to retrace the course of each scenario for purposes of further analysis, and to document the whole training process. The first part gives also an overview of collected data scope, human error taxonomy, and state classifications for SBEOP instructions coding. The second part describes analytical work undertaken to describe time distribution necessary for execution of various kinds of instructions performed by operators according to the classification for coding of SBEOP instructions. It also presents the methods used for determination of probability distribution for various operator errors. Results from the data evaluation are presented in the last part of the paper. An overview of

  18. A second generation framework for the analysis of microsatellites in expressed sequence tags and the development of EST-SSR markers for a conifer, Cryptomeria japonica

    Directory of Open Access Journals (Sweden)

    Ueno Saneyoshi

    2012-04-01

    Full Text Available Abstract Background Microsatellites or simple sequence repeats (SSRs in expressed sequence tags (ESTs are useful resources for genome analysis because of their abundance, functionality and polymorphism. The advent of commercial second generation sequencing machines has lead to new strategies for developing EST-SSR markers, necessitating the development of bioinformatic framework that can keep pace with the increasing quality and quantity of sequence data produced. We describe an open scheme for analyzing ESTs and developing EST-SSR markers from reads collected by Sanger sequencing and pyrosequencing of sugi (Cryptomeria japonica. Results We collected 141,097 sequence reads by Sanger sequencing and 1,333,444 by pyrosequencing. After trimming contaminant and low quality sequences, 118,319 Sanger and 1,201,150 pyrosequencing reads were passed to the MIRA assembler, generating 81,284 contigs that were analysed for SSRs. 4,059 SSRs were found in 3,694 (4.54% contigs, giving an SSR frequency lower than that in seven other plant species with gene indices (5.4–21.9%. The average GC content of the SSR-containing contigs was 41.55%, compared to 40.23% for all contigs. Tri-SSRs were the most common SSRs; the most common motif was AT, which was found in 655 (46.3% di-SSRs, followed by the AAG motif, found in 342 (25.9% tri-SSRs. Most (72.8% tri-SSRs were in coding regions, but 55.6% of the di-SSRs were in non-coding regions; the AT motif was most abundant in 3′ untranslated regions. Gene ontology (GO annotations showed that six GO terms were significantly overrepresented within SSR-containing contigs. Forty–four EST-SSR markers were developed from 192 primer pairs using two pipelines: read2Marker and the newly-developed CMiB, which combines several open tools. Markers resulting from both pipelines showed no differences in PCR success rate and polymorphisms, but PCR success and polymorphism were significantly affected by the expected PCR product size

  19. A second generation framework for the analysis of microsatellites in expressed sequence tags and the development of EST-SSR markers for a conifer, Cryptomeria japonica

    Science.gov (United States)

    2012-01-01

    Background Microsatellites or simple sequence repeats (SSRs) in expressed sequence tags (ESTs) are useful resources for genome analysis because of their abundance, functionality and polymorphism. The advent of commercial second generation sequencing machines has lead to new strategies for developing EST-SSR markers, necessitating the development of bioinformatic framework that can keep pace with the increasing quality and quantity of sequence data produced. We describe an open scheme for analyzing ESTs and developing EST-SSR markers from reads collected by Sanger sequencing and pyrosequencing of sugi (Cryptomeria japonica). Results We collected 141,097 sequence reads by Sanger sequencing and 1,333,444 by pyrosequencing. After trimming contaminant and low quality sequences, 118,319 Sanger and 1,201,150 pyrosequencing reads were passed to the MIRA assembler, generating 81,284 contigs that were analysed for SSRs. 4,059 SSRs were found in 3,694 (4.54%) contigs, giving an SSR frequency lower than that in seven other plant species with gene indices (5.4–21.9%). The average GC content of the SSR-containing contigs was 41.55%, compared to 40.23% for all contigs. Tri-SSRs were the most common SSRs; the most common motif was AT, which was found in 655 (46.3%) di-SSRs, followed by the AAG motif, found in 342 (25.9%) tri-SSRs. Most (72.8%) tri-SSRs were in coding regions, but 55.6% of the di-SSRs were in non-coding regions; the AT motif was most abundant in 3′ untranslated regions. Gene ontology (GO) annotations showed that six GO terms were significantly overrepresented within SSR-containing contigs. Forty–four EST-SSR markers were developed from 192 primer pairs using two pipelines: read2Marker and the newly-developed CMiB, which combines several open tools. Markers resulting from both pipelines showed no differences in PCR success rate and polymorphisms, but PCR success and polymorphism were significantly affected by the expected PCR product size and number of SSR

  20. Enhancing the health of women living with HIV: the SMART/EST Women's Project

    Directory of Open Access Journals (Sweden)

    Stephen M Weiss

    2011-02-01

    Full Text Available Stephen M Weiss1, Jonathan N Tobin2, Michael Antoni1, Gail Ironson1, Mary Ishii1, Anita Vaughn2, Andrea Cassells2, Deborah Jones1, Neil Schneiderman1, Elizabeth Brondolo3, Arthur LaPerriere1, Maria Lopez1, Olga Villar-Loubet1, Joanne Camille2, Mahendra Kumar1, J Bryan Page1, SMART/EST Women's Project Team*1University of Miami, Miami, FL, USA; 2Clinical Directors Network, New York, NY, USA; 3St Johns University, Queens, NY, USA; *The SMART/EST Womens' Project Team: DeVieux J, Jean-Gilles M, Gousse Y, Alexander K, Bustamonte V, Lopez E, Casani J, Stanley H, Asthana D, Van Splunteren F, Goldstein A, Nasajon R, Wiesner Y, Zukerman M, Segal-Isaacson CJ, Romanowsky A, Masheb R, Coma C, Ubiera M, D'Andrea SM, Ittai N.Abstract: The principal objective of these multisite studies (Florida, New York, New Jersey: epicenters for human immunodeficiency virus [HIV] among women was to develop and implement effective combinations of behavioral interventions to optimize the health status of the most neglected and understudied population affected by the acquired immunodeficiency syndrome (AIDS epidemic in the United States: poor women of color living with HIV. The two studies enrolled nearly 900 women randomly assigned to “high intensity” (cognitive–behavioral stress management training combined with expressive–supportive therapy [CBSM]+ group or “low intensity” (individual psychoeducational program treatment conditions over a period of 9 years. The initial study of the stress management and relaxation training/expressive–supportive therapy (SMART/EST Women's Project (SWP I focused on reducing depression and anxiety, as well as improving self-efficacy and overall quality of life for women with case-defined AIDS. Findings from this study demonstrated the utility of CBSM+ in reducing distress (depression, anxiety and denial, while improving social support, self-efficacy, coping skills, and quality of life. The second study (SWP II, which included all

  1. 78 FR 56897 - Agency Information Collection Activities; Proposed Collection; Public Comment Request

    Science.gov (United States)

    2013-09-16

    ... Health and Human Services (HHS), HHS collects some basic information about the company's product through... necessity and utility of the proposed information collection for the proper performance of the agency's...

  2. 76 FR 4697 - Agency Information Collection Activities: Proposed Collection; Comment Request

    Science.gov (United States)

    2011-01-26

    ... engagement and on the current organizational culture and climate surrounding patient and family engagement... DEPARTMENT OF HEALTH AND HUMAN SERVICES Agency for Healthcare Research and Quality Agency Information Collection Activities: Proposed Collection; Comment Request AGENCY: Agency for Healthcare Research...

  3. 76 FR 73651 - Agency Information Collection Activities: Proposed Collection: Comment Request

    Science.gov (United States)

    2011-11-29

    ... DEPARTMENT OF HEALTH AND HUMAN SERVICES Health Resources and Services Administration Agency Information Collection Activities: Proposed Collection: Comment Request Periodically, the Health Resources and... Resources and Services Administration (HRSA), Bureau of Clinician Recruitment and Service (BCRS) places...

  4. Analysis and functional annotation of expressed sequence tags (ESTs from multiple tissues of oil palm (Elaeis guineensis Jacq.

    Directory of Open Access Journals (Sweden)

    Lee Weng-Wah

    2007-10-01

    Full Text Available Abstract Background Oil palm is the second largest source of edible oil which contributes to approximately 20% of the world's production of oils and fats. In order to understand the molecular biology involved in in vitro propagation, flowering, efficient utilization of nitrogen sources and root diseases, we have initiated an expressed sequence tag (EST analysis on oil palm. Results In this study, six cDNA libraries from oil palm zygotic embryos, suspension cells, shoot apical meristems, young flowers, mature flowers and roots, were constructed. We have generated a total of 14537 expressed sequence tags (ESTs from these libraries, from which 6464 tentative unique contigs (TUCs and 2129 singletons were obtained. Approximately 6008 of these tentative unique genes (TUGs have significant matches to the non-redundant protein database, from which 2361 were assigned to one or more Gene Ontology categories. Predominant transcripts and differentially expressed genes were identified in multiple oil palm tissues. Homologues of genes involved in many aspects of flower development were also identified among the EST collection, such as CONSTANS-like, AGAMOUS-like (AGL2, AGL20, LFY-like, SQUAMOSA, SQUAMOSA binding protein (SBP etc. Majority of them are the first representatives in oil palm, providing opportunities to explore the cause of epigenetic homeotic flowering abnormality in oil palm, given the importance of flowering in fruit production. The transcript levels of two flowering-related genes, EgSBP and EgSEP were analysed in the flower tissues of various developmental stages. Gene homologues for enzymes involved in oil biosynthesis, utilization of nitrogen sources, and scavenging of oxygen radicals, were also uncovered among the oil palm ESTs. Conclusion The EST sequences generated will allow comparative genomic studies between oil palm and other monocotyledonous and dicotyledonous plants, development of gene-targeted markers for the reference genetic map

  5. Potencialidades del pensamiento estético martiano para el desarrollo de la educación estético-literaria

    Directory of Open Access Journals (Sweden)

    José Reinaldo Marrero-Zaldívar

    2012-01-01

    Full Text Available El artículo aborda las potencialidades axiológicas de la obra martiana para el desarrollo de la educación estética. Presenta un estudio sistematizado de los principales acercamientos estéticos y el análisis de la singularidad de su proyección para el cumplimiento de dicho objetivo. El autor, a partir del estudio de la obra martiana y las direcciones del abordaje de su crítica literaria y artística, sintetizó ideas que se integran como núcleos conceptuales del pensamiento estético martiano, las cuales constituyen pilares esenciales para el desarrollo de la educación estética. En correspondencia con el análisis realizado se elaboró una metodología la cual ha sido aplicada en centros del la educación preuniversitaria de la provincia y en el Programa de Introducción a la Didáctica en el Curso de Formación Básica de la Universidad de Ciencias Pedagógicas "José de la Luz y Caballero".

  6. Workforce Competitiveness Collection. "LINCS" Resource Collection News

    Science.gov (United States)

    Literacy Information and Communication System, 2011

    2011-01-01

    This edition of "'LINCS' Resource Collection News" features the Workforce Competitiveness Collection, covering the topics of workforce education, English language acquisition, and technology. Each month Collections News features one of the three "LINCS" (Literacy Information and Communication System) Resource Collections--Basic…

  7. The Neurobiology of Collective Action

    Directory of Open Access Journals (Sweden)

    Paul Joseph Zak

    2013-11-01

    Full Text Available This essay introduces a neurologically-informed mathematical model of collective action that reveals the role for empathy and distress in motivating costly helping behaviors. We report three direct tests of model with a key focus on the neuropeptide oxytocin as well as a variety of indirect tests. These studies, from our lab and other researchers, show support for the model. Our findings indicate that empathic concern, via the brain's release of oxytocin, is a trigger for collective action. We discuss the implications from this model for our understanding why human beings engage in costly collective action.

  8. El aporte literario y estético de the Beatles

    Directory of Open Access Journals (Sweden)

    Gustavo Hernández Castro

    2013-07-01

    Full Text Available Este artículo intenta dilucidar el aporte literario y estético de la banda de rock and roll The Beatles a partir del reacomodo económico e ideológico moderno de la segunda mitad del siglo veinte. El punto de partida, para este análisis, es el pensamiento existencialista, específicamente las categorías del “absurdo”, “ser” y la “nada”, como conceptos de una espiral histórica en contradicción para nuestro tiempo.

  9. ESTIMA, a tool for EST management in a multi-project environment

    Directory of Open Access Journals (Sweden)

    Lewin Harris A

    2004-11-01

    Full Text Available Abstract Background Single-pass, partial sequencing of complementary DNA (cDNA libraries generates thousands of chromatograms that are processed into high quality expressed sequence tags (ESTs, and then assembled into contigs representative of putative genes. Usually, to be of value, ESTs and contigs must be associated with meaningful annotations, and made available to end-users. Results A web application, Expressed Sequence Tag Information Management and Annotation (ESTIMA, has been created to meet the EST annotation and data management requirements of multiple high-throughput EST sequencing projects. It is anchored on individual ESTs and organized around different properties of ESTs including chromatograms, base-calling quality scores, structure of assembled transcripts, and multiple sources of comparison to infer functional annotation, Gene Ontology associations, and cDNA library information. ESTIMA consists of a relational database schema and a set of interactive query interfaces. These are integrated with a suite of web-based tools that allow a user to query and retrieve information. Further, query results are interconnected among the various EST properties. ESTIMA has several unique features. Users may run their own EST processing pipeline, search against preferred reference genomes, and use any clustering and assembly algorithm. The ESTIMA database schema is very flexible and accepts output from any EST processing and assembly pipeline. ESTIMA has been used for the management of EST projects of many species, including honeybee (Apis mellifera, cattle (Bos taurus, songbird (Taeniopygia guttata, corn rootworm (Diabrotica vergifera, catfish (Ictalurus punctatus, Ictalurus furcatus, and apple (Malus x domestica. The entire resource may be downloaded and used as is, or readily adapted to fit the unique needs of other cDNA sequencing projects. Conclusions The scripts used to create the ESTIMA interface are freely available to academic users in

  10. Literatura chilena en digital: mapas, estéticas y conceptualizaciones

    OpenAIRE

    Carolina Gaínza C.

    2017-01-01

    En el presente artículo se busca analizar una experiencia estética vinculada a lo digital, que tiene como principales componentes la posibilidad de interactuar, participar y manipular las obras creadas en este formato. Con tal fin, se presentará un mapa de la literatura digital en Chile, para luego profundizar en el análisis de dos aspectos que permiten caracterizar una estética de lo digital: la hipertextualidad y el hackeo cultural. A partir de estos elementos y tomando en cuenta que la lit...

  11. Estándares de calidad de la información y democracia de calidad

    Directory of Open Access Journals (Sweden)

    José Villamarin Carrascal

    2013-06-01

    Full Text Available Este artículo propone seis estándares de calidad de la información, indicadores mínimos para el desarrollo de un periodismo ético, responsable y creador de ciudadanía. Se complementa con casos de la prensa nacional y mundial en los que la ausencia de esos estándares puede terminar en evidentes formas de manipulación. Propone que la recuperación de la credibilidad de un discurso público como el periodismo depende de la rigurosidad de sus prácticas informativas.

  12. ESTIMA, a tool for EST management in a multi-project environment.

    Science.gov (United States)

    Kumar, Charu G; LeDuc, Richard; Gong, George; Roinishivili, Levan; Lewin, Harris A; Liu, Lei

    2004-11-04

    Single-pass, partial sequencing of complementary DNA (cDNA) libraries generates thousands of chromatograms that are processed into high quality expressed sequence tags (ESTs), and then assembled into contigs representative of putative genes. Usually, to be of value, ESTs and contigs must be associated with meaningful annotations, and made available to end-users. A web application, Expressed Sequence Tag Information Management and Annotation (ESTIMA), has been created to meet the EST annotation and data management requirements of multiple high-throughput EST sequencing projects. It is anchored on individual ESTs and organized around different properties of ESTs including chromatograms, base-calling quality scores, structure of assembled transcripts, and multiple sources of comparison to infer functional annotation, Gene Ontology associations, and cDNA library information. ESTIMA consists of a relational database schema and a set of interactive query interfaces. These are integrated with a suite of web-based tools that allow a user to query and retrieve information. Further, query results are interconnected among the various EST properties. ESTIMA has several unique features. Users may run their own EST processing pipeline, search against preferred reference genomes, and use any clustering and assembly algorithm. The ESTIMA database schema is very flexible and accepts output from any EST processing and assembly pipeline. ESTIMA has been used for the management of EST projects of many species, including honeybee (Apis mellifera), cattle (Bos taurus), songbird (Taeniopygia guttata), corn rootworm (Diabrotica vergifera), catfish (Ictalurus punctatus, Ictalurus furcatus), and apple (Malus x domestica). The entire resource may be downloaded and used as is, or readily adapted to fit the unique needs of other cDNA sequencing projects. The scripts used to create the ESTIMA interface are freely available to academic users in an archived format from http

  13. La importancia de la experiencia estética y el arte actual

    OpenAIRE

    Tejada, Jesús

    2003-01-01

    Es imprescindible que la reflexión estética aborde el problema de la crisis del arte actual y que analice las distintas respuestas que en la práctica se le están dando. La renovación del diálogo con planteamientos estéticos tradicionales puede arrojar una nueva luz sobre la actividad de la creatividad artística, al destacar los conceptos de emoción y conocimiento entre otros.

  14. Database Description - AcEST | LSDB Archive [Life Science Database Archive metadata

    Lifescience Database Archive (English)

    Full Text Available abase Description General information of database Database name AcEST Alternative n...hi, Tokyo-to 192-0397 Tel: +81-42-677-1111(ext.3654) E-mail: Database classificat...eneris Taxonomy ID: 13818 Database description This is a database of EST sequences of Adiantum capillus-vene...(3): 223-227. External Links: Original website information Database maintenance site Plant Environmental Res...base Database Description Download License Update History of This Database Site Policy | Contact Us Database Description - AcEST | LSDB Archive ...

  15. A era MTV: análise da estética de videoclipe (1984- 2009)

    OpenAIRE

    Trevisan, Michele Kapp

    2011-01-01

    Uma das mais importantes evoluções registradas no reino da cena musical de massas foi o aparecimento do fenômeno videoclipe. Trata-se de um formato audiovisual que modificou a maneira de “ver” a musica. Porém, foi a emissora Music Television, criada na década de 80, que deu a este a devida importância, tornando-se referencia de uma estética. Assim, o presente trabalho objetiva analisar a estética de videoclipe durante a era MTV, a partir da observação dos vídeos premiados nas principais categ...

  16. Las primeras muestras del romancero de tradición oral moderna: Serafín Estébanez Calderón (The first signs of ballads from modern oral tradition: Serafin Estébanez Calderon

    Directory of Open Access Journals (Sweden)

    Carmen de la Vega de la Muela

    2010-12-01

    Full Text Available Resumen: Las primeras muestras del Romancero de la tradición oral moderna vinieron de la mano de románticos viajeros que, como Washington Irving, dejaron testimonios de romances que se cantaban en Andalucía; y más tarde, los pioneros del folklorismo español daban a conocer en sus escritos costumbristas algunos romances recogidos directamente en estas tierras meridionales, siendo Serafín Estébanez Calderón quien más datos nos ofrece sobre los ambientes en los que se desenvolvía el Romancero en la primera mitad del siglo XIX.Abstract: The first signs of ballads from modern oral tradition came from the hand of romantic travelers who, like Washington Irving, left testimonies of ballads that were sung in Andalusia, and later, the pioneers of Spanish folklore were to reveal in his writings some manners romances collected directly in these southern lands, where Serafin Estébanez Calderon who gives us more data about the environments in which unfolded the Ballads in the first half of the nineteenth century.

  17. Genetic disorders as collective phenomena

    International Nuclear Information System (INIS)

    Chela-Flores, J.

    1987-05-01

    Genetic disorders due to human chromosome aberrations in number are discussed from the point of view of Molecular Genetics. The etiology of trisomy is discussed in the light of the collective variables recently introduced and an age-dependent metabolic disorder is suggested as a possible etiological factor. (author). 11 refs

  18. Equal Potential: A Collective Fraud.

    Science.gov (United States)

    Gottfredson, Linda S.

    2000-01-01

    Critiques the College Board's report, "Reaching the Top," asserting that it illustrates collective fraud in the social sciences, which sustains an egalitarian fiction that intelligence is clustered equally across all human populations. Suggests that while the report omits certain popular falsehoods, it also omits crucial truths about…

  19. License - ClEST | LSDB Archive [Life Science Database Archive metadata

    Lifescience Database Archive (English)

    Full Text Available switchLanguage; BLAST Search Image Search Home About Archive Update History Data ...License Update History of This Database Site Policy | Contact Us License - ClEST | LSDB Archive ...

  20. Relatório de Estágio em La Casa Amarilla (Barcelona)

    OpenAIRE

    Serrazina, Catarina Lopes

    2013-01-01

    Relatório de Estágio apresentado para cumprimento dos requisitos necessários à obtenção do grau de Mestre em Práticas Culturais para Municípios Este relatório procura apresentar os resultados das 570 horas de estágio em La Casa Amarilla e lançar uma base de reflexão acerca da pertinência que entidades como aquela que acolheu o estágio possuem nas cidades que as albergam. La Casa Amarilla é uma associação cultural sem fins lucrativos, com estatuto de organização não governamental, sediada e...

  1. Relatório de estágio em gestão escolar

    Directory of Open Access Journals (Sweden)

    Bernadete Lourdes de Sousa

    2011-12-01

    Full Text Available Fiz este estágio quando cursei o segundo semestre no curso de Pedagogia da UNEMAT, campus de Sinop/MT, como requisito para aprovação na disciplina de Estágio de Gestão; na Creche Municipal Alvorada, localizada na Avenida Alexandre Ferronato, 1200, no Setor Industrial; CEP: 78557-267, em Sinop-MT; Com o Telefone (66 3511-1949. No dia 18 de maio de 2011, das 7:00 às 15:00 horas. Estavam presentes: a Diretora da creche: Regina Lucia Alves; a Coordenadora: Vilma Ruela de Souza; o Secretário: Alex Sandro Alves da Gama (bolsista. Catorze professoras, sete monitoras, cinco bolsistas, três cozinheiras e três zeladoras.Palavras-chave: estágio; gestores; Projeto Político Pedagógico; creche municipal.

  2. Relato de estágio práticas pedagógicas

    Directory of Open Access Journals (Sweden)

    Lenir Guedes

    2011-12-01

    Full Text Available O presente artigo é o resultado final do estágio de regência na Educação Infantil, que foi realizado no CMEI Clara Teixeira, que está situada na Avenida das Sibipirunas, no Bairro Jardim Primaveras, no município de Sinop, Mato Grosso. O estágio foi realizado em tempo integral, no mês de Maio de 2011, contando com uma carga horária de 60 horas práticas. Cumprindo as normas do Curso de Pedagogia da Universidade do Estado de Mato Grosso (UNEMAT – campus de Sinop e a ementa da disciplina do Estágio Curricular Supervisionado na Educação Infantil II. Desenvolvemos um plano de aula, seguindo planejamento bimestral proposto pela Professora regente da sala, tendo fundamentação teórica.Palavras-chave: educador; educando; prática.

  3. El arte en el umbral. Estética y cultura del mercado

    Directory of Open Access Journals (Sweden)

    CARLOS FAJARDO FAJARDO

    2009-01-01

    Full Text Available Esta conferencia se centra en algunos aspectos donde creemos observar ciertas transformaciones importantes e ineludibles en la estética contemporánea. De este modo nos interesa indagar sobre las condiciones del arte y de las sensibilidades bajo los macroproyectos del mercado y de los medios, como también la mutación en algunas categorías de la estética moderna, tales como el concepto de obra de arte, el gusto estético, lo sublime, las relaciones entre arte y diseño. No es su propósito el rastrear la densa y exhaustiva historia de dichas mutaciones, más bien hemos realizado una mirada general a sus características actuales, mostrando algunos aspectos que operan en su interior.

  4. L'etat, C'est Moi: Why provincial Intra-governmental disputes in ...

    African Journals Online (AJOL)

    L'etat, C'est Moi: Why provincial Intra-governmental disputes in Shout Africa remain ungoverned by the final constitution and the Intergovernmental Relations Framework Act - and how we can best resolve them.

  5. Development and characterization of EST-SSR markers in Bombax ceiba (Malvaceae).

    Science.gov (United States)

    Ju, Miao-Miao; Ma, Huan-Cheng; Xin, Pei-Yao; Zhou, Zhi-Li; Tian, Bin

    2015-04-01

    Bombax ceiba (Malvaceae), commonly known as silk cotton tree, is a multipurpose tree species of tropical forests. Novel expressed sequence tag-simple sequence repeat (EST-SSR) markers were developed and characterized for the species using transcriptome analysis. A total of 33 new EST-SSR markers were developed for B. ceiba, of which 13 showed polymorphisms across the 24 individuals from four distant populations tested in the study. The results showed that the number of alleles per polymorphic locus ranged from two to four, and the expected heterozygosity and observed heterozygosity per locus varied from 0.043 to 0.654 and from 0 to 0.609, respectively. These newly developed EST-SSR markers can be used in phylogeographic and population genetic studies to investigate the origin of B. ceiba populations. Furthermore, these EST-SSR markers could also greatly promote the development of molecular breeding studies pertaining to silk cotton tree.

  6. Soutenir des politiques d'alimentation plus saine en Asie du Sud-Est ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Soutenir des politiques d'alimentation plus saine en Asie du Sud-Est. Près d'un quart des décès causés par des maladies non transmissibles dans le monde surviennent en Asie du Sud-Est. Ce projet tentera de résoudre le problème en menant des recherches sur la façon dont les politiques peuvent favoriser des ...

  7. Environmental Factors Modulating the Stability and Enzymatic Activity of the Petrotoga mobilis Esterase (PmEst.

    Directory of Open Access Journals (Sweden)

    Jose L S Lopes

    Full Text Available Enzymes isolated from thermophilic organisms found in oil reservoirs can find applications in many fields, including the oleochemical, pharmaceutical, bioenergy, and food/dairy industries. In this study, in silico identification and recombinant production of an esterase from the extremophile bacteria Petrotoga mobilis (designated PmEst were performed. Then biochemical, bioinformatics and structural characterizations were undertaken using a combination of synchrotron radiation circular dichroism (SRCD and fluorescence spectroscopies to correlate PmEst stability and hydrolytic activity on different substrates. The enzyme presented a high Michaelis-Menten constant (KM 0.16 mM and optimum activity at ~55°C for p-nitrophenyl butyrate. The secondary structure of PmEst was preserved at acid pH, but not under alkaline conditions. PmEst was unfolded at high concentrations of urea or guanidine through apparently different mechanisms. The esterase activity of PmEst was preserved in the presence of ethanol or propanol and its melting temperature increased ~8°C in the presence of these organic solvents. PmEst is a mesophilic esterase with substrate preference towards short-to medium-length acyl chains. The SRCD data of PmEst is in agreement with the prediction of an α/β protein, which leads us to assume that it displays a typical fold of esterases from this family. The increased enzyme stability in organic solvents may enable novel applications for its use in synthetic biology. Taken together, our results demonstrate features of the PmEst enzyme that indicate it may be suitable for applications in industrial processes, particularly, when the use of polar organic solvents is required.

  8. En Asie du Sud-Est, la recherche en écosanté contribue à la ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    29 avr. 2016 ... C'est en Thaïlande que l'on observe la plus forte incidence de cholangiocarcinome, forme mortelle de cancer du foie notamment attribuable à une infection parasitaire par l'opisthorchiase (Opisthorchis viverrini). À certains endroits du nord-est de la Thaïlande, près de 85 % des habitants sont infectés par ...

  9. An overview of interactions among oceanography, marine ecosystems, climatic and human disruptions along the eastern margins of the Pacific Ocean Una visión general de las interacciones entre la oceanografía, los ecosistemas marinos y las disrupciones climáticas y antrópicas en los márgenes este del Océano Pacífico

    Directory of Open Access Journals (Sweden)

    PATRICIA M. HALPIN

    2004-09-01

    Full Text Available Physical processes, biotic processes and human activities all act to shape marine ecosystems. Future management of these valuable ecosystems requires an integrative approach that takes into account complicated organismal interactions, oceanographic processes that span large scales of time and space, and how anthropogenic effects interact with the natural environment. The temperate west coasts of North and South America represent a unique opportunity for comparison, as many of the same oceanographic processes, particularly upwelling, occur off both coasts. Additionally, a number of marine ecosystems in both areas have surprising parallels. Here we present an overview of the oceanographic processes that dominate the coastlines, and give examples of ecosystems and the effects that oceanography, human activities and their interaction have on the communitiesLos procesos físicos y biológicos y las actividades humanas determinan los ecosistemas marinos. El manejo futuro de estos valiosos ecosistemas requiere de una aproximación integrativa que considere las complejas interacciones entre individuos, los procesos oceanográficos que se desarrollan a gran escala espacial y temporal, y la interacción de los efectos antropogénicos con el medio ambiente. Las costas templadas del oeste de Norteamérica y Sudamérica representan una oportunidad única para efectuar comparaciones ya que muchos procesos oceanográficos, particularmente la surgencia costera, ocurren en ambas costas. Adicionalmente, numerosos ecosistemas marinos en ambas áreas presentan sorprendentes paralelos. La presente revisión ofrece una visión general de los procesos oceanográficos dominantes en ambas costas y ofrece ejemplos de ecosistemas y los efectos que la oceanografía, las actividades humanas y las interacciones entre individuos tienen sobre las comunidades marinas

  10. EST-SSR marker revealed effective over biochemical and morphological scepticism towards identification of specific turmeric (Curcuma longa L.) cultivars.

    Science.gov (United States)

    Sahoo, Ambika; Jena, Sudipta; Kar, Basudeba; Sahoo, Suprava; Ray, Asit; Singh, Subhashree; Joshi, Raj Kumar; Acharya, Laxmikanta; Nayak, Sanghamitra

    2017-05-01

    Turmeric (Curcuma longa L., family Zingiberaceae) is one of the most economically important plants for its use in food, medicine, and cosmetic industries. Cultivar identification is a major constraint in turmeric, owing to high degree of morphological similarity that in turn, affects its commercialization. The present study addresses this constraint, using EST-SSR marker based, molecular identification of 8 elite cultivars and 88 accessions in turmeric. Fifty EST-SSR primers were screened against eight cultivars of turmeric (Suroma, Roma, Lakadong, Megha, Alleppey Supreme, Kedaram, Pratibha, and Suvarna); out of which 11 primers showed polymorphic banding pattern. The polymorphic information content (PIC) of these primers ranged from 0.13 to 0.48. However, only three SSR loci (CSSR 14, CSSR 15, and CSSR 18) gave reproducible unique banding pattern clearly distinguishing the cultivars 'Lakadong' and 'Suvarna' from other cultivars tested. These three unique SSR markers also proved to be effective in identification of 'Lakadong' cultivars when analysed with 88 accessions of turmeric collected from different agro-climatic regions. Furthermore, two identified cultivars (Lakadong and Suvarna) could also be precisely differentiated when analysed and based on phylogenetic tree, with other 94 genotypes of turmeric. The novel SSR markers can be used for identification and authentication of two commercially important turmeric cultivars 'Lakadong' and 'Suvarna'.

  11. Development of Novel Polymorphic EST-SSR Markers in Bailinggu (Pleurotus tuoliensis for Crossbreeding

    Directory of Open Access Journals (Sweden)

    Yueting Dai

    2017-11-01

    Full Text Available Identification of monokaryons and their mating types and discrimination of hybrid offspring are key steps for the crossbreeding of Pleurotus tuoliensis (Bailinggu. However, conventional crossbreeding methods are troublesome and time consuming. Using RNA-seq technology, we developed new expressed sequence tag-simple sequence repeat (EST-SSR markers for Bailinggu to easily and rapidly identify monokaryons and their mating types, genetic diversity and hybrid offspring. We identified 1110 potential EST-based SSR loci from a newly-sequenced Bailinggu transcriptome and then randomly selected 100 EST-SSRs for further validation. Results showed that 39, 43 and 34 novel EST-SSR markers successfully identified monokaryons from their parent dikaryons, differentiated two different mating types and discriminated F1 and F2 hybrid offspring, respectively. Furthermore, a total of 86 alleles were detected in 37 monokaryons using 18 highly informative EST-SSRs. The observed number of alleles per locus ranged from three to seven. Cluster analysis revealed that these monokaryons have a relatively high level of genetic diversity. Transfer rates of the EST-SSRs in the monokaryons of closely-related species Pleurotus eryngii var. ferulae and Pleurotus ostreatus were 72% and 64%, respectively. Therefore, our study provides new SSR markers and an efficient method to enhance the crossbreeding of Bailinggu and closely-related species.

  12. Two EST-derived marker systems for cultivar identification in tree peony.

    Science.gov (United States)

    Zhang, J J; Shu, Q Y; Liu, Z A; Ren, H X; Wang, L S; De Keyser, E

    2012-02-01

    Tree peony (Paeonia suffruticosa Andrews), a woody deciduous shrub, belongs to the section Moutan DC. in the genus of Paeonia of the Paeoniaceae family. To increase the efficiency of breeding, two EST-derived marker systems were developed based on a tree peony expressed sequence tag (EST) database. Using target region amplification polymorphism (TRAP), 19 of 39 primer pairs showed good amplification for 56 accessions with amplicons ranging from 120 to 3,000 bp long, among which 99.3% were polymorphic. In contrast, 7 of 21 primer pairs demonstrated adequate amplification with clear bands for simple sequence repeats (SSRs) developed from ESTs, and a total of 33 alleles were found in 56 accessions. The similarity matrices generated by TRAP and EST-SSR markers were compared, and the Mantel test (r = 0.57778, P = 0.0020) showed a moderate correlation between the two types of molecular markers. TRAP markers were suitable for DNA fingerprinting and EST-SSR markers were more appropriate for discriminating synonyms (the same cultivars with different names due to limited information exchanged among different geographic areas). The two sets of EST-derived markers will be used further for genetic linkage map construction and quantitative trait locus detection in tree peony.

  13. Fronteras imaginadas y estereotipos : la creación de un monstruo llamado Europa del Este

    Directory of Open Access Journals (Sweden)

    Daniel Esparza

    2009-01-01

    Full Text Available En este artículo se observa como se han formado en el «oeste», desde la Guerra Fría hasta hoy, algunos estereotipos negativos sobre la marca «Europa del Este», la cual está cargada de connotaciones negativas (ciudades grises, guerras, inmigración ilegal, pobreza o criminalidad. Al mismo tiempo, como si de un oasis se tratara, se observa parojicamente como la marca Praga o Budapest (capitales de países de «Europa del Este» no son percibidas negativamente, precisamente porque no están relacionadas directamente con el Este, sino con centroeuropa y con imágenes positivas asociadas a la herencia artístico-cultural de los imperios centrales: el sacro imperio germano-romano y el austrohúngaro.In this article it is observed how from the Cold War till today have been formed in the West significant stereotypes towards Eastern Europe, which are endowed with negative images, such as grey towns, illegal immigration, wars, poverty or criminality. At the same time it is observed, paradoxically, how the brand Prague or Budapest (capitals of «Eastern European» countries are not perceived negatively, precisely because they are not directly associated with the East, but with the cultural heritage form the old central empires: the Sacred Roman-German empire first, and the Habsburg empire later.

  14. Integración de ética y estética

    Directory of Open Access Journals (Sweden)

    Maureen Trebilcock Kelly

    2008-10-01

    Full Text Available Este artículo plantea que si bien la mayoría de los arquitectos coincide en la urgente necesidad de integrar criterios de sustentabilidad ambiental en el proyecto, aún nos encontramos con que el tipo de arquitectura que logra tribuna en los medios está dominada por la imagen, mientras que los ejemplos de arquitectura sustentable son criticados por considerarse estéticamente pobres. Sin embargo, la arquitectura sustentable no implica necesariamente agregar una apariencia estética a un comportamiento físico que persigue objetivos de sustentabilidad, sino que crear una relación integral entre valores estéticos y fundamentos científicos. En un escenario de búsqueda de integración entre ética y estética a través de múltiples y diversos caminos hacia la sustentabilidad, no debemos dejar de mirar con suspicacia aquellas tendencias que se basan en un supuesto consenso universal acerca de lo que la arquitectura sustentable debe ser y en la creencia de que ésta puede ser evaluada objetivamente en base a la desintegración de la obra en un listado de parámetros. En arquitectura, el todo es siempre más que la suma de las partes.

  15. New functions of the este system - new possibilities for emergency response

    International Nuclear Information System (INIS)

    Carny, P.

    2005-01-01

    The ESTE system (Emergency Source Term Evaluation) is support instrument for off-site emergency response and its main objective is to assist to the crisis staff: - to mitigate radiological consequences of significant releases; - to manage the protective measures; - to manage emergency monitoring. At national level the ESTE system are implemented at the Emergency Response Centre of the Czech Republic (SUJB) and Austrian versions are implemented at the Crisis Centre of the Austrian Republic (BMLFUW). ESTE system can now be utilized not only in close (40 km) vicinity of the point of the release (NPP), but radiological impacts are now calculated across the whole country or over the country border. Puff Trajectory Model (PTM) with the background of geographical information system (GIS) is included in este. Numerical weather prediction data (wind fields) predicted for the whole or the part of the country are online connected with este and utilized for the puffs movement simulation and impacts calculations. It means that not only meteorological data from the point of release (measured or predicted), but 'meteorological data wind field' predicted for larger region across the country are used by the este system. (author)

  16. Development of Novel Polymorphic EST-SSR Markers in Bailinggu (Pleurotus tuoliensis) for Crossbreeding

    Science.gov (United States)

    Dai, Yueting; Su, Wenying; Song, Bing; Li, Yu; Fu, Yongping

    2017-01-01

    Identification of monokaryons and their mating types and discrimination of hybrid offspring are key steps for the crossbreeding of Pleurotus tuoliensis (Bailinggu). However, conventional crossbreeding methods are troublesome and time consuming. Using RNA-seq technology, we developed new expressed sequence tag-simple sequence repeat (EST-SSR) markers for Bailinggu to easily and rapidly identify monokaryons and their mating types, genetic diversity and hybrid offspring. We identified 1110 potential EST-based SSR loci from a newly-sequenced Bailinggu transcriptome and then randomly selected 100 EST-SSRs for further validation. Results showed that 39, 43 and 34 novel EST-SSR markers successfully identified monokaryons from their parent dikaryons, differentiated two different mating types and discriminated F1 and F2 hybrid offspring, respectively. Furthermore, a total of 86 alleles were detected in 37 monokaryons using 18 highly informative EST-SSRs. The observed number of alleles per locus ranged from three to seven. Cluster analysis revealed that these monokaryons have a relatively high level of genetic diversity. Transfer rates of the EST-SSRs in the monokaryons of closely-related species Pleurotus eryngii var. ferulae and Pleurotus ostreatus were 72% and 64%, respectively. Therefore, our study provides new SSR markers and an efficient method to enhance the crossbreeding of Bailinggu and closely-related species. PMID:29149037

  17. Book Review: Zarzo, E. (2016, Memoria Retórica y Experiencia Estética. Retórica, Estética y Educación. Madrid: Dykinson

    Directory of Open Access Journals (Sweden)

    Davide Mombelli

    2016-10-01

    Full Text Available Memoria retórica y experiencia estética. Retórica, Estética y Educación, recently published by Dykinson, is a fundamental body of research on rhetoric memory and aesthetic experience, two objects of study which, although having generated much literature separately, have not been considered in their reciprocity until now. The author, Esther Zarzo, who earned her Ph.D. in Philosophy, has published several investigations of both a theoretical and practical nature concerning the treatment and development of the faculty of memory. From among her theoretical works, standouts include “Historia, memoria y tiempo” (2015a, which addresses the relationship between memory and history from a metaphysical approach in order to explain some of the mnemonic aporiae underlying historical knowledge; and from among her work of a practical nature standouts include, “La mirada topológica” (2013, focused on the media of today's exploitation of the image, and, "The art of memory in the Digital Age"(2015b, in which different implementation strategies of the classical rhetorical techniques found in Virtual Learning Environments are considered. Regarding the investigation’s second object, the aesthetic experience, it is important to highlight the author’s editing work carried out in collaboration with Prof. Pedro Aullón de Haro of the fundamental work by Alfonso Reyes, El Deslinde(2014, whose concept of literary experience is crucial to understanding the text at hand. As Esther Zarzo explains in the introduction, the choice of such objects of study is justified by the need to analyse the epistemological consequences of the revolution produced by electronic media that enable the external storage and transmission of information, since any modifications to the way of organising and accessing content substantially affects the individual and collective experience, both in regard to knowledge and to self-knowledge, along with the experience of time. According

  18. Interpretación nietzscheana del fenómeno estético Nietzschean Interpretation of the Esthetic Phenomenon

    Directory of Open Access Journals (Sweden)

    Franz Mauricio Castro Barahona

    2008-06-01

    Full Text Available Las reflexiones nietzscheanas sobre la razón y la sensibilidad como grandes fuerzas en tensión, la sensibilidad como liberadora de la existencia y la embriaguez cómo estado creativo por excelencia se presentan en este artículo mostrando como interpretar es un acto vital; así como lo es el crear para Nietzsche. De esta manera, un investigador gana una posición en el mundo y trasciende en la medida en que no solo se comprende a sí mismo, ni a una obra aislada y particular, sino al hombre en general. La creencia en el poder del hombre y la naturaleza: la unión de estas fuerzas para sentir la vida y mostrar lo bello del ser humano así como sus contradicciones, es el poder que la estética nietzscheana da al hombre frente a los ideales que lo alejan de la vida misma y no le permiten la posesión de la tierra. Es la liberación de todos los instintos para acabar con los ideales de la religión que es nociva para la vida. Aspecto enunciado ya por Habermas, en las formas de existir, de sujetos diferentes, que expresan una respuesta estéticamente fundada a la pregunta por la existencia.Nietzsche builds up a reflection about reason and senses as strong forces on tension. Where the senses release human existence and drunkenness is the creative state for excellence. In this paper are shown the reflection and the interpretation acts, as a vital phenomenon created by Nietzsche himself. For this reason, an interpreter reaches a position in the world and transcends when there is not just an understanding of him or herself, of an art work, but also an interpretation of the human being in general. There is a believe on the power of man and nature, their union in order to life, that can show the beauty, the ugliness, and the contradictions of human being; this power is given to mankind on Nietzsche’s special way of seeing art, and goes in the opposite way than ideas does; since they move men further away from life itself. Nietzsche faces religion

  19. Exploiting the transcriptome of Euphrates Poplar, Populus euphratica (Salicaceae to develop and characterize new EST-SSR markers and construct an EST-SSR database.

    Directory of Open Access Journals (Sweden)

    Fang K Du

    Full Text Available BACKGROUND: Microsatellite markers or Simple Sequence Repeats (SSRs are the most popular markers in population/conservation genetics. However, the development of novel microsatellite markers has been impeded by high costs, a lack of available sequence data and technical difficulties. New species-specific microsatellite markers were required to investigate the evolutionary history of the Euphratica tree, Populus euphratica, the only tree species found in the desert regions of Western China and adjacent Central Asian countries. METHODOLOGY/PRINCIPAL FINDINGS: A total of 94,090 non-redundant Expressed Sequence Tags (ESTs from P. euphratica comprising around 63 Mb of sequence data were searched for SSRs. 4,202 SSRs were found in 3,839 ESTs, with 311 ESTs containing multiple SSRs. The most common motif types were trinucleotides (37% and hexanucleotides (33% repeats. We developed primer pairs for all of the identified EST-SSRs (eSSRs and selected 673 of these pairs at random for further validation. 575 pairs (85% gave successful amplification, of which, 464 (80.7% were polymorphic in six to 24 individuals from natural populations across Northern China. We also tested the transferability of the polymorphic eSSRs to nine other Populus species. In addition, to facilitate the use of these new eSSR markers by other researchers, we mapped them onto Populus trichocarpa scaffolds in silico and compiled our data into a web-based database (http://202.205.131.253:8080/poplar/resources/static_page/index.html. CONCLUSIONS: The large set of validated eSSRs identified in this work will have many potential applications in studies on P. euphratica and other poplar species, in fields such as population genetics, comparative genomics, linkage mapping, QTL, and marker-assisted breeding. Their use will be facilitated by their incorporation into a user-friendly web-based database.

  20. Le fascisme, c’est du théâtre. Macchina scenica e meccanica narrativa

    Directory of Open Access Journals (Sweden)

    Emanuele Canzaniello

    2015-11-01

    Full Text Available «Le fascisme, c’est du théâtre», sostiene Jean Genet, e come tale i suoi legami con la natura e la prassi della messa in scena sono essenziali alla specificità del fenomeno. La resa spettacolare della nazionalizzazione delle masse è stata senz’altro tra i temi fondamentali della ricerca sui totalitarismi. Il mio proposito è qui quello di intarsiare alcuni nuclei consolidati della ricerca storica con le rese squisitamente letterarie di quello che fu poco più che un  decennio di immensi tableaux vivants, visioni di un nuovo ordine di massa. Un’opera d’arte collettiva, basata su una premessa  fondamentale: dare “figurabilità” ai detriti e alle rovine (rimosse? di alcuni miti delle origini propri della cultura romantica, e  consapevolmente avviare e mettere in luce un enorme processo più generale di disgregazione del logos e di tutta la civiltà europea nella sua prospettiva diremo cartesiana, geometrica e razionalista. Il mio discorso si fonda, anche se in breve, su un testo solo: la Gerbe des forces (1937 di A. de Châteaubriant, uno dei più singolari resoconti di pellegrinaggio politico verso il miraggio totalitario che si sia dato tre le due guerre mondiali. Soccorsi non secondari sono il saggio di Sontag Under the sign of Saturn (1980 e quello di Tame La Mystique du Fascisme dans l’oeuvre de Robert Brasillach (1986. According to Jean Genet: «Le fascisme, c’est du théâtre», and as such its relationship with the nature and praxis of staging are essential to the specificity of the phenomenon. The magnificent representation of mass nationalisation is beyond doubt one of the fundamental issues when investigating totalitarianisms. My aim here is to link some wellestablished nuclei of historical research to the literary outputs of what was little more than a decade of immense tableaux vivants, visions of a new mass order. A collective work of art, based on a fundamental premise: to give ‘figurality’ to the rubble

  1. Toxicological Impact of Air Pollution Particulate Matter PM 2.5 Collected under Urban Industrial or Rural Influence Occurrence of Oxidative Stress and Inflammatory Reaction in BEAS 2B Human Bronchial Epithelial Cells Corrected Version

    International Nuclear Information System (INIS)

    Dergham, M.; Billet, S; Verdin, A.; Courcot, D.; Cazier, F.; Pirouz, Sh.; Garcon, G.

    2011-01-01

    Exposure to air pollution Particulate Matter (PM) is one of the risk factors involved in the high incidence of respiratory and cardio-vascular diseases. In this work, to integrate inter-seasonal and inter-site variations, fine particle (PM2.5) samples have been collected in spring-summer 2008) and autumn 2008-winter 2009, in Dunkerque (France) under urban or industrial influence, and in Rubrouck (France), under rural influence. Attention was paid to characterize their physico-chemical characteristics, and to determine their ability to induce oxidative stress and inflammatory response in a human bronchial epithelial cell model (BEAS-2B cell line). Physico-chemical characterization of the six PM samples showed their heterogeneities and complexities depending upon their respective natural and/or anthropogenic emission sources. Lung cytotoxicity of these air pollution PM2.5 samples, as shown in BEAS-2B cells, might rely on the induction of oxidative stress conditions and particularly on the excessive inflammatory response. (author)

  2. Development of 23 novel polymorphic EST-SSR markers for the endangered relict conifer Metasequoia glyptostroboides1

    Science.gov (United States)

    Jin, Yuqing; Bi, Quanxin; Guan, Wenbin; Mao, Jian-Feng

    2015-01-01

    Premise of the study: Metasequoia glyptostroboides is an endangered relict conifer species endemic to China. In this study, expressed sequence tag–simple sequence repeat (EST-SSR) markers were developed using transcriptome mining for future genetic and functional studies. Methods and Results: We collected 97,565 unigene sequences generated by 454 pyrosequencing. A bioinformatics analysis identified 2087 unique and putative microsatellites, from which 96 novel microsatellite markers were developed. Fifty-three of the 96 primer sets successfully amplified clear fragments of the expected sizes; 23 of those loci were polymorphic. The number of alleles per locus ranged from two to eight, with an average of three, and the observed and expected heterozygosity values ranged from 0 to 1.0 and 0.117 to 0.813, respectively. Conclusions: These microsatellite loci will enrich the genetic resources to develop functional studies and conservation strategies for this endangered relict species. PMID:26421250

  3. Peripheral blood collection

    DEFF Research Database (Denmark)

    Franken, Carmen; Remy, Sylvie; Lambrechts, Nathalie

    2016-01-01

    A crucial challenge for gene expression analysis in human biomonitoring studies on whole blood samples is rapid sample handling and mRNA stabilization. This study was designed to evaluate the impact of short bench times (less than 30 min) on yield, quality and gene expression of mRNA in the prese......A crucial challenge for gene expression analysis in human biomonitoring studies on whole blood samples is rapid sample handling and mRNA stabilization. This study was designed to evaluate the impact of short bench times (less than 30 min) on yield, quality and gene expression of m......RNA in the presence of different stabilization buffers (TempusTM Blood RNA tube and RNAlater® Stabilization Reagent). Microarray analyzes showed significant changes over short periods of time in expression of a considerate part of the transcriptome (2356 genes) with a prominent role for NFкB-, cancer......- and glucocorticoid-mediated networks, and specifically interleukin-8 (IL-8). These findings suggest that even short bench times affect gene expression, requiring to carry out blood collection in a strictly standardized way. © 2016 Informa UK Limited, trading as Taylor & Francis Group....

  4. Collection Directions: The Evolution of Library Collections and Collecting

    Science.gov (United States)

    Dempsey, Lorcan; Malpas, Constance; Lavoie, Brian

    2014-01-01

    This article takes a broad view of the evolution of collecting behaviors in a network environment and suggests some future directions based on various simple models. The authors look at the changing dynamics of print collections, at the greater engagement with research and learning behaviors, and at trends in scholarly communication. The goal is…

  5. Construction of a cDNA library from female adult of Toxocara canis, and analysis of EST and immune-related genes expressions.

    Science.gov (United States)

    Zhou, Rongqiong; Xia, Qingyou; Huang, Hancheng; Lai, Min; Wang, Zhenxin

    2011-10-01

    Toxocara canis is a widespread intestinal nematode parasite of dogs, which can also cause disease in humans. We employed an expressed sequence tag (EST) strategy in order to study gene-expression including development, digestion and reproduction of T. canis. ESTs provided a rapid way to identify genes, particularly in organisms for which we have very little molecular information. In this study, a cDNA library was constructed from a female adult of T. canis and 215 high-quality ESTs from 5'-ends of the cDNA clones representing 79 unigenes were obtained. The titer of the primary cDNA library was 1.83×10(6)pfu/mL with a recombination rate of 99.33%. Most of the sequences ranged from 300 to 900bp with an average length of 656bp. Cluster analysis of these ESTs allowed identification of 79 unique sequences containing 28 contigs and 51 singletons. BLASTX searches revealed that 18 unigenes (22.78% of the total) or 70 ESTs (32.56% of the total) were novel genes that had no significant matches to any protein sequences in the public databases. The rest of the 61 unigenes (77.22% of the total) or 145 ESTs (67.44% of the total) were closely matched to the known genes or sequences deposited in the public databases. These genes were classified into seven groups based on their known or putative biological functions. We also confirmed the gene expression patterns of several immune-related genes using RT-PCR examination. This work will provide a valuable resource for the further investigations in the stage-, sex- and tissue-specific gene transcription or expression. Copyright © 2011. Published by Elsevier Inc.

  6. A new set of ESTs and cDNA clones from full-length and normalized libraries for gene discovery and functional characterization in citrus

    Directory of Open Access Journals (Sweden)

    Alamar Santiago

    2009-09-01

    Full Text Available Abstract Background Interpretation of ever-increasing raw sequence information generated by modern genome sequencing technologies faces multiple challenges, such as gene function analysis and genome annotation. Indeed, nearly 40% of genes in plants encode proteins of unknown function. Functional characterization of these genes is one of the main challenges in modern biology. In this regard, the availability of full-length cDNA clones may fill in the gap created between sequence information and biological knowledge. Full-length cDNA clones facilitate functional analysis of the corresponding genes enabling manipulation of their expression in heterologous systems and the generation of a variety of tagged versions of the native protein. In addition, the development of full-length cDNA sequences has the power to improve the quality of genome annotation. Results We developed an integrated method to generate a new normalized EST collection enriched in full-length and rare transcripts of different citrus species from multiple tissues and developmental stages. We constructed a total of 15 cDNA libraries, from which we isolated 10,898 high-quality ESTs representing 6142 different genes. Percentages of redundancy and proportion of full-length clones range from 8 to 33, and 67 to 85, respectively, indicating good efficiency of the approach employed. The new EST collection adds 2113 new citrus ESTs, representing 1831 unigenes, to the collection of citrus genes available in the public databases. To facilitate functional analysis, cDNAs were introduced in a Gateway-based cloning vector for high-throughput functional analysis of genes in planta. Herein, we describe the technical methods used in the library construction, sequence analysis of clones and the overexpression of CitrSEP, a citrus homolog to the Arabidopsis SEP3 gene, in Arabidopsis as an example of a practical application of the engineered Gateway vector for functional analysis. Conclusion The new

  7. A new set of ESTs and cDNA clones from full-length and normalized libraries for gene discovery and functional characterization in citrus

    Science.gov (United States)

    Marques, M Carmen; Alonso-Cantabrana, Hugo; Forment, Javier; Arribas, Raquel; Alamar, Santiago; Conejero, Vicente; Perez-Amador, Miguel A

    2009-01-01

    Background Interpretation of ever-increasing raw sequence information generated by modern genome sequencing technologies faces multiple challenges, such as gene function analysis and genome annotation. Indeed, nearly 40% of genes in plants encode proteins of unknown function. Functional characterization of these genes is one of the main challenges in modern biology. In this regard, the availability of full-length cDNA clones may fill in the gap created between sequence information and biological knowledge. Full-length cDNA clones facilitate functional analysis of the corresponding genes enabling manipulation of their expression in heterologous systems and the generation of a variety of tagged versions of the native protein. In addition, the development of full-length cDNA sequences has the power to improve the quality of genome annotation. Results We developed an integrated method to generate a new normalized EST collection enriched in full-length and rare transcripts of different citrus species from multiple tissues and developmental stages. We constructed a total of 15 cDNA libraries, from which we isolated 10,898 high-quality ESTs representing 6142 different genes. Percentages of redundancy and proportion of full-length clones range from 8 to 33, and 67 to 85, respectively, indicating good efficiency of the approach employed. The new EST collection adds 2113 new citrus ESTs, representing 1831 unigenes, to the collection of citrus genes available in the public databases. To facilitate functional analysis, cDNAs were introduced in a Gateway-based cloning vector for high-throughput functional analysis of genes in planta. Herein, we describe the technical methods used in the library construction, sequence analysis of clones and the overexpression of CitrSEP, a citrus homolog to the Arabidopsis SEP3 gene, in Arabidopsis as an example of a practical application of the engineered Gateway vector for functional analysis. Conclusion The new EST collection denotes an

  8. Formação de classes funcionais de estímulos musicais

    Directory of Open Access Journals (Sweden)

    Alex Roberto Machado

    2009-04-01

    Full Text Available O objetivo deste experimento foi verificar o efeito do treino discriminativo sobre a formação de classes funcionais de melodias em andamentos e modos diferentes. Nove estudantes universitários do 2° período da graduação em Psicologia foram divididos em três grupos: Modo, Andamento ou Misto. O software SomPsi, produzido especialmente para este estudo, treinou os participantes e gerou relatórios com informações sobre os desempenhos, nas quatro fases do procedimento. O treino proposto mostrou-se eficiente para a formação das classes funcionais de estímulos sonoros musicais. Observou-se que agrupamentos de estímulos pela propriedade andamento foram mais facilmente discriminados que os agrupados pela melodia. A manipulação combinada das duas propriedades, em condição convergente, permitiu desempenho superior dos participantes. A rápida formação de classes funcionais e equivalentes de estímulos musicais, a partir de procedimentos de ensino automatizado de relações condicionais entre estímulos musicais, indica a possibilidade de uso desse procedimento na iniciação à música.

  9. Hacia una estética de las nuevas tecnologías como proyecto educativo

    Directory of Open Access Journals (Sweden)

    Juan Sebastián López

    2011-01-01

    Full Text Available Este artículo parte de la descripción de un cambio de época en curso, analiza - do en los niveles del orden social, la cultura, la comunicación y las tecnologías. De ahí se extraen una serie de retos a los que se enfrenta cualquier proyecto de educación contemporáneo. En este marco problémico, se examinarán algunos puntos fundamentales de la teoría estética de Theodor Adorno. Lo que se intenta proponer es una concepción de la estética asumida como mediación conceptual de la experiencia del sujeto con su entorno. Este será el primer paso para consolidar un proyecto educativo que resuelva uno de sus retos más urgentes: reducir la brecha entre el desarrollo tecnológico y sus correspondientes mediaciones culturales.

  10. Estética y Trabajo Social. El protagonismo de lo sensible

    Directory of Open Access Journals (Sweden)

    Alberto Carreras

    2005-11-01

    Full Text Available La Estética no se ocupa únicamente del arte o de la belleza, aunque habitualmente así se crea. Por el contrario, ella es el ámbito de todo lo sensible, es decir, del conocimiento sensorial y de las emociones producidas por las sensaciones. El artículo resalta la importancia de la sensibilidad en la actuación de los trabajadores sociales. Toma en cuenta tanto las sensaciones que recibimos nosotros como las que producimos en los demás. Desde esta perspectiva se abordan temas como la capacidad de observación, la inteligencia emocional, los estilos de vida, los estilos de trabajo, la resonancia, la sintonía con el cliente o el síndrome del profesional «quemado». Más aún, este ámbito de las sensaciones no está lejos del mundo teórico sino que es su punto de partida y su piedra de toque. En realidad, el mundo abstracto no existe sin el sensible. Y uno y otro tienen una dimensión relacional y ética. De este modo, el artículo termina criticando la separación de la ciencia, la estética y la ética como «esferas» de la cultura.

  11. Rapid assessment of sexual behavior, drug use, human immunodeficiency virus, and sexually transmitted diseases in northern thai youth using audio-computer-assisted self-interviewing and noninvasive specimen collection.

    Science.gov (United States)

    van Griensven, F; Supawitkul, S; Kilmarx, P H; Limpakarnjanarat, K; Young, N L; Manopaiboon, C; Mock, P A; Korattana, S; Mastro, T D

    2001-07-01

    Drug use, unwanted pregnancy, human immunodeficiency virus (HIV) infection, and sexually transmitted diseases are serious health problems among Thai youth. The gravity of these problems demands high-quality data to direct public health policy and prevention programs. Previous studies of stigmatized behaviors have been hampered by participation bias and underreporting. To evaluate sexual behavior, disease, and drug use, we used audio-computer-assisted self-interviewing (ACASI) and noninvasive specimen collection methods. We also evaluated effectiveness of these methods in minimizing participation bias and underreporting. In late 1999, students aged 15 to 21 years attending 3 vocational schools were invited to participate in a cross-sectional survey. Consenting students completed a classroom-based ACASI interview using a confidential code number system. Oral fluid specimens were tested for HIV antibodies, and urine was tested for chlamydial and gonococcal nucleic acids, methamphetamines, and opiates. Of 1736 invited students, 1725 (99%) agreed to participate. Of these, 48% of the male students and 43% of the female students reported ever having had sexual intercourse. Overall, the mean number of lifetime sexual partners was 4.6 among male participants (median: 2) and 2.8 among female participants (median: 1). Consistent use of condoms with steady partners was reported by 16% of male participants and 11% of female participants who had such partners. Of all male participants, 7% had ever paid for sex, 3% had ever sold sex, and 7% had ever been coerced to have sex. Of all female participants, 3% had ever sold sex and 21% had ever been coerced to have sex. Among women with a history of sexual intercourse, 27% reported at least 1 pregnancy. Of these pregnancies, 83% were terminated. Among those with sexual intercourse experience, the prevalence of HIV infection was 0.5%; of infection with Neisseria gonorrhoeae, 0.4%; and of infection with Chlamydia trachomatis, 5%. Twenty

  12. Physiologic and skeletal response to exogenous equine somatotropin (eST) in two-year-old quarter horses in race training

    International Nuclear Information System (INIS)

    Day, T.R.J; Potter, G.D.; Morris, E.L.; Greene, L.W.; Simmons, J.B.

    1998-01-01

    This study was conducted to determine the physiologic and skeletal response to exogenous equine somatotropin (eST) in two-year-old horses in race training. Sixteen Quarter Horse geldings were paired by age (ave. age=26 months), and one horse from each pair was assigned at random to either the eST treatment group or the control. The experiment was conducted over 112 days during which the horses were broke to ride and trained on a dirt track in a regimen typical for racehorses in training. Radiographs were taken of the left third metacarpal on day 0,28, 42, 56, 70, 84 and 112. Jugular blood samples were collected every 14 days and analyzed for calcium (Ca), phosphorous (P), osteocalcin, 25-dihydroxyvitamin D (Vit D), parathyroid hormone (PTH), insulin-like growth factor-I (IGF-I) and growth hormone (GH). Daily injections of eST were well tolerated and resulted in no observed side effects. There was a trend (P= .14) for increased plasma GH concentrations in the treated horses as the trial progressed. Plasma IGF-I concentrations were increased (P .05). In this study, administration of eST was effective in elevating plasma IGF-I, which is stimulatory to osteoblasts, and serum osteocalcin, which is a product of osteoblastic activity

  13. Evaluating human genetic diversity

    National Research Council Canada - National Science Library

    This book assesses the scientific value and merit of research on human genetic differences--including a collection of DNA samples that represents the whole of human genetic diversity--and the ethical...

  14. Gene discovery in EST sequences from the wheat leaf rust fungus Puccinia triticina sexual spores, asexual spores and haustoria, compared to other rust and corn smut fungi

    Science.gov (United States)

    2011-01-01

    Background Rust fungi are biotrophic basidiomycete plant pathogens that cause major diseases on plants and trees world-wide, affecting agriculture and forestry. Their biotrophic nature precludes many established molecular genetic manipulations and lines of research. The generation of genomic resources for these microbes is leading to novel insights into biology such as interactions with the hosts and guiding directions for breakthrough research in plant pathology. Results To support gene discovery and gene model verification in the genome of the wheat leaf rust fungus, Puccinia triticina (Pt), we have generated Expressed Sequence Tags (ESTs) by sampling several life cycle stages. We focused on several spore stages and isolated haustorial structures from infected wheat, generating 17,684 ESTs. We produced sequences from both the sexual (pycniospores, aeciospores and teliospores) and asexual (germinated urediniospores) stages of the life cycle. From pycniospores and aeciospores, produced by infecting the alternate host, meadow rue (Thalictrum speciosissimum), 4,869 and 1,292 reads were generated, respectively. We generated 3,703 ESTs from teliospores produced on the senescent primary wheat host. Finally, we generated 6,817 reads from haustoria isolated from infected wheat as well as 1,003 sequences from germinated urediniospores. Along with 25,558 previously generated ESTs, we compiled a database of 13,328 non-redundant sequences (4,506 singlets and 8,822 contigs). Fungal genes were predicted using the EST version of the self-training GeneMarkS algorithm. To refine the EST database, we compared EST sequences by BLASTN to a set of 454 pyrosequencing-generated contigs and Sanger BAC-end sequences derived both from the Pt genome, and to ESTs and genome reads from wheat. A collection of 6,308 fungal genes was identified and compared to sequences of the cereal rusts, Puccinia graminis f. sp. tritici (Pgt) and stripe rust, P. striiformis f. sp. tritici (Pst), and poplar

  15. Gene discovery in EST sequences from the wheat leaf rust fungus Puccinia triticina sexual spores, asexual spores and haustoria, compared to other rust and corn smut fungi

    Directory of Open Access Journals (Sweden)

    Wynhoven Brian

    2011-03-01

    Full Text Available Abstract Background Rust fungi are biotrophic basidiomycete plant pathogens that cause major diseases on plants and trees world-wide, affecting agriculture and forestry. Their biotrophic nature precludes many established molecular genetic manipulations and lines of research. The generation of genomic resources for these microbes is leading to novel insights into biology such as interactions with the hosts and guiding directions for breakthrough research in plant pathology. Results To support gene discovery and gene model verification in the genome of the wheat leaf rust fungus, Puccinia triticina (Pt, we have generated Expressed Sequence Tags (ESTs by sampling several life cycle stages. We focused on several spore stages and isolated haustorial structures from infected wheat, generating 17,684 ESTs. We produced sequences from both the sexual (pycniospores, aeciospores and teliospores and asexual (germinated urediniospores stages of the life cycle. From pycniospores and aeciospores, produced by infecting the alternate host, meadow rue (Thalictrum speciosissimum, 4,869 and 1,292 reads were generated, respectively. We generated 3,703 ESTs from teliospores produced on the senescent primary wheat host. Finally, we generated 6,817 reads from haustoria isolated from infected wheat as well as 1,003 sequences from germinated urediniospores. Along with 25,558 previously generated ESTs, we compiled a database of 13,328 non-redundant sequences (4,506 singlets and 8,822 contigs. Fungal genes were predicted using the EST version of the self-training GeneMarkS algorithm. To refine the EST database, we compared EST sequences by BLASTN to a set of 454 pyrosequencing-generated contigs and Sanger BAC-end sequences derived both from the Pt genome, and to ESTs and genome reads from wheat. A collection of 6,308 fungal genes was identified and compared to sequences of the cereal rusts, Puccinia graminis f. sp. tritici (Pgt and stripe rust, P. striiformis f. sp

  16. Los patrones estéticos en los albores del siglo XXI. Hacia una revisión de los estudios en torno a este tema

    Directory of Open Access Journals (Sweden)

    CARMEN BAÑUELOS

    1994-01-01

    Full Text Available El culto del cuerpo se ha convertido en nuestros días en un fenómeno social de gran significación. La presentación del yo físico adquiere una especial relevancia en los nuevos estilos de vida. Diversos grupos sociales (médicos, psicologos, sociólogos, modistos, publicistas, estilistas, esteticistas, periodistas... centran su interés en la definición social del "cuerpo". el objetivo es contribuir a la creación de un modelo ideal único y generalizable, legitimando determinadas prácticas sociales dirigidas hacia este fín. La definición de este modelo esta en manos de un grupo de "diseñadores de cuerpos" que asumen el papel de especificar los límites de la normalidad corporal en nuestra sociedad. La expresión corporal se ha convertido en un lenguaje que, en último extremo, manifiesta el status y la posición social. Por otra parte, en las últimas décadas se plantea la cuestión de conocer como las diferencias biológicas entre los individuos se transforman en factores de discriminación social. En este sentido, diversos problemas de salud actuales chocan con la definición de "cuerpo" ideal. La gordura es un buen ejemplo para comprender como las modas sociales utilizan la categorización de enfermedad "etiquetando" lo "normal" en un momento dado como "patológico" en otro. La exclusión social de las personas obesas, el rechazo a la obesidad y la construcción social de su figura marginal correspondiente, adquieren una relevancia merecedora de un análisis sociológico mas exhaustivo. Por este motivo, es necesario comprender como se han impuesto criterios sociales para estigmatizar a personas cuyo peso no es un riesgo para la salud ni un obstaculo para su vida social...

  17. Estrabismo após toxina botulínica para fins estéticos

    Directory of Open Access Journals (Sweden)

    Marta Halfeld Ferrari Alves Lacordia

    2011-06-01

    Full Text Available RESUMO Nas últimas décadas, a toxina botulínica tem sido aplicada para fins terapêuticos em inúmeras afecções. A toxina do tipo A foi aprovada primeiramente em 1989 para o uso em estrabismo, blefaroespasmo e espasmo hemifacial de pacientes maiores que 12 anos de idade. A observação de que pacientes tratados de blefaroespasmo com toxina botulínica apresentavam um efeito adicional de diminuição das rugas de expressão inspirou estudos sobre a aplicação cosmética da toxina. Recentemente, a toxina botulínica do tipo A foi aprovada para fins estéticos. Este trabalho relata um caso de ocorrência de estrabismo após aplicação de toxina botulínica na face para fins estéticos.

  18. Dispositivos estéticos y formas sensibles de la emancipación

    Directory of Open Access Journals (Sweden)

    María Luciana Cadahia

    2016-08-01

    Full Text Available Se explora la noción de dispositivo desde una perspectiva estético-política. Se inquieren los motivos para distanciarnos de las lecturas de Agamben, Esposito y el Colectivo tiqqun,se examina la interpretación de Deleuze al respecto, en una dimensión poco conocida, y se amplía esta perspectiva hacia una concepción estética del dispositivo, atendiendo para ello a Martín-Barbero. Finalmente, se considera el vínculo problemático entre el dispositivo y la positividad estética, para acercarnos a Schiller, quien da las pautas para disolver el vínculo problemático.

  19. Perniola, Mario: La estética contemporánea y El arte expandido.

    Directory of Open Access Journals (Sweden)

    Óscar Ortega Ruiz

    2016-01-01

    Full Text Available Recientemente, han llegado a las librerías dos nuevas publicaciones de una de las grandes personalidades del pensamiento filosófico italiano, el profesor Mario Perniola, catedrático de Estética de la Universidad Tor Vergata de Roma. Este veterano intelectual de origen piamontés, nacido en 1941, ha ddedicado la mayor parte de su carrera a la reflexión acerca de los problemas y retos surgidos en el seno de la disciplina estética de los últimos decenios, tales como la evolución de las vanguardias, el situacionismo –movimiento en el que estuvo directamente involucrado–, los estudios culturales, el postmodernismo, el posthumanismo, etc.

  20. Los programas de estímulos fiscales en México, 2001-2005

    OpenAIRE

    Fujii, Dmitri; Huffman, Curtis

    2008-01-01

    El presente artículo analiza el impacto de los estímulos fiscales como instrumento de política en la industria mexicana durante los últimos años. El trabajo parte de la identificación de las principales líneas de política económica en México en términos de desarrollo tecnológico y se enfoca a los programas de estímulos fiscales como instrumentos de dicha política. Se revisa a detalle la aplicación de los recursos de los programas de estímulos fiscales en cuanto a la empresa objetivo que se ha...