WorldWideScience

Sample records for hulka tnu edule

  1. Kaks Eesti projekti valiti parimate LIFE Nature projektide hulka

    Index Scriptorium Estoniae

    2010-01-01

    Euroopa Komisjon valis 2009. aastal lõppenud 23 parima LIFE Nature projekti hulka projektid "Harivesiliku kaitse korraldamine Läänemere-äärsetes riikides" ning "Must-toonekure ja konnakotkaste kaitse korraldamine Eestis"

  2. Eestlaste IT-firma valiti saja innovaatilisema hulka / Ilmar Kahro

    Index Scriptorium Estoniae

    Kahro, Ilmar

    2011-01-01

    Tehnoloogiaajakiri Red Herring järjestas maailma kõige innovaatilisemad ettevõtted, esimese saja hulka jõudis Märt Saarepera ja Ahto Buldase asutatud GuardTime. Firma arendatava tehnoloogia abil on võimalik kindlaks teha, millal fail on tegelikult loodud

  3. [The chayote, Sechium edule Swartz (Cucurbitaceae)].

    Science.gov (United States)

    Flores, E M

    1989-06-01

    Sechium edule (chayote) is a cucurbitaceus species. A fast transition from domestic crop to exportation product, made evident the lack of adequate information about the plant and the cultivation techniques. This work summarizes, reinterprets or describes comprehensively several aspects related to the taxonomy, origin, morphology, physiology, ecology and culture of the species.

  4. Mäeorg Stuudio film pääses paremate hulka / Margus Haav

    Index Scriptorium Estoniae

    Haav, Margus, 1969-

    2007-01-01

    Noorte filmihuviliste asutatud Mäeorg Stuudio film "Armastus on külmem kui surm" ehk "Liebe ist kälter als der Tod" pääses 37 parema hulka, mida saab näha kinos Sõprus ja 9. detsembril Eesti Televisioonis

  5. Conservación in vitro de chayote (Sechium edule)

    OpenAIRE

    Alvarenga-Venutolo, Silvana; Abdelnour-Esquivel, Ana; Villalobos-Aránbula, Víctor

    2007-01-01

    Conservación in vitro de chayote (Sechium edule). La técnica de conservación in vitro a mediano plazo fue examinada en chayote. Para ello se determinó la supervivencia de los brotes después de la adición de altas concentraciones de sacarosa (0, 30, 50, 60, 70 y 80 g/l) y ácido acetil salicílico (10-9, 10-6 y 10-3 M) al medio de cultivo, de disminuciones en la temperatura de crecimiento (16, 18, 20, 22 y 25ºC) y combinaciones de estos factores, en Costa Rica, en 1997. Se e...

  6. Low molecular weight squash trypsin inhibitors from Sechium edule seeds.

    Science.gov (United States)

    Laure, Hélen J; Faça, Vítor M; Izumi, Clarice; Padovan, Júlio C; Greene, Lewis J

    2006-02-01

    Nine chromatographic components containing trypsin inhibitor activity were isolated from Sechium edule seeds by acetone fractionation, gel filtration, affinity chromatography and RP-HPLC in an overall yield of 46% of activity and 0.05% of protein. The components obtained with highest yield of total activity and highest specific activity were sequenced by Edman degradation and their molecular masses determined by mass spectrometry. The inhibitors contained 31, 32 and 27 residues per molecule and their sequences were: SETI-IIa, EDRKCPKILMRCKRDSDCLAKCTCQESGYCG; SETI-IIb, EEDRKCPKILMRCKRDSDCLAKCTCQESGYCG and SETI-V, CPRILMKCKLDTDCFPTCTCRPSGFCG. SETI-IIa and SETI-IIb, which differed by an amino-terminal E in the IIb form, were not separable under the conditions employed. The sequences are consistent with consensus sequences obtained from 37 other inhibitors: CPriI1meCk_DSDCla_C_C_G_CG, where capital letters are invariant amino acid residues and lower case letters are the most preserved in this position. SETI-II and SETI-V form complexes with trypsin with a 1:1 stoichiometry and have dissociation constants of 5.4x10(-11)M and 1.1x10(-9)M, respectively.

  7. Conservación in vitro de chayote (Sechium edule

    Directory of Open Access Journals (Sweden)

    Silvana Alvarenga-Venutolo

    2007-01-01

    Full Text Available Conservación in vitro de chayote (Sechium edule. La técnica de conservación in vitro a mediano plazo fue examinada en chayote. Para ello se determinó la supervivencia de los brotes después de la adición de altas concentraciones de sacarosa (0, 30, 50, 60, 70 y 80 g/l y ácido acetil salicílico (10-9, 10-6 y 10-3 M al medio de cultivo, de disminuciones en la temperatura de crecimiento (16, 18, 20, 22 y 25ºC y combinaciones de estos factores, en Costa Rica, en 1997. Se encontró que los brotes mantuvieron altos porcentajes de viabilidad después de ser conservados durante seis meses en los tratamientos evaluados. Debido a la apariencia más vigorosa y a la coloración más verde que presentaron las plántulas, se consideró que el mejor tratamiento fue la adición de 60 g/l de sacarosa al medio de cultivo combinado con la incubación a 16ºC.

  8. Factors involved in the (near) anoxic survival time of Cerastoderma edule: associated bacteria vs. endogenous fuel

    NARCIS (Netherlands)

    Babarro, J.M.F.; De Zwaan, A.

    2001-01-01

    The effect of several antibiotics, molybdate and hydrogen sulfide was tested on anoxic tolerance of the cockle Cerastoderma edule, as well as utilisation of glycogen. The aim was to evaluate the role of fuel depletion and growth of bacteria as a cause of mortality. The exponential increase of

  9. Properties of cast films made of chayote (Sechium edule Sw.) tuber starch reinforced with cellulose nanocrystals

    Science.gov (United States)

    In this study, cellulose (C) and cellulose nanocrystals (CN) were blended with chayote tuber (Sechium edule Sw.) starch (CS) in formulations cast into films. The films were conditioned at different storage temperatures and relative humidity (RH), and analyzed by mechanical tests, X-ray diffraction, ...

  10. Effect of feeding chayote (Sechium edule) meal on growth performance and nutrient utilization in indigenous pig (Zovawk) of Mizoram

    OpenAIRE

    Lalthansanga, James; Samanta, A. K.

    2015-01-01

    Aim: This study was planned to investigate the effect of feeding different levels of chayote (Sechium edule) meal by replacing standard concentrate mixture (CM) on the growth parameters such as feed intake, body weight gain, average daily gain (ADG) and feed conversion ratio (FCR), and nutrient utilization in indigenous pig of Mizoram. Materials and Methods: Twenty-four growing indigenous pigs (Zovawk) were used to study the effect of feeding chayote (Sechium edule) meal (fruits and leaves...

  11. Erodibility of a mixed mudflat dominated by microphytobenthos and Cerastoderma edule, East Frisian Wadden Sea, Germany

    DEFF Research Database (Denmark)

    Andersen, Thorbjørn Joest; Lanuru, Mahatma; van Bernem, Carlo

    2010-01-01

    Sediment erodibility and a range of physical and biological parameters were measured at an intertidal site in the German Wadden Sea area in June, September and November 2002 and February and April 2003 in order to examine the influence of macrozoobenthos and microphytobenthos on sediment erodibil......Sediment erodibility and a range of physical and biological parameters were measured at an intertidal site in the German Wadden Sea area in June, September and November 2002 and February and April 2003 in order to examine the influence of macrozoobenthos and microphytobenthos on sediment...... erodibility and the temporal variation. The study site was a mixed mudflat situated in the mesotidal Baltrum-Langeoog tidal basin at the East Frisian barrier coast. The mud content at the site was about 35% and the filter-feeding cockle Cerastoderma edule was the dominating macrozoobenthic species (by biomass...... of C. edule will therefore probably increase the content of fine-grained sediments at the surface compared to an abiotic situation. Increasing the amount of fine-grained material in mixed sediments has previously been shown to reduce the erodibility of the sediments and C. edule will therefore...

  12. Effects of metal contamination on the gene expression profile of two benthic species: Cerastoderma edule and Ruditapes philippinarum

    KAUST Repository

    Rodrigues, Raquel

    2017-08-14

    This study aimed to identify new biomarkers for metal exposure in two bivalve species. Suppressive Subtractive Hybridization (SSH) was employed to evaluate the transcriptomic response of Cerastoderma edule and Ruditapes philippinarum to metal pollution. Protein synthesis and catalytic activity were the most affected metabolic processes in C. edule and R. philippinarum, respectively. Also, different genes responded to the effect of contamination in each species. The different response observed in both species reinforces the importance of including more than one bioindicator species in risk assessment studies. These results provide the basis for new studies, which are necessary for further validation of the use of the identified genes as molecular biomarkers for metal exposure.

  13. Effects of metal contamination on the gene expression profile of two benthic species: Cerastoderma edule and Ruditapes philippinarum

    KAUST Repository

    Rodrigues, Raquel; Lourenç o, Joana; Pereira, Patrí cia; Carvalho, Susana; Mendo, Sonia

    2017-01-01

    This study aimed to identify new biomarkers for metal exposure in two bivalve species. Suppressive Subtractive Hybridization (SSH) was employed to evaluate the transcriptomic response of Cerastoderma edule and Ruditapes philippinarum to metal pollution. Protein synthesis and catalytic activity were the most affected metabolic processes in C. edule and R. philippinarum, respectively. Also, different genes responded to the effect of contamination in each species. The different response observed in both species reinforces the importance of including more than one bioindicator species in risk assessment studies. These results provide the basis for new studies, which are necessary for further validation of the use of the identified genes as molecular biomarkers for metal exposure.

  14. The inhibitory effect of Mesembryanthemum edule (L.) bolus essential oil on some pathogenic fungal isolates

    Science.gov (United States)

    2014-01-01

    Background Mesembryanthemum edule is a medicinal plant which has been indicated by Xhosa traditional healers in the treatment HIV associated diseases such as tuberculosis, dysentery, diabetic mellitus, laryngitis, mouth infections, ringworm eczema and vaginal infections. The investigation of the essential oil of this plant could help to verify the rationale behind the use of the plant as a cure for these illnesses. Methods The essential oil from M. edule was analysed by GC/MS. Concentration ranging from 0.005 - 5 mg/ml of the hydro-distilled essential oil was tested against some fungal strains, using micro-dilution method. The plant minimum inhibitory activity on the fungal strains was determined. Result GC/MS analysis of the essential oil resulted in the identification of 28 compounds representing 99.99% of the total essential oil. A total amount of 10.6 and 36.61% constituents were obtained as monoterpenes and oxygenated monoterpenes. The amount of sesquiterpene hydrocarbons (3.58%) was low compared to the oxygenated sesquiterpenes with pick area of 9.28%. Total oil content of diterpenes and oxygenated diterpenes detected from the essential oil were 1.43% and 19.24%. The fatty acids and their methyl esters content present in the essential oil extract were found to be 19.25%. Antifungal activity of the essential oil extract tested against the pathogenic fungal, inhibited C. albican, C. krusei, C. rugosa, C. glabrata and C. neoformans with MICs range of 0.02-0.31 mg/ml. the activity of the essential oil was found competing with nystatin and amphotericin B used as control. Conclusion Having accounted the profile chemical constituent found in M. edule oil and its important antifungal properties, we consider that its essential oil might be useful in pharmaceutical and food industry as natural antibiotic and food preservative. PMID:24885234

  15. Propensity to metal accumulation and oxidative stress responses of two benthic species (Cerastoderma edule and Nephtys hombergii): are tolerance processes limiting their responsiveness?

    KAUST Repository

    Marques, Ana; Piló , David; Araú jo, Olinda; Pereira, Fá bio; Guilherme, Sofia; Carvalho, Susana; Santos, Maria Ana; Pacheco, Má rio; Pereira, Patrí cia

    2016-01-01

    and antioxidant system responses of two benthic organisms (Cerastoderma edule, Bivalvia; Nephtys hombergii, Polychaeta). This approach will provide clarifications about the ability of each species to signalise metal contamination. Organisms of both species were

  16. Growth and fatty acid composition of juvenile Cerastoderma edule (L.) fed live microalgae diets with different fatty acid profiles

    NARCIS (Netherlands)

    Reis Batista, dos I.C.; Kamermans, P.; Verdegem, M.C.J.; Smaal, A.C.

    2014-01-01

    The importance of dietary 20:5n-3 (EPA), 22:6n-3 (DHA) and 20:4n-6 (ARA) for growth, survival and fatty acid composition of juvenile cockles (Cerastoderma edule) was investigated. Cockles of 6.24 ± 0.04 mm and 66.14 ± 0.34 mg (live weight) were distributed into three treatments where live microalgae

  17. Effect of picung (Pangium edule plant extracts as a botanical pesticide on mortality of coffee berry borer (Hypothenemus hampei

    Directory of Open Access Journals (Sweden)

    soekadar wiryadiputra

    2014-12-01

    Full Text Available Coffee pests known as coffe berry borer (CBB, Hypothenemus hampei were main pests which decreasing the productivity of Indonesian coffee. One of pests controlling was done by insecticides. Generally, plant uses for insecticide show high security level, because the breaking molecule was easy as not dangerous compound. Pangium edule contains of flavanoide, cyanide acid and saponin had potential as an botanical insecticide. The purpose of this research was to prove the potential extract of seed and leaves of picung (Pangium edule as an botanical insecticide for CBB. This research used a complete random design. There were 8 treatments with the concentration of the extract from leaves and seed of picung, one positive control treatment (Carbaril 0,02% formulation and one negative control treatment (aquades. The treatment was repeated four times and carried out observation on every day until six days. The concentrations leaf and seed extracts were 1.0%, 2.5% and 5.0%. The result of the research show that between concentration applied the were no significant different and at observation six days after application the mortality of CBB only around 35 -40% on both extracts (ewater and methanol. The result of the research also show that there were no real differentiation between leaves and seed of picung. LT-50 values were 1.25% and 0.96%, for leaves and seed extract in water for six day observation. From this observation could be concluded that picung tree (Pangium edule is not effective in the controlling CBB in the interval concentration applied and extraction method used. Key words: Botanical pesticide, picung tree, Pangium edule, mortality, Hypothenemus hampei, water extraction, methanol extraction.

  18. Cryopreservation of chayote (Sechium edule JACQ.SW.) zygotic embryos and shoot-tips from in vitroplantlets

    OpenAIRE

    Abdelnour-Esquivel, Ana; Engelmann, Florent

    2002-01-01

    This paper presents the development of cryopreservation protocols for zygotic embryos and apices of chayote (Sechium edule Jacq. Sw.), a tropical plant species with recalcitrant seeds. Zygotic embryos of two cultivars, Ccocro negro (CN) and Claudio (Cl) could withstand cryopreservation, with survival percentages of 10 and 30 %, after desiccation to 23 and 19 % moisture content (fresh weight basis), respectively. Apices sampled on in vitro plantlets of cultivars Cl, 13 and JM we...

  19. Sechium edule (Jacq. Swartz, a New Cultivar with Antiproliferative Potential in a Human Cervical Cancer HeLa Cell Line

    Directory of Open Access Journals (Sweden)

    Sandra Salazar-Aguilar

    2017-07-01

    Full Text Available The Sechium edule Perla Negra cultivar is a recently-obtained biological material whose progenitors are S. edule var. nigrum minor and S. edule var. amarus silvestrys, the latter of which has been reported to have antiproliferative activity against the HeLa P-388 and L-929 cancer cell lines. The present study aimed to determine if the methanolic extract of the fruit of the Perla Negra cultivar had the same biological activity. The methanolic extract was phytochemically characterized by thin layer chromatography (TLC and column chromatography (CC, identifying the terpenes and flavonoids. The compounds identified via high performance liquid chromatography (HPLC were Cucurbitacins B, D, E, and I for the terpene fractions, and Rutin, Phlorizidin, Myricetin, Quercetin, Naringenin, Phloretin, Apigenin, and Galangin for the flavonoid fractions. Biological activity was evaluated with different concentrations of the methanolic extract in the HeLa cell line and normal lymphocytes. The methanolic extract inhibited the proliferation of HeLa cells (IC50 1.85 µg·mL−1, but the lymphocytes were affected by the extract (IC50 30.04 µg·mL−1. Some fractions, and the pool of all of them, showed inhibition higher than 80% at a concentration of 2.11 µg·mL−1. Therefore, the biological effect shown by the methanolic extract of the Perla Negra has some specificity in inhibiting tumor cells and not normal cells; an unusual feature among molecules investigated as potential biomedical agents.

  20. Sechium edule (Jacq.) Swartz, a New Cultivar with Antiproliferative Potential in a Human Cervical Cancer HeLa Cell Line.

    Science.gov (United States)

    Salazar-Aguilar, Sandra; Ruiz-Posadas, Lucero Del Mar; Cadena-Iñiguez, Jorge; Soto-Hernández, Marcos; Santiago-Osorio, Edelmiro; Aguiñiga-Sánchez, Itzen; Rivera-Martínez, Ana Rocío; Aguirre-Medina, Juan Francisco

    2017-07-25

    The Sechium edule Perla Negra cultivar is a recently-obtained biological material whose progenitors are S. edule var. nigrum minor and S. edule var. amarus silvestrys, the latter of which has been reported to have antiproliferative activity against the HeLa P-388 and L-929 cancer cell lines. The present study aimed to determine if the methanolic extract of the fruit of the Perla Negra cultivar had the same biological activity. The methanolic extract was phytochemically characterized by thin layer chromatography (TLC) and column chromatography (CC), identifying the terpenes and flavonoids. The compounds identified via high performance liquid chromatography (HPLC) were Cucurbitacins B, D, E, and I for the terpene fractions, and Rutin, Phlorizidin, Myricetin, Quercetin, Naringenin, Phloretin, Apigenin, and Galangin for the flavonoid fractions). Biological activity was evaluated with different concentrations of the methanolic extract in the HeLa cell line and normal lymphocytes. The methanolic extract inhibited the proliferation of HeLa cells (IC 50 1.85 µg·mL -1 ), but the lymphocytes were affected by the extract (IC 50 30.04 µg·mL -1 ). Some fractions, and the pool of all of them, showed inhibition higher than 80% at a concentration of 2.11 µg·mL -1 . Therefore, the biological effect shown by the methanolic extract of the Perla Negra has some specificity in inhibiting tumor cells and not normal cells; an unusual feature among molecules investigated as potential biomedical agents.

  1. Propensity to metal accumulation and oxidative stress responses of two benthic species (Cerastoderma edule and Nephtys hombergii): are tolerance processes limiting their responsiveness?

    KAUST Repository

    Marques, Ana

    2016-02-24

    The chronic exposure of benthic organisms to metals in sediments can lead to the development of tolerance mechanisms, thus diminishing their responsiveness. This study aims to evaluate the accumulation profiles of V, Cr, Co, Ni, As, Cd, Pb and Hg and antioxidant system responses of two benthic organisms (Cerastoderma edule, Bivalvia; Nephtys hombergii, Polychaeta). This approach will provide clarifications about the ability of each species to signalise metal contamination. Organisms of both species were collected at the Tagus estuary, in two sites with distinct contamination degrees (ALC, slightly contaminated; BAR, highly contaminated). Accordingly, C. edule accumulated higher concentrations of As, Pb and Hg at BAR compared to ALC. However, antioxidant responses of C. edule were almost unaltered at BAR and no peroxidative damage occurred, suggesting adjustment mechanisms to the presence of metals. In contrast, N. hombergii showed a minor propensity to metal accumulation, only signalising spatial differences for As and Pb and accumulating lower concentrations of metals than C. edule. The differences in metal accumulation observed between species might be due to their distinctive foraging behaviour and/or the ability of N. hombergii to minimise the metal uptake. Despite that, the accumulation of As and Pb was on the basis of the polychaete antioxidant defences inhibition at BAR, including CAT, SOD, GR and GPx. The integrated biomarker response index (IBRv2) confirmed that N. hombergii was more affected by metal exposure than C. edule. In the light of current findings, in field-based studies, the information of C. edule as a bioindicator should be complemented by that provided by another benthic species, since tolerance mechanisms to metals can hinder a correct diagnosis of sediment contamination and of the system’s health. Overall, the present study contributed to improve the lack of fundamental knowledge of two widespread and common estuarine species, providing

  2. Nutraceutic Characteristics of the Extracts and Juice of Chayote (Sechium edule (Jacq. Sw. Fruits

    Directory of Open Access Journals (Sweden)

    María de la Luz Riviello-Flores

    2018-05-01

    Full Text Available Fruits of chayote [Sechium edule (Jacq. Swartz] are a non-traditional vegetable widely consumed in Latin America, with the state of Veracruz, México being the world’s main producer, but little is known about the nutraceutical potential. This study aimed to determine the chemical compositions and antioxidant activities from the juice fruits from two commercial varieties of chayote cultivated in Mexico, as well as a proposal for the elaboration of chayote juices with stevia leaves and pineapple juice. The physicochemical properties of juice from virens levis (VL and nigrum spinosum (NS varieties were determined using standard methods. The juice of the two varieties differ significantly regarding the concentrations of total soluble solids and total sugars, but not vitamin C. The total concentration of phenolics in NS extracts was slightly higher than in VL (1005 and 856 mg 100 g−1 dry-weight, respectively, but the total flavonoid contents were similar (27 and 26 mg 100 g−1 dry-weight, respectively. Cucurbitacin D was predominant in both varieties. The radical scavenging capacities of VL and NS extracts varied slightly (IC50 = 0.45 to 0.65 mg mL−1, while the antioxidant activities were similar (~80%. The NS variety is particularly promising regarding nutraceutical application. The chayote juice combined with stevia and pineapple maintained the original nutraceutical characteristics of the fruit, but enhanced the organoleptic characteristics like density and sugar/acidity balance.

  3. Physiological responses to ocean acidification and warming synergistically reduce condition of the common cockle Cerastoderma edule.

    Science.gov (United States)

    Ong, E Z; Briffa, M; Moens, T; Van Colen, C

    2017-09-01

    The combined effect of ocean acidification and warming on the common cockle Cerastoderma edule was investigated in a fully crossed laboratory experiment. Survival of the examined adult organisms remained high and was not affected by elevated temperature (+3 °C) or lowered pH (-0.3 units). However, the morphometric condition index of the cockles incubated under high pCO 2 conditions (i.e. combined warming and acidification) was significantly reduced after six weeks of incubation. Respiration rates increased significantly under low pH, with highest rates measured under combined warm and low pH conditions. Calcification decreased significantly under low pH while clearance rates increased significantly under warm conditions and were generally lower in low pH treatments. The observed physiological responses suggest that the reduced food intake under hypercapnia is insufficient to support the higher energy requirements to compensate for the higher costs for basal maintenance and growth in future high pCO 2 waters. Copyright © 2017 Elsevier Ltd. All rights reserved.

  4. Chemical analyses and in vitro and in vivo toxicity of fruit methanol extract of Sechium edule var. nigrum spinosum.

    Science.gov (United States)

    Aguiñiga-Sánchez, Itzen; Cadena-Íñiguez, Jorge; Santiago-Osorio, Edelmiro; Gómez-García, Guadalupe; Mendoza-Núñez, Víctor Manuel; Rosado-Pérez, Juana; Ruíz-Ramos, Mirna; Cisneros-Solano, Víctor Manuel; Ledesma-Martínez, Edgar; Delgado-Bordonave, Angel de Jesus; Soto-Hernández, Ramón Marcos

    2017-12-01

    Sechium edule (Jacq.) Sw. (Cucurbitaceae) is used in ethnomedicine, but the diversity of the varietal groups of this species has not often been considered. This is important because we previously reported that different variety of species exhibit different activities across different tumor cell lines. This study investigates the chemical composition and biological activities of extracts obtained from S. edule var. nigrum spinosum. The leukemia P388 cell line and mononuclear bone marrow cells (MNCBMs) were treated with the extract at a concentration ranging from 40 to 2370 μg/mL for cytotoxicity and viability assays. CD-1 mice were treated with 8-5000 mg/kg extract and monitored every hour for the first 24 h and subsequently for seven days for signs of toxicity (LD 50 ). In addition, the chromatographic profile of the extract was determined by HPLC. The extract inhibits the proliferation of both P388 cells and MNCBMs, with IC 50 values of 927 and 1911 μg/mL, respectively, but reduced the viability and induced the apoptosis of only leukemia cells. The LD 50 was higher than 5000 mg/kg, and this concentration did not alter the blood chemistry or cell count but doubled the mitotic index in the bone marrow. The HPLC showed the presence of cucurbitacins, phloridzin, naringenin, phloretin, apigenin, and gallic, chlorogenic, vanillic, p-hydroxybenzoic, caffeic, and p-coumaric acids. Sechium edule var. nigrum spinosum contains bioactive compounds that explain the antiproliferative and nutraceutical activities, and its lack of physiological side effects constitutes an added value to a widely consumed vegetable.

  5. Micropropagación de chayote (sechium edule jacq. Sw. a partir de brotes vegetativos

    Directory of Open Access Journals (Sweden)

    Ana Abdelnour

    2002-01-01

    Full Text Available El chayote (Sechium edule es una importante fuente de divisas para los países exportadores, entre los que Costa Rica mantiene el liderazgo mundial. Entre los factores más limitantes para su producci ón se encuentra el material de siembra, tradicionalmente la semilla, que por su naturaleza no permite la obtención de una producción morfológicamente homogénea de frutos (color, forma y textura de la epidermis motivo de los altos porcentajes de rechazo en las plantas empacadoras. El establecimiento de una metodología de propagación vegetativa de la especie ayudaría a resolver los problemas de heterogeneidad. Por lo anterior, la presente investigación se dirigió a desarrollar un método de micropropagación a partir de brotes vegetativos. Se evaluó el efecto de varios desinfectantes y concentraciones de reguladores de crecimiento en las etapas de establecimiento, multiplicación y enraizamiento de dos cultivares comerciales. Se observó que una desinfección con hipoclorito de calcio al 4% permitió el mayor porcentaje de explantes establecidos asépticamente bajo condiciones in vitro (49%. También se observó que durante las etapas posteriores de la micropropagación, los requerimientos de reguladores de crecimiento fueron muy bajos (0,1 mgL-1 de BA en la etapa de brotación de yemas y de 0,1 a 0,2 mgL-1 de AIB durante el enraizamiento o no se requirieron (etapa de multiplicaci ón de microestacas.

  6. Purification and Partial Characterization of β-Glucosidase in Chayote (Sechium edule

    Directory of Open Access Journals (Sweden)

    Sergio Espíndola Mateos

    2015-10-01

    Full Text Available β-Glucosidase (EC 3.2.1.21 is a prominent member of the GH1 family of glycoside hydrolases. The properties of this β-glucosidase appear to include resistance to temperature, urea, and iodoacetamide, and it is activated by 2-ME, similar to other members. β-Glucosidase from chayote (Sechium edule was purified by ionic-interchange chromatography and molecular exclusion chromatography. Peptides detected by LC-ESI-MS/MS were compared with other β-glucosidases using the BLAST program. This enzyme is a 116 kDa protein composed of two sub-units of 58 kDa and shows homology with Cucumis sativus β-glucosidase (NCBI reference sequence XP_004154617.1, in which seven peptides were found with relative masses ranging from 874.3643 to 1587.8297. The stability of β-glucosidase depends on an initial concentration of 0.2 mg/mL of protein at pH 5.0 which decreases by 33% in a period of 30 h, and then stabilizes and is active for the next 5 days (pH 4.0 gives similar results. One hundred μg/mL β-D-glucose inhibited β-glucosidase activity by more than 50%. The enzyme had a Km of 4.88 mM with p-NPG and a Kcat of 10,000 min−1. The optimal conditions for the enzyme require a pH of 4.0 and a temperature of 50 °C.

  7. Purification and Partial Characterization of β-Glucosidase in Chayote (Sechium edule).

    Science.gov (United States)

    Mateos, Sergio Espíndola; Cervantes, Carlos Alberto Matías; Zenteno, Edgar; Slomianny, Marie-Christine; Alpuche, Juan; Hernández-Cruz, Pedro; Martínez-Cruz, Ruth; Canseco, Maria Del Socorro Pina; Pérez-Campos, Eduardo; Rubio, Manuel Sánchez; Mayoral, Laura Pérez-Campos; Martínez-Cruz, Margarito

    2015-10-23

    β-Glucosidase (EC 3.2.1.21) is a prominent member of the GH1 family of glycoside hydrolases. The properties of this β-glucosidase appear to include resistance to temperature, urea, and iodoacetamide, and it is activated by 2-ME, similar to other members. β-Glucosidase from chayote (Sechium edule) was purified by ionic-interchange chromatography and molecular exclusion chromatography. Peptides detected by LC-ESI-MS/MS were compared with other β-glucosidases using the BLAST program. This enzyme is a 116 kDa protein composed of two sub-units of 58 kDa and shows homology with Cucumis sativus β-glucosidase (NCBI reference sequence XP_004154617.1), in which seven peptides were found with relative masses ranging from 874.3643 to 1587.8297. The stability of β-glucosidase depends on an initial concentration of 0.2 mg/mL of protein at pH 5.0 which decreases by 33% in a period of 30 h, and then stabilizes and is active for the next 5 days (pH 4.0 gives similar results). One hundred μg/mL β-D-glucose inhibited β-glucosidase activity by more than 50%. The enzyme had a Km of 4.88 mM with p-NPG and a Kcat of 10,000 min(-1). The optimal conditions for the enzyme require a pH of 4.0 and a temperature of 50 °C.

  8. Seasonal changes in size selection and intake rate of Oystercatchers Haematopus ostralegus feeding on the bivalves Mytilus edulis and Cerastoderma edule

    NARCIS (Netherlands)

    Ens, B.J.; Dirksen, S; Smit, CJ; Bunskoeke, AJ

    1996-01-01

    During the course of spring, Cockles Cerastoderma edule and Mussels Mytilus edulis grow in size, while the condition, as measured by the biomass content of shells of a given size, also increases. Condition temporarily drops when the larger individuals spawn. This study investigates the effects of

  9. HONGOS CAUSANTES DE ENFERMEDADES POSTCOSECHA EN CHAYOTE (Sechium edule (Jacq. SW. Y SU CONTROL IN VITRO

    Directory of Open Access Journals (Sweden)

    Siul D. Romero-Velazquez

    2015-01-01

    Full Text Available El fruto de chayote (Sechium edule (Jaqc. Sw. es una hortaliza de exportación de importancia para México y Costa Rica. El proceso comercial exige cumplir con estándares de calidad, que implican frutos sanos y libres de defectos. Sin embargo, debido a las condiciones de alta humedad que se desarrollan en los frutos empacados en películas plásticas, se han presentado rechazos en el mercado de exportación, por la presencia de enfermedades fungosas. El objetivo de este trabajo fue identificar morfológica (microscopía óptica y electrónica de barrido y molecularmente (PCR: Polimerase Chain Reaction las especies de hongos causales de las principales enfermedades postcosecha de chayote en frutos infectados procedentes de huertas comerciales para exportación, así como probar in vitro la efectividad de diversos productos comerciales en la inhibición del crecimiento de dichos hongos. Los resultados mostraron a Didymella bryoniae como el causante de “gomosis de las cucurbitáceas” y a Fusarium oxysporum y F. solani como causales de fusariosis o ahogamiento de guías; estos patógenos dañan la parte basal y media de frutos comerciales, además de Chaetomium globosum, un asociado al proceso infeccioso de Fusarium sp., como saprófito no patógeno. La inoculación con Bacillus subtilis presentó una inhibición efectiva (0,01 mg.l-1 i.a en las pruebas in vitro contra Didymella bryoniae, Fusarium oxysporum y F. solani; el fungicida más efectivo contra los 2 primeros fue Tebuconazole-trifloxystrobin, con una DL50 de 0,0116 y 0,0106 mg.l-1 respectivamente; no así contra F. solani, cuyo mayor control fue registrado con procloraz, con DL50 de 0,0042 mg.l-1. Estos resultados contribuyen al reconocimiento de las enfermedades fungosas más importantes en chayote y su perspectiva de control durante el manejo postcosecha de frutos para exportación.

  10. Chemical composition profiling and antifungal activity of the essential oil and plant extracts of Mesembryanthemum edule (L.) bolus leaves.

    Science.gov (United States)

    Omoruyi, Beauty Etinosa; Afolayan, Anthony Jide; Bradley, Graeme

    2014-01-01

    Essential oil from Mesembryanthemum edule leaves have been used by the Eastern Cape traditional healers for the treatment of respiratory tract infections, tuberculosis, dysentery, diabetic mellitus, laryngitis and vaginal infections. The investigation of bioactive compounds in the essential oil of this plant could help to verify the efficacy of the plant in the management or treatment of these illnesses. Various concentrations of the hydro-distilled essential oil, ranging from 0.005-5 mg/ml, were tested against some fungal strains, using the micro-dilution method. Minimum inhibitory activity was compared with four other different crude extracts of hexane, acetone, ethanol and aqueous samples from the same plant. The chemical composition of the essential oil, hexane, acetone and ethanol extracts was determined using GC-MS. GC/MS analysis of the essential oil resulted in the identification of 28 compounds, representing 99.99% of the total oil. Phytoconstituents of hexane, acetone and ethanol extracts yielded a total peak chromatogram of fifty nine compounds. A total amount of 10.6% and 36.61% of the constituents were obtained as monoterpenes and oxygenated monoterpenes. Sesquiterpene hydrocarbons (3.58%) were relatively low compared to the oxygenated sesquiterpenes (9.28%), while the major concentrated diterpenes and oxygenated diterpenes were 1.43% and 19.24 %, respectively and phytol 12.41%. Total amount of fatty acids and their methyl esters content, present in the oil extract, were found to be 19.25 %. Antifungal activity of the oil extract and four solvent extracts were tested against five pathogenic fungal strains. The oil extract showed antifungal activity against Candida albican, Candida krusei, Candida rugosa, Candida glabrata and Cryptococcus neoformans with MIC ranges of 0.02 0.31 mg/ml. Hexane extract was active against the five fungal strains with MICs ranging between 0.02-1.25 mg/ml. Acetone extracts were active against C. krusei only at 0.04mg/ml. No

  11. Effect of feeding chayote (Sechium edule) meal on growth performance and nutrient utilization in indigenous pig (Zovawk) of Mizoram.

    Science.gov (United States)

    Lalthansanga, James; Samanta, A K

    2015-07-01

    This study was planned to investigate the effect of feeding different levels of chayote (Sechium edule) meal by replacing standard concentrate mixture (CM) on the growth parameters such as feed intake, body weight gain, average daily gain (ADG) and feed conversion ratio (FCR), and nutrient utilization in indigenous pig of Mizoram. Twenty-four growing indigenous pigs (Zovawk) were used to study the effect of feeding chayote (Sechium edule) meal (fruits and leaves at the ratio 4:1) on growth performance and nutrient utilization. They were allocated randomly into 4 treatment groups (G1, G2, G3, and G4). Chayote meal was used to replace standard CM (pig grower ration) at 0% (G1), 20% (G2), 30% (G3), and 40% (G4). During the feeding trial of 90 days, it was found that the dry matter (DM) intake decreased as the level of chayote meal increased. For G1, G2, G3, and G4, the ADG (kg) was 0.24±0.04, 0.23±0.03, 0.18±0.02, and 0.18±0.02, respectively, and the feed conversion efficiency was 5.42±0.44, 4.93±0.17, 5.38±0.05, and 5.74±0.53, respectively. However, there was no significant difference (p>0.05) among the different treatment groups in respect to ADG and FCR. At the end of the feeding trial, digestibility trial was conducted to study the effect of feeding chayote meal in the digestibility of the different nutrients by the experimental animals. From the digestibility trial, it was revealed that the digestibility coefficient of DM, crude protein, and crude fiber were also similar (p>0.05), although the ether extract digestibility in G1 was significantly low (pChayote meal could safely replace the standard grower ration up to 40% in the diet of growing local pigs without causing any adverse effects on growth and nutrient utilization.

  12. Effect of feeding chayote (Sechium edule meal on growth performance and nutrient utilization in indigenous pig (Zovawk of Mizoram

    Directory of Open Access Journals (Sweden)

    James Lalthansanga

    2015-07-01

    Full Text Available Aim: This study was planned to investigate the effect of feeding different levels of chayote (Sechium edule meal by replacing standard concentrate mixture (CM on the growth parameters such as feed intake, body weight gain, average daily gain (ADG and feed conversion ratio (FCR, and nutrient utilization in indigenous pig of Mizoram. Materials and Methods: Twenty-four growing indigenous pigs (Zovawk were used to study the effect of feeding chayote (Sechium edule meal (fruits and leaves at the ratio 4:1 on growth performance and nutrient utilization. They were allocated randomly into 4 treatment groups (G1, G2, G3, and G4. Chayote meal was used to replace standard CM (pig grower ration at 0% (G1, 20% (G2, 30% (G3, and 40% (G4. Results: During the feeding trial of 90 days, it was found that the dry matter (DM intake decreased as the level of chayote meal increased. For G1, G2, G3, and G4, the ADG (kg was 0.24±0.04, 0.23±0.03, 0.18±0.02, and 0.18±0.02, respectively, and the feed conversion efficiency was 5.42±0.44, 4.93±0.17, 5.38±0.05, and 5.74±0.53, respectively. However, there was no significant difference (p>0.05 among the different treatment groups in respect to ADG and FCR. At the end of the feeding trial, digestibility trial was conducted to study the effect of feeding chayote meal in the digestibility of the different nutrients by the experimental animals. From the digestibility trial, it was revealed that the digestibility coefficient of DM, crude protein, and crude fiber were also similar (p>0.05, although the ether extract digestibility in G1 was significantly low (p<0.01 as compared to G2, G3, and G4. Conclusion: Chayote meal could safely replace the standard grower ration up to 40% in the diet of growing local pigs without causing any adverse effects on growth and nutrient utilization.

  13. Study of flavonoids of Sechium edule (Jacq) Swartz (Cucurbitaceae) different edible organs by liquid chromatography photodiode array mass spectrometry.

    Science.gov (United States)

    Siciliano, Tiziana; De Tommasi, Nunziatina; Morelli, Ivano; Braca, Alessandra

    2004-10-20

    A liquid chromatography-mass spectrometry (LC-MS)-based method was developed for the characterization of flavonoids from Sechium edule (Jacq) Swartz (Cucurbitaceae) edible organs, a plant cultivated since pre-Colombian times in Mexico where the fruit is called chayote. Chayote is used for human consumption in many countries; in addition to the fruits, stems, leaves and the tuberous part of the roots are also eaten. Eight flavonoids, including three C-glycosyl and five O-glycosyl flavones, were detected, characterized by nuclear magnetic resonance spectroscopic data, and quantified in roots, leaves, stems, and fruits of the plant by LC-photodiode array-MS. The aglycone moieties are represented by apigenin and luteolin, while the sugar units are glucose, apiose, and rhamnose. The results indicated that the highest total amount of flavonoids was in the leaves (35.0 mg/10 g of dried part), followed by roots (30.5 mg/10 g), and finally by stems (19.3 mg/10 g). Copyright 2004 American Chemical Society

  14. Cryopreservation of chayote (Sechium edule JACQ. SW.) zygotic embryos and shoot-tips from in vitro plantlets.

    Science.gov (United States)

    Abdelnour-Esquivel, Ana; Engelmann, Florent

    2002-01-01

    This paper presents the development of cryopreservation protocols for zygotic embryos and apices of chayote (Sechium edule Jacq. Sw.), a tropical plant species with recalcitrant seeds. Zygotic embryos of two cultivars, Ccocro negro (CN) and Claudio (Cl) could withstand cryopreservation, with survival percentages of 10 and 30 %, after desiccation to 23 and 19 % moisture content (fresh weight basis), respectively. Apices sampled on in vitro plantlets of cultivars Cl, 13 and JM were successfully cryopreserved using a vitrification technique. Optimal conditions included the culture of mother-plants for 22 days on medium containing 0.3 M sucrose, culture of excised apices on the same medium for 1 day, loading of apices for 20 min with 2M glycerol + 0.4M glycerol, treatment with a series of diluted PVS2 solution (60 % PVS2 followed by 80 % PVS2 solution for 15 min (cultivar Cocoro Blanco [CB]) or 30 min (cultivars CN and Cl) at each concentration), rapid freezing and thawing, washing of shoot-tips with a 1.2 M sucrose solution, followed by recovery on media with progressively decreasing sucrose concentrations until the standard concentration of 0.1 M was reached. The highest survival percentages achieved ranged between 17 and 38 %, depending on the cultivar.

  15. Effects of IAA and IBA on the in vitro rooting of stem cuttings of Sechium edule (Jacq. Sw

    Directory of Open Access Journals (Sweden)

    José García García

    2015-01-01

    Full Text Available This investigation was carried out with the objective of evaluating the response of shoots of chayote [S. edule (Jacq. Sw.] to the application of indole-3-butyric acid (IBA and indole-3-acetic acid (IAA on the in vitro rooting phase. The effect of three culture media, modified from the proposed of Murashige and Skoog (MS was studied: 1- 65% MS salt base, 2- 65% MS salt base + 0.05 mg l-1 of indolebutyric acid (AIB and 3- 65% MS salt base + 3.0 mg l-1-3-indole acetic acid (IAA. The variables evaluated were: number of roots, length and number of shoots per in vitro seedling. The best result were obtained when using 65% MS salt base with 3.0 mg l-1 of IAA. Significant differences (P<0.05 among treatments containing growth regulators was obtained for the variables number of roots and length of in vitro plantlets. In the UNA-730 accession root induction was obtained in a 65% MS salt base culture medium without growth regulators; however, when IAA and IBA was added the induction was 100%. The differences identified in this work with regards to the root induction were probably the combined result of genotype and specific culture conditions. Key words: auxins, chayote, growth regulators, in vitro culture

  16. Hongos causantes de enfermedades postcosecha en chayote (Sechium edule(Jacq. SW. y su control in vitro

    Directory of Open Access Journals (Sweden)

    Siul D. Romero Velazquez

    2015-11-01

    Full Text Available El fruto de chayote (Sechium edule (Jaqc. Sw. es una hortaliza de exportación de importancia para México y Costa Rica. El proceso comercial exige cumplir con estándares de calidad, que implican frutos sanos y libres de defectos. Sin embargo, debido a las condiciones de alta humedad que se desarrollan en los frutos empacados en películas plásticas, se han presentado rechazos en el mercado de exportación, por la presencia de enfermedades fungosas. El objetivo de este trabajo fue identificar morfológica (microscopía óptica y electrónica de barrido y molecularmente (PCR: Polimerase Chain Reaction las especies de hongos causales de las principales enfermedades postcosecha de chayote en frutos infectados procedentes de huertas comerciales para exportación, así como probar in vitro la efectividad de diversos productos comerciales en la inhibición del crecimiento de dichos hongos. Los resultados mostraron a Didymella bryoniae como el causante de “gomosis de las cucurbitáceas” y a Fusarium oxysporum y F. solani como causales de fusariosis o ahogamiento de guías; estos patógenos dañan la parte basal y media de frutos comerciales, además de Chaetomium globosum, un asociado al proceso infeccioso de Fusariumsp., como saprófito no patógeno. La inoculación con Bacillus subtilis presentó una inhibición efectiva (0,01 mg.l-1 i.a en las pruebas in vitro contra Didymella bryoniae, Fusarium oxysporum y F. solani; el fungicida más efectivo contra los 2 primeros fue Tebuconazole-trifloxystrobin, con una DL50 de 0,0116 y 0,0106 mg.l-1 respectivamente; no así contra F. solani, cuyo mayor control fue registrado con procloraz, con DL50 de 0,0042 mg.l-1. Estos resultados contribuyen al reconocimiento de las enfermedades fungosas más importantes en chayote y su perspectiva de control durante el manejo postcosecha de frutos para exportación.

  17. Criterios locales para selección de semillas de chayote (Sechium edule Jacq. Sw. en zonas rurales de Chiapas, México

    Directory of Open Access Journals (Sweden)

    Francisco Guevara Hernández

    2015-04-01

    Full Text Available En el estudio se identificaron y analizaron los criterios socio-antropológicos fundamentados en etnoagronomía y etnobotánica de los productores para seleccionar semillas de chayote (Sechium edule Jacq. Sw. en zonas rurales de los municipios Villa Corzo y Villaflores (Chiapas, México. En entrevistas semi-estructuradas realizadas a 60 productores se describieron los criterios locales para seleccionar las semillas de esta hortaliza, considerando características de color, tamaño y presencia de espinas en los frutos, así como la obtención de variedades y recomendaciones para la siembra. Sin considerar la procedencia de los productores, el cultivo del chayote se realiza independientemente del tamaño, el color o la presencia de espinas en los frutos. Más de 60% de los productores entrevistados compra las semillas y prefieren aquellas variedades que posean frutos con espinas debido a su sabor agradable. Se confirmó la validez de los estudios socio-antropológicos en sistemas agrícolas tradicionales en la zona, particularmente en etnobotánica, para entender las relaciones sociales y productivas a nivel local, y para definir sistemas productivos sostenibles a partir de los criterios propios de las familias campesinas, lo que permite documentar, analizar, validar y entender multi-criterios relacionados con la producción familiar de chayote y su posible mejoramiento.

  18. VALORACIÓN DE LA CIDRA PAPA (Sechium edule COMO ALTERNATIVA DE ALIMENTACIÓN Y RECUPERACIÓN DE VÍNCULOS CON EL CAMPO VALORAÇÃO DA Sechium edule COMO ALTERNATIVA DE ALIMENTAÇÃO E RECUPERAÇÃO DOS VINCULOS COM O CAMPO VALUATION OF Sechium edule AS AN ALIMENTARY ALTERNATIVE AND RECUPERATION OF BONDS TO THE COUNTRY

    Directory of Open Access Journals (Sweden)

    CONSUELO MONTES R

    2011-12-01

    Full Text Available El objetivo de la investigación, fue valorar la cidra papa (Sechium edule como alternativa de alimentación para familias en desplazamiento que viven en asentamientos urbano marginales de Popayán, con el fin de contribuir a la recuperación del conocimiento tradicional asociado al uso y manejo, identificar ecotipos, identificar el significado sociocultural como alternativa para mantener los vínculos con el campo, evaluar productividad y posibilidades de manejo en espacios urbano marginales. El proceso se desarrolló mediante 'investigación participativa', donde los actores participaron en dinámicas recreativas, talleres de sensibilización y socialización, giras de intercambio de saberes, de semillas y generación de conocimientos, lo que permitió obtener información, y la apropiación del proceso. Se definieron como áreas de estudio 3 comunas de Popayán, se seleccionaron 4 asentamientos, se aplicaron 116 encuestas, se realizaron visitas mensuales por asentamiento, entablando diálogos informales con las familias participantes. Se conocieron las posibilidades de manejo de la planta, se incentivó la siembra de la misma aplicando el concepto de agricultura urbana donde se asoció la planta con otras hortalizas. Se pudo constatar que plantas como la cidra se adaptan a las condiciones que ofrecen los asentamientos y que son fuente alternativa para la alimentación de estas poblaciones, se fomentó el consumo de especies sub utilizadas, se hizo intercambio de saberes y se generaron espacios para motivar la conservación de ecotipos y especies de plantas como la cidra, que pueden resistir a las condiciones de marginalidad.0 objetivo da pesquisa, foi avaliar a cidra papa (Sechium edule como alternativa de alimentação para familias deslocadas que moram nos perímetros da cidade de Popayán, com o proposito de contribuir na recuperação do conhecimento tradicional relacionado com a utilização e manejo, identificação de ecotipos e o

  19. Transfer across the human gut of environmental plutonium, americium, cobalt, caesium and technetium: studies with cockles (Cerastoderma edule) from the Irish Sea

    International Nuclear Information System (INIS)

    Hunt, G.J.

    1998-01-01

    Our previous studies have indicated lower values of the gut transfer factor ('f L values') for plutonium and americium in winkles (Littorina littorea) than adopted by ICRP. The present study was undertaken primarily to investigate whether this observation extends to other species. Samples of cockles (Cerastoderma edule) from Ravenglass, Cumbria were eaten by volunteers who provided 24 samples of urine and faeces. Urine samples indicated f L values for cockles which were higher than for winkles; for plutonium these ranged overall up to 7x10 -4 with an arithmetic mean in the range (2-3)x10 -4 , and for americium up to 2.6x10 -4 with an arithmetic mean of 1.2x10 -4 . Limited data based on volunteers eating cockles from the Solway suggest that f L values for americium may be greater at distance from Sellafield. The measured values compare with 5x10 -4 used by the ICRP for environmental forms of both elements, which would appear to provide adequate protection when calculating doses from Cumbrian cockles. Data for other nuclides were obtained by analysing faecal samples from the volunteers who ate the Ravenglass cockles. Cobalt-60 showed an f L value in the region of 0.2, twice the value currently used by ICRP. For 137 Cs, variabilities were indicated in the range 0.08 to 0.43, within the ICRP value of f L =1.0. Technetium-99 gave f L values up to about 0.6, in reasonable conformity with the ICRP value of 0.5. (author)

  20. Eestlased kuuluvad Euroopa Liidus pessimistide hulka / Henrik Ilves

    Index Scriptorium Estoniae

    Ilves, Henrik

    2008-01-01

    Euroopa Komisjoni poolt avaldatud majandususalduse indeksi langus näitab inimeste kindlustunde vähenemist kogu Euroopas, eestlaste usk elujärje paranemisse on üks pessimistlikumaid. Diagramm: Euroopa majandususalduse indeks (ESI). Vt. samas: Kogu Euroopas mustad toonid

  1. Hewlett-Packard tulemas rahva hulka / Tõnis Oja

    Index Scriptorium Estoniae

    Oja, Tõnis, 1957-

    2008-01-01

    Maailma suurima arvutitootja Hewlett-Packard tegevjuht Mark Hurd on otsustanud printerite läbimüügi suurendamiseks reorganiseerida printerite divisjoni kolmeks üksuseks, senisest enam hakkab ettevõte tähelepanu pöörama eraisikutest tarbijatele. Graafik: Aktsia hind on kolme aastaga kahekordistunud. Tabel: Kasum kasvanud võimsalt: Lisad: Mis on mis; Tasub teada

  2. Minute co-variations of Sr/Ca ratios and microstructures in the aragonitic shell of Cerastoderma edule (Bivalvia) - Are geochemical variations at the ultra-scale masking potential environmental signals?

    Science.gov (United States)

    Füllenbach, Christoph S.; Schöne, Bernd R.; Shirai, Kotaro; Takahata, Naoto; Ishida, Akizumi; Sano, Yuji

    2017-05-01

    It remains a challenging task to reconstruct water temperatures from Sr/Ca ratios of bivalve shells. Although in many aragonitic species, Sr/Ca is negatively correlated to temperature - which is expected based on abiogenic precipitation experiments, the incorporation of Sr into the shell of bivalves is strongly controlled by physiological processes and occurs away from the predicted thermodynamic equilibrium. Strontium-to-calcium ratios of aragonitic shells remain far below that of the ambient water. Moreover, Sr concentrations vary considerably among shell portions consisting of different microstructures and/or organic content. Values observed at annual growth lines and within the intervening shell portions (= annual growth increments) deviate much stronger from each other than expected from a change in temperature or Sr/Cawater. As demonstrated here by ultra-high-resolution chemical analysis (EPMA, NanoSIMS) of a Cerastoderma edule shell, Sr concentrations are also heterogeneously distributed at approximately micrometer resolution. For example, in the outer portion of the outer shell layer, Sr/Ca ratios were statistically significantly (t-, u-tests) higher at circatidal growth lines (irregular simple prismatic structure; arithmetic mean ± 1 standard deviation = 2.86 ± 0.38 mmol/mol; n = 53) than within circatidal increments (nondenticular prismatic structure; 2.42 ± 0.25 mmol/mol; n = 51). S/Cashell, a representative of the concentration of organics, showed the opposite pattern, i.e., significantly higher values in circatidal increments (2.37 ± 0.29 mmol/mol; n = 51) than at circatidal growth lines (2.13 ± 0.47 mmol/mol; n = 53). Overall highest values of Sr/Cashell (3.47 ± 0.65 mmol/mol; n = 3) and S/Cashell (3.98 ± 0.65 mmol/mol; n = 3), however, were typically associated with annual growth lines and larger biomineral units. The intimate link between Sr/Cashell, S/Cashell and shell architecture may indicate that microstructures or the processes

  3. TNU-9 Zeolite: Aluminum Distribution and Extra-Framework Sites of Divalent Cations

    Czech Academy of Sciences Publication Activity Database

    Karcz, R.; Dědeček, Jiří; Supronowicz, B.; Thomas, Haunani M.; Klein, Petr; Tabor, Edyta; Sazama, Petr; Pashková, Veronika; Sklenák, Štěpán

    2017-01-01

    Roč. 23, JUL 2017 (2017), s. 8857-8870 ISSN 1521-3765 R&D Projects: GA ČR(CZ) GA15-14007S; GA MŠk(CZ) LM2015073 Grant - others:Ga MŠk(CZ) LM2015070 Institutional support: RVO:61388955 Keywords : Aluminum * Cobalt * Density functional calculations * Structure elucidation * Zeolites Subject RIV: CF - Physical ; Theoretical Chemistry OBOR OECD: Physical chemistry

  4. Chayote (Sechium edule) causing hypokalemia in pregnancy.

    Science.gov (United States)

    Jensen, L P; Lai, A R

    1986-11-01

    A case of severe hypokalemia in pregnancy is presented. Chayote, a subtropical vegetable with potent diuretic action, is implicated, as the potassium level returned to normal, without recurrence of hypokalemia, once the ingestion was stopped.

  5. Andrus Ansip seadis Tallinna-Tartu maantee riigi prioriteetide hulka / Tuuli Koch

    Index Scriptorium Estoniae

    Koch, Tuuli, 1978-

    2006-01-01

    Peaminister Andrus Ansip sõnas Riigikogu infotunnis, et Tallinn-Tartu maantee on olnud riigi jaoks prioriteet ning aastani 2013 Euroopa Liidu struktuurifondidest Eestile laekuvast 52 miljardist kroonist on riigil kavas Tartu maanteesse investeerida 4,5 miljardit krooni

  6. EFEKTIFITAS PEMBERIAN JUS LABU SIAM (Sechium edule TERHADAP PROFIL LIPID TIKUS (Rattus novergicus MODEL HIPERLIPIDEMIA

    Directory of Open Access Journals (Sweden)

    Yanita Listianasari

    2017-10-01

    Full Text Available Hyperlipidemia is a lipid profile (TC, TG, HDL, LDL metabolism disorder becoming the leading cause of cardiovascular disease. Flavonoid, phenol, vitamin C contained in squash have strong cardioprotective effect but its optimal dose has not been known yet. The objective of this research was to analyze the effectiveness of squash juice administration with varying doses on the lipid profile of hyperlipidemia model-rat with High Fat Diet induced. This research was done in laboratory experimental research with pre and posttest control group design.The experimental animals were consisted of 36 rats and divided into negative control, positive control, treatment I (drug, treatment II, III, IV (squash juice dose 1 ml, 2 ml, 4 ml/ 100 g BW rat/day with treatment for 38 days. The rat’s blood was taken before and after treatment for lipid profile. TC, HDL, LDL levels were measured using spectrophotometer Microlab 300 with CHOD-PAP. TG level was measured using Microlab 300 with GPO-PAP. Considering the statistic analysis, squash juice at doses 1 ml, 2 ml and 4 ml / 100 g BW rat/day, could reduce significantly (p < 0.05 TC, TG, LDL levels of rats. HDL level of rat could increase significantly (p < 0.05 with squash juice at dose 1 ml/100 g BW rat/day. There was no significant difference between the three doses of squash juice, so that squash juice at dose 1 ml/100 g BW rat/day is the best dose to reduce the lipid profile of hyperlipidemia model-rat. Hiperlipidemia merupakan gangguan metabolisme profil lipid (kolesterol total, trigliserida, HDL, LDL yang menjadi penyebab utama timbulnya penyakit kardiovaskular. Flavonoid, fenol, vitamin C yang terkandung dalam buah labu siam mempunyai efek kardioprotektif yang kuat akan tetapi belum diketahui dosis optimal. Tujuan penelitian ini adalah untuk menganalisis efektifitas pemberian jus labu siam dengan variasi dosis terhadap profil lipid tikus model hiperlipidemia. Metode yang digunakan adalah eksperimental laboratorik dengan rancangan pre and posttest control group design. Sebanyak 36 tikus putih Strain Wistar jantan dibagi menjadi 6 kelompok dengan 6 ekor tiap kelompok, yaitu kontrol negatif, kontrol positif (diinduksi High Fat Diet, perlakuan 1 (diinduksi High Fat Diet dan obat, perlakuan 2, 3, 4 (diinduksi High Fat Diet dan jus labu siam dosis 1 ml, 2 ml, 4 ml/100 g BB tikus/hari dengan perlakuan selama 38 hari. Pengambilan darah tikus dilakukan sebelum dan sesudah perlakuan untuk analisis profil lipid. Kadar kolesterol total, HDL, LDL diukur menggunakan spektrofotometer Microlab 300 dengan metode CHOD-PAP. Kadar trigliserida diukur menggunakan spektrofotometer Microlab 300 dengan metode GPO-PAP. Data dianalisis menggunakan uji Paired T-Test dan menunjukkan jus labu siam ketiga dosis dapat menurunkan secara bermakna (p<0,05 kadar kolesterol total, trigliserida dan LDL tikus. Kadar HDL tikus dapat naik secara bermakna (p<0,05 dengan jus labu siam dosis 1 ml/100 g BB tikus/hari. Pemberian jus labu siam dosis 1 ml/100 g BB tikus/hari merupakan dosis yang paling efektif dalam menurunkan kadar kolesterol total, trigliserida dan LDL serta menaikkan kadar HDL.

  7. Assessment of a fruit extract ( Sechium edule ) on the labeling of ...

    African Journals Online (AJOL)

    The blood was centrifuged and plasma (P) and RBC were isolated, also precipitated with trichloroacetic acid (TCA, 5%) and soluble (S) and insoluble (I) fractions (F) of plasma and cells (C) were determined. The radioactivity (ATI%) was rated in RBC, IF-P and IF-C. The results have showed that extract was able to reduce ...

  8. Koos ühisele edule! = Together towards success / Jüri Järviste

    Index Scriptorium Estoniae

    Järviste, Jüri

    2004-01-01

    Autori hinnangul vaid ettevõtjate endi aktiivne suhtumine ettevõtlust puudutavatesse küsimustesse ja probleemidesse tagab nende kiirema lahendamise. EVEA kui väike- ja keskmise suurusega ettevõtteid ühendav organisatsioon aitab ühenduse liikmetel olla teadlikum oma õigustest ja võimalustest

  9. Polysaccharide composition of raw and cooked chayote (Sechium edule Sw.) fruits and tuberous roots.

    Science.gov (United States)

    Shiga, Tânia M; Peroni-Okita, Fernanda Helena Gonçalves; Carpita, Nicholas C; Lajolo, Franco Maria; Cordenunsi, Beatriz Rosana

    2015-10-05

    Chayote is a multipurpose table vegetable widely consumed in Latin America countries. Chayote fruits, leaves and tuberous roots contain complex carbohydrates as dietary fiber and starch, vitamins and minerals. The complex polysaccharides (cell walls and starch) were analyzed in the black and green varieties of chayote fruits as well as in green chayote tuberous root before and after a controlled cooking process to assess changes in their composition and structure. The monosaccharide composition and linkage analysis indicated pectins homogalacturonans and rhamnogalacturonan I backbones constitute about 15-20% of the wall mass, but are heavily substituted with, up to 60% neutral arabinans, galactans, arabinogalactans. The remainder is composed of xyloglucan, glucomannans and galactoglucomannans. Chayote cell-wall polysaccharides are highly stable under normal cooking conditions, as confirmed by the optical microscopy of wall structure. We found also that tuberous roots constitute a valuable additional source of quality starch and fiber. Published by Elsevier Ltd.

  10. Pengaruh Lama Penyimpanan Biji Picung (Pangium edule Reinw. Beku terhadap Aktivitasnya dalam Mengawetkan Ikan Nila (Oreochromis niloticus

    Directory of Open Access Journals (Sweden)

    Novalia Rachmawati

    2011-12-01

    Full Text Available Penelitian dilakukan untuk mengetahui pengaruh lama penyimpanan biji picung beku terhadap kemampuannya dalam mengawetkan ikan. Biji picung cacah disimpan dalam kondisi beku (-18° selama 4 bulan. Setiap bulan biji picung beku diambil dan diaplikasikan pada ikan nila segar dengan perbandingan 3% (b/b dengan dan tanpa penambahan garam 2% (b/b. Ikan nila disimpan pada suhu ruang dan dilakukan pengamatan terhadap parameter mikrobiologi (Angka Lempeng Total dan antibakteri, kimiawi (TVB dan kadar air serta organoleptik. Uji aktivitas antibakteri dari biji picung beku dilakukan terhadap bakteri Eschericia colidan Staphylococcus aureus. Hasil penelitian menunjukkan bahwa berdas arkan parameter mikrobiologi, kimia dan organoleptik, biji picung beku yang disimpan hingga 1 bulan mampu mempertahankan kesegaran ikan hingga penyimpanan hari ke-2. Sedangkan dari hasil uji aktivitas antibakteri, biji pic ung beku dapat menghambat pertumbuhan bakteri E. colidan S. aureusdengan kategori aktivitas sangat kuat.

  11. Genetic characterization of chayote [Sechium edule (Jacq.) Swartz.] landraces of North Eastern Hills of India and conservation measure.

    Science.gov (United States)

    Verma, Veerendra Kumar; Pandey, Avinash; Jha, Anjani Kumar; Ngachan, S V

    2017-10-01

    Chayote or chow-chow is an underutilized cucurbit vegetable crop, widely cultivated by farmers in the backyards and Jhum lands for its tender leaves, fruits and tuberous root. In order to initiate crop improvement program in this crop, the present study was undertaken to assess the genetic variations in the 74 chow-chow landraces collected from the North Eastern Hill region of India. Wide variations for fruit colors, fruit length (6.5-21.5 cm), fruit width (4.2-10.7 cm), fruit weight (60-560 g), vitamin-C (2.6-13.8 mg/100 g), reducing sugar (0.18-2.77%), total sugar (1.09-2.94%) and phenol content (0.17-3.85 mg/100 g FW) were recorded among the landraces. All the landraces were also characterized using random amplified polymorphic DNA (RAPD) and inter simple sequence repeat (ISSR) markers. In RAPD analyses, out of 28 primers a total of 198 reproducible amplicons were formed at an average of 7.01 per primer and an overall polymorphism of 88.38%. Eight fragments were specific to landraces with light green fruits. Four fragments were observed to be specific to RCSC-22 (dark green fruits) and another four specific to a RCSC-30 (pale yellow fruits). Out of 30 ISSR, only 5 primers generated a total of 32 reproducible amplicons with an average of 6.4 per primer and overall polymorphism of 62.5%. The pair wise similarity coefficient values ranged from 0.55 to 0.96. The grouping of landraces in cluster analysis was found to be independent of their respective geographic locations. The cuttings of suckers and shoot top (2 months old) treated with indole-3-butyric acid (200 mg l -1 ) provide an alternative for the conservation of the diverse genetic materials to the researchers.

  12. Molecular evidence for the occurrence of tomato leaf curl New Delhi virus on chayote (Sechium edule) in southern India.

    Science.gov (United States)

    Nagendran, K; Mohankumar, S; Mohammed Faisal, P; Bagewadi, B; Karthikeyan, G

    2017-12-01

    During 2012-2014, mosaic disease on chayote in the farmers field of Kodaikanal region (high altitude zone) of Tamil Nadu was observed. The disease was characterized with severe mosaic, cupping and enation on leaves with reduced fruit size. Disease was found to causes an yield loss of more than 60% with the maximum disease incidence of 100% for the past 5 years consecutively. Preliminary serological and molecular screening indicated the association of begomovirus with the disease. Complete nucleotide sequence and phylogenetic analysis of DNA A revealed the identity of the virus as tomato leaf curl New Delhi virus (ToLCNDV). In recombination analysis study, the major parent was identified as ToLCNDV from Pakistan infecting tomato. Thus the present finding confirms expansion of new geographical region and host for ToLCNDV causing mosaic disease on chayote from Tamil Nadu. To our knowledge this is the first confirmed report for the occurrence of ToLCNDV on chayote in southern India.

  13. Traditional knowledge on integrated pest and weed management in chayote (Sechium edule (Jacq. Sw. crops from localities of Chiapas, Mexico

    Directory of Open Access Journals (Sweden)

    Luis Alfredo Rodríguez-Larramendi

    2017-10-01

    Full Text Available This research was carried out in Villaflores and Villa Corzo, located in Chiapas State of Mexico. Specifically, throughout an ethno-agronomical approach, semi-structured interviews were designed and applied to the chayote producers who were selected by random routes. The results indicate the 57.89% of chayote producers in both municipalities, have allowed to control weeds in their crops, and being a higher proportion represented by Villaflores. Given these concerns, they prefer to control weeds throughout traditional methods, basically using mattocks with frequencies of 15 to 30 days after sowing or two to four times per cycle of crop production. Both pest and diseases are mainly controlled throughout chemical methods application. A preference to perform control among periods of higher rainfall or drought is not distinguished. A considerable percentage, which reaches 44% of the interviewed population among both municipalities, report they do not need to control pests and crop diseases.

  14. Fruit extract from a Sechium edule hybrid induce apoptosis in leukaemic cell lines but not in normal cells.

    Science.gov (United States)

    Aguiñiga-Sánchez, Itzen; Soto-Hernández, Marcos; Cadena-Iñiguez, Jorge; Ruíz-Posadas, Lucero del Mar; Cadena-Zamudio, Jorge David; González-Ugarte, Ana Karen; Steider, Benny Weiss; Santiago-Osorio, Edelmiro

    2015-01-01

    The antiproliferative potential of a crude extract from the chayote hybrid H-837-07-GISeM® and its potential for apoptosis induction were assessed in leukaemic cell lines and normal mouse bone marrow mononuclear cells (BM-MNCs). The extract strongly inhibited the proliferation of the P388, J774, and WEHI-3 cell lines (with an IC50 below 1.3 μg·mL(-1)), reduced cell viability, and induced apoptotic body production, phosphatidylserine translocation, and DNA fragmentation. However, the extract had no effect on BM-MNCs. We postulate that these properties make the extract a good candidate for an anti-tumour agent for clinical use.

  15. Dva nové dokumenty o návštěvě prezidenta Edvarda Beneše ve Spojených státech amerických a Kanadě v květnu a červnu 1943

    Czech Academy of Sciences Publication Activity Database

    Dejmek, Jindřich

    2008-01-01

    Roč. 16, - (2008), s. 291-320 ISSN 1210-6860 Institutional research plan: CEZ:AV0Z80150510 Keywords : History of Czechoslovak Foreign Policy * History of Diplomacy * History of International Relations Subject RIV: AB - History

  16. Hra na flétnu v předškolním věku a význam hudby v dalším životě dítěte

    OpenAIRE

    PAVLIŠOVÁ, Irena

    2013-01-01

    This bachelor thesis called "Playing a Flute at Preschool Age and the Importance of Music for Further Life of a Child" aims to find out what is the importance of music for further life of children who learnt to play a flute at preschool age. The theoretical part introduces terms such as a recorder, it also focuses on the therapeutic playing a flute and its history and it also deals with the idea of professor Václav Žilka as reflected in his book called "Veselé pískání - zdravé dýchání". Other...

  17. Digenean trematode species in the cockle Cerastodema edule: identification key and distribution along the north-eastern Atlantic shoreline

    DEFF Research Database (Denmark)

    Montaudouin, Xavier De; Thieltges, David W.; Gam, Mériame

    2009-01-01

    host. The remaining eleven species have cockles as their second intermediate host. Water birds and fish are the definitive hosts to twelve and four species, respectively. Cockles are infected with digeneans along the latitudinal gradient from southern Morocco to the western region of the Barents Sea...

  18. Feeding current characteristics of three morphologically different bivalve suspension feeders, Crassostrea gigas, Mytilus edulis and Cerastoderma edule, in relation to food competition

    NARCIS (Netherlands)

    Troost, K.; Stamhuis, E.J.; van Duren, L.A; Wolff, W.J.

    Introduced Pacific oysters (Crassostrea gigas) have shown rapid expansion in the Oosterschelde estuary, while stocks of native bivalves declined slightly or remained stable. This indicates that they might have an advantage over native bivalve filter feeders. Hence, at the scale of individual

  19. Pengaruh Penambahan Karagenan Terhadap Karakteristik Fisik, Kimia Dan Sensoris Fruit and Vegetable Leather Berbasis Albedo Semangka (Citrullus Vulgaris Schard.) Dan Labu Siam (Sechium Edule)

    OpenAIRE

    Haryu, Adinda Safira Puspa; Parnanto, Nur Her Riyadi; Nursiwi, Asri

    2016-01-01

    Penelitian ini bertujuan untuk mengetahui pengaruh penambahan karagenan terhadap karakteristik fisik, kimia dan sensorisdari fruit and vegetable leather berbasis albedo semangka dan labu siam. Pengolahan fruit leather yang ada di Indonesia saat inihanya berbahan dasar buah buahan, perlu adanya penganekaragaman olahan dari fruit leather ini dengan menambahkan sayuranuntuk meningkatkan kandungan serat dan gizi, yang selanjutnya dikenal sebagai fruit and vegetable leather. Penelitian inimengguna...

  20. Feeding current characteristics of three morphologically different bivalve suspension feeders, Crassostrea gigas Mytilus edulis and Cerastoderma edule , in relation to food competition

    NARCIS (Netherlands)

    Troost, K.; Stamhuis, E.J.; Duren, L.A.; Wolff, W.

    2009-01-01

    Introduced Pacific oysters (Crassostrea gigas) have shown rapid expansion in the Oosterschelde estuary, while stocks of native bivalves declined slightly or remained stable. This indicates that they might have an advantage over native bivalve filter feeders. Hence, at the scale of individual

  1. Cultivo de meristemas, termo y quimioterapia en chayote (Sechium edule Jacq. Sw.) para la erradicación del virus del mosaico del chayote (ChMV)

    OpenAIRE

    Abdelnour-Esquivel, Ana; Bermudez, L.C.; Rivera, C; Alvarenga-Venutolo, Silvana

    2006-01-01

    Recientemente se identificó en Costa Rica una nueva enfermedad viral en chayote, denominada "virus del mosaico del chayote" (ChMV, Chayote mosaic virus). Además de disminuir los rendimientos, esta enfermedad causa reducciones y malformación de los frutos, lo que eventualmente podría incidir en el incremento de frutos rechazados para la exportación. La enfermedad puede ser transmitida durante la propagación vegetativa y por la semilla. El cultivo de meristemas se utiliza en muchas ...

  2. DINÁMICA DE LA FORMACIÓN DE LA RAÍZ TUBERIZADA DEL CHAYOTE (Sechium edule Sw. EN SU PRIMER AÑO DE CULTIVO

    Directory of Open Access Journals (Sweden)

    A. Cruz-León

    2005-01-01

    Full Text Available El chayote es una planta perenne de crecimiento anual y su posesión de órganos de reserva le permite el rebrote e iniciar las primeras fases de crecimiento en un nuevo ciclo. Estas cualidades naturales, añadidas al consumo y aprovechamiento de todas sus partes vegetativas, lo hacen un cultivo muy apreciado por indígenas y campesinos, cuyos frutos también son vendidos en el mercado. El conocimiento empírico de sus productores le adjudica un gran valor nutricional a la raíz tuberizada de la planta, la que ha sido poco estudiada. Con el objetivo de contribuir al conocimiento de las características y proceso de formación de esa raíz tuberizada, se estableció una plantación que fue estudiada durante un año; así se determinó la dinámica de la formación de la raíz tuberizada para ese mismo lapso. Se describieron las características del chayotextle, que es el nombre popular que se da a esa raíz. Los resultados contribuyeron a establecer bases para un mayor conocimiento de su formación, sus características y las relaciones que se establecieron con el fotoperiodo en el comportamiento de los órganos externos de la planta. El estudio permitió aportar referencias de longitud, grosor, color, forma, textura y distribución en el suelo, así como la época de aparición, aumentó en volumen y la etapa de descomposición de la raíz engrosada de la especie en estudio. También se anotaron contribuciones sobre el conocimiento empírico que poseen los campesinos que aprovechan la raíz tuberizada de la planta de chayote.

  3. Multitalent Google astub Facebookile-Elionile kandadele / Ann-Marii Nergi

    Index Scriptorium Estoniae

    Nergi, Ann-Marii

    2011-01-01

    Google avalikustas oma katse vallutada ka sotsiaalvõrgustike keskkond, mida praegu valitsevad Facebook ja Twitter. Ekspertide hinnangul oskab Google kasumit teenida ja tema kasutajate hulka prognoositakse kasvavat

  4. Uudised : "Sõprus" Europa Cinema nominent

    Index Scriptorium Estoniae

    2005-01-01

    Euroopa ja Vahemere regiooni kinopidajaid ühendav organisatsioon tunnustab igal aastal kinosid kolmes kategoorias. Sõpruse kino on valitud viie nominendi hulka noorsooürituste korraldamise kategoorias

  5. Niisked ruumid : tehnilisi nõuandeid ja tegutsemisjuhiseid väikeehitajale / Tiit Masso

    Index Scriptorium Estoniae

    Masso, Tiit, 1935-

    1998-01-01

    Niiskete ruumide hulka kuuluvad pesuruumid, saunad, basseiniruumid. Keskkond saunas, pesuruumis. Planeering. Seinad. Lagi. Põrandad. Sauna tuulutus. Suitsusaun. Lava. Basseiniruum. Pesupesemisruum. Lisatud joonised.

  6. Ministr obrazovanija : Russkomu obrazovaniju nitshto ne ugrazhajet / Tõnis Lukas ; interv. Jana Litvinova

    Index Scriptorium Estoniae

    Lukas, Tõnis, 1962-

    2007-01-01

    Haridus- ja teadusminister Tõnis Lukas vastab küsimustele, mis puudutavad hariduse finantseerimist, õpetajate kvalifikatsiooni, vene koolide reforme ja kohustusliku kirjanduse hulka mittesobivaid raamatuid

  7. Kozhevniki nabirajut võssotu / Jevgeni Ashihmin

    Index Scriptorium Estoniae

    Ashihmin, Jevgeni

    2004-01-01

    Narva nahavabrik AS Nakro kuulub Baltimaade juhtivate nahatoodete tootjate hulka - ekspordist Euroopa Liidu liikmesriikidesse, Venemaale, Valgevenesse. Välisriikide diplomaadid tutvusid nahavabriku ja tehnopargiga

  8. "Kontsert porgandipirukale" kandideerib Cartoon d'Or'i auhinnale

    Index Scriptorium Estoniae

    2004-01-01

    Heiki Ernitsa ja Janno Põldma "Kontsert porgandipirukale" valiti Santiago de Compostelas (Hispaania) üleantava animafilmi auhinna Cartoon d'Or viie nominendi hulka. Loetletud ka konkureerivad filmid

  9. Print Best jahib trükiteenuste turul liidrirolli / Toivo Tänavsuu

    Index Scriptorium Estoniae

    Tänavsuu, Toivo

    2004-01-01

    Konkursil Ettevõtluse auhind 2004 piirkonna edendaja nominentide hulka kuuluv Print Best on tõusnud viimase aastaga mahtudelt viie suurema poogentrükikoja hulka Eestis. Firma prioriteediks on Venemaa, mõeldud on müügiüksuse loomisele Moskvas. Lisa: Print Best Trükikoda

  10. Catalytic transformation of methyl benzenes over zeolite catalysts

    KAUST Repository

    Al-Khattaf, S.; Akhtar, M. N.; Odedairo, T.; Aitani, A.; Tukur, N. M.; Kubů, M.; Musilová -Pavlačková , Z.; Čejka, J.

    2011-01-01

    experiments were carried out in the temperature range of 300-400 °C to understand the transformation of these alkyl benzenes over large pore (mordenite and SSZ-33) in contrast to medium-pore (ZSM-5 and TNU-9) zeolite-based catalysts. The effect of reaction

  11. On the Use of a Cumulative Distribution as a Utility Function in Educational or Employment Selection.

    Science.gov (United States)

    1981-02-01

    economic applications. LI In the previous section, we discussed some properties of the TNU function. A GBU with a> 1 and b> 1 has similar characteristics...76/443 1 Dir :ctor, Office of Manpower Utilization Maxwell AFB, AL 36112 HQ, Marine Corps ( MPU ) BCB, Bldg. 2009 1 Dr. Earl A. Alluisi Quantico, VA

  12. Tähelepanu, lätlased tulevad...! / Peeter Järvelaid

    Index Scriptorium Estoniae

    Järvelaid, Peeter, 1957-

    1991-01-01

    Arvustus: Tartu Ülikooli õigusteaduskonna lõpetanute ja õigusteadust õpetanute nimekiri 1919-1989. Tartu, 1989 ; Latvijas Universitātes Tiesību Zinātnu Nodalas absolventu saraksts 1920-1940. Hamburg, 1990. - Sisaldab andmeid ka prof. Dietrich André Loeberi kohta

  13. Heavy-traffic analysis for the GI/G/1 queue with heavy-tailed distributions

    NARCIS (Netherlands)

    O.J. Boxma (Onno); J.W. Cohen

    1997-01-01

    textabstractWe consider a $GI/G/1$ queue in which the service time distribution and/or the interarrival time distribution has a heavy tail, i.e., a tail behaviour like $t^{-nu$ with $1

  14. Kriisi võimalikud tagajärjed / Urmas Kiil

    Index Scriptorium Estoniae

    Kiil, Urmas

    2009-01-01

    Briti majandusajakirja The Economist tütarkompanii Economist Intelligence Unit hindas poliitilise ebastabiilsuse tekke võimalusi maailma riikides. Eesti kuulub analüütikute arvates kõrge riskiga riikide hulka

  15. Aeroflot tahab ka ise Moskvast Tallinna lennata / Raimo Poom

    Index Scriptorium Estoniae

    Poom, Raimo

    2011-01-01

    Aeroflot kavatseb suurendada oma rahvusvaheliste reiside hulka umbes veerandi võrra, uute sihtkohtade seas on infoportaali ATO.ru andmeil ka Tallinn. Tallinna lennujaama juhatuse liikme Erik Sakkovi kommentaare

  16. Tiit Land : Anname panuse Alzheimeri tõve võimalikuks raviks / Kristel Toom

    Index Scriptorium Estoniae

    Toom, Kristel

    2008-01-01

    Matemaatika ja loodusteaduste instituudis töötab uurimisrühm, kes tegeleb organismis toimuva raua ainevahetuse ning selle häirete tagajärjel ilmnevate haiguslike protsessidega, mille hulka kuulub ka Alzheimeri tõbi

  17. Sakslastele kuuluv meditsiinitehas värbab uusi töötajaid / Andres Reimer

    Index Scriptorium Estoniae

    Reimer, Andres

    2007-01-01

    Saksa perekonnale kuuluv rahvusvahelise optiliste sondide ehk endoskoopide tootja Karl Stroz Video Endoscopy Tallinna ettevõte areneb jõudsalt ja kavatseb suurendada töötajate hulka sel aastal kolmandiku võrra

  18. TÜ jätkab tõusu maailma juhtivate teadusülikoolide edetabelites

    Index Scriptorium Estoniae

    2011-01-01

    Eluteaduste valdkonnas (life sciences: bioloogia, meditsiin, psühholoogia) on TÜ enam kui 15 tuhande ülikooli seas 301.-350. kohal. Sellel aastal jõuti esmakordselt 1% mõjukamate institutsioonide hulka ka geoteadustes

  19. Norralased kahtlevad Veerpalu Lahti MMi kuldmedali õigsuses / Andrus Nilk

    Index Scriptorium Estoniae

    Nilk, Andrus, 1962-

    2002-01-01

    Norra meedia andmetel kuulus Andrus Veerpalu 2001. aastal Lahti maailmameistrivõistlustel uuritud kaheteistkümne medaliomaniku hulka, kelle verepilt erines tugevasti tavapärasest. Lisa: Aftenposteni shokinimekiri

  20. Terves kehas terve vaim - a sound mind in a sound body / Ene Kelder

    Index Scriptorium Estoniae

    Kelder, Ene

    2012-01-01

    Pühajärve Haridusseltsi täiskasvanutele suunatud projektist, mille eesmärgiks oli suurendada täiskasvanud õppijate hulka piirkonnas ning praktiseerida aktiivset eluhoiakut ja tervislikke eluviise

  1. Arthur von Oettingen ja tema orthtonophonium oma aja kontekstis / Karl Traugott Goldbach ; tõlkinud Anu Sõõro ; toimetanud Mart Humal

    Index Scriptorium Estoniae

    Goldbach, Karl Traugott, 1974-

    2009-01-01

    Arthur von Oettingen kuulus nende arvukate 19. sajandi lõpu õpetlaste hulka, kes otsisid muusikateooriale eksperimentaalset tuge. Oluliseks instrumendiks olid siin puhta häälestusega harmooniumid.

  2. Muru & Pere rahvusvahelisele tippkonkursile

    Index Scriptorium Estoniae

    1999-01-01

    Rahvusvaheline Intellektuaalomandi Organisatsioon (World Intellectual Property Organization) mis korraldab oma Genfis asuva peamaja laiendamiseks rahvusvahelise arhitektuurikonkursi, valis 6.-8. IX arhitektuuribüroo Muru & Pere OÜ 28 finalisti hulka. Konkursiprojekt peab valmima 31. jaanuariks 2000.

  3. Kristian Taska tahab vändata lastefilmi / Neeme Korv

    Index Scriptorium Estoniae

    Korv, Neeme, 1974-

    2003-01-01

    European Film Promotion (EFP) valis K. Taska 20 lootustandva produtsendi hulka, keda Cannes'i festivalil tutvustatakse. Taska plaanib lastefilmi jõuluks ja suvel algavad thrilleri "Lilled Evale" võtted

  4. Park asendas Manhattanil logistika / Rivo Sarapik

    Index Scriptorium Estoniae

    Sarapik, Rivo, 1981-

    2010-01-01

    New Yorgis Manhattani edelaosas rajati vanale raudteele, kümne meetri kõrgusele tänava kohale High Line Park. Arhitektid: Diller Scotidio + Renfro. New York Times valis pargi 2009. aasta arhitektuurialaste triumfide hulka New York Citys

  5. Karja kirikuaia vanimad hauaplaadid varju all / Mari Loit

    Index Scriptorium Estoniae

    Loit, Mari

    2007-01-01

    2006. a. valmis Muinsuskaitseameti tellimusel OÜ Rändmeister poolt projekteeritud ning rajatud varikatus Eesti vanimate hauaplaatide hulka kuuluvale kolmele trapetsiaalsele hauakivile Karja kirikuaias. 1920-ndatel uuris neid hauakive ja joonistas üles rootsi kunstiajaloolane Tor Helge Kjellin

  6. Miljardär asub võitlema kliimasoojenemise vastu / Heiki Suurkask

    Index Scriptorium Estoniae

    Suurkask, Heiki, 1972-

    2006-01-01

    Lennukompanii Virgin Atlantic omanik Briti ärimees Richard Branson üritab saavutada kokkulepet teiste Briti lennufirmadega, et vähendada õhku paisatavate süsinikuühendite hulka 150 miljoni tonni võrra aastas

  7. Uku ja Eha Masing - õiglased rahvaste hulgas / Hele Israel

    Index Scriptorium Estoniae

    Israel, Hele

    2009-01-01

    Holokausti keskuses Yad Vashem on juute aidanud inimestele pühendatud mälestustahvlid. Inimesi, kes holokausti käigus aitasid juute, nimetatakse õiglased rahvaste hulgas, kelle hulka kuuluvad ka Uku ja Eha Masing

  8. Rolexi tantsuauhinna nominent näitab oma lavastust

    Index Scriptorium Estoniae

    2005-01-01

    R. Valme tantsulavastust "Mesta" saab taas näha 26. nov. Kanuti Gildi saalis. R. Valme valiti hiljuti 25 noore koreograafist nominendi hulka prestiizhikas projektis Rolex Mentor & Protégé Arts Initiative

  9. Walter van der Cruijsen / Walter van der Cruijsen ; interv. Tilman Baumgärtel

    Index Scriptorium Estoniae

    Cruijsen, Walter van der

    2006-01-01

    1997. a. Berliinis tehtud intervjuu hollandi maali, võrgu- ja installatsioonikunstniku Walter van der Cruijseniga (sünd. 1958), kes kuulub Euroopa ühe edukama 1990-ndatel loodud võrguprojekti De Digitale Stad Amsterdam loojate hulka

  10. Bolshoi vopross : Dolzhnõ li mõ bojatsja kontrolja Kremlja nad energetitsheskim snabzhenijem Jevropõ?

    Index Scriptorium Estoniae

    2006-01-01

    Venemaa valitsuse poolt kontrollitav Gazprom kuulub maailma suurimate maagaasi tootjate hulka ning rahuldab 20 protsenti maailma nõudlusest, kontserni tähtsusest Lääneriikide ja Venemaa jaoks. Gazpromi huvist Suurbritannia firma Centrica vastu

  11. Paint-ball Moskvas / Eerik-Niiles Kross

    Index Scriptorium Estoniae

    Kross, Eerik-Niiles, 1967-

    2002-01-01

    Rünnakutest Eesti saatkonna vastu Moskvas. Autori sõnul on ametliku Moskva ebaametlike diplomaatiliste meetodite hulka ammustest aegadest kuulunud saatkondade vastaste nn. pehmete rünnete kasutamine

  12. "Porgandipirukas" ei võitnud Cartoon d'Ori

    Index Scriptorium Estoniae

    2004-01-01

    Heiki Ernitsa ja Janno Põldma "Kontsert porgandipirukale" valiti Santiago de Compostelas (Hispaania) üleantava animafilmi auhinna Cartoon d'Or viie nominendi hulka. Auhinna sai siiski Virgil Widrichi lühifilm "Kiire film" ("Fast Film") : Austria - Luksemburg 2003

  13. Maailma ühe parima loodusfoto tegi eestlane

    Index Scriptorium Estoniae

    2011-01-01

    Eesti fotograaf Sven Začek on jõudnud loodusfotode võistlusel "Veolia Environnement Wildlife Photographer of the Year" kategoorias "Loovalt loodusest" esiletõstetud fotode autorite hulka. Võistlust korraldavad BBC Wildlife Magazine ja Briti loodusmuuseum

  14. Eurovisiooni vaheklipp murrab teed animailmas / Neeme Korv

    Index Scriptorium Estoniae

    Korv, Neeme, 1974-

    2003-01-01

    Mulluse Eurovisiooni lauluvõistluse Tallinna kontserdi üks vaheklippidest "Saabastega kass", mille režissöörid on René Vilbre ja Meelis Arulepp, valiti maineka Annecy animafilmifestivali nominentide hulka

  15. Kalvitis targets banks' dirty money / Aaron Eglitis

    Index Scriptorium Estoniae

    Eglitis, Aaron

    2005-01-01

    Läti pangad on maailmas tuntud rahapesu juhtude rohkuse poolest, seal on pestud maailma suuruselt neljandat USA dollarite hulka. Märtsis 2004 liitis USA Välisministeerium Läti oma rahapesu riikide tähelepanulisti.

  16. Riigikogu laiendab eripensioni saavate ametiisikute ringi / Kai Kalamees

    Index Scriptorium Estoniae

    Kalamees, Kai

    2007-01-01

    Tolliseaduse muutmise eelnõust, millega loetakse alates 1. jaanuarist 2008 eripensioni saajate hulka ka tolliametnikud, kes teenisid 1990-1994 majandus- või riigipiiril ja kellel on 31. detsembriks täitunud teenistusstaazhi 20 aastat

  17. Soome ekspert soovitab Eestil riigiametnike armeed vähendada

    Index Scriptorium Estoniae

    2010-01-01

    Soome rahandusministeeriumi riigihalduse asekantsler Juhani Turunen ja OECD valitsussektori ja territoriaalse arengu ekspert Edwin Lau soovitavad Eestil eeskuju võtta Soomest ja vähendada riigiametnike hulka, samuti arendada koostööd keskvalitsuse ja omavalitsuste vahel

  18. Mida su lõunasöök sinu kohta räägib / Daniel Stone

    Index Scriptorium Estoniae

    Stone, Daniel

    2016-01-01

    Toidu kaudu on võimalik uurida ühiskonnast kõrvale heidetud inimeste etnilist identiteeti, milliseid toitumisharjumusi tuleb teiste hulka sobitumiseks muuta. National Geographicu uurija Elizabeth Unger uuris, mis juhtub toiduga kahe kultuuri põrkumisel

  19. Baltic leaders who returned from West to East

    Index Scriptorium Estoniae

    2006-01-01

    Artiklis tutvustatakse kolme Balti riigi presidentide sarnast minevikku eksiilis ning nenditakse, et varasem demokraatlikus riigis elamise kogemus on kindlasti kaasa aidanud Eesti, Läti ja Leedu majanduslikule ning välispoliitilisele edule

  20. Выборы как предвестник перемен / Айн Тоотс

    Index Scriptorium Estoniae

    Тоотс, Айн, 1944-

    2009-01-01

    Kohalike omavalitsuste volikogude valimiste tulemustest. Endise Tallinna linnapea Hardo Aasmäe sõnul võib Keskerakonna võit kohalikel valimistel sillutada teed Edgar Savisaare edule 2011. a. presidendivalimistel

  1. Tutorial on Using LISP Object-Oriented Programming for Blackboards: Solving the Radar Tracking Problem

    Science.gov (United States)

    1989-08-01

    1977. Pp. 1-229. 25. V. Lesser and R. Fennell. "Parallelism in Aritificial Intelligence Problem Solving: A Case Study of Hearsay II," IEEE Transactions...artificial intelligence architecture used to solve the radar tracking problem. The research described was performed at Purdue University during long...TION 1 COSA TI CODES 18 SUBJECT TERMS in ,,tnu; . ’ .’ , .., ,’ a-, ,’£ ,i-, ,4’o4,, nun br) ,LD I GROUP SUB.GROu P Artificial intelligence Object

  2. Catalytic transformation of methyl benzenes over zeolite catalysts

    KAUST Repository

    Al-Khattaf, S.

    2011-02-01

    Catalytic transformation of three methyl benzenes (toluene, m-xylene, and 1,2,4-trimethyl benzene) has been investigated over ZSM-5, TNU-9, mordenite and SSZ-33 catalysts in a novel riser simulator at different operating conditions. Catalytic experiments were carried out in the temperature range of 300-400 °C to understand the transformation of these alkyl benzenes over large pore (mordenite and SSZ-33) in contrast to medium-pore (ZSM-5 and TNU-9) zeolite-based catalysts. The effect of reaction conditions on the isomerization to disproportionation product ratio, distribution of trimethylbenzene (TMB) isomers, and p-xylene/o-xylene ratios are reported. The sequence of reactivity of the three alkyl benzenes depends upon the pore structure of zeolites. The zeolite structure controls primarily the diffusion of reactants and products while the acidity of these zeolites is of a secondary importance. In the case of medium pore zeolites, the order of conversion was m-xylene > 1,2,4-TMB > toluene. Over large pore zeolites the order of reactivity was 1,2,4-TMB > m-xylene > toluene for SSZ-33 catalyst, and m-xylene ∼ 1,2,4-TMB > toluene over mordenite. Significant effect of pore size between ZSM-5 and TNU-9 was observed; although TNU-9 is also 3D 10-ring channel system, its slightly larger pores compared with ZSM-5 provide sufficient reaction space to behave like large-pore zeolites in transformation of aromatic hydrocarbons. We have also carried out kinetic studies for these reactions and activation energies for all three reactants over all zeolite catalysts under study have been calculated. © 2011 Elsevier B.V.

  3. Ethylene formation by dehydration of ethanol over medium pore zeolites

    Science.gov (United States)

    Gołąbek, Kinga; Tarach, Karolina A.; Filek, Urszula; Góra-Marek, Kinga

    2018-03-01

    In this work, the role of pore arrangement of 10-ring zeolites ZSM-5, TNU-9 and IM-5 on their catalytic properties in ethanol transformation were investigated. Among all the studied catalysts, the zeolite IM-5, characterized by limited 3-dimensionality, presented the highest conversion of ethanol and the highest yields of diethyl ether (DEE) and ethylene. The least active and selective to ethylene and C3 + products was zeolite TNU-9 with the largest cavities formed on the intersection of 10-ring channels. The catalysts varied, however, in lifetime, and their deactivation followed the order: IM-5 > TNU-9 > ZSM-5. The processes taking place in the microporous zeolite environment were tracked by IR spectroscopy and analysed by the 2D correlation analysis (2D COS) allowing for an insight into the nature of chemisorbed adducts and transition products of the reaction. The cage dimension was found as a decisive factor influencing the tendency for coke deposition, herein identified as polymethylated benzenes, mainly 1,2,4-trimethyl-benzene.

  4. Re?bus disainivõistlus ehk noored innovaatorid bussirevolutsiooni otsinguil

    Index Scriptorium Estoniae

    2005-01-01

    2005. a. algul agentuuri APCI (Agence pour la Promotion de la Creation Industrielle) poolt korraldatud disainivõistlusest Re?bus. Eestist valiti 30 finalisti hulka büroo ZiZi & YoYo töö. Edukamad võistlustööd olid juuni algul väljas rahvusvahelise ühistranspordi assotsiatsiooni (UITP) 56. kongressil Roomas

  5. Aga miks mitte panustada teraviljale? / Tarvo Vaarmets

    Index Scriptorium Estoniae

    Vaarmets, Tarvo

    2007-01-01

    Üha populaarsust koguvate ETFide ehk börsil kaubeldavate fondide hulka on lisandunud ka viimaste variatsioonid ETCd ehk börsil kaubeldavad toorained, nende perspektiivikust tõstab tarbimise kasv maailmas. Tabel: Millistel börsidel tehakse tehinguid ETF-idega

  6. Pankrotivara moodustamine : [bakalaureusetöö] / Margus Lentsius ; Tartu Ülikool, õigusteaduskond ; juhendaja: Paul Varul

    Index Scriptorium Estoniae

    Lentsius, Margus, 1980-

    2003-01-01

    Pankrotivara mõiste ja moodustamise viisid, tagasivõitmise mõiste ja üldiseloomustus ning võlgniku lähikondsed, tagasivõitmise alused, muul viisil pankrotivara hulka lisanduv vara, vara välistamine pankrotivarast

  7. Erik Dahlbergi Narva bastionide projektist ja selle võimalikest eeskujudest / Ragnar Nurk

    Index Scriptorium Estoniae

    Nurk, Ragnar

    2015-01-01

    Narva kuulus Karl XI ja Dahlbergi poolt välja valitud väikese arvu kõige olulisemat kindluslinnade hulka, mille kaitseehitisi tuli tugevdada esimese järjekorras. Narva kindlustuste omapärast. Seoses Põhjasõja algusega jäi Narva kindluse ehitamine pooleli

  8. Mass customization and system development: case findings from the packaging industry / Andrus Kotri, Brent McKenzie

    Index Scriptorium Estoniae

    Kotri, Andrus

    2010-01-01

    Masstootmise kohandamise süsteemi loomisest keskmise suurusega Eesti tootmisettevõtte näitel. Masstootmise kohandamine on süsteem, mis kasutab paindlikke protsesse, organisatsiooni struktuure ja infotehnoloogiat tootmaks suurt hulka tooteid ja teenuseid, mis vastaksid klientide erinevatele vajadustele. Skeemid, tabel

  9. Savinõude vormimismass : Keraamika uurimise võimalikkusest III / Aivar Kriiska

    Index Scriptorium Estoniae

    Kriiska, Aivar

    2008-01-01

    Savinõude vormimise massi moodustavad savi ja sellesse segatav lisand. Keraamika uurimise üldisematest lähtekohtadest ja terminitest, savidest, lisanditest. Eestis on esiajaloolisel ja ajaloolisel ajal keraamikat valmistatud kohalikest kergesti kaevandatavatest savidest ja savimoreenidest, mille hulka on segatud teokarbipudru, taimeosakesi, kivipudru, liiva ja ̧amotti.

  10. Võimalus osta Leonardo joonistus / Maria-Kristiina Soomre

    Index Scriptorium Estoniae

    Soomre, Maria-Kristiina, 1978-

    2001-01-01

    10. VII tuleb Londonis Christies'i oksjonil müügile Leonardo da Vinci etüüd ratsanikust, mis kuulub kunstniku poolelijäänud "Tarkade kummardamise" kompositsiooni ettevalmistavate etüüdide hulka. Müügihinnaks arvatakse kujunevat 3,5 miljonit naela.

  11. Bangladeshi biennaalil tunnustati Ulast

    Index Scriptorium Estoniae

    2006-01-01

    Aasia kunstibiennaalil jõudis kaheksa äramärgitud töö hulka Maria-Kristiina Ulase joonistus "Ükssarv meeliskleb Musta Madonna saladuste üle". Eestit esindavad veel Silvi Liiva ja Peeter Allik. Grand Prix sai Hiroshi Fuji Jaapanist

  12. Eestis tegutseb üks Euroopa parimaid tööandjaid / Agne Narusk

    Index Scriptorium Estoniae

    Narusk, Agne, 1971-

    2005-01-01

    Kiirtransporditeenust pakkuv TNT Express Worldwide Eesti AS võitis mullu Euroopa parima tööandja tiitli. Tänavu jõudis ettevõte Euroopa kvaliteediauhinna konkursil kolme parema hulka väikeste ja keskmiste ettevõtete kategoorias. Lisa: Mahukas raport. Eri tasemed

  13. Kümme kõige sobimatumat jõulukingitust / Kaivo Kopli

    Index Scriptorium Estoniae

    Kopli, Kaivo

    2004-01-01

    Šveitsis asuv Maailma Looduse Fond (WWF) esitas üleskutse hoiduda beluugakaaviari, krokodilkinahksete esemete ja korallidest ehete ostmisest. Need kolm kuuluvad kümne asja hulka, mille kommertskasutamine ähvardab looma- ja taimeliike välja suretada

  14. Tiit Land: Anname panuse Alzheimeri tõve võimalikuks raviks / Kristel Toom

    Index Scriptorium Estoniae

    Toom, Kristel

    2008-01-01

    Tallinna Ülikooli Matemaatika ja Loodusteaduste Instituudis töötab uurimisrühm, kelle huvi on seotud organismis toimuva raua ainevahetuse ning selle häirete tagajärjel ilmnevate haiguslike protsessidega, mille hulka kuulub ka Alzheimeri tõbi. Teadusprojekte juhivad Tiit Land ja Sandra Zetterström Fernaeus

  15. ETV ekraanigraafika on Euroopa parimate seas / René Vilbre

    Index Scriptorium Estoniae

    Vilbre, René, 1970-

    2011-01-01

    Euroopa avalik-õiguslikle telejaamade konkurentsis valiti ETV ekraanigraafika viie parima hulka. Finaali pääses ETV kahes kategoorias - "Best design package" ja "Best use of audio". Intervjuu vaheklippide autori René Vilbrega. Võttemeeskonda kuulusid veel toimetaja Anu Välba, operaatorid Kristjan-Jaak Nuudi ja Ergo Treier

  16. "Armastuse retsepti" tippkokk Zeta Jones ei oska muna keeta / Triin Tael

    Index Scriptorium Estoniae

    Tael, Triin

    2007-01-01

    Scott Hicksi romantiline komöödiafilm "Armastuse retsept" ("No Reservations"), mille peaosas Walesist pärit näitlejanna Catherine Zeta Jones. Näitlejanna muljeid oma rolliks ettevalmistustest, mille hulka käis ka praktika pärisrestoranis

  17. When disruption was taboo / Tiit Hennoste

    Index Scriptorium Estoniae

    Hennoste, Tiit, 1953-

    2010-01-01

    Väliseesti kultuurist, mil määral oli väliseesti kultuur 1930. aastate eesti kultuuri jätk ja mil määral katkestus. Väliseesti kunsti ja kirjanduse uurimisest, tasemest, pagulaste rollist eesti professionaalse kultuuri arengus, pagulaskunsti ja -kirjanduse kuulumisest eesti kultuuri hulka

  18. Efektiivne, aga mitte väga innovatiivne / Villu Zirnask

    Index Scriptorium Estoniae

    Zirnask, Villu, 1966-

    2006-01-01

    World Economic Forumi (WEF) hinnangul kuulub Eesti nende üheksa riigi hulka, mis on teel efektiivsusel põhinevast arengustaadiumist innovatsioonil põhinevasse staadiumi. Eesti kohast WEF-i konkurentsivõime edetabelis. Lisad: Eesti innovatsiooninäitajad võrreldes Euroopa Liidu keskmise tasemega; Innovatsioon: Eesti 2014. aasta eesmärgid. Tabel

  19. Estonia's Big Boys' Club / Justin Petrone

    Index Scriptorium Estoniae

    Petrone, Justin, 1979-

    2007-01-01

    Eesti üliõpilasseltside ajaloost, liikmetest ning mõjust Eesti ühiskonnale ja poliitikale. Lähemalt Eesti Üliõpilaste Seltsist (EÜS), selle tekkest, taastamisest Gorbatšovi reformide aastail, liikmeskonnast, suhetest teiste korporatsioonidega. EÜSi liikmete hulka kuulub ka president Toomas Hendrik Ilves. Ajakirjanumbri esikaanel T.H. Ilvese foto

  20. Kurvitz kodutute kaitsjana / Sigrid Saarep

    Index Scriptorium Estoniae

    Saarep, Sigrid

    1999-01-01

    27. aug.-st Tallinna Kunstihoones ning Kunstihoone galeriis Raoul Kurvitza isiknäitus "Sümfoonia Si-bemoll minoor ئ Postapokalüptika", mille hulka kuulub ka mahuline rajatis "Katedraal" (vanadest akendest koosnev ehitus avati 31. VIII). Näitus võtab kokku autori loominguprintsiibid ajavahemikus 1986-1999. Audioelementide autor Ariel Lagle. Kommentaar: R. V

  1. Kunstiteaduslikke Uurimusi tõusis teadusajakirjade nomenklatuuris / Virve Sarapik

    Index Scriptorium Estoniae

    Sarapik, Virve, 1961-

    2011-01-01

    Thomson Reutersi Web of Science koostab ka humanitaarajakirjade andmebaase Arts & Humanities Citation Index ja Current Contents. Web of Science indeksitesse jõudnud Eestis väljaantavaid humanitaariaväljaandeid, millede hulka 2011. a. suvel lisandus Eesti Kunstiteadlaste Ühingu poolt väljaantav Kunstiteaduslikke Uurimusi. Suhteliselt algstaadiumis olevast Euroopa-kesksest humanitaarajakirjade andmebaasist ERIH

  2. Playtech kasvatas Kivisikust miljardäri / Kadri Bank

    Index Scriptorium Estoniae

    Bank, Kadri

    2008-01-01

    Investeerimine internetikasiinode tarkvara tootja Playtech aktsiatesse, on tõstnud Rain Kivisiku Eesti paarikümne jõukaima ettevõtja hulka. Graafik: Playtech liigub Tallinna börsiga vastuvoolu. Diagramm: Playtechi käive on jõudsalt kasvanud. Vt. samas: Internetimängurlus on väärt investeering. Kommenteerivad Joel Kukemelk ja Allan Martinson

  3. Saldome

    Index Scriptorium Estoniae

    2006-01-01

    2005. a. augustis Šveitsis Riburgis valminud soolalaost Saldome, mis valiti 2005. a. maailmanäitusel Aichis (Jaapanis) ülemaailmse ökotehnilise auhinna saajate hulka. Kuppelhoone kuppel on peaaegu täielikult valmistatud puidust. Projekteerija: Šveitsi perefirma Häring AG. 5 värv. ill

  4. Ring-wall enclosure of Lipa in Prehistoric Southern Harjumaa / Marge Konsa, Valter Lang, Karin Vimberg...[jt.

    Index Scriptorium Estoniae

    2006-01-01

    Lipa vallsulendik kuulub Eestis väikesearvuliste muististe hulka, mille iseloomulikuks tunuseks on tasasele maale ehitatud kividest või mullast madal vall, mis ringikujuliselt piirab õueala. Leitud keraamika järgi võiks asulakiht kuuluda ajavahemikku eelrooma rauaaja lõpust kuni rooma rauaaja lõpuni

  5. Alam-Pedja sai sõsara / Martin Pau

    Index Scriptorium Estoniae

    Pau, Martin, 1975-

    2007-01-01

    Laeva, Tähtvere ja Tartu valla maadel sündis ligi 18 ruutkilomeetri suurune Kärevere looduskaitseala, mille põhiväärtuste hulka kuuluvad näiteks väike-konnakotkad ja mitmed teised ohustatud liigid. Lisaks kaart: Kärevere ja Alam-Pedja looduskaitseala

  6. Laparoscopic reconstructive tubal surgery in a tertiary referral centre ...

    African Journals Online (AJOL)

    Objectives. To establish the pregnancy rate (PR) following endoscopic reconstructive tubal surgery in patients with tubal disease presenting to the Reproductive Medicine Unit at Groote Schuur Hospital between January 1994 and December 1997. Design. A prospective descriptive study utilising the Hulka classification ...

  7. Kuuldemäng "Palju õnne argipäevaks!" edukümnes

    Index Scriptorium Estoniae

    2006-01-01

    Raadioteatri kuuldemäng "Palju õnne argipäevaks" jõudis Euroopa meediafestivalil Prix Europa kümne parema hulka. Näidendi lavastas raadio jaoks Andres Noormets. 1999. a. jõudis festivalil Prix Europa äramärkimiseni Ervin Õunapuu kuuldemäng "Õhtueine Emmauses"

  8. Kultuuriministeerium jättis parima harrastusteatri toetuseta / Rando Tooming

    Index Scriptorium Estoniae

    Tooming, Rando

    2003-01-01

    Kultuuriministeerium loobus toetamast harrastusteatri sõitu Ülemaailmsele amatöörteatrite festivalile Kanadas. Tegemist on Eestit Harrastusteatrite Liidu, Teoteatri, Tallinna Toomklubi ja Botaanikaaia ühisprojektiga - A. Alegria "Niagaara" (lavastaja Jaan Urvet), mille rahvusvaheline žürii valis 300 hulgast 14 parima hulka

  9. Gruusias valiti ka koridorides burzhuikade ümber / Raigo Pajula, Igor Taro

    Index Scriptorium Estoniae

    Pajula, Raigo, 1971-

    2008-01-01

    Postimees : na russkom jazõke (lühendatud) 7. jaan. 2008, lk. 7. Ülevaade Gruusia erakorralistest presidendivalimistest, kus Mihhail Saakashvili poolt hääletas 52,8% valijatest. Eesti valimisvaatlejatest. Lisa: Valimistulemused. Vt. samas: Opositsioon ei kogunud kokku lubatud hulka meeleavaldajaid

  10. Andrei Luzgin : küll Kaial tulevad võidud ja ka kõrgem reiting / Andrei Luzgin ; interv. Maarja Värv

    Index Scriptorium Estoniae

    Luzgin, Andrei

    2006-01-01

    Vt. ka Postimees : na russkom jazõke 9. nov., lk. 13. Vestlus Eesti parima tennisisti Kaia Kanepi treeneriga, kelle arvates suudab sportlane juba tänavu tõusta maailmas viiekümne parema hulka. Lisa: Kaia Kanepi

  11. Virtuaalmuuseum Egiptuses / Ra Luhse, Tanel Tuhal

    Index Scriptorium Estoniae

    Luhse, Ra, 1964-

    2003-01-01

    Suure Egiptuse Muuseumi rahvusvaheline arhitektuurivõistlus Kairos autorite osalusel. Eestlaste töö jõudis 200 hulka ja avaldati kataloogis. Võidu- ja äramärgitud tööde iseloomustus. Võitis Iiri arhitektibüroo Henegan-Peng Architects

  12. Margiskandaal Inglismaal

    Index Scriptorium Estoniae

    1999-01-01

    Briti Kuninglik Post andis välja Peter Blake'i loodud millenniumile pühendatud postmargi, mis kujutab Queeni lauljat Freddie Mercuryt ja trummarit Roger Taylorit. Mark on saanud kriitika osaliseks, kuna seni on kehtinud reegel, et oma eluajal võib margil kujutada vaid kuningliku perekonna liikmeid, kelle hulka Taylor ei kuulu

  13. Lotte vallutab maailma

    Index Scriptorium Estoniae

    2006-01-01

    Eesti Joonisfilmi täispikk animafilm "Leiutajateküla Lotte", autoriteks Heiki Ernits, Janno Põldma ja Andrus Kivirähk, on kohe valmimas. Filmi tootjate hulka kuuluvad ka Läti stuudio Rija Films ja Eesti Televisioon, projekti produtsent on Riina Sildos

  14. Lotte maandub Cannes'is / Janno Põldma, Heiki Ernits ; interv. Jaan Ruus

    Index Scriptorium Estoniae

    Põldma, Janno, 1950-

    2006-01-01

    Eesti Joonisfilmi täispikk animafilm "Leiutajateküla Lotte", autoriteks Heiki Ernits, Janno Põldma ja Andrus Kivirähk on valmis. Filmi tootjate hulka kuuluvad ka Läti stuudio Rija Films ja Eesti Televisioon, projekti produtsent on Riina Sildos

  15. Hesburger asub ründama, McDonalds teeb kaevikuid / Andres Reimer

    Index Scriptorium Estoniae

    Reimer, Andres

    2005-01-01

    Hesburger tahab Eestis oma restoranide hulka kolmekordistada. McDonald's Eestis ei laiene, kuid kavatseb ettevõtte efektiivsust suurendada. Eesti hamburgerirestoranide kett Nehatu on konkurentsist välja langenud. Tabelid: Tulemused; Hamburgerirestoranid Eestis; Hamburger ja McDonald's maailmas. Lisad: Hakkas Hesburgeri partneriks; Hakka McDonald'si partneriks

  16. Kanada minister Van Loan on hobieestlane / Peter Van Loan ; interv. Marje Aksli

    Index Scriptorium Estoniae

    Van Loan, Peter

    2007-01-01

    Kanada konservatiivse valitsuse parlamendiasjade juht ja demokraatliku reformi minister vastab küsimustele, mis puudutavad eestlaste hulka tema valimisringkonnas, kohtumist president Toomas Hendrik Ilvesega, viisavabaduse andmist Eestile, samuti pronkssõdurit ja vene poliitikute väidet, et Eestis tõstab pead natsism

  17. Münchenis esitletakse Eesti juveelikunsti

    Index Scriptorium Estoniae

    2009-01-01

    Münchenis toimuval üritusel Schmuckzene esitletakse raamatut "Just Must", mis ilmus 2008. aastal Tallinnas samanimelise ehtekunstinäituse raames. Koostaja Kadri Mälk, kujundaja Aadam Kaarma, fotod Tanel Veenre. Kirjastus Arnoldsche Art Publishers arvas raamatu aasta viie parema ehtekunstiraamatu hulka

  18. Tudengiprojekt

    Index Scriptorium Estoniae

    2009-01-01

    Eesti Kunstiakadeemia tootedisaini üliõpilase Siim Westi töö"Sõidukite arvutikontrolli süsteem". Nahakunsti üliõpilase Karen Milistveri helkur-kott "Morpho Peleides", mis jõudis 2008. a. Jaapanis toimunud rahvusvahelisel disainivõistlusel "Design for Happiness" auhinnanominentide hulka

  19. Lorena reeglid / Lorena Rojas ; interv. Kaisa Karu

    Index Scriptorium Estoniae

    Rojas, Lorena

    2007-01-01

    Mehhiko telenovelade staar, kes mängib ka sel hooajal TV3s jooksvas seriaalis "Teine võimalus" ("El cuerpo del deseo"), valiti ajak. People poolt 2006.a. maailma 100 ilusama naise hulka. Sama : Teleleht nr. 3, lk. 38 : ill

  20. Istorii s risunkami

    Index Scriptorium Estoniae

    2003-01-01

    Akvarellide autorina tuntud Sveta Aleksejeva tööst raamatute illustreerijana. Tema illustreeritud raamatutest tuli Leelo Märjamaa "Cupido & Psyche" konkursil "25 kaunimat raamatut" 5 kaunima eesti 2002. a. lasteraamatu hulka ja Enrico S. Conti "The stone-dragons of Metsamaa" sai samasuguse tunnustuse aastaid tagasi

  1. Eesti jääb tugevaks, kui jätkab valitud teel / Irene Mia

    Index Scriptorium Estoniae

    Mia, Irene

    2005-01-01

    Maailma Majandusfoorumi analüütiku hinnangul jääb Eesti ka järgmistel aastatel maailma kõige konkurentsivõimelisemate riikide hulka, kui ta jätkab sama teed. Väla on toodud ka parandamist vajavad valdkonnad. Lisa: Eesti koht 2004. aastal majanduskasvu indeksis

  2. Scanforesti Purila saetööstus müüdi eksjuhile

    Index Scriptorium Estoniae

    2004-01-01

    Pankrotistunud puidutööstuse Scanforest Purila saetööstus müüdi Marek Krippeli firmale OÜ Johanna Grupp, Scanforesti vara hulka kuuluv Näpi sae- ja höövlitööstus on aga seni müümata. Nõudeid Scanforesti vastu on 81,5 miljoni krooni eest

  3. Filmõ Mihhalkova i Bodrova nominirovanõ na premiju "Oskar"

    Index Scriptorium Estoniae

    2008-01-01

    Nikita Mihhalkovi mängufilm "12" on Venemaa poolt võõrfilmi Oscari kandidaat, Kasahstani poolt aga "Mongol", mille režissöör on samuti venelane Sergei Bodrov. Mõlemad on valitud 9 filmi hulka, millest 22.01. nomineeritakse viis

  4. Linnar Viik kaotas lahingu IKEA omanikule / Airi Ilisson

    Index Scriptorium Estoniae

    Ilisson, Airi, 1980-

    2005-01-01

    Linnar Viik valiti 50 kõige mõjukama eurooplase hulka ning kandideeris Euroopa aasta ärijuhi tiitlile, tiitli pälvis IKEA asutaja Ingvar Kamprad. Kõige edukama eurooplase tiitli sai Türgi peaminister Recep Tayyip Erdogan

  5. Riigikontrolli audit paljastab Natura-alade segaduse / Ulvar Käärt

    Index Scriptorium Estoniae

    Käärt, Ulvar, 1982-

    2008-01-01

    Riigikontrolli audit näitab, et Natura 2000 kaitsealade hulka on arvatud ka väheväärtuslikke metsaalasid, samas on välja jäetud kaitset väärivaid elupaiku. Keskkonnaministeeriumi nõuniku Hanno Zingeli selgitusi. Lisa: Paljud taluvad asjata piiranguid

  6. Häda protokolli pärast = The trouble with the protocol / Indrek Rünkla

    Index Scriptorium Estoniae

    Rünkla, Indrek, 1971-

    2015-01-01

    Artiklis on käsitletud arhitektidele 21. sajandil esitatud nõudeid. Ta peab valdama ja praktiseerima teatud hulka tegevusi, mida ühiskond temalt tellib. Arhitekti tegevus on reguleeritud normatiivide ja protokollidega. Kuigi normid ja seadused on ühiskonnale vajalikud, siis nendega liialdamine hakkab süsteemi koormama, selle asemel et seda toetada ja arendada

  7. Kuressaare Gümnaasiumi e-töövihik pälvis üle-euroopalise tunnustuse / Monika Puutsa

    Index Scriptorium Estoniae

    Puutsa, Monika

    2005-01-01

    Kuressaare Gümnaasiumi õppealajuhataja Maidu Variku koostatud ja arvutiõpetaja Gert Lutteri kujundatud elektrooniline ühiskonnaõpetuse töövihik valiti Euroopa e-õppe projektide konkursil eLearning Awards in 2005 saja parima hulka

  8. И миллиардеры сейчас начинают с нуля / Маршалл Голдсмит ; интервьюировал Кристьян Отсманн

    Index Scriptorium Estoniae

    Голдсмит, Маршалл

    2009-01-01

    Maailma juhtivate ärinõustajate hulka kuuluv Marshall Goldsmith vastab küsimustele, mis puudutavad majanduskriisi põhjuseid, muutusi nende juhtide käitumises, kes on harjunud olema võitjad, juhtide käitumist muutunud maailmas ning majanduslanguse kestvust

  9. Startup'i majanduse kiirkursus Tarifa palmide all / Erik Aru

    Index Scriptorium Estoniae

    Aru, Erik

    2012-01-01

    Eesti sotsiaalvõrgustikuprojekt Majakaja pääses nende hulka, kes said osaleda Hispaanias toimunud ärikiirendis Spanish Village. Majakaja on ühist kinnisvara omavate isikute võgustik. Selle asutajateks on Andrei Filimonov, Zahhar Kirillov ja Dmitri Semirenko

  10. Introducing Leo LT - the "three-headed lion"

    Index Scriptorium Estoniae

    2008-01-01

    Leedu valitsus kiitis heaks seaduseparandused, mille tulemusena saab võtta tuumajaama ehitaja, investeerimis- ja energiafirma Leo LT strateegilise tähtsusega firmade hulka. Kui parlament valitsuse ettepanekud heaks kiidab, saab riik 61,7% Leo LT ja 38,3% NDX Energija aktsiatest

  11. The end of the honeymoon: The increasing differentiation of (long-term) unemployment risks in Europe / Martin Heidenreich

    Index Scriptorium Estoniae

    Heidenreich, Martin

    2015-01-01

    Artikkel analüüsib, millistel sotsiaalsetel gruppidel on suurem tõenäosus sattuda töötute hulka praeguse majandus- ja finantskriisi ajal, kusjuures eristatakse lühi- ja pikaajalist töötust. Aluseks EU-SILC andmed 24 Euroopa riigi (sh Eesti) kohta aastatest 2005-2012

  12. Rein Ruutsoo: Vaenlase tegemine on ikka veel mõnede poliitikute ainus poliitika / Rein Ruutsoo

    Index Scriptorium Estoniae

    Ruutsoo, Rein, 1947-

    2007-01-01

    Nõukogude Eestist saladokumente Läände toimetanud Rein Ruutsoo kommenteerib riiklike teenetemärkide jagamist endistele kommunistidele president Arnold Rüütli ja president Toomas Hendrik Ilvese ajal. T.H. Ilves on arvanud autasustatavate hulka Eestimaa Kommunistliku Partei poolt juhitud ideoloogiatöö võitlejad Eesti Raadios Aarne Rannamäe ja Peeter Kaldre

  13. Estonija mozhet ostatsja bez uzkoi kolei / Jelizaveta Gavrilova

    Index Scriptorium Estoniae

    Gavrilova, Jelizaveta

    2005-01-01

    Poola-Leedu-Läti-Eesti raudteeprojekt Rail Baltica on lülitatud Euroopa Komisjoni transpordi prioriteetide hulka. Eesti probleemiks on kujunenud madal koostöövõime infrastruktuuride valduse küsimuses riigi ja erafirma Eesti Raudtee vahel

  14. Steve Forbes näeb Eestit rikkaimate riikide hulgas / Steve Forbes ; interv. Kertu Ruus

    Index Scriptorium Estoniae

    Forbes, Steve, 1947-

    2008-01-01

    Meediamagnaat Steve Forbes ütleb intervjuus Äripäevale, et Eesti jõuab rikkaimate riikide hulka, kuid peab edu jätkumiseks äärmiselt oluliseks haridust ning Eesti vajab tema hinnangul selles osas pikaajalist plaani. Vt. samas: Steve Forbes; Ansip: Forbes tõstab Eesti tuntust maailmas

  15. Kaberla kalmistu 12.-13. sajandi klaashelmed / Irita Kallis

    Index Scriptorium Estoniae

    Kallis, Irita

    2010-01-01

    Kaberla kalmistult leitud klaashelmestest, põhitähelepanu on 12.-13. saj. matuste inventari hulka kuulunud leiumaterjalil. Ülevaade helmeste esimemisvariatsioonidest helmekeedes, võimalikust tähendusest ja väärtusest ning samatüübiliste helmeste dateeringutest naaberaladel

  16. Riskikapitalist : "Uus Euroopa on meie Hiina ja India" / Danny Rimer ; interv. Kristjan Otsmann

    Index Scriptorium Estoniae

    Rimer, Danny

    2006-01-01

    Euroopa suurimate riskikapitalide hulka kuuluva Index Venturesi partner Danny Rimer otsib kõikjalt Euroopast, ka Eestist, ettevõtteid, mis suudavad luua uut läbilöögivõimelist tehnoloogiat. Kuumad teemad riskikapitali maailmas, ettevõtete valik, kuhu investeerida. Lisa: Index Ventures

  17. Eesti joonisfilmi "Leiutajateküla Lotte" sai 3,13 miljonit krooni toetust

    Index Scriptorium Estoniae

    2004-01-01

    Euroopa Nõukogu juures tegutsev Eurimages'i fond määras toetuse Eesti Joonisfilmi täispikale filmile, autoriteks Heiki Ernits, Janno Põldma ja Andrus Kivirähk. Filmi tootjate hulka kuuluvad ka Läti stuudio Rija Films ja Eesti Televisioon. Sama ka Linnaleht (Pärnu, Tartu) nr. 8

  18. Juhtimise juhiseid 11/9-järgsesse maailma : ettevaatusabinõud ja strateegia ebajärjekindluse ajastul / Ralph W Shrader, Mike McConnell

    Index Scriptorium Estoniae

    Shrader, Ralph W

    2002-01-01

    Ettevõtete juhtide kohustuste hulka kuulub turvalisuse tagamine ja riskide juhtimine. See hõlmab töötajate ohutuse tagamist, firma põhitegevuse ning süsteemide kaitset. Diagrammid. Lisa: Juhend sõjamängude mõistmiseks: vahend haavatuse/töökatkestuste hindamiseks

  19. Oktoober oli kasumiteenimise kuu / Fredy-Edwin Esse ; kommenteerinud Kristjan Hänni

    Index Scriptorium Estoniae

    Esse, Fredy-Edwin

    2010-01-01

    Nii Tallinna kui ka Vilniuse börs kuulusid oktoobris maailma kümne enim tõusnud aktsiaturu hulka, Tallinna börs on viimase nelja kuu jooksul kasvanud 26,9%. Kõige rohkem tõusis oktoobris Shanghai börs. Kallinemisest toorainete turul

  20. Maailma tippkonsultant: ka miljardär alustab praegu nullist / Marshall Goldsmith ; intervjueerinud Kristjan Otsmann

    Index Scriptorium Estoniae

    Goldsmith, Marshall

    2009-01-01

    Maailma juhtivate ärinõustajate hulka kuuluv Marshall Goldsmith vastab küsimustele, mis puudutavad majanduskriisi põhjuseid, muutusi nende juhtide käitumises, kes on harjunud olema võitjad, juhtide käitumist muutunud maailmas ning majanduslanguse kestvust

  1. Eurovisiooni vaheklipid tõid ETV-le Aumuna

    Index Scriptorium Estoniae

    2003-01-01

    Mulluse Eurovisiooni lauluvõistluse Tallinna kontserdi vaheklipid said Eesti reklaamiauhindade Kuldmuna jagamisel Aumuna. Üks vaheklippidest "Saabastega kass", mille režissöörid on René Vilbre ja Meelis Arulepp, valiti maineka Annecy animafilmifestivali nominentide hulka. 2 klippi valiti Norras Fredrikstadis toimuva animafestivali programmi. Praegu teeb Rene Vilbre koos võttegrupiga Euroopa Liidu referendumi teemalisi klippe

  2. Miljonär paneb Ridalas lepalego kokku / Kaire Talviste

    Index Scriptorium Estoniae

    Talviste, Kaire, 1979-

    2003-01-01

    Ridala vallas Panga külas mustast lepast saunatarbeid ja köögitarvikuid meisterdav ettevõtja Gallo Trei kuulus Sylvesteri aktsionäride hulka, aktsiate müügist saadud raha investeeris ta oma ettevõttesse OÜ Trei Puidukaubad. Vt. samas: Sylvesteri müük. Kommenteerib Toomas Schmidt

  3. Tarkvaratootjad nõuavad STV-lt hiigelkahjutasu / Lauri Linnamäe

    Index Scriptorium Estoniae

    Linnamäe, Lauri

    2007-01-01

    Maailma suuremate tarkvaratootjate hulka kuuluvad Microsoft ja Adobe Systems nõuavad kohtus kaabellevifirmalt STV ja selle juhilt Igor Laevalt 448 000 kroonist kahjutasu 75 piraatprogrammi eest, mis leiti firma arvutitest 2004. aastal toimunud reidi käigus. Lisa: Varastatud programmid

  4. Treffneri hoone pälvis Tartu aasta teo tiitli / Priit Rajalo

    Index Scriptorium Estoniae

    Rajalo, Priit, 1975-

    2002-01-01

    Viiendat korda välja antud Tartu aasta teo konkursi aunimetuse pälvis tänavu Huga Treffneri gümnaasiumi renoveeritud hoone, sümboliseerides vajadust anda rohkem raha haridusele. Tartu linnapea Andrus Ansipi sõnul kuulub see hoone praegu Euroopa kümne parima gümnaasiumihoone hulka

  5. Central Bank's tools for tackling financial instability : feasibility to implement emergency lending facility in Estonia / Jana Kask

    Index Scriptorium Estoniae

    Kask, Jana

    2006-01-01

    Keskpanga ülesandeks finantssüsteemi stabiilsuse eest seismisel on hoolitseda, et finantsvahendus riigis toimiks efektiivselt ja tõrgeteta. Krediidiasutuste ajutiste likviidsusprobleemide lahendamiseks kuulub keskpanga raha- ja finantspoliitika töövahendite hulka ka erakorralise likviidsuslaenu (ELA - emergency liquidity assistance) instrument. Tabelid, diagrammid

  6. Recommended Practices for Measurement of Gas Path Pressures and Temperatures for Performance Assessment of Aircraft Turbine Engines and Components (Les Methodes Recommandees pour la Mesure de la Pression et de la Temperature de la Veine Gazeuse en Vue de l’Evaluation des Performances des Turbines Aeronautiques et de leurs Composants

    Science.gov (United States)

    1990-06-01

    and the attachment of the tag To Engine Center Line while satisfying the requirements in I above. Aluminium or stainless steel are preferred. Two...1IP~g 11211 U TNU yl j 7/PjM U! UZZZPUMU IM iL PI/P$| ________ L_____/ ___ Neau PKUK UTISL PTT /Pu WO12 ENME MU STL T/PM Fig. 2.10-2 Examples of...uncertainty distortion produced by intrusive probes of an types estimation as well. A diagram of the components of one must be controlled; and

  7. Biografická glosa: Šedesátiny Františka Znebejánka

    Directory of Open Access Journals (Sweden)

    Helena Kubátová

    2017-10-01

    Full Text Available V květnu 2011 oslavil významné životní jubileum PhDr. František Znebejánek, Ph.D., odborný asistent na Katedře sociologie a andragogiky Filozofické fakulty Univerzity Palackého v Olomouci. V neposlední řadě tak ovšem jubiluje také významný člen redakční rady časopisu Historická sociologie.

  8. RECONSTRUCTING DIET COMPOSITION ON THE BASIS OF FECES IN A MOLLUSK-EATING WADER, THE KNOT CALIDRIS-CANUTUS

    NARCIS (Netherlands)

    DEKINGA, A; PIERSMA, T

    Methods are described to assess the molluscan diet of Knots feeding on intertidal flats in western Europe from their faecal output. The size distributions of two common bivalve prey, Macoma balthica and Cerastoderma edule, can be estimated from the heights of shell hinges retrieved from droppings.

  9. Reconstructing diet composition on the basis of faeces in a mollusc-eating wader, the Knot Calidris canutus

    NARCIS (Netherlands)

    Dekinga, A.; Piersma, T.

    1993-01-01

    Methods are described to assess the molluscan diet of Knots feeding on intertidal flats in western Europe from their faecal output. The size distributions of two common bivalve prey, Macoma balthica and Cerastoderma edule, can be estimated from the heights of shell hinges retrieved from droppings.

  10. ENVIRONMENTAL-EFFECTS ON THE GROWTH-RATE OF INTERTIDAL INVERTEBRATES AND SOME IMPLICATIONS FOR FORAGING WADERS

    NARCIS (Netherlands)

    WANINK, JH; ZWARTS, L

    1993-01-01

    The paper describes effects of intertidal height and sediment type on growth rate of the bivalves Cerastoderma edule, Macoma balthica, Mya arenaria, Mytilus edulis and Scrobicularia plana, and of the worms Arenicola marina, Nephtys hombergii and Nereis diversicolor in the eastern part of the Dutch

  11. India hiilgav viletsus / Andrei Hvostov

    Index Scriptorium Estoniae

    Hvostov, Andrei, 1963-

    2006-01-01

    Hiinat nimetatakse maailma töökojaks, Indiat aga bürooks (back office), võrdlus põhineb India IT-firmade edul - kõik tegevused, mida saab teha arvutite abil, kipuvad kolima Indiasse. Tulevikuriik India on hädas keskaegsete tavadega

  12. Interkultuurilised võimalused ja ohud turunduses / Kristel Kaljund

    Index Scriptorium Estoniae

    Kaljund, Kristel

    2002-01-01

    Kasut. kirj. lk. 27. - Kokkuvõte ingl. k. lk. 28. Artiklis põhjendatakse kultuuritausta mõju majanduslikule edule ning tuuakse ära kõige sagedasemad vigade põhjused ning pakutakse välja, kuidas Eesti majandusspetsialistidel oleks võimalik neid vigu vältida

  13. Burrowing and avoidance behaviour in marine organisms exposed to pesticide-contaminated sediment

    DEFF Research Database (Denmark)

    Møhlenberg, Flemming; Kiørboe, Thomas

    1983-01-01

    Behavioural effects of marine sediment contaminated with pesticides (6000 ppm parathion, 200 ppm methyl parathion, 200 ppm malathion) were studied in a number of marine organisms in laboratory tests and in situ. The burrowing behaviour in Macoma baltica, Cerastoderma edule, Abra alba, Nereis...

  14. Mööblifirmade trump a la carte-teenuses / Heli Lehtsaar

    Index Scriptorium Estoniae

    Lehtsaar, Heli, 1976-

    2008-01-01

    Mööblitootjad on muutuvas majandusolukorras hakanud seeriatootmise asemel pöörama rohkem tähelepanu eritellimustele. Vt. samas: Aktiivne müük ja likviidne käibevara aitavad madalseisu ajal elus püsida. Ain Alvela. Edule pürgiv mööblitootja peab moevooludega kaasa sörkima

  15. Kultuuritegelaste luhtunud katse ajalugu korrata / Ando Leps

    Index Scriptorium Estoniae

    Leps, Ando, 1935-

    2003-01-01

    Kultuuritegelaste pöördumine nelja erakonna poole üritas olla signaaliks nelja partei lähenemisele ja ühisele koostöövandele seista vastu Keskerakonna arvatavale edule Riigikogu valimistel. Võrdlus 1980. aasta 40 kirjaga

  16. Edukaks töö ja arengu kaudu / Ketlin Priilinn

    Index Scriptorium Estoniae

    Priilinn, Ketlin, 1982-

    2005-01-01

    Ilmunud ka: Delovõje Vedomosti 2. veebr. lk. 11. TOP-i 2. koht. Ehituse, kaevetööde ja kinnisvaraga tegeleva Malkati Kaubanduse OÜ juhatuse liikme Indrek Puhalaineni sõnul on ettevõtet edule aidanud aktiivne töö. Diagramm

  17. Phenolic Content, and Antioxidant and Antimicrobial Activities of ...

    African Journals Online (AJOL)

    Erah

    Methods: The content of total phenols, flavonoids and anthocyanins of the alcohol, hydroalcohol and aqueous extracts of ... Keywords: Crataegus oxyacantha L.; Natural phenolic compounds; Antioxidant and antimicrobial activity, Southeast Serbia. ..... Antioxidant activities of Sechium edule (Jacq.) Swart extracts, Food ...

  18. Nutritional composition and antioxidant activities of Curculigo pilosa ...

    African Journals Online (AJOL)

    ajl yemi

    2011-11-28

    Nov 28, 2011 ... Phenolic, flavonoids and proanthocyanidin contents were 65.17, 23.17 and 4.23 mg/g .... The total phenol content in the extract was determined by the modified Folin-Ciocalteu method (Wolfe et al., 2003). 0.5 ml ( ..... activities of Sechium edule (Jacq.) Swart extracts. Food Chem. 97: 452–458. Palazzino G ...

  19. Chemical composition profiling and antifungal activity of the ...

    African Journals Online (AJOL)

    Background: Essential oil from Mesembryanthemum edule leaves have been used by the Eastern Cape traditional healers for the treatment of respiratory tract infections, tuberculosis, dysentery, diabetic mellitus, laryngitis and vaginal infections. The investigation of bioactive compounds in the essential oil of this plant could ...

  20. Ultrasound-Assisted Extraction: Effect of Extraction Time and Solvent ...

    African Journals Online (AJOL)

    Purpose: To investigate the influence of extraction conditions assisted by ultrasound on the quality of extracts obtained from Mesembryanthemum edule shoots. Methods: The extraction procedure was carried out in an ultrasonic bath. The effect of two solvents (methanol and ethanol) and two extraction times (5 and 10 min) ...

  1. An Analysis of Estimated Versus Actual Development Costs for an Electronics State-of-the-Art (SOA) Extension.

    Science.gov (United States)

    1987-12-01

    DOWNGPAONG SC-EDULE distributiJ-_ _ . 1.,1J=.ted 4 PERFORMING ORGANZA ;ON REPORT NuMBERIS) S MONiTORING ORGANIZATION REP(CRT %L%𔄂ERS, 6a NAME OF PERFORMING...process. It is the one where assistance of other technical experts may be required. It may also require some restructuring of the program merely to

  2. Achieving Lower Nitrogen Balance and Higher Nitrogen Recovery Efficiency Reduces Nitrous Oxide Emissions in North America's Maize Cropping Systems

    Directory of Open Access Journals (Sweden)

    Rex A. Omonode

    2017-06-01

    Full Text Available Few studies have assessed the common, yet unproven, hypothesis that an increase of plant nitrogen (N uptake and/or recovery efficiency (NRE will reduce nitrous oxide (N2O emission during crop production. Understanding the relationships between N2O emissions and crop N uptake and use efficiency parameters can help inform crop N management recommendations for both efficiency and environmental goals. Analyses were conducted to determine which of several commonly used crop N uptake-derived parameters related most strongly to growing season N2O emissions under varying N management practices in North American maize systems. Nitrogen uptake-derived variables included total aboveground N uptake (TNU, grain N uptake (GNU, N recovery efficiency (NRE, net N balance (NNB in relation to GNU [NNB(GNU] and TNU [NNB(TNU], and surplus N (SN. The relationship between N2O and N application rate was sigmoidal with relatively small emissions for N rates <130 kg ha−1, and a sharp increase for N rates from 130 to 220 kg ha−1; on average, N2O increased linearly by about 5 g N per kg of N applied for rates up to 220 kg ha−1. Fairly strong and significant negative relationships existed between N2O and NRE when management focused on N application rate (r2 = 0.52 or rate and timing combinations (r2 = 0.65. For every percentage point increase, N2O decreased by 13 g N ha−1 in response to N rates, and by 20 g N ha−1 for NRE changes in response to rate-by-timing treatments. However, more consistent positive relationships (R2 = 0.73–0.77 existed between N2O and NNB(TNU, NNB(GNU, and SN, regardless of rate and timing of N application; on average N2O emission increased by about 5, 7, and 8 g N, respectively, per kg increase of NNB(GNU, NNB(TNU, and SN. Neither N source nor placement influenced the relationship between N2O and NRE. Overall, our analysis indicated that a careful selection of appropriate N rate applied at the right time can both increase NRE and reduce N

  3. Eesti elanike valimiskäitumise motiivid ja mehhanismid / Marti Taru, Rein Toomla

    Index Scriptorium Estoniae

    Taru, Marti

    2003-01-01

    Uuringutest selgub, et sotsiaaldemograafilistest omadustest suurendavad valima mineku tõenäosust kõrgem haridustase ja elukoha paiknemine väikeasulas, valima mineku tõenäosust vähendavad kuulumine pensionäride, õppurite või ettevõtjate hulka. Diagrammid: Valima mittemineku ja mineku põhjused; Valimiskriteeriumid. Tabelid: Riigikogusse valitavate inimeste oluliseks peetavad omadused (%-des); Valijate tähelepanu erakonnale (%-des)

  4. Elitaristlikud juhid rikuvad töö- ja meelerahu / Paul Tammert

    Index Scriptorium Estoniae

    Tammert, Paul, 1956-

    2007-01-01

    Ilmunud ka: Severnoje Poberezhje, 12. okt. 2007, lk. 2; Võrumaa Teataja, 13. okt. 2007, lk. 2; Vooremaa, 13. okt. 2007, lk. 2; Meie Maa, 13. okt. 2007, lk. 2; Lääne Elu, 13. okt. 2007, lk. 2; Harjumaa, 2. nov. 2007, lk. 2. Autor põhjendab, miks tal ei ole usku, et Eesti aastaks 2021 EL-i viie rikkama riigi hulka jõuab

  5. Eesti Raadio 2006. aasta preemiaid

    Index Scriptorium Estoniae

    2006-01-01

    Teiste hulgas pälvisid preemia ka Andres Noormets ja Külli Tüli Raadioteatri kuuldemängu "Palju õnne sünnipäevaks" eest, mis jõudis Euroopa meediafestivalil Prix Europa kümne parima hulka. Näidendi lavastaja Andres Noormets ja helirežissöör Külli Tüli

  6. Taimne linn - fantaasia saab tegelikkuseks / Kadri Kalle

    Index Scriptorium Estoniae

    Kalle, Kadri, 1984-

    2009-01-01

    Belgia arhitektist Luc Schuitenist ja tema töödest Brüsselis 2009. a. suvel eksponeeritud näitusel "Vegetal City". Arhitekt pakub loovaid lähenemisi sellele, kuidas linnad võiksid rohkem sarnaneda looduslike elupaikadega. Juba 1970. aastatel ehitas ta maja, mis kasutab päikese- ja tuuleenergiat, tema ideekavandite hulka kuuluvad ka üllatava disainiga keskkonnasõbralikud sõidukid

  7. Zatlers addresses Harvard audience

    Index Scriptorium Estoniae

    2010-01-01

    Läti presidendi Valdis Zatlersi Harvardi ülikoolis peetud kõnest, milles ta märgib, et üks tema jaoks tähtsamatest küsimustest on, kes võiks Läti uue peaministrina riigi praegust majanduskurssi jätkata, ja leiab, et Läti kuulub oma rahvaarvu arvestades Afganistani enam panustavate riikide hulka

  8. Ekspress Grupp laieneb Lätti ja Euroopasse / Vallo Toomet

    Index Scriptorium Estoniae

    Toomet, Vallo, 1960-

    2007-01-01

    Hans H. Luige meediafirma teatas, et viib oma aktsiad börsile. Vt. samas: Mida arvate aktsiaemissioonist ning kas ise ostaksite aktsiaid? Kommenteerivad: GILD Bankersi juhtivpartner Rainer Tamm, Kristjan Lepik tarkinvestor.ee'st, Allan Martinson Trigon Venture Partners'ist, riigikogu liige Olari Taal; Hans H. Luik ja Priit Leito vastavad Päevaleht Online'i lugejate küsimustele. Priit Leito. Tellijad kuuluvad ise kirjastajate hulka

  9. Rein Lang: Eesti kõige väärtuslikum ressurss on mõistus / Rein Lang ; interv. Peep Lillemägi ; komment. Siim Kallas, Jüri Pihl, Väino Linde

    Index Scriptorium Estoniae

    Lang, Rein, 1957-

    2009-01-01

    Justiitsminister Rein Lang vastab küsimustele, mis puudutavad Ameerika Ühendriike kui vabaduse kantsi, ettevõtlusvabadust Ameerika Ühendriikides ja Eestis, tööd justiitsministrina, varasemat karjääri, Eesti põhiseaduse loomist, Euroopa Liidu aluslepingu välja töötamist, avaliku võimu rolli tänapäeva maailmas ning Eesti jõudmist Euroopa rikkamate riikide hulka

  10. Eesti arukas hotell St Etienneþi disainibiennaalil

    Index Scriptorium Estoniae

    2008-01-01

    2006. a. käivitus Eesti-Soome koostööprojekt "Estonian and Finnish Design Challenge". Koostöös ettevõtjatega sündis DesignStart programmi piloot "Smart Hotell", milles osalesid disainerid Tarmo Luisk, Ivari Männi, Monika Järg, Keret Altpere, Igor Volkov, Jan Graps, Ken Ruut, Jukka Halttunen, Tapio Anttila ja Ilona Gurjanova ning mis valiti St. Etienneþi disainibiennaali projektide hulka

  11. "Leiutajateküla Lotte" sai toetust Euroopa filmifondilt / Margit Tõnson

    Index Scriptorium Estoniae

    Tõnson, Margit, 1978-

    2004-01-01

    Euroopa Nõukogu juures tegutsev Eurimages'i fond määras toetuse Eesti Joonisfilmi täispikale filmile, mille autoriteks on Heiki Ernits, Janno Põldma ja Andrus Kivirähk. Filmi tootjate hulka kuuluvad ka Läti stuudio Rija Films ja Eesti Televisioon. Kommentaariks vastavad küsimustele EFSA peadirektor Martin Aadamsoo, projekti produtsent Riina Sildos ja Eesti Televisiooni juht Ilmar Raag

  12. Jaan Pillesaar : Eesti vajab revolutsiooni / Urmas Vaino

    Index Scriptorium Estoniae

    Vaino, Urmas, 1974-

    2007-01-01

    1991. aastal startinud Helmes on tarkvaratootjana jõudnud Eesti tugevamate tegijate hulka. Firma käive ületab 100 miljonit krooni ning 30 miljoni ulatuses läheb tarkvara ekspordiks. Helmese juht Jaan Pillesaar spetsialistide puudusest, arengu piduriks olevast maksusüsteemist, riigi suhtumisest teabeärisse. Lisad: Mida Helmes teeb?; Helmese säravad tütred: MarkIT ja Now! Innovations

  13. Richard Wollheim 1923-2003 / Marek Volt

    Index Scriptorium Estoniae

    Volt, Marek

    2004-01-01

    Järelehüüe anglo-ameerika filosoofile Richard Wollheimile (5. V 1923-4. XI 2003), kes huvitus maalist ja psühhoanalüüsist ning kuulub XX sajandi analüütilist kunstifilosoofiat enim kujundanud filosoofide hulka. Tema peamised tööd: "Art and Its Objects" (1968), "Painting As an Art" (1987), "On Painting and the Self" (1992). Ilmunud ka raamatus: Volt, Marek. Esteetikast. Tallinn : Sirp, 2006

  14. Environmental Impact Research Program. Ruffed Grouse (Bonasa umbellus) Section 4.1.1, US Army Corps of Engineers Wildlife Resources Management Manual.

    Science.gov (United States)

    1986-07-01

    tors in most populations (Edminster 1954, Gullion and Marshall 1968). However, hunting may depress grouse numbers on areas that receive intensive...in the diversity of ruffed grouse diets. Clover and other green leafy material and the fruits of Arctostaphylos, cranberry , and meadow rue contribute...Christmas fern Polystichum acrostichoides Clover Trifoliwn spp. Cranberry Viburnum edule Dandelion Taraxaum spp. Dogwood Corfus spp. Douglas fir Pseudotsuga

  15. Evaluation of the potential of translocated common cockle for ecological risk assessment studies: bioaccumulation and biomarkers test

    OpenAIRE

    Arteaga, Jorge Lobo

    2009-01-01

    Thesis submitted to the Faculdade de Ciências e Tecnologia to obtain the Master’s degree in Environmental Engineering, profile in Ecological Engineering Sediment–bound contamination is a major concern factor in estuaries and other confined coastal water bodies, frequently subjected to anthropogenic sources of pollution. In order to investigate the effects and responses of the common cockle (Cerastoderma edule, L. 1558, Bivalvia: Cardiidae) to sediment contaminants and to assess the species...

  16. Installation Restoration Program. Site Investigation Report. 147th Fighter Interceptor Group, Texas Air National Guard, Ellington, Field, Houston, Texas

    Science.gov (United States)

    1991-01-01

    N4.L.....-I~C1 01AME TER ...... SACKS OF TON’O 4-1At AN SCH4EDULE 40PVC SAK pTA rEINO 8LANK VLT TRAP I o GALLONS OF GVOUT USED SOTTOM WELL CAP POUNDS...and fungi on leaf surfaces and in soil. Many of these microorganisms play key roles in the decomposer food chain. Cases of lead poisoning have been

  17. Venemaa ja Georgia sõda : suurvõimu lõks / Ivan Krastev ; tõlk. Triinu Pakk

    Index Scriptorium Estoniae

    Krastev, Ivan

    2008-01-01

    Autor kirjutab, et Venemaa-Gruusia konflikti puhul on tegemist 19. sajandi sõjaga 21. sajandi Euroopas, millele on iseloomulik võimukonfrontatsioon ilma laiema ideoloogilise polarisatsioonita. Konflikt näitas kolmekordset nurjumist: Gruusia presidendil Mihheil Saakashvilil ei õnnestunud taastada riigi territoriaalset terviklikkust, USA administratsioon näitas oma võimetust strateegilise liitlase abistamisel ning vaatamata sõjalisele edule, ei õnnestunud Venemaal mõjutada Euroopa poliitikat

  18. Suudab ta pensionäre toita? / Merike Lees

    Index Scriptorium Estoniae

    Lees, Merike, 1976-

    2000-01-01

    Kuna Eesti rahvastiku vananemine suurendab ülalpeetavate hulka ühiskonnas, siis ei saa praegust solidaarsuspõhimõttel rajanevat pensionisüsteemi enam kasutada, vaid tuleb pensionisüsteemi muuta. Pensionisüsteemi koormusest ja kohustuslikust kogumispensionist. Diagrammid: Eesti rahvaarv 1999-2050; rahvastikupüramiid 1997, 2025 ja 2050; kaua saavad/said mehed ja naised pensionipõlve nautida 1960-2010; vajaliku sotsiaalmaksu % palgast 2000-2070; keskmise pensioni ja brutopalga suhe 1965-2000; vanurite osatähtsus 1881-2030; keskmine eluiga 1950-2050. Kommenteerivad E. Nestor, K. Katus, L. Sakkeus

  19. Jüri Talvet maailmaluule tõlgendajana / Jüri Talvet’s Interpretations of World Poetry

    OpenAIRE

    Lauri Pilter

    2016-01-01

    Teesid: Tartu Ülikooli maailmakirjanduse professori, luuletaja, kirjandusteadlase ja hispaaniakeelse kirjanduse spetsialisti Jüri Talveti tõlketegevuse viljade hulka kuulub luulet ja proosat nii sajandeid vanast Hispaania klassikast kui ka 20. sajandil või tänapäeval romaani keeltes või inglise keeles loodud teostest. Käesolev artikkel keskendub sellele, kuidas professor Talvet on tõlgendanud luule ja poeetika, kuid ka kirjandusajaloo, iseäranis barokk-kirjanduse alaseid küsimusi oma kirjandu...

  20. Igor Stromajer / Igor Stromajer ; interv. Tilman Baumgärtel

    Index Scriptorium Estoniae

    Stromajer, Igor

    2006-01-01

    Sloveeni kunstnikust Igor Stromajerist (sünd. 1967) ja tema loomingust. I. Stromajer võitis 1997. a. Hamburgi Kunstihalle korraldatud võrgukunsti võistluse "Extension" tööga "0.html". Tema domeeni www.intima.org ülespandud tööd kuuluvad parima disainiga võrgukunsti näidete hulka. I. Stromajer on loonud WAP-kunsti mobiiltelefonidele, lavastanud Interneti-performance'eid. I. Stromajer 1999. a. tehtud meiliintervjuus oma töödest, pikemalt võrguprojektist "b.ALT.ica", võrgukunsti tulevikust

  1. Eesti disaini uudised / Kai Lobjakas

    Index Scriptorium Estoniae

    Lobjakas, Kai, 1975-

    2006-01-01

    Eesti Kunstiakadeemia üliõpilaste Kadri Kruus-Laurimaa kott-jope, Riho Tiiveli lusikas "Spoon container" ja Ülle Jehe sisustuspadjad "Roll it!" valiti Prantsusmaal toimunud rahvusvahelisel kunsti-ja disainikõrgkoolide võrgustiku CUMULUS konkursil "European Ways of Life" nominentide hulka. EKA sisearhitektuuri eriala üliõpilaste toolide hindamisest. Mari Adamsoni nimelise noore tekstiilikunstniku preemia pälvis Kadri Klampe. Eesti Ajaloomuuseumis Maarjamäe lossis avatud moenäitusest "Paula, sul on poisipea!", mille koostas Helle Avila, konsulteeris Anu Ojavee, kujundasid Krista Lepland ja Malle Jürgenson büroost Laika, Belka ja Strelka

  2. Viljandis tuleb imeline kohtumine / Linda Järve

    Index Scriptorium Estoniae

    Järve, Linda, 1946-

    2001-01-01

    8.-22. juulinì01 toimub Eestis 10. Euroopa Laste Teatrikohtumine (EDERED - European Drama Encounter), mis toob kohale 180 last koos juhendajatega 18 riigist. Samal ajal on koos ka EDERED-i peaassamblee. Kahenädalase, peamiselt Viljandis aset leidva kohtumise korraldavad Eesti Harrastusteatrite Liit, haridusministeerium ja Viljandi linnavalitsus. EDERED loodi 1985. a, pärast 4 aastat varem toimunud esimest laste teatrikohtumist, kus osalesid 12-14-aastased lapsed. Hiljem lisandusid EDERED-i ürituste hulka ka noorte teatrikohtumised, kus osalejad on 16-20-aastased. EDERED-i kohtumistel kasutatakse mitmesuguseid teatriõpetuse meetodeid, toimub loov koostöö laste ja õpetajate vahel

  3. 18. II avati Jõgeva kultuurikeskuses... / Hele Tallinn

    Index Scriptorium Estoniae

    Tallinn, Hele

    2005-01-01

    Koos Tartu naiskoori Laulikud kontserdiga avati nahaköitekunsti näitus "Assisi Franciscuse "Päikeselaul" ehk "Ülemlaul loojale"", mis on osa 2002. a. Itaalias Assisis ja Macaretas toimunud II rahvusvahelisest raamatuköitekunsti näituskonkursist. Eestist pääses 100 medaliga autasustatud meistri hulka Urve Kolde, Kaia Lukats, Tiina Piisang ja Esta Voss. 200 äramärgitud töö hulgas on 18 eesti autori tööd

  4. Disaineri- ja arhitektihinge võluv liit / Kristjan Arunurm

    Index Scriptorium Estoniae

    Arunurm, Kristjan

    2008-01-01

    Edina-Dufala Pärnast ja Martin Pärnast, nende disainibüroost Knok, loomingust, pikemalt Ülemiste City ökokaupluse Maa kujundusest. Martin Pärn töötas kaks aastat Soome mööblitootja Martela disainerina, edasi Thulema kontorimööbli kujundajana. M. Pärna büroo-klapplaua "Martin" Martela valikust hindas Saksa ajakiri "md" 2000. a. üheks 20. sajandi 200 parima eseme hulka, laud pälvis ka Saksa Der Rote Punkt disainiauhinna. M. Pärna ja E. Dufala-Pärna kommentaarid

  5. Atmospheric Triatomic Molecular Studies.

    Science.gov (United States)

    1980-11-17

    ADORE.SS(Jf dlII.,.nt tra 05), tivl 15, SECURITY CLA’.SS. (of this rwpofl) __ 1 P7 jl / 15&. DECLASSJFI CAT DJGft*114I1 -J SCmEDULE If- DiSTRIBUT ION...work in Table I are given in Appendix I. I (3) 41 S. - I + t/n LU ) *C14~ & c .) a)Z. W i 0 0 uL a) NCDNN N 0 4-3 0) cl b -4 cu a x of acca Lm %- a

  6. Caracterização Morfológica de Três Espécies de Broca-da-Haste em Chuchuzeiro (Coleoptera: Cerambycidae, Lamiinae)

    OpenAIRE

    SOUZA FILHO, MIGUEL F. DE; GABRIEL, DALVA; AZEVEDO FILHO, JOAQUIM A. DE

    2001-01-01

    A ocorrência simultânea de Adetus analis (Haldeman), Adetus fuscoapicalis Breuning e Plerodia syrinx (Bates) (Coleoptera: Cerambycidae, Lamiinae), broqueando ramos de chuchuzeiro Sechium edule (Jaqc.) Sw., é relatada. A. analis é sinônima de A. muticus (Thomson), que foi referida por diversos autores no Brasil. A. analis e A. fuscoapicalis são muito semelhantes quanto aos aspectos morfológicos e etológicos. Assim foi realizada uma descrição detalhada e ilustrações de ambas espécies a fim de p...

  7. A survey for potential biological control agents of Pereskia aculeata Miller (Cactaceae) in Brazil reveals two new species of Horismenus Walker (Hymenoptera: Eulophidae).

    Science.gov (United States)

    Pikart, Tiago G; Costa, Valmir A; Hansson, Christer; Cristo, Sandra C DE; Vitorino, Marcelo D

    2017-05-30

    This paper deals with the description of two new species of Horismenus Walker (Hymenoptera: Eulophidae) from Brazil, parasitoids of larvae of Adetus analis (Haldeman) (Coleoptera: Cerambycidae). Both species are similar to Horismenus steirastomae (Girault), a species that also parasitizes cerambycids. Adetus analis is a pest of Sechium edule (Jacq.) Swartz (Cucurbitaceae), a minor crop in Brazil, Argentina and U.S.A., but also feeds in stems of Pereskia aculeata Miller (Cactaceae), an ornamental plant that has become a problematic weed species in Africa, where it was introduced. The two new Horismenus species are described, diagnosed, and compared to H. steirastomae.

  8. The Use of Tailored Testing with Instructional Programs.

    Science.gov (United States)

    1986-03-01

    AVAILABILITY OF REPORT Approved for public release: distribution un- t~X DWNCADNGSCHiEDULE li-mited. Reproduction in whole or in part is...of Education ,-’ Washington, DC 20V 0 Chicago, IL r06𔄁 Air Force Human Resources Lab Cdt. Arnold Bohrer . AFHRL/MPD Sectie Psychologisch Cnderzoek...University of Texas-Austin Univ-ir-tat Puss-ldorf Measurement and Evalu-,tion Er zi, gswi ssensch;ftl iches Cpnter Un ivf rsit ’tsst r. 1 Austin, TX 787

  9. Maritime Halophyte Species from Southern Portugal as Sources of Bioactive Molecules

    DEFF Research Database (Denmark)

    Rodrigues, Maria João; Gangadhar, Katkam N.; Vizetto-Duarte, Catarina

    2014-01-01

    -ethylbenzothiazoline-6-sulphonic acid) (ABTS) radical was obtained in the ether extract of J. acutus (IC50 = 0.4 mg/mL) and H. portulacoides (IC50 = 0.9 mg/mL). The maximum total phenolic content (TPC) was found in the methanol extract of M. edule (147 mg gallic acid equivalents (GAE)/g) and in the ether extract of J......,1-diphenyl-2-picrylhydrazyl (DPPH) radical were the methanol extracts of M. edule (IC50 = 0.1 mg/mL) and J. acutus (IC50 = 0.4 mg/mL), and the ether extracts of J. acutus (IC50 = 0.2 mg/mL) and A. macrostachyum (IC50 = 0.3 mg/mL). The highest radical scavenging activity (RSA) against the 2,2'-azino-bis (3...... activity and selectivity was obtained with the ether extract of J. acutus. Juncunol was identified as the active compound and for the first time was shown to display selective in vitro cytotoxicity towards various human cancer cells....

  10. Climate change impacts on potential recruitment in an ecosystem engineer.

    Science.gov (United States)

    Morgan, Emer; O' Riordan, Ruth M; Culloty, Sarah C

    2013-03-01

    Climate variability and the rapid warming of seas undoubtedly have huge ramifications for biological processes such as reproduction. As such, gametogenesis and spawning were investigated at two sites over 200 km apart on the south coast of Ireland in an ecosystem engineer, the common cockle, Cerastoderma edule. Both sites are classed as Special Areas of Conservation (SACs), but are of different water quality. Cerastoderma edule plays a significant biological role by recycling nutrients and affecting sediment structure, with impacts upon assemblage biomass and functional diversity. It plays a key role in food webs, being a common foodstuff for a number of marine birds including the oystercatcher. Both before and during the study (early 2010-mid 2011), Ireland experienced its two coldest winters for 50 years. As the research demonstrated only slight variation in the spawning period between sites, despite site differences in water and environmental quality, temperature and variable climatic conditions were the dominant factor controlling gametogenesis. The most significant finding was that the spawning period in the cockle extended over a greater number of months compared with previous studies and that gametogenesis commenced over winter rather than in spring. Extremely cold winters may impact on the cockle by accelerating and extending the onset and development of gametogenesis. Whether this impact is positive or negative would depend on the associated events occurring on which the cockle depends, that is, presence of primary producers and spring blooms, which would facilitate conversion of this extended gametogenesis into successful recruitment.

  11. Occurrence of Squash yellow mild mottle virus and Pepper golden mosaic virus in Potential New Hosts in Costa Rica.

    Science.gov (United States)

    Castro, Ruth M; Moreira, Lisela; Rojas, María R; Gilbertson, Robert L; Hernández, Eduardo; Mora, Floribeth; Ramírez, Pilar

    2013-09-01

    Leaf samples of Solanum lycopersicum, Capsicum annuum, Cucurbita moschata, Cucurbita pepo, Sechium edule and Erythrina spp. were collected. All samples were positive for begomoviruses using polymerase chain reaction and degenerate primers. A sequence of ∼1,100 bp was obtained from the genomic component DNA-A of 14 samples. In addition, one sequence of ∼580 bp corresponding to the coat protein (AV1) was obtained from a chayote (S. edule) leaf sample. The presence of Squash yellow mild mottle virus (SYMMoV) and Pepper golden mosaic virus (PepGMV) were confirmed. The host range reported for SYMMoV includes species of the Cucurbitaceae, Caricaceae and Fabaceae families. This report extends the host range of SYMMoV to include the Solanaceae family, and extends the host range of PepGMV to include C. moschata, C. pepo and the Fabaceae Erythrina spp. This is the first report of a begomovirus (PepGMV) infecting chayote in the Western Hemisphere.

  12. Occurrence of Squash yellow mild mottle virus and Pepper golden mosaic virus in Potential New Hosts in Costa Rica

    Directory of Open Access Journals (Sweden)

    Ruth M. Castro

    2013-09-01

    Full Text Available Leaf samples of Solanum lycopersicum, Capsicum annuum, Cucurbita moschata, Cucurbita pepo, Sechium edule and Erythrina spp. were collected. All samples were positive for begomoviruses using polymerase chain reaction and degenerate primers. A sequence of ∼1,100 bp was obtained from the genomic component DNA-A of 14 samples. In addition, one sequence of ∼580 bp corresponding to the coat protein (AV1 was obtained from a chayote (S. edule leaf sample. The presence of Squash yellow mild mottle virus (SYMMoV and Pepper golden mosaic virus (PepGMV were confirmed. The host range reported for SYMMoV includes species of the Cucurbitaceae, Caricaceae and Fabaceae families. This report extends the host range of SYMMoV to include the Solanaceae family, and extends the host range of PepGMV to include C. moschata, C. pepo and the Fabaceae Erythrina spp. This is the first report of a begomovirus (PepGMV infecting chayote in the Western Hemisphere.

  13. Eessõna

    Directory of Open Access Journals (Sweden)

    Miia Rannikmäe

    2017-04-01

    Full Text Available Ligikaudu kümme aastat on nn Rocardi raporti "Science education now: A renewed pedagogy for the future of Europe" avaldamisest saadik olnud loodusteaduslik ja matemaatikaharidus Euroopa Liidus varasemast suurema tähelepanu all. Selle eesmärk on suurendada loodusteadustes, inseneri- ja matemaatikavaldkonnas karjääri valivate inimeste hulka, et tagada liikmesriikide areng neile erialadele tugineva innovatsiooni kaudu. Ka Euroopa Komisjoni hiljutises raportis "Science education for responsible citizenship" (2015 rõhutatakse, et tulevikusuundumused eeldavad kõigi ühiskonnaliikmete senisest paremat arusaamist loodusteadustest ja tehnoloogiast, et tagada nende aktiivne ja vastutustundlik osalemine otsustusprotsessis ja teadmistepõhises innovatsioonis. Muutus algab aga koolist, kus tuleb senisest enam pöörata tähelepanu loodusteadusliku-tehnoloogiaalase kirjaoskuse kõrgematele tasemetele.

  14. Avaliku võimu ja kodanikualgatuse partnerlus : koostööd mõjutavad tegurid / Krista Hinno, Tanel Vallimäe

    Index Scriptorium Estoniae

    Hinno, Krista

    2007-01-01

    Artiklis esitatakse kokkuvõte Tallinna Ülikooli Eesti Humanitaarinstituudi Kodanikeühiskonna Uurimis- ja Arenduskeskuse uurimuse "Avaliku võimu ja kodanikualgatuse komplementaarsed suhted" peamistest tulemustest. Raporti autorite hulka kuulusid Erle Rikmann, Krista Hinno, Aigi Bremse, Kersti Kollom, Mari Sepp ja Tanel Vallimäe. Toetudes uuringutele väidavad autorid, et Eesti ametnikkond on soodsalt meelestatud koostööle kodanikuühendustega, takistuseks võivad saada kodanikeühenduste erinev tööstiil, vajalike ressursside puudus, sh ka ajanappus, ametnike kaadrivoolavus ja teatavate vanusegruppide vähene avatus. Diagrammid: Koostöö jaotumine asutuseliikide vahel; Ametnike hinnang ühistegevuse sisukusele seoses koostöö algatamisega; Ametnike hinnang omaduse vajalikkusele oma töös (vastajate osakaal, kes peavad antud omadust oma töös väga vajalikuks)

  15. Short-term fluctuations in bivalve larvae compared with some environmental factors in a coastal lagoon (South Portugal

    Directory of Open Access Journals (Sweden)

    Luis M.Z. Chícaro

    2000-12-01

    Full Text Available In this study, short-term fluctuations in bivalve larvae were compared with some triggering factors for a period of sixteen months. Data on the abundance of planktonic larvae, collected two to three times a week were related to water temperature, salinity, wind velocity, tidal amplitude and chlorophyll a. Higher densities of planktonic bivalve larvae were caught between May and August, but intense fluctuations in abundance were observed. Planktonic bivalve larvae of eighteen taxa were identified. Larvae of Mytilus galloprovincialis, Cerastoderma edule, Ruditapes decussates and Venerupis spp. were the most abundant. The seasonal fluctuations of bivalve abundance seem to be controlled by temperature, the major factor in the timing of the reproduction of bivalves. Nevertheless, advection may be also a key factor during the planktonic life of bivalve species in coastal systems, such as the Ria Formosa.

  16. Uso de plantas medicinais por pessoas com hipertensão

    Directory of Open Access Journals (Sweden)

    Marília Gabrielle Santos Nunes

    2015-01-01

    Full Text Available Objetivo: describir el uso de plantas medicinales en el tratamiento de la hipertensión arterial por personas con hipertensión inscritas en el Programa de Salud Familiar en una ciudad del interior de Pernambuco. Métodos: estudio descriptivo, cuyos datos se obtuvieron a través de guía de entrevistas semiestructuradas aplicada a 172 pacientes. Resultados: el uso de plantas medicinales para el control de la hipertensión fue informado por 39,5%, de los cuales 57,4% utiliza sólo una planta medicinal. Entre las especies citadas predominó el uso de chayote [Sechium edule (Jacq. Sw.-34.8%]. Conclusión: plantas medicinales constituyen terapia coadyuvante en el tratamiento de hipertensión, sin embargo requiere monitoreo del manejo y de las especies seleccionadas.

  17. Isolation of Cryptococcus neoformans var. neoformans from bird droppings, fruits and vegetables in Mexico City.

    Science.gov (United States)

    López-Martínez, R; Castañón-Olivares, L R

    1995-01-01

    The presence of Cryptococcus neoformans in various natural sources, such as bird droppings, fruits and vegetables, was investigated. A total of 711 samples were analyzed; C. neoformans var. neoformans was isolated from seven out of 74 bird droppings (9.5%), with parrots as one of the most significant sources. Fruits were positive in 9.5% of the 169 samples studied, specially citrus fruits, particularly grapefruit, in which the highest frequency was found. From the 468 vegetable samples, only 20 were positive (4.2%). It is emphasized that five of the positive vegetables species are autochthonous to Mexico: avocado (Nectandra salicifolia), beet (Beta vulgaris var. quinopodiace), chayote (Sechium edule), stringbean (Cassia sp), and nopal (Opuntia ficus-indica).

  18. Use of medicinal plants by people with hypertension

    Directory of Open Access Journals (Sweden)

    Marília Gabrielle Santos Nunes

    2015-12-01

    Full Text Available Objective: to describe the use of medicinal plants in the treatment of high blood pressure for people with hypertension enrolled in the Family Health Program in a city in Pernambuco State. Methods: a descriptive study, whose data were obtained through semi-structured interview script applied to 172 patients. Results: the use of medicinal plants for hypertension control was reported by 39.5%, of which 57.4% used only one medicinal plant. Among the species cited, there was predominant use of chayote [Sechium edule (Jacq. Sw.-34.8%]. Conclusion: medicinal plants constitute an adjunctive therapy in the treatment of hypertension. However, there is need for monitoring of handling and listed species.

  19. Promoción positiva de vegetales en preescolares costarricenses empleando el Kamishibai

    OpenAIRE

    Chacón-Villalobos, Alejandro; Molina Angulo, Ruth; Ruíz-González, María José

    2015-01-01

    Este artículo presenta la evaluación de la promoción positiva de los vegetales chayóte (Sechium edule) y brócoli (Brassica olerácea L), al emplear la estrategia de animación a la lectura conocida como Kamishibai. Durante el año 2012 en San José, se estudió la actitud infantil hacia los vegetales (positiva, negativa o neutra), y el agrado sensorial que manifestaba esta población antes de la exposición al Kamishibai y posterior a la misma. Se trabajó con 213 infantes preescolares entre los 4 y ...

  20. Comparative exploration of learning styles and teaching techniques between Thai and Vietnamese EFL students and instructors

    Directory of Open Access Journals (Sweden)

    Supalak Nakhornsri

    2016-09-01

    Full Text Available Learning styles have been a particular focus of a number of researchers over the past decades. Findings from various studies researching into how students learn highlight significant relationships between learners’ styles of learning and their language learning processes and achievement. This research focuses on a comparative analysis of the preferences of English learning styles and teaching techniques perceived by students from Thailand and Vietnam, and the teaching styles and techniques practiced by their instructors. The purposes were 1 to investigate the learning styles and teaching techniques students from both countries preferred, 2 to investigate the compatibility of the teaching styles and techniques practiced by instructors and those preferred by the students, 3 to specify the learning styles and teaching techniques students with high level of English proficiency preferred, and 4 to investigate the similarities of Thai and Vietnamese students’ preferences for learning styles and teaching techniques. The sample consisted of two main groups: 1 undergraduate students from King Mongkut’s University of Technology North Bangkok (KMUTNB, Thailand and Thai Nguyen University (TNU, Vietnam and 2 English instructors from both institutions. The instruments employed comprised the Students’ Preferred English Learning Style and Teaching Technique Questionnaire and the Teachers’ Practiced English Teaching Style and Technique Questionnaire. The collected data were analyzed using arithmetic means and standard deviation. The findings can contribute to the curriculum development and assist teachers to teach outside their comfort level to match the students’ preferred learning styles. In addition, the findings could better promote the courses provided for students. By understanding the learning style make-up of the students enrolled in the courses, faculty can adjust their modes of content delivery to match student preferences and maximize

  1. Applicability Of A Semi-Automated Clinical Chemistry Analyzer In Determining The Antioxidant Concentrations Of Selected Plants

    Directory of Open Access Journals (Sweden)

    Allan L. Hilario

    2017-07-01

    Full Text Available Plants are rich sources of antioxidants that are protective against diseases associated to oxidative stress. There is a need for high throughput screening method that should be useful in determining the antioxidant concentration in plants. Such screening method should significantly simplify and speed up most antioxidant assays. This paper aimed at comparing the applicability of a semi-automated clinical chemistry analyzer Pointe Scientific MI USA with the traditional standard curve method and using a Vis spectrophotometer in performing the DPPH assay for antioxidant screening. Samples of crude aqueous leaf extract of kulitis Amaranthus viridis Linn and chayote Sechium edule Linn were screened for the Total Antioxidant Concentration TAC using the two methods. Results presented in mean SD amp956gdl were compared using unpaired Students t-test P0.05. All runs were done in triplicates. The mean TAC of A. viridis was 646.0 45.5 amp956gdl using the clinical chemistry analyzer and 581.9 19.4 amp956gdl using the standard curve-spectrophotometer. On the other hand the mean TAC of S. edule was 660.2 35.9 amp956gdl using the semi-automated clinical chemistry analyzer and 672.3 20.9 amp956gdl using the spectrophotometer. No significant differences were observed between the readings of the two methods for A. viridis P0.05 and S. edible P0.05. This implies that the clinical chemistry analyzer can be an alternative method in conducting the DPPH assay to determine the TAC in plants. This study presented the applicability of a semi-automated clinical chemistry analyzer in performing the DPPH assay. Further validation can be conducted by performing other antioxidant assays using this equipment.

  2. Laparoscopic female sterilization.

    Science.gov (United States)

    Filshie, G M

    1989-09-01

    An overview of laparoscopic sterilization techniques from a historical and practical viewpoint includes instrumentation, operative techniques, mechanical occlusive devices, anesthesia, failure rates, morbidity and mortality. Laparoscope was first reported in 1893, but was developed simultaneously in France, Great Britain, Canada and the US in the 1960s. There are smaller laparoscopes for double-puncture procedures, and larger, single-puncture laparoscopes. To use a ring or clip, a much larger operating channel, up to 8 mm is needed. Insufflating gas may be CO2, which does not support combustion, but is more uncomfortable, NO2, which is also an anesthetic, and room air often used in developing countries. Unipolar electrocautery is now rarely used, in fact most third party payers do not allow it. Bipolar cautery, thermal coagulation and laser photocoagulation are safer methods. Falope rings, Hulka-Clemens, Filshie, Bleier, Weck and Tupla clips are described and illustrated. General anesthesia, usually a short acting agent with a muscle relaxant, causes 33% of the mortality of laparoscope, often due to cardiac arrest and arrhythmias, preventable with atropine. Local anesthesia is safer and cheaper and often used in developing countries. Failure rates of the various laparoscopic tubal sterilization methods are reviewed: most result from fistula formation. Mortality and morbidity can be caused by bowel damage, injury or infection, pre- existing pelvic infection, hemorrhage, gas embolism (avoidable by the saline drip test), and other rare events.

  3. Water quality and pollution status of Chambal river in National Chambal Sanctuary, Madhya Pradesh.

    Science.gov (United States)

    Saksena, D N; Garg, R K; Rao, R J

    2008-09-01

    The physico-chemical characteristics of Chambal river water in National Chambal sanctuary (Madhya Pradesh) have been studied. The stretch of Chambal river contained in the National Chambal sanctuary (located at 25 degrees 23'-26 degrees 52'N, 76 degrees 28'-79 degrees 15'E) is extending up to 600 km downstream from Kota (Rajasthan) to the confluence of the Chambal with Yamuna river (Etawah). The river flow in Madhya Pradesh spans up to approximately 400 km. Three sampling stations viz., Station A--near Palighat, district Sheopurkalan, Station B--near Rajghat, district Morena and Station C--near Baraighat, district Bhind were established for the collection of water samples during April, 2003 to March, 2004. The water quality parameters namely transparency (12.12-110 cm), colour (transparent-very turbid), turbidity (1-178 TNU), electrical conductivity (145.60-884 microS cm(-1)), total dissolved solids (260-500 mgl(-1)), pH (7.60-9.33), dissolved oxygen (4.86-14.59 mgl(-1)), free carbon dioxide (0-16.5 mgl(-1)), total alkalinity (70-290 mgl(-1)), total hardness (42-140 mgl(-1)), chloride (15.62-80.94 mgl(-1)), nitrate (0.008-0.025 mgl(-1)), nitrite (0.002-0.022 mgl(-1)), sulphate (3.50-45 mgl(-1)), phosphate (0.004-0.050 mgl(-1)), silicate (2.80-13.80 mgl(-1)), biochemical oxygen demand (0.60-5.67 mgl(-1)), chemical oxygen demand (2.40-26.80 mgl(-1)), ammonia (nil-0.56 mgl(-1)), sodium (14.30-54.40 mgl(-1)) and potassium (2.10 mgl(-1)-6.30 mgl(-1)) reflects on the pristine nature of the river in National Chambal sanctuary. On the basis of various parameters studied, Chambal river in this stretch can be placed under the category of oligosaprobic. The water quality analysis, indicated that the riverwater in the sanctuary area is pollution free and can serve as a good habitat for many aquatic animals including endangered species.

  4. Are metallothioneins equally good biomarkers of metal and oxidative stress?

    Science.gov (United States)

    Figueira, Etelvina; Branco, Diana; Antunes, Sara C; Gonçalves, Fernando; Freitas, Rosa

    2012-10-01

    Several researchers investigated the induction of metallothioneins (MTs) in the presence of metals, namely Cadmium (Cd). Fewer studies observed the induction of MTs due to oxidizing agents, and literature comparing the sensitivity of MTs to different stressors is even more scarce or even nonexistent. The role of MTs in metal and oxidative stress and thus their use as a stress biomarker, remains to be clearly elucidated. To better understand the role of MTs as a biomarker in Cerastoderma edule, a bivalve widely used as bioindicator, a laboratory assay was conducted aiming to assess the sensitivity of MTs to metal and oxidative stressors. For this purpose, Cd was used to induce metal stress, whereas hydrogen peroxide (H2O2), being an oxidizing compound, was used to impose oxidative stress. Results showed that induction of MTs occurred at very different levels in metal and oxidative stress. In the presence of the oxidizing agent (H2O2), MTs only increased significantly when the degree of oxidative stress was very high, and mortality rates were higher than 50 percent. On the contrary, C. edule survived to all Cd concentrations used and significant MTs increases, compared to the control, were observed in all Cd exposures. The present work also revealed that the number of ions and the metal bound to MTs varied with the exposure conditions. In the absence of disturbance, MTs bound most (60-70 percent) of the essential metals (Zn and Cu) in solution. In stressful situations, such as the exposure to Cd and H2O2, MTs did not bind to Cu and bound less to Zn. When organisms were exposed to Cd, the total number of ions bound per MT molecule did not change, compared to control. However the sort of ions bound per MT molecule differed; part of the Zn and all Cu ions where displaced by Cd ions. For organisms exposed to H2O2, each MT molecule bound less than half of the ions compared to control and Cd conditions, which indicates a partial oxidation of thiol groups in the cysteine

  5. Population of bacteria from soil in Tudu-Aog village, Passi district, Bolaang Mongondow, North Sulawesi

    Directory of Open Access Journals (Sweden)

    RIANI HARDININGSIH

    2004-01-01

    Full Text Available An experiment was conducted in order to know the population of bacteria from soil in Tudu-Aog village, Passi district, Bolaang Mongondow, North Sulawesi, the purpose of the research was to study the population of bacteria from soil. Fourthy six soil samples were taken from two location, namelyTudu-Aog village and Bugis mountain. Isolation was done by dilution methods on YEMA medium (for Rhizobium bacteria, Winogradsky’s (for Azotobacter bacteria, Pycosvkaya (for Phosphat Solubilizing Bacteria, and selective Difco Pseudomonas (for Pseudomonas bacteria. Incubation at room temperature (27-280C until 15 days, and the enumeration with plate count method. The highest enumeration of Rhizobium bacteria with plant rhizosphere of Alocasia esculenta (27x105 CFU/g soil, Theobroma cacao (29x105 CFU/g soil,and Euphorbia paniculata (26x105 CFU/g soil, Azotobacter bacteria with plant rhizosphere of Lycopersicum esculantum (38x105 CFU/g soil, Eugenia aromaticum (43x105 CFU/g soil, Andropogon sp. (34x105 CFU/g soil, Phosphat Solubilizing bacteria with plant rhizosphere of Sechium edule (27x105 CFU/g soil, Cinnamomum sp. (48x105 CFU/g soil, Cyathea sp. (72x105 CFU/g soil, and Pseudomonas bacteria with plant rhizosphere of Oryza sativa (18x105 CFU/g soil, Vanilla sp. (12x105 CFU/g soil, dan Saurauia sp.(19x105 CFU/g soil.

  6. Assessing the role of benthic filter feeders on phytoplankton production in a shellfish farming site: Mont Saint Michel Bay, France

    Science.gov (United States)

    Cugier, Philippe; Struski, Caroline; Blanchard, Michel; Mazurié, Joseph; Pouvreau, Stéphane; Olivier, Frédéric; Trigui, Jihane R.; Thiébaut, Eric

    2010-07-01

    The macrobenthic community of Mont Saint Michel Bay (English Channel, France) is mainly dominated by filter feeders, including cultivated species (oysters and mussels). An ecological model of the bay was developed, coupling a 2D hydro-sedimentary model and two biological models for primary production and filter-feeder filtration. The filter-feeder model includes three cultivated species ( Mytilus edulis, Crassostrea gigas and Ostrea edulis), one invasive species ( Crepidula fornicata) and eight wild native species ( Abra alba, Cerastoderma edule, Glycymeris glycymeris, Lanice conchilega, Macoma balthica, Paphia rhomboides, Sabellaria alveolata, andSpisula ovalis). For cultivated and invasive species, the production of biodeposits was computed to assess their role in restimulating primary production. Chlorophyll a concentrations appeared to be strongly controlled by the filter feeders. When the pressure of each benthic compartment on phytoplankton was estimated separately wild species and the invasive slipper limpet C.fornicata were shown to be key elements in the control of primary production. Conversely, the role of cultivated species, particularly oysters, was weaker. Feedback due to the mineralization of biodeposits also appears to be crucial to fully evaluate the role of filter feeders in primary production.

  7. Maximization of Energy Efficiency in Wireless ad hoc and Sensor Networks With SERENA

    Directory of Open Access Journals (Sweden)

    Saoucene Mahfoudh

    2009-01-01

    Full Text Available In wireless ad hoc and sensor networks, an analysis of the node energy consumption distribution shows that the largest part is due to the time spent in the idle state. This result is at the origin of SERENA, an algorithm to SchEdule RoutEr Nodes Activity. SERENA allows router nodes to sleep, while ensuring end-to-end communication in the wireless network. It is a localized and decentralized algorithm assigning time slots to nodes. Any node stays awake only during its slot and the slots assigned to its neighbors, it sleeps the remaining time. Simulation results show that SERENA enables us to maximize network lifetime while increasing the number of user messages delivered. SERENA is based on a two-hop coloring algorithm, whose complexity in terms of colors and rounds is evaluated. We then quantify the slot reuse. Finally, we show how SERENA improves the node energy consumption distribution and maximizes the energy efficiency of wireless ad hoc and sensor networks. We compare SERENA with classical TDMA and optimized variants such as USAP in wireless ad hoc and sensor networks.

  8. Levantamento etnobotânico de plantas medicinais na comunidade quilombola Carreiros, Mercês – Minas Gerais

    Directory of Open Access Journals (Sweden)

    Flávia M. C. Ferreira

    2014-09-01

    Full Text Available O objetivo do trabalho foi identificar as espécies medicinais utilizadas pela comunidade quilombola Carreiros, bem como traçar o perfil social das famílias desta comunidade. Para tanto, foram realizadas entrevistas semiestruturadas da comunidade, sendo um representante de cada família. Para fins de registro foram coletados dois exemplares de cada espécie medicinal identificada, os quais foram conservados na forma de exsicatas e mantidos no Laboratório de Ecologia do IF Sudeste MG – Campus Rio Pomba. As mulheres aparentemente desempenham importante papel social e estão bastante envolvidas no conhecimento das plantas medicinais. Nota-se, que o conhecimento existente foi adquirido de forma empírica e éevidente entre as famílias a preocupação em repassar os conhecimentos tradicionais sobre o uso das plantas medicinais aos jovens. Dentre as principais espécies utilizadas pela comunidade estão: Citrus Sinensis L., Psidium guajava L., Leonurus sibiricus L., Citrus Limonia (Osbeck, Carica sp., Vernonia condensataBacker, Sechuium edule (Jacq. Sw, Sansevieria trifasciata Prain, Malpighia glabra L., e Saccharum zofficinarum L..

  9. Accumulation of Sellafield-derived radiocarbon ((14)C) in Irish Sea and West of Scotland intertidal shells and sediments.

    Science.gov (United States)

    Tierney, Kieran M; Muir, Graham K P; Cook, Gordon T; MacKinnon, Gillian; Howe, John A; Heymans, Johanna J; Xu, Sheng

    2016-01-01

    The nuclear energy industry produces radioactive waste at various stages of the fuel cycle. In the United Kingdom, spent fuel is reprocessed at the Sellafield facility in Cumbria on the North West coast of England. Waste generated at the site comprises a wide range of radionuclides including radiocarbon ((14)C) which is disposed of in various forms including highly soluble inorganic carbon within the low level liquid radioactive effluent, via pipelines into the Irish Sea. This (14)C is rapidly incorporated into the dissolved inorganic carbon (DIC) reservoir and marine calcifying organisms, e.g. molluscs, readily utilise DIC for shell formation. This study investigated a number of sites located in Irish Sea and West of Scotland intertidal zones. Results indicate (14)C enrichment above ambient background levels in shell material at least as far as Port Appin, 265 km north of Sellafield. Of the commonly found species (blue mussel (Mytilus edulis), common cockle (Cerastoderma edule) and common periwinkle (Littorina littorea)), mussels were found to be the most highly enriched in (14)C due to the surface environment they inhabit and their feeding behaviour. Whole mussel shell activities appear to have been decreasing in response to reduced discharge activities since the early 2000s but in contrast, there is evidence of continuing enrichment of the carbonate sediment component due to in-situ shell erosion, as well as indications of particle transport of fine (14)C-enriched material close to Sellafield. Copyright © 2015 The Authors. Published by Elsevier Ltd.. All rights reserved.

  10. Antioxidant Activity in Extracts of 27 Indigenous Taiwanese Vegetables

    Directory of Open Access Journals (Sweden)

    Pi-Yu Chao

    2014-05-01

    Full Text Available The objectives of this study were to identify the antioxidants and antioxidant axtivity in 27 of Taiwan’s indigenous vegetables. Lycium chinense (Lc, Lactuca indica (Li, and Perilla ocymoides (Po contained abundant quercetin (Que, while Artemisia lactiflora (Al and Gynura bicolor (Gb were rich in morin and kaempferol, respectively. Additionally, Nymphoides cristata (Nc and Sechium edule (Se-yellow had significantly higher levels of myricetin (Myr than other tested samples. Cyanidin (Cyan and malvidin (Mal were abundant in Gb, Abelmoschus esculentus Moench (Abe, Po, Anisogonium esculentum (Retz. Presl (Ane, Ipomoea batatas (Ib-purple, and Hemerocallis fulva (Hf-bright orange. Relatively high levels of Trolox equivalent antioxidant capacity (TEAC, oxygen radical absorption capacity (ORAC, and 1,1-diphenyl-2-picryl-hydrazyl (DPPH radical scavenger were generated from extracts of Toona sinensis (Ts and Po. Significant and positive correlations between antioxidant activity and polyphenols, anthocyanidins, Que, Myr, and morin were observed, indicating that these phytochemicals were some of the main components responsible for the antioxidant activity of tested plants. The much higher antioxidant activity of Po, Ts, and Ib (purple leaf may be related to their higher Cyan, Que, and polyphenol content.

  11. Metabolites of saxitoxin analogues in bivalves contaminated by Gymnodinium catenatum.

    Science.gov (United States)

    Vale, Paulo

    2010-01-01

    Bivalve metabolites of saxitoxin analogues, not present in microalgae, were recently described as an important toxin fraction in mussels contaminated by Alexandrium tamarense. These possess very low fluorescence, and require mass spectrometry detection. HILIC-MS was implemented to look for these metabolites in bivalves contaminated during Gymnodinium catenatum blooms at the Portuguese coast. The presence of M1 was tentatively identified in several bivalves, ranging from estuarine (Mytilus galloprovinciallis, Cerastoderma edule and Ruditapes decussatus) to oceanic habitat (Donax trunculus and Ensis spp.). It was hypothesized that M1 could contribute to an important fraction of the profile of STX analogues. M1 was more abundant in estuarine bivalves that retain longer PSP toxins, in the following order: mussels>cockles>clams. These data highlight that the study by fluorimetry alone of the carbamoyl, N-sulfocarbamoyl, and decarbamoyl families is manifestly insufficient to fully understand toxin dynamics in bivalves feeding on G. catenatum without a proper study of hydroxybenzoate and hydroxylated M-toxins.

  12. Immediate effect of intertidal non-mechanised cockle harvesting on macrobenthic communities: a comparative study

    Directory of Open Access Journals (Sweden)

    Francisco Miguel Sousa Leitão

    2007-12-01

    Full Text Available In Ria Formosa cockles (Cerastoderma edule have traditionally been harvested with a harvesting-knife (HK. However, over the last six years there has been an increase in the use of a hand-dredge (HD to exploit cockle beds. A comparative study on the impact of these harvesting methods on the benthic macrofauna was undertaken with the aim of evaluating the possible introduction of the hand-dredge in the fishery. Macrofaunal mortality was very low regardless of the gear. However, the total mortality resulting from using the HK was superior to the one observed for the HD. For the same fishing time the hand-dredge covers an area approximately five times greater that the one covered by the knife, with the former yielding 5 times the catch of the latter. Consequently, the use of hand-dredges increases the fishing effort, which may lead to the overexploitation of the cockle populations. Our results revealed that the immediate effect of both gears on macrobenthic communities was similar and minimal. Therefore, we believe that introducing the hand-dredge in the cockle fishery should only be authorised if other management measures, such as daily quotas, closed areas and limiting the number of fishing licenses, are implemented.

  13. Shifting baselines in the Ems Dollard estuary: A comparison across three decades reveals changing benthic communities

    Science.gov (United States)

    Compton, Tanya J.; Holthuijsen, Sander; Mulder, Maarten; van Arkel, Maarten; Schaars, Loran Kleine; Koolhaas, Anita; Dekinga, Anne; ten Horn, Job; Luttikhuizen, Pieternella C.; van der Meer, Jaap; Piersma, Theunis; van der Veer, Henk W.

    2017-09-01

    At a time when there is a growing discussion about the natural state of estuaries, a comparison of macrozoobenthos communities from two surveys conducted 30 years apart in the Ems Dollard estuary, in the eastern Wadden Sea, The Netherlands, provides a unique opportunity to compare changes over time. As expected, our comparison revealed a gradient in species composition from land (the Dollard) to sea (the Outer Ems) at both points in time, with brackish species in the Dollard and more marine species in the Outer Ems (Wadden Sea). Total richness increased over time; however, this mainly reflected the immigration of new species and sampling differences. In the Dollard, total biomass declined over time, most likely reflecting de-eutrophication in this area. Strikingly, at the meeting point between the sea and the brackish Dollard, i.e. the Inner Ems, the community composition changed from one dominated by bivalves (1970s) to one dominated by worms (since 2009). This change involved a reduction in total biomass, mainly of Mya arenaria, and immigration of polychaete worms (Marenzellaria viridis and Alitta succinea). In the Outer Ems, an increase in total biomass was observed, associated with the recent successful recruitment of Cerastoderma edule. This comparison highlights that historical data provides useful insights at large spatial scales. However, a full understanding of the complex dynamics of estuaries requires an analysis of continuous long-term monitoring series.

  14. Biology of Anastrepha grandis (Diptera: Tephritidae) in Different Cucurbits.

    Science.gov (United States)

    Bolzan, Anderson; Nava, Dori E; Garcia, Flávio R M; Valgas, Ricardo A; Smaniotto, Giovani

    2015-06-01

    Anastrepha grandis (Macquart) (Diptera: Tephritidae) is one of the main pests of cucurbits in Brazil. Losses occur due to the damage caused to the fruits and the embargo on exports, as A. grandis is considered a quarantine pest in countries that import Brazilian cucurbits. This study aimed to evaluate the development of A. grandis in hosts of the Cucurbitaceae family. The hosts used were stem squash (Cucurbita pepo L.), squash (Cucurbita moschata Duchesne), chayote [Sechium edule (Jacq.) Swartz], mini watermelon [Citrullus lanatus (Thunb.) Matsum & Nakai], Spanish melon (Cucumis melo L.), hybrid squash "Tetsukabuto" (C. moschata×Cucurbita maxima Duchesne), and salad cucumber (Cucumis sativus L.). We evaluated the viability and duration of egg-to-pupa period, pupal weight, sex ratio, and average number of pupae per fruit under controlled conditions of temperature, relative humidity, and photophase. The preoviposition and oviposition periods, fecundity, fertility, and longevity of females were determined for adults. Hosts of the genus Cucurbita provided a better development of A. grandis in comparison with other hosts, and presented a greater number of insects on fruit as well as higher infestation rate. Fecundity and longevity were also higher for females that developed in hosts of the genus Cucurbita, although values of these biological parameters varied between stem squash, squash, hybrid squash "Tetsukabuto." © The Authors 2015. Published by Oxford University Press on behalf of Entomological Society of America. All rights reserved. For Permissions, please email: journals.permissions@oup.com.

  15. Shellfish dredging pushes a flexible avian top predator out of a marine protected area.

    Directory of Open Access Journals (Sweden)

    Jan A van Gils

    2006-11-01

    Full Text Available There is a widespread concern about the direct and indirect effects of industrial fisheries; this concern is particularly pertinent for so-called "marine protected areas" (MPAs, which should be safeguarded by national and international law. The intertidal flats of the Dutch Wadden Sea are a State Nature Monument and are protected under the Ramsar convention and the European Union's Habitat and Birds Directives. Until 2004, the Dutch government granted permission for ~75% of the intertidal flats to be exploited by mechanical dredgers for edible cockles (Cerastoderma edule. Here we show that dredged areas belonged to the limited area of intertidal flats that were of sufficient quality for red knots (Calidris canutus islandica, a long-distance migrant molluscivore specialist, to feed. Dredging led to relatively lower settlement rates of cockles and also reduced their quality (ratio of flesh to shell. From 1998 to 2002, red knots increased gizzard mass to compensate for a gradual loss in shellfish quality, but this compensation was not sufficient and led to decreases in local survival. Therefore, the gradual destruction of the necessary intertidal resources explains both the loss of red knots from the Dutch Wadden Sea and the decline of the European wintering population. This study shows that MPAs that do not provide adequate protection from fishing may fail in their conservation objectives.

  16. Mesocosm validation of the marine No Effect Concentration of dissolved copper derived from a species sensitivity distribution.

    Science.gov (United States)

    Foekema, E M; Kaag, N H B M; Kramer, K J M; Long, K

    2015-07-15

    The Predicted No Effect Concentration (PNEC) for dissolved copper based on the species sensitivity distribution (SSD) of 24 marine single species tests was validated in marine mesocosms. To achieve this, the impact of actively maintained concentrations of dissolved copper on a marine benthic and planktonic community was studied in 18 outdoor 4.6m(3) mesocosms. Five treatment levels, ranging from 2.9 to 31μg dissolved Cu/L, were created in triplicate and maintained for 82days. Clear effects were observed on gastropod and bivalve molluscs, phytoplankton, zooplankton, sponges and sessile algae. The most sensitive biological endpoints; reproduction success of the bivalve Cerastoderma edule, copepod population development and periphyton growth were significantly affected at concentrations of 9.9μg Cu/L and higher. The No Observed Effect Concentration (NOEC) derived from this study was 5.7μg dissolved Cu/L. Taking into account the DOC concentration of the mesocosm water this NOEC is comparable to the PNEC derived from the SSD. Copyright © 2015. Published by Elsevier B.V.

  17. New xenophytes from La Palma (Canary Islands, Spain, with emphasis on naturalized and (potentially invasive species

    Directory of Open Access Journals (Sweden)

    R. Otto

    2016-07-01

    Full Text Available Many years of field work in La Palma (western Canary Islands yielded a number of interesting new records of non-native vascular plants. Amaranthus blitoides, A. deflexus, Aptenia cordifolia, Argemone ochroleuca, Begonia schmidtiana, Capsella rubella, Cardamine hamiltonii, Centratherum punctatum, Cerastium fontanum subsp. vulgare, Chasmanthe floribunda (widely confused with C. aethiopica and Crocosmia xcrocosmiiflora in Macaronesia, Chenopodium probstii, Commelina latifolia var. latifolia, Dichondra micrantha, Dysphania anthelmintica, Epilobium ciliatum, Erigeron sumatrensis, Erodium neuradifolium, Eucalyptus globulus, Euphorbia hypericifolia, E. maculata, Gamochaeta antillana, Geranium pyrenaicum, Hedychium coronarium, Hypochaeris radicata, Kalanchoe daigremontiana, K. delagoensis, K. xhoughtonii, Kickxia commutata subsp. graeca, K. spuria subsp. integrifolia, Lactuca viminea subsp. ramosissima, Landoltia punctata, Malvastrum coromandelianum subsp. capitatospicatum, Oenothera jamesii, Orobanche nana, Oxalis latifolia, Papaver hybridum, P. setigerum, Pilea microphylla, Podranea ricasoliana, Polygonum arenastrum, Portulaca granulatostellulata, P. nicaraguensis, P. nitida, P. papillatostellulata, Rumex crispus subsp. crispus, R. pulcher subsp. pulcher, R. xpratensis, Sechium edule, Sida spinosa var. angustifolia, Silene nocturna, Solanum abutiloides, S. alatum, S. decipiens, Sonchus tenerrimus, Spergularia marina, Stellaria pallida, Tragopogon porrifolius subsp. australis, Tribulus terrestris and Trifolium repens subsp. repens are naturalized or (potentially invasive xenophytes, reported for the first time from either the Canary Islands or from La Palma. 37 additional, presumably ephemeral taxa are reported for the first time from the Canary Islands, whereas 56 ephemeral taxa are new for La Palma..

  18. Potensi Ekstrak Tumbuhan Sebagai Pengawet Produk Pangan

    Directory of Open Access Journals (Sweden)

    I Nengah Kencana Putra

    2015-04-01

    Full Text Available Nowadays, the use of natural antimicrobials such as plants extracts to preserve food get much attention of the researchers. This is related to the increasing of public concern over synthetic chemical food preservatives. Various types of plants had been declared can produce extracts that effectively inhibited the growth of food-contaminating microbes, such as methanol and ethanol extracts of bark Saccoglottis gabonensis, effectively inhibited the growth of Leuconostoc mesenteroides and Lactobacillus plantarum; extracts of onion and red pepper inhibited Candida crucei and Candida utilis; ethanol and water extracts of Eugenia Jambos had antimicrobial properties against bacteria such as Staphylococcus aureus, Yersenia enterocolitica, Staphylococcus hominis, Staphylococcus cohnii, Staphylococcus warneri; Picung seed extract (Pagium edule inhibited the growth of Staphylococcus aureus; and ethanol extract of Salvia pratensis leaves inhibited Escherichia coli, Bacillus cereus and Saccharomyces cerevisiae. Extraction of antimicrobial compounds from plant material could be done by using different types of solvents. Among the various types of solvents, ethanol and methanol solvents are most commonly used.Keyword: antimicrobial, plant extract, food preservative

  19. Extending research on the influence of grammatical gender on object classification: A cross-linguistic study comparing Estonian, Italian and Lithuanian native speakers

    Directory of Open Access Journals (Sweden)

    Luca Vernich

    2017-05-01

    Full Text Available Using different experimental tasks, researchers have pointed to a possible correlation between grammatical gender and classification behaviour. Such effects, however, have been found comparing speakers of a relatively small set of languages. Therefore, it’s not clear whether evidence gathered can be generalized and extended to languages that are typologically different from those studied so far. To the best of our knowledge, Baltic and Finno-Ugric languages have never been examined in this respect. While most previous studies have used English as an example of gender-free languages, we chose Estonian because – contrary to English and like all Finno-Ugric languages – it does not use gendered pronouns (‘he’ vs. ‘she’ and is therefore more suitable as a baseline. We chose Lithuanian because the gender system of Baltic languages is interestingly different from the system of Romance and German languages tested so far. Taken together, our results support and extend previous findings and suggest that they are not restricted to a small group of languages. "Grammatiline sugu objektide kategoriseerimise mõjutajana: eesti, itaalia ja leedu keele võrdlev uurimus" Eri tüüpi eksperimente kasutades on uurijad osutanud grammatilise soo ja objektide klassifitseerimise võimalikele seostele. Senised tulemused on saadud siiski suhteliselt väheste keelte andmete võrdlemisel. Seetõttu ei ole teada, kas need järeldused on üldistatavad ka nendele keeltele, mille struktuur erineb siiani uuritud keeltest. Probleemi uurimiseks laiendasime vaadeldavate keelte hulka ja tegime grammatilise soo ja objektide kategoriseerimise seoste katse läbi balti ja soome-ugri keelte hulka kuuvate keeltega, mida ei ole kõnealusest vaatenurgast uuritud. Enamik seniseid uuringuid on seadnud nn lähtepunktiks ehk grammatilise soota keeleks inglise keele. Siinses uuringus valisime aga selliseks lähtepunktiks hoopis eesti keele, kus erinevalt inglise keelest ei ole ka

  20. Sterilization: new method options, failure rate info.

    Science.gov (United States)

    1998-01-01

    This article discusses new sterilization methods for tubal ligation, failure rates, and risks for ectopic pregnancy in the US. The Filshie clip, which was developed by Femcare, Ltd. in Nottingham, England, and is distributed by Avalon Medical Corp of Vermont, was approved by the US Food and Drug Administration in September 1996. The company has provided training sessions at major universities nationwide and exhibited at national professional association meetings. A training video and two more films will be available in 1998. The new clip is considered a more modern approach to a tubal occlusion method, which relies on newer materials and solves prior problems. Physicians usually used Falope rings, which had better failure rates than the Hulka clip and bipolar coagulation methods. There is a need for more long-term and large scale information exchange about the new Filshie clip. Some physicians still use the Falope ring because it is cost effective and well-studied. Physicians are warned to continue to advise women about the potential failure rates up to 10 years after sterilization and the 1 in 3 risk of ectopic pregnancy. Counseling about failure rates and the risk of ectopic pregnancy should target women under 30 years old, who have the highest failure rates, and women 30-34 years old. All sterilized women should be advised to seek a provider immediately if they have pregnancy symptoms following sterilization. Counseling should include the issue of "regrets," since it is a permanent method. All women should know about nonpermanent methods and experience a basic informed consent process. Young women and newly divorced women are particularly vulnerable to the "regrets" syndrome.

  1. Od melancholii do rozpaczy. O prozie Andrzeja Stasiuka

    Directory of Open Access Journals (Sweden)

    Claudia Snochowska-Gonzalez

    2014-06-01

    Full Text Available From melancholy to despair. About Andrzej Stasiuk’s prose works In Moja Europa, Jadąc do Babadag and Fado Andrzej Stasiuk describes his travelling to the countries of the East-Central Europe: its diminished, forgotten part, lying on the margins of History and Progress. It is a land of melancholy, of the eternal emptiness and lack. To praise it means to give an ironic response to the enthusiasm of a “return to the West”, to the attempts to meet East-European stigma and to the West’s fear of East-European ferocity. What is the source of this melancholy? Stasiuk refers to Cioran, his philosophy of history, his resignation and his belief in the bankruptcy of the European civilization. We know, however, that in the case of Cioran melancholy covers the memory of philosopher’s commitment to Romanian fascism; his subsequent melancholy replaces responsibility. What are the wounds and silenced victims hiding in Stasiuk’s melancholic landscape? What kind of responsibility does he not want to accept? In his next book, Dziennik pisany później, Stasiuk comes back to the same countries, this time not trying to escape the hell of questions about the East-European ethnic carnage. The author of the article analyses his turning point, using the terminology developed in Peter Hallward’s Absolutely Post-colonial to describe the dynamics between two tendencies: singular and specific.   Od melancholii do rozpaczy. O prozie Andrzeja Stasiuka W Mojej Europie, Jadąc do Babadag i Fado Andrzej Stasiuk podróżuje po krajach Europy Środkowo-Wschodniej. To Europa pomniejsza, zapomniana, na marginesie Historii i Postępu. Jest to kraina melancholii, pustki i wiecznego braku. Opiewanie jej staje się ironiczną odpowiedzią na entuzjazm „powrotu do Zachodu”, na próby sprostania wschodnioeuropejskiemu piętnu i na zachodnie przerażenie wschodnioeuropejską dzikością. Skąd się jednak bierze spowijająca ją melancholia? Stasiuk powołuje się na

  2. How the food supply harvestable by waders in the Wadden Sea depends on the variation in energy density, body weight, biomass, burying depth and behaviour of tidal-flat invertebrates

    Science.gov (United States)

    Zwarts, Leo; Wanink, Jan H.

    For several reasons, waders in the Wadden Sea face a large seasonal and annual variation in their food supply. Observations on a tidal flat in the Dutch Wadden Sea have shown that: - (1) The average energy density of ten invertebrate prey species varies between 21 and 23 kJ·g -1 AFDW. In Scrobicularia plana and Mya arenaria, but not in Macoma balthica, the energy density is 10% lower in winter than in summer. - (2) Depending on the species, body weights of prey of similar size are 30 to 60% lower in winter than in summer. - (3) The year-to-year fluctuation in standing-crop biomass is larger in some species than in others, the difference depending mainly on the frequency of successful recruitment. The overall biomass of the macrobenthos in winter is half of that in summer, but the timing of the peak biomass differs per species. - (4) The burying depth varies per species: Cerastoderma edule live just beneath the surface, while M. balthica, S. plana, M. arenaria, Arenicola marina and Nereis diversicolor bury more deeply and the majority of these prey live out of reach of the bird's bill. In all six species, burying depth increases with size. There is no seasonal variation in depth of C. edule and M. arenaria, but the four other species live at most shallow depth in early summer and most deeply in midwinter. Burying depths in winter vary from year to year, but are unrelated to temperature. Neither has temperature any effect on depth within months. For knot Calidris canutus feeding on M. balthica, the fluctuation in the accessible fraction was the main source of variation in the biomass of prey that is actually harvestable, i.e. the biomass of prey of suitable size that is accessible. Accordingly, the paper reviews the available data on the temporal variations in accessibility, detectability, ingestibility, digestibility and profitability of prey for waders. Only a small part of the prey is harvestable since many accessible prey are ignored because of their low

  3. Additions to the flora of Tenerife (Canary Islands, Spain

    Directory of Open Access Journals (Sweden)

    Verloove, F.

    2011-12-01

    Full Text Available Additions to the flora of Tenerife (Canary Islands, Spain.- Recent fieldwork in Tenerife, especially in September 2010, yielded several interesting new records of non-native vascular plants. Bothriochloa ischaemum var. songarica, “Asian” Cardamine flexuosa, Cestrum parqui, Digitaria violascens, Ficus lyrata, Ficus rubiginosa, Hoffmannseggia glauca, Hyparrhenia rufa subsp. altissima, Jacaranda mimosifolia, Merremia tuberosa, Passiflora morifolia, Phytolacca dioica, Schefflera actinophylla and Solanum abutiloides are reported for the first time from the Canary Islands, while Eragrostis barrelieri var. pygmaea, Ficus microcarpa, Ipomoea purpurea, Leucaena leucocephala subsp. glabrata, Sechium edule, Tradescantia zebrina and Turnera ulmifolia are new to the flora of the island of Tenerife. New records of Acacia cyclops, Atriplex suberecta, Heliotropium curassavicum, Paspalum dilatatum, P. notatum, Pluchea ovalis, Pulicaria paludosa, Sclerophylax spinescens and Solanum villosum subsp. miniatum confirm their recent expansion on the island of Tenerife. New records are provided for the recently described Sporobolus copei . Finally, Paspalum vaginatum (hitherto possibly confused with P. distichum and Potentilla indica are confirmed from the island of Tenerife.

    Adiciones para la flora de Tenerife (Islas Canarias, España.- Algunos recientes trabajos de campo en Tenerife, especialmente en Septiembre de 2010, trajeron consigo varias nuevas e interesantes adiciones de plantas vasculares no autóctonas. Bothriochloa ischaemum var. songarica, Cardamine flexuosa “Asiática”, Cestrum parqui, Digitaria violascens, Ficus lyrata, Ficus rubiginosa, Hoffmannseggia glauca, Hyparrhenia rufa subsp. altissima, Jacaranda mimosifolia, Merremia tuberosa, Passiflora morifolia, Phytolacca dioica, Schefflera actinophylla y

  4. Pulp fruit added to culture medium for in vitro orchid developmentPolpa de frutos adicionada ao meio de cultivo no crescimento in vitro de orquídea

    Directory of Open Access Journals (Sweden)

    Gilberto Rostirolla Batista de Souza

    2013-06-01

    Full Text Available As an additive in in vitro culture media, fruits have a great potential for facilitating economical orchid production because of lower technology requirements and the ease of obtaining raw materials to formulate culture media. We studied the in vitro growth of Cattleya bicolor Lindl. grown in a simplified culture medium supplemented with different kinds of fruit pulp. The experimental design was completely randomised, with eight seedlings per replication and ten replications per treatment, for a total of 80 seedlings per treatment. The culture medium was made using 150 g L -1 of pulp (without peel or seed from the following fruits: ripe Santa Cruz tomatoes (Solanum lycopersicum L., dwarf bananas (Musa cavendishii L. of intermediate ripeness, light green chayote (Sechium edule (Jacq. Sw, ripe papaya (Carica papaya L. or green coconut (Cocos nucifera L..The treatment control was MS 50 %. The treatments and the control were kept in a growth chamber for seven months before evaluating seedling survival percentage, shoot height, number of leaves, rooting percentage, root number, root length and dry masses of shoot and roots. The highest percentages of seedling survival were obtained using MS 50 %, banana and coconut medium. The seedling survival and rooting percentages illustrate that it is possible to emphasise the culture medium MS 50% and the culture medium supplemented with coconut on the most traditional culture medium with banana or tomato pulp. For the in vitro development of Cattleya bicolor Lindl., a simplified culture medium supplemented with coconut pulp is the most suitable for use as an alternative to MS 50%. A simplified culture medium supplemented with papaya pulp is not recommended for the in vitro development of Cattleya bicolor Lindl. Os frutos apresentam potencial para serem utilizados na elaboração de meios de cultivo para facilitar a produção de orquídeas em pequenas propriedades, contribuindo para a rentabilidade do cultivo

  5. Shellfish Fishery Severely Reduces Condition and Survival of Oystercatchers Despite Creation of Large Marine Protected Areas

    Directory of Open Access Journals (Sweden)

    Simon Verhulst

    2004-06-01

    Full Text Available Fisheries and other human activities pose a global threat to the marine environment. Marine protected areas (MPAs are an emerging tool to cope with such threats. In the Dutch Wadden Sea, large MPAs (covering 31% of all intertidal flats have been created to protect shellfish-eating birds and allow recovery of important habitats. Even though shellfish fishing is prohibited in these areas, populations of shellfish-eating birds in the Wadden Sea have declined sharply. The role of shellfish fisheries in these declines is hotly debated, therefore, we investigated the effectiveness of MPAs for protecting oystercatcher (Haematopus ostralegus populations. Shellfish stocks (cockles, Cerastoderma edule were substantially higher in the MPAs, but surprisingly this has not resulted in a redistribution of wintering oystercatchers. Oystercatchers in unprotected areas had less shellfish in their diet and lower condition (a combined measure of mass and haematological parameters, and their estimated mortality was 43% higher. It is likely, therefore, that shellfish fishing explains at least part of the 40% decline in oystercatcher numbers in recent years. Condition and mortality effects were strongest in males, and the population sex ratio was female biased, in agreement with the fact that males rely more on shellfish. The unprotected areas apparently function as an "ecological trap," because oystercatchers did not respond as anticipated to the artificial spatial heterogeneity in food supply. Consequently, the MPAs are effective on a local scale, but not on a global scale. Similar problems are likely to exist in terrestrial ecosystems, and distribution strategies of target species need to be considered when designing terrestrial and marine protected areas if they are to be effective.

  6. STUDI KOMUNITAS RUMPUT LAUT DI PANTAI SANUR DAN PANTAI SAWANGAN NUSA DUA BALI

    Directory of Open Access Journals (Sweden)

    GALIH INDRAWATI

    2012-11-01

    Full Text Available Aims of this research are to analyze structure community population, relative population, variety domination, heterogeneous, and equality of seaweed species in Sanur and Sawangan Beach Nusa Dua.The result of the study shows that in Sanur and Sawangan Beach observed 13 related seaweed species were observed, which are: Ulva reticulata, Chaetomorpha crassa, Bornetella nitida, Halimeda macroloba, Padina australis, Sargassum binderi, Hypnea asperi, Dictyopteris sp, Gracilaria coronapifolia, Gracilaria gracilis, Acanthopora spicifera, Euchema edule, Euchema denticulatum Meanwhile, , Caulerpa racemosa, Boergesiana forbessii, Sargassum crassifolium, Gelidium sp, Turbinaria ornata, Gracilaria foliifera only observed in Sanur Beach and species of Actinotrichia fragilis, Ulva lactuca, Euchema serra, Turbinaria conoides observed in Sawangan Beach, Nusa Dua.Heterogeneous value index (H in Sanur Beach is 0.75 – 1.87 categorized as medium category, except in station five characterized as low category. Domination index (C is 0.10 – 0.28, where there is no dominated species. Equality index value (E is 0.32 – 0.85 in unstable condition, except in station one is stable. In Sawangan Beach, heterogeneous indexes is 1.04 – 1.54, that spread in all stations by medium category. Domination index is 0.14 – 0.30, indicated that there is no dominant species. Equality index is 0.47 – 0.74, by stabile condition in station one, while others station is unstable. Highest relatif population in Sanur Beach is 37.63% in station three (Gracilaria foliifera. In Sawangan Nusa Dua Beach is Hypnea asperi (48.65%.Substrate analysis show that Sanur and Sawangan Beach has mud sand types. Water temperature in both research locations approximately is 28.90 C – 30.40 C, pH 7.00 – 7.80 and dissolved oxygen around 6.8mg/1-7.4mg/l.

  7. Penggunaan Ekstrak Bahan Alami Untuk Menghambat Infestasi Lalat Selama Penjemuran Ikan Jambal Asin

    Directory of Open Access Journals (Sweden)

    Farida Ariyani

    2007-11-01

    Full Text Available lkan jambal asin adalah ikan asin kering yang dibuat dengan cara memfermentasikan ikan dalam garam sebelum penjemuran. Untuk mengurangi infestasi lalat selama penjemuran pada pengolahan ikan jambal asin, penelitian penggunaan ekstrak bahan alami sebagai insektisida telah dilakukan. Penelitian ini dilakukan 2 tahap, yaitu penelitian pendahuluan dan penelitian utama. Pada penelitian pendahuluan, bahan baku yang digunakan adalah ikan manyung (Arius thalassinus dan bahan alami yang diuji adalah ekstrak daun mimba (Azadirachta indica A. Juss dan daun picung (Pangium edule Reinw masing‑masing dengan konsentrasi 2,5; 7,5; 10,0; 12,5 % (b/v, serta ekstrak bawang putih (Allium sativum dengan konsentrasi 1,5; 3,0; 4,5; 6,0; 7,5 % (b/v. lkan yang telah difermentasi dalam garam direndam dalarn ekstrak bahan alami selama 30 detik, kemudian dilakukan penjemuran sehingga menjadi ikan jambal asin. Selama penjemuran dan penyimpanan dilakukan pengamatan tingkat infestasi lalat, larva dan pupa. Hasil penelitian pendahuluan menunjukkan bahwa ekstrak bawang putih merupakan bahan yang paling efektif untuk menghambat infestasi lalat sehingga dipilih untuk digunakan pada penelitian utama. Pada penelitian utama, bahan baku yang digunakan adalah ikan patin (Pangasius hypophthalmus. lkan patin yang telah difermentasi direndam dalam ekstrak bawang putih dengan konsentrasi 3, 6 dan 9% (b/v dengan waktu perendaman 0, 5, 10, dan 15 menit. Pengamatan dilakukan terhadap tingkat infestasi lalat dan karakteristik organoleptik produk ikan jambal asin. Hasil penelitian utama menunjukkan bahwa perlakuan terbaik yang memberikan tingkat infestasi lalat terkecil dan dapat diterima panelis adalah perendaman dalarn ekstrak bawang putih 9% selama 10 menit.

  8. Accumulation of Sellafield-derived radiocarbon ("1"4C) in Irish Sea and West of Scotland intertidal shells and sediments

    International Nuclear Information System (INIS)

    Tierney, Kieran M.; Muir, Graham K.P.; Cook, Gordon T.; MacKinnon, Gillian; Howe, John A.; Heymans, Johanna J.; Xu, Sheng

    2016-01-01

    The nuclear energy industry produces radioactive waste at various stages of the fuel cycle. In the United Kingdom, spent fuel is reprocessed at the Sellafield facility in Cumbria on the North West coast of England. Waste generated at the site comprises a wide range of radionuclides including radiocarbon ("1"4C) which is disposed of in various forms including highly soluble inorganic carbon within the low level liquid radioactive effluent, via pipelines into the Irish Sea. This "1"4C is rapidly incorporated into the dissolved inorganic carbon (DIC) reservoir and marine calcifying organisms, e.g. molluscs, readily utilise DIC for shell formation. This study investigated a number of sites located in Irish Sea and West of Scotland intertidal zones. Results indicate "1"4C enrichment above ambient background levels in shell material at least as far as Port Appin, 265 km north of Sellafield. Of the commonly found species (blue mussel (Mytilus edulis), common cockle (Cerastoderma edule) and common periwinkle (Littorina littorea)), mussels were found to be the most highly enriched in "1"4C due to the surface environment they inhabit and their feeding behaviour. Whole mussel shell activities appear to have been decreasing in response to reduced discharge activities since the early 2000s but in contrast, there is evidence of continuing enrichment of the carbonate sediment component due to in-situ shell erosion, as well as indications of particle transport of fine "1"4C-enriched material close to Sellafield. - Highlights: • We measure "1"4C activity in shells and sediment at sites on the UK west coast. • Mussel shell activity varies in response to average "1"4C discharges from Sellafield. • Shell activities reflect species feeding habits and ecological niche. • NE Irish Sea inorganic sediment activity will gradually increase. • Increases in sediment activity will occur at remote sites on the Scottish west coast.

  9. BMAA in shellfish from two Portuguese transitional water bodies suggests the marine dinoflagellate Gymnodinium catenatum as a potential BMAA source.

    Science.gov (United States)

    Lage, Sandra; Costa, Pedro Reis; Moita, Teresa; Eriksson, Johan; Rasmussen, Ulla; Rydberg, Sara Jonasson

    2014-07-01

    The neurotoxin β-N-methylamino-l-alanine (BMAA) and its putative role in multiple neurodegenerative diseases have been intensely studied since 2005 when the toxin was discovered to be produced by worldwide-distributed cyanobacterial species inhabiting terrestrial, marine, brackish, and freshwater ecosystems. Recently, BMAA production was also associated with one eukaryotic group, namely, diatoms, raising questions about its production by other phytoplanktonic groups. To test for BMAA bioavailability in ecosystems where abundant phytoplanktonic blooms regularly occur, samples of filter-feeding shellfish were collected in two Portuguese transitional water bodies. BMAA content in cockles (Cerastoderma edule) collected weekly between September and November 2009 from Ria de Aveiro and at least once a month from May to November from Ria Formosa, fluctuated from 0.079±0.055 to 0.354±0.066μg/g DW and from below the limit of detection to 0.434±0.110μg/g DW, respectively. Simultaneously to BMAA occurrence in cockles, paralytic shellfish toxins were detected in shellfish as a result of Gymnodinium catenatum blooms indicating a possible link between this marine dinoflagellate and BMAA production. Moreover, considerable high BMAA levels, 0.457±0.186μg/g DW, were then determined in a laboratory grown culture of G. catenatum. This work reveals for the first time the presence of BMAA in shellfish from Atlantic transitional water bodies and consubstantiate evidences of G. catenatum as one of the main sources of BMAA in these ecosystems. Copyright © 2014 Elsevier B.V. All rights reserved.

  10. Ecology of megabenthic bivalve communities from sandy beaches on the south coast of Portugal

    Directory of Open Access Journals (Sweden)

    Marta M. Rufino

    2010-03-01

    Cardiidae (except Acanthocardia tuberculata and Cerastoderma edule included mostly species occurring in deeper waters. Bathymetric sequence of species distribution within some families was observed.

  11. The human alimentary tract transfer and body retention of environmental polonium-210

    International Nuclear Information System (INIS)

    Hunt, G J; Rumney, H S

    2007-01-01

    This paper presents the results of a 4 year study to investigate the human alimentary tract transfer factor (f A value) and body retention of 210 Po in shellfish. In the first 3 years, mussels (Mytilus edulis L.), cockles (Cerastoderma edule L.) and brown meat from crab (Cancer pagurus L.) were successively studied. In each year five volunteers (from a pool of seven) ate a suitable portion of the shellfish and provided 24 h samples of excreta usually for 3 days before and for at least 7 days during and after eating. Subsamples of shellfish were analysed to determine the intakes of 210 Po. Faeces were analysed and the data used to assess apparent f A values. Urine samples were analysed in the mussel and crab studies to provide urinary excretion parameters. Pb-210 was also analysed during the mussel study; the levels were low, leading to large uncertainties, but confirming the negligible effect of radioactive decay to its granddaughter 210 Po in the main study. In the fourth year, larger samples of brown crab meat were eaten by five volunteers and faecal samples were taken at suitable times over periods of up to 43 days to study body retention of 210 Po. The first ∼7 days provided additional data on f A values. Pooled results for the apparent f A for the whole study lay in the range 0.15-0.65 with a mean of 0.46; corrections for endogenous excretion suggest a true f A value of ∼0.51, supporting the value of 0.5 currently used by the International Commission on Radiological Protection (ICRP). The retention data suggest a biological half-time of about 40 days, in broad consistency with the 50 days currently used by the ICRP. Thus there is no strong evidence from this study suggesting a change in dose coefficient for 210 Po. Full experimental data are provided to allow independent further interpretation

  12. Promoción positiva de vegetales en preescolares costarricenses empleando el Kamishibai

    Directory of Open Access Journals (Sweden)

    Alejandro Chacón-Villalobos

    2015-01-01

    Full Text Available Este artículo presenta la evaluación de la promoción positiva de los vegetales chayote (Sechium edule y brócoli (Brassica oleracea L, al emplear la estrategia de animación a la lectura conocida como Kamishibai. Durante el año 2012 en San José, se estudió la actitud infantil hacia los vegetales (positiva, negativa o neutra, y el agrado sensorial que manifestaba esta población antes de la exposición al Kamishibai y posterior a la misma. Se trabajó con 213 infantes preescolares entre los 4 y 6 años de edad. Las evaluaciones de actitud se efectuaron por medio de una entrevista, mientras que el agrado se estudió por medio de un panel sensorial. La exposición al Kamishibai consistió en 10 intervenciones en la forma de sesiones de cuentos, donde se dividieron los infantes en cuatro grupos según género del menor y género del personaje del cuento que promocionó el vegetal. Todas las actividades se llevaron a cabo en un espacio de juego acondicionado para tal efecto en el salón de clases. A partir de los resultados obtenidos, puede argumentarse que el uso del Kamishibai como técnica de animación a la lectura incrementó significativamente la opinión positiva y el agrado inicial hacia los vegetales en los menores (p<0,05, indiferentemente de su género y del género de las figuras que efectuaron la promoción.

  13. Promoción positiva de vegetales en preescolares costarricenses empleando el Kamishibai

    Directory of Open Access Journals (Sweden)

    Alejandro Chacón-Villalobos

    2015-07-01

    Full Text Available Este artículo presenta la evaluación de la promoción positiva de los vegetales chayote (Sechium edule y brócoli (Brassica oleracea L, al emplear la estrategia de animación a la lectura conocida como Kamishibai. Durante el año 2012 en San José, se estudió la actitud infantil hacia los vegetales (positiva, negativa o neutra, y el agrado sensorial que sentía esta población antes de la exposición al Kamishibai y, posterior a la misma; se trabajó conn 213 infantes preescolares entre los 4 y 6 años de edad. Las evaluaciones de actitud se efectuaron por medio de una entrevista, mientras que el agrado se estudió por medio de un panel sensorial. La exposición al Kamishibai consistió en 10 intervenciones en la forma de sesiones de cuentos, donde se dividieron los infantes en cuatro grupos según género del menor y género del personaje del cuento que promocionó el vegetal. Todas las actividades se llevaron a cabo en un espacio de juego acondicionado para tal efecto en el salón de clases. A partir de los resultados obtenidos, puede argumentarse que el uso de la técnica del Kamishibai como técnica de animación a la lectura incrementó significativamente la opinión positiva y el agrado inicial hacia los vegetales en estas personas menores (p<0,05, indiferentemente de su género y del género de las figuras que efectuaron la promoción.

  14. Pathogenicity for onion and genetic diversity of isolates of the pathogenic fungus Colletotrichum gloeosporioides (Phyllachoraceae) from the State of Pernambuco, Brazil.

    Science.gov (United States)

    Nova, M X Vila; Borges, L R; de Sousa, A C B; Brasileiro, B T R V; Lima, E A L A; da Costa, A F; de Oliveira, N T

    2011-02-22

    Onion anthracnose, caused by Colletotrichum gloeosporioides, is one of the main diseases of onions in the State of Pernambuco. We examined the pathogenicity of 15 C. gloeosporioides strains and analyzed their genetic variability using RAPDs and internal transcribed spacers (ITS) of the rDNA region. Ten of the strains were obtained from substrates and hosts other than onion, including chayote (Sechium edule), guava (Psidium guajava), pomegranate (Punica granatum), water from the Capibaribe River, maracock (Passiflora sp), coconut (Cocus nucifera), surinam cherry (Eugenia uniflora), and marine soil; five isolates came from onions collected from four different regions of the State of Pernambuco and one region of the State of Amazonas. Pathogenicity tests were carried out using onion leaves and bulbs. All strains were capable of causing disease in leaves, causing a variable degree of lesions on the leaves; four strains caused the most severe damage. In the onion bulb tests, only three of the above strains caused lesions. Seven primers of arbitrary sequences were used in the RAPD analysis, generating polymorphic bands that allowed the separation of the strains into three distinct groups. The amplification products generated with the primers ITS1 and ITS4 also showed polymorphism when digested with three restriction enzymes, DraI, HaeIII and MspI. Only the latter two demonstrated genetic variations among the strains. These two types of molecular markers were able to differentiate the strain from the State of Amazonas from those of the State of Pernambuco. However, there was no relationship between groups of strains, based on molecular markers, and degree of pathogenicity for onion leaves and bulbs.

  15. Trematode infection modulates cockles biochemical response to climate change.

    Science.gov (United States)

    Magalhães, Luísa; de Montaudouin, Xavier; Figueira, Etelvina; Freitas, Rosa

    2018-05-06

    Resulting mainly from atmospheric carbon dioxide (CO 2 ) build-up, seawater temperature rise is among the most important climate change related factors affecting costal marine ecosystems. Global warming will have implications on the water cycle, increasing the risk of heavy rainfalls and consequent freshwater input into the oceans but also increasing the frequency of extreme drought periods with consequent salinity increase. For Europe, by the end of the century, projections describe an increase of CO 2 concentration up to 1120 ppm (corresponding to 0.5 pH unit decrease), an increase in the water temperature up to 4 °C and a higher frequency of heavy precipitation. These changes are likely to impact many biotic interactions, including host-parasite relationships which are particularly dependent on abiotic conditions. In the present study, we tested the hypothesis that the edible cockle, Cerastoderma edule, exposed to different salinity, temperature and pH levels as proxy for climate change, modify the infection success of the trematode parasite Himasthla elongata, with consequences to cockles biochemical performance. The results showed that the cercariae infection success increased with acidification but higher biochemical alterations were observed in infected cockles exposed to all abiotic experimental stressful conditions tested. The present study suggested that changes forecasted by many models may promote the proliferation of the parasites infective stages in many ecosystems leading to enhanced transmission, especially on temperate regions, that will influence the geographical distribution of some diseases and, probably, the survival capacity of infected bivalves. Copyright © 2018 Elsevier B.V. All rights reserved.

  16. Reproductive investment in the intertidal bivalve Macoma balthica

    Science.gov (United States)

    Honkoop, P. J. C.; Van der Meer, J.; Beukema, J. J.; Kwast, D.

    1999-05-01

    Bivalve eggs generally contain large amounts of lipids which, in comparison with proteins and carbohydrates, have high energy contents and are thus costly in energetic terms. As lipid contents vary between species, comparisons of reproductive investments should not only include numbers and sizes of eggs, but also their energy content. We estimated the investment in egg material of mature females of the Baltic tellin Macoma balthica (L.) in terms of both mass and energy content. All mass below a minimum body mass (below which no eggs are produced) was defined as structural mass. This threshold amounts to a body mass index (BMI) of 5.6 (ash-free dry mass per cubic shell length in mg cm -3). More than half (55%) of the mass above the structural mass was invested in egg material and 45% in extra somatic tissue and tissue for production and storage of gametes. This means that the amount of eggs spawned ranged from 0 (at BMI = 5.6 mg cm -3) to 33% of the total ash-free dry mass (at a high BMI value of 14 mg cm -3). Eggs contained a relatively large amount of lipids, about 30% of their ash-free dry mass, whereas non-egg material contained only about 7% lipids. Eggs of two other bivalves in the Wadden Sea, the cockle Cerastoderma edule and the mussel Mytilus edulis, were smaller and contained only about 11% and 20% lipids, respectively. Energy content of M. balthica eggs amounted to ˜0.006 J, in the other two species to ˜0.002 J. The function of the more expensive eggs in M. balthica may be related to its early spawning in spring, causing slower larval development until first feeding.

  17. Multiscale patterns in the diversity and organization of benthic intertidal fauna among French Atlantic estuaries

    Science.gov (United States)

    Blanchet, Hugues; Gouillieux, Benoît; Alizier, Sandrine; Amouroux, Jean-Michel; Bachelet, Guy; Barillé, Anne-Laure; Dauvin, Jean-Claude; de Montaudouin, Xavier; Derolez, Valérie; Desroy, Nicolas; Grall, Jacques; Grémare, Antoine; Hacquebart, Pascal; Jourde, Jérôme; Labrune, Céline; Lavesque, Nicolas; Meirland, Alain; Nebout, Thiebaut; Olivier, Frédéric; Pelaprat, Corine; Ruellet, Thierry; Sauriau, Pierre-Guy; Thorin, Sébastien

    2014-07-01

    Based on a parallel sampling conducted during autumn 2008, a comparative study of the intertidal benthic macrofauna among 10 estuarine systems located along the Channel and Atlantic coasts of France was performed in order to assess the level of fauna similarity among these sites and to identify possible environmental factors involved in the observed pattern at both large (among sites) and smaller (benthic assemblages) scales. More precisely this study focused on unraveling the observed pattern of intertidal benthic fauna composition and diversity observed at among-site scale by exploring both biotic and abiotic factors acting at the among- and within-site scales. Results showed a limited level of similarity at the among-site level in terms of intertidal benthic fauna composition and diversity. The observed pattern did not fit with existing transitional water classification methods based on fish or benthic assemblages developed in the frame of the European Water Framework Directive (WFD). More particularly, the coastal plain estuaries displayed higher among-site similarity compared to ria systems. These coastal plain estuaries were characterized by higher influence of river discharge, lower communication with the ocean and high suspended particulate matter levels. On the other hand, the ria-type systems were more dissimilar and different from the coastal plain estuaries. The level of similarity among estuaries was mainly linked to the relative extent of the intertidal "Scrobicularia plana-Cerastoderma edule" and "Tellina tenuis" or "Venus" communities as a possible consequence of salinity regime, suspended matter concentrations and fine particles supply with consequences on the trophic functioning, structure and organization of benthic fauna. Despite biogeographical patterns, the results also suggest that, in the context of the WFD, these estuaries should only be compared on the basis of the most common intertidal habitat occurring throughout all estuarine systems

  18. EFEITO DO TRATAMENTO TÉRMICO NAS CARACTERÍSTICAS FÍSICO-QUÍMICAS E MICROBIOLÓGICAS DA POLPA DE MARACUJÁ

    Directory of Open Access Journals (Sweden)

    ALESSANDRA PADOVANE AMARO

    2009-07-01

    Full Text Available

    Frutos de maracujá amarelo (Passjflora edulls f. flavicarpa Deg., material IAC-275, foram processados para a obtenção da polpa. A polpa obtida foi pasteurizada durante 30 segundos empregando três faixas de temperatura (69 a 72ºC, 73 a 76ºC e 77 a 82ºC. Foi também obtida polpa fresca (sem pasteurizar. Polpas fresca e pasteurizadas foram comparadas utilizando avaliações físico-químicas e microbiológicas. Não houve diferença significativa (p > 0,05 nos valores de acidez total, no pH e no ratio das polpas fresca e pasteurizada. A polpa fresca apresentou menor conteúdo de sólidos solúveis totais (p < 0,05 em relação à polpa pasteurizada e conteúdo de vitamina C praticamente similar, embora tenha havido diferença significativa (p < 0,05 entre a polpa pasteurizada na faixa de temperatura de 69 a 72ºC e as demais. As perdas de vitamina C decorrentes do processamento foram de 5%,4% e 0,6%, quando as faixas de temperatura de 69 a 72°C, 73 a 76°C e 77 a 82°C foram, respectivamente, empregadas. Os resultados da análise microbiológica mostraram que as polpas pasteurizadas apresentaram contagem de bolores e leveduras, de mesófilos aeróbios e de psicrófilos aeróbios significativamente (p < 0,05 menor quando comparadas à polpa fresca, indicando que o tratamento térmico empregado foi adequado.

  19. [State strategy for Cycad (Zamiaceae) conservation: a proposal for the State of Hidalgo, Mexico].

    Science.gov (United States)

    Vite, Aurelia; Pulido, María T; Flores-Vázquez, Juan C

    2013-09-01

    Mexico has the second largest cycad diversity in the world, and the Sierra Madre Oriental (SMO) is one of the richest biogeographic regions for these plants. Despite there is a general Cycad National Program in the country, there are no state-level cycad conservation strategies or programs. Thus the aim of this study was to propose a cycad conservation strategy for the state of Hidalgo, which is located in the Southern part of the SMO. For this, a cycad species inventory was made in the state, for which three methods were used: review of published literature; consultation in the main Mexican herbaria to verify botanical specimens; and exhaustive field research to compare findings with previously reported species and to recognize new records at the county and state level. The proposed research work strategy combined the following elements: prioritize the county and local areas with greatest cycad species richness; prioritize the species least resistant to environmental change and/or having restricted geographic distribution; and to consider the main uses of these plants by local residents. The results showed that Hidalgo has three genera and eight species ofcycads: Ceratozamia fuscoviridis, C. latifolia, C. mexicana, C. sabatoi, Dioon edule, Zamia fischeri, Z. loddigesii and Z. vazquezii, all of which are considered by the International Union for Conservation of Nature (IUCN). This study added two new species records for Hidalgo and 21 at the county level. The species are distributed in 26 counties, of which Chapulhuacán and Pisaflores are notable for their high species richness. Hidalgo has the fourth-greatest cycad species richness among Mexican states, although its area accounts for only 1.07% of the country. The state's diversity is greater than in other states with larger area, and even than in some other entire countries in Mesoamerica. The presented state cycad conservation strategy proposes that a total of some 11,325 ha to be conserved in nine zones

  20. Source and impact of lead contamination on δ-aminolevulinic acid dehydratase activity in several marine bivalve species along the Gulf of Cadiz

    International Nuclear Information System (INIS)

    Company, R.; Serafim, A.; Lopes, B.; Cravo, A.; Kalman, J.; Riba, I.; DelValls, T.A.; Blasco, J.; Delgado, J.; Sarmiento, A.M.; Nieto, J.M.; Shepherd, T.J.; Nowell, G.; Bebianno, M.J.

    2011-01-01

    Coastal areas and estuaries are particularly sensitive to metal contamination from anthropogenic sources and in the last few decades the study of space-time distribution and variation of metals has been extensively researched. The Gulf of Cadiz is no exception, with several rivers draining one of the largest concentrations of sulphide deposits in the world, the Iberian Pyrite Belt (IPB). Of these rivers, the Guadiana, one of the most important in the Iberian Peninsula, together with smaller rivers like the Tinto and Odiel, delivers a very high metal load to the adjacent coastal areas. The purpose of this work was to study the source and impact of lead (Pb) drained from historical or active mining areas in the IPB on the activity of a Pb inhibited enzyme (δ-aminolevulinic acid dehydratase, ALAD) in several bivalve species along the Gulf of Cadiz. Seven marine species (Chamelea gallina, Mactra corallina, Donax trunculus, Cerastoderma edule, Mytilus galloprovincialis, Scrobicularia plana and Crassostrea angulata) were collected at 12 sites from Mazagon, near the mouth of the rivers Tinto and Odiel (Spain), to Cacela Velha (Ria Formosa lagoon system, Portugal). Lead concentrations, ALAD activity and lead isotope ratios ( 206 Pb/ 204 Pb, 207 Pb/ 204 Pb and 208 Pb/ 204 Pb) were determined in the whole soft tissues. The highest Pb concentrations were determined in S. plana (3.50 ± 1.09 μg g -1 Pb d.w.) and D. trunculus (1.95 ± 0.10 μg g -1 Pb d.w.), while M. galloprovincialis and C. angulata showed the lowest Pb levels ( -1 Pb d.w.). In general, ALAD activity is negatively correlated with total Pb concentration. However this relationship is species dependent (e.g. linear for C. gallina ALAD = -0.36[Pb] + 0.79; r = 0.837; or exponential for M. galloprovincialis ALAD = 2.48e -8.3[Pb] ; r = 0.911). This indicates that ALAD activity has considerable potential as a biomarker of Pb and moreover, in marine bivalve species with different feeding habits. Lead isotope data

  1. The impact of extreme flooding events and anthropogenic stressors on the macrobenthic communities’ dynamics

    Science.gov (United States)

    Cardoso, P. G.; Raffaelli, D.; Lillebø, A. I.; Verdelhos, T.; Pardal, M. A.

    2008-02-01

    , heavy flooding in the Mondego region during the recovery process had more severe effects on these assemblages than expected, effectively re-setting the recovery clock, with significant socio-economic impacts (e.g. high mortality of fish in fish farms, and a large decline of economically important species, such as the bivalves Scrobicularia plana and Cerastoderma edule). The frequency and magnitude of these extreme events is predicted to increase in future years [IPCC WGI, 2001. Climate change 2001: the scientific basis, contribution of working group I to the third assessment report of the Intergovernmental Panel on Climate Change (IPCC). In: Houghton, J.T., Ding, Y., Griggs, D.J., Noguer, M., van der Linden, P.J., Xiaosu, D. (Eds.), Cambridge University Press, UK, 944 p.] and there is a risk that impacted ecosystems will never recover fully, with far-reaching consequences for human well being.

  2. Estudio de los síntomas asociados a la pérdida de color del chayote

    Directory of Open Access Journals (Sweden)

    J. Cadena-Iñiguez

    2005-01-01

    Full Text Available Bajo condiciones de invernadero, se reprodujeron los síntomas de deficiencias nutrimentales iniciales asociadas a la pérdida de vigor de planta y color del fruto de Sechium edule (Jacq. Sw. llamado chayote blanco, para evaluar la respuesta de adición de nutrimentos e inoculación de microsimbiontes. Se utilizó suelo de Actopan, Veracruz, México, separándolo en capas a 0-30, 30-60, 60-90 cm y mezcla del perfil completo para determinar su fertilidad. Se aplicaron 8.29 g de (NH42SO4, 1.0 g de Ca3 (PO42, 4.4 g de K2SO4, 1.15 g de FeSO4, MnSO4 y ZnSO4, y 0.75 g de azufre, 40 g de Glomus intraradices (MA y Azospirillum brasilense por cada 30 litros de capa de suelo. Se evaluó altura de planta, clorofila y biomasa total, asimilación de CO2 y análisis con rayos-X de cortes del cuarto entrenudo inferior a la yema apical del tallo principal. El suelo evaluado presentó compuestos solubles de Cl-, SO4 2-, HCO3 -, Na+ y pH de hasta 7.9, además de 5.6, 50.3 y 4.7 veces más P, Ca2+ y Mg2+ que los valores consignados para la especie. En suelo de la capa 0-30 cm, las plantas presentaron mayor crecimiento y menor en 30-60, 60-90 cm y la mezcla. Los nutrimentos combinados con MA, así como con MA y A. brasilense fueron estadísticamente significativos. Las plantas testigo mostraron cristales formados por P, Ca, S, Si, Na y Mg obstruyendo los vasos del xilema de tallo. La evidencia experimental mostró que los síntomas iniciales asociados a chayote blanco, se deben en gran medida a deficiencias nutrimentales, siendo más evidentes en capas de suelo inferiores a 0-30 cm

  3. Estudo da concordância das citações de uso e importância das espécies e famílias utilizadas como medicinais pela comunidade do bairro Ponta Grossa, Porto Alegre, RS, Brasil

    Directory of Open Access Journals (Sweden)

    Giovana Secretti Vendruscolo

    2006-06-01

    Full Text Available Ferramentas para quantificar dados etnobotânicos estão sendo usadas como complementares aos levantamentos sobre a utilização de plantas por populações. Neste trabalho são utilizadas técnicas para avaliar a concordância das citações de uso e a importância das espécies e famílias para as 51 pessoas entrevistadas no bairro Ponta Grossa, Porto Alegre, Rio Grande do Sul. Para tal, foram utilizados os cálculos de Valor de Uso (UV e a porcentagem corrigida de Concordância quanto aos Usos Principais (CUPc para as 142 espécies mencionadas no levantamento. As espécies Aloe arborescens Mill., Citrus × aurantium L., Achyrocline satureioides (Lam. DC., Foeniculum vulgare Mill, Eugenia uniflora L., Cunila microcephala Benth., Citrus limon (L. Osveck, Plectranthus barbatus Andrews, Cymbopogon citratus (DC. Stapf, Psidium guajava L., Artemisia absinthium L., Ocimum basilicum L., Plantago tomentosa Lam., Rosmarinus officinalis L., Persea americana Mill., Aloysia citrodora Palau, Sambucus australis Cham. & Schltdl., Cuphea carthagenensis (Jacq. J.F. Macbr., Petroselinum crispum (Mill. Nyman ex A.W. Hill, Ocimum selloi Benth. e Tanacetum vulgare L., nesta ordem de Valor de Uso, foram consideradas como as mais importantes para a população estudada. As famílias mais importantes foram Asphodelaceae, Caprifoliaceae, Rutaceae e Lythraceae. Para o cálculo da porcentagem a corrigida de Concordância quanto aos Usos Principais (CUPc foram consideradas como espécies principais as que apresentaram valores acima de 24%: Eugenia uniflora, Achyrocline satureioides, Psidium guajava, Cunila microcephala, Plectranthus barbatus, Citrus × aurantium, Citrus limon, Cymbopogon citratus, Punica granatum L., Sechium edule (Jacq. Sw., Sphagneticola trilobata (L. Pruski, Aloysia citrodora, Foeniculum vulgare, Plectranthus neochilus Schltr., Artemisia absinthium, Lippia alba (Mill. N.E. Br., Mikania laevigata Sch. Bip ex Baker, Aloe arborescens e Petroselinum

  4. Aplicación de Tecnología de Barreras para la Conservación de Mezclas de Vegetales Mínimamente Procesados / Application of Barrier Technology for the Conservation of Minimally Processed Vegetables Mixtures

    Directory of Open Access Journals (Sweden)

    Alejandro Escobar Hernández

    2014-03-01

    Full Text Available Los vegetales son componentes esenciales de la dietahumana y su procesamiento trae como consecuencia el rápido deterioro ocasionado por el aumento de las reacciones metabólicas, esto hace necesario que se utilicen tecnologías emergentes de conservación. En este trabajo se estudió el efecto de la tecnología de barreras (desinfección, tratamiento térmico, recubrimiento comestible, atmósfera modificada y refrigeración sobre la vida útil de una mezcla de vegetales mínimamente procesados compuesta por brócoli (Brassica oleracea var. itálica, coliflor (Brassica oleracea var. botrytis, zucchini (Cucurbita pepo L., chayote (Sechium edule, apio (Apium graveolens y zanahoria (Daucus carota. Las barreras fueron aplicadas a las hortalizas para luego ser envasadas en dos tipos de bandejas (empaque en atmósfera modificada y empaque en bandeja sello plus. Los vegetales se almacenaron durante 12 días en refrigeración (4 °C y 95% HR, se llevaron a cabo análisis microbiológicos, físicoquímicos y sensoriales, y un estudio de vida útil. Los resultados mostraron que el proceso de desinfección con NaClO 100 ppm y el tratamiento térmico de 60 °C durante 2 min, tuvieron efecto en la reducción de la población microbiana para el día cero de evaluación. La calidad general se conservó para los 12 días dealmacenamiento, en la zanahoria, chayote, coliflor y apio. Laevaluación fisicoquímica presentó diferencias estadísticamente significativas de los parámetros evaluados con respecto al tiempo de almacenamiento. El estudio de vida útil arrojó tiempos de 7 y 5 días para la mezcla de vegetales empacada en bandeja sello plus en atmósfera modificada, respectivamente. La combinación debarreras se muestra como alternativa viable en la conservación de mezclas de vegetales mínimamente procesados. /  Vegetables are essential components of the human diet. However, rapid deterioration of vegetables occurs after

  5. Vida útil de produto minimamente processado composto por abóbora, cenoura, chuchu e mandioquinha-salsa Shelf life of fresh-cut composed of vegetables

    Directory of Open Access Journals (Sweden)

    Juliana Alvarenga Alves

    2010-02-01

    Full Text Available Objetivou-se avaliar o efeito do tempo de armazenamento sobre a qualidade de produto minimamente processado à base de hortaliças: abóbora (Cucurbita moschata Duch, cenoura (Daucus carota L., chuchu (Sechium edule Swartz e mandioquinha-salsa (Arracacia xanthorrhiza Bancroft. As hortaliças foram sanificadas em hipoclorito de sódio 200 mg.L-1, por 5 minutos, descascadas, manualmente, e cortadas utilizando-se processador. O produto processado foi sanificado em hipoclorito de sódio 50 mg.L-1, por 3 minutos, e apenas as mandioquinhas-salsa foram imersas em solução de ácido ascórbico 1%, por 2 minutos. As embalagens flexíveis de polietileno de baixa densidade linear (25 x 20 cm, contendo 400 g do "mix", foram armazenadas a 5ºC e 99% UR, por 8 dias. A firmeza e o valor L* das hortaliças estudadas não alteraram com o tempo de armazenamento. Os valores a* e b* da abóbora não oscilaram durante o armazenamento. O valor a* da mandioquinha-salsa e do chuchu aumentou e o da cenoura diminuiu com o armazenamento, enquanto o valor b* da cenoura, do chuchu e da mandioquinha-salsa reduziu. O "mix" apresentou taxa de perda de massa muito baixa e ascensão respiratória até o oitavo dia. A atmosfera de equilíbrio, em torno de 2,93% de O2 e 7,06% de CO2, foi alcançada no interior da embalagem, contendo o "mix", a partir do segundo dia. Não foi detectada a presença de coliformes a 45ºC e Salmonella sp. em nenhuma amostra. Os coliformes a 35ºC aumentaram durante o armazenamento. Conclui-se que, o produto minimamente processado, à base de hortaliças mantém a sua qualidade por 8 dias a 5ºC.The objective of this work was to evaluate the effect of storage time on the quality of fresh-cut product made up of four vegetables: pumpkin (Cucurbita moschata Duch, carrot (Daucus carota L., chayote (Sechium edule Swartz, and peruvian carrot (Arracaia xanthorrhiza Bancroft. The vegetables were sanitized in sodium hypochlorite solution (200 mg.L-1 for 5

  6. Source and impact of lead contamination on {delta}-aminolevulinic acid dehydratase activity in several marine bivalve species along the Gulf of Cadiz

    Energy Technology Data Exchange (ETDEWEB)

    Company, R.; Serafim, A.; Lopes, B.; Cravo, A. [CIMA, University of Algarve, Campus de Gambelas, 8005-139 Faro (Portugal); Kalman, J.; Riba, I.; DelValls, T.A. [Catedra UNESCO/UNITWIN/WiCop, Department of Physical-Chemistry, Faculty Marine and Environmental Sciences, University of Cadiz, 11510 Puerto Real, Cadiz (Spain); Blasco, J. [Instituto Ciencias Marinas Andalucia (CSIC), Campus Rio San Pedro, 11510 Puerto Real, Cadiz (Spain); Delgado, J. [Department of Geology, University of Huelva, Avda Fuerzas Armadas s/n, 21071 Huelva (Spain); Sarmiento, A.M. [Catedra UNESCO/UNITWIN/WiCop, Department of Physical-Chemistry, Faculty Marine and Environmental Sciences, University of Cadiz, 11510 Puerto Real, Cadiz (Spain); Department of Geology, University of Huelva, Avda Fuerzas Armadas s/n, 21071 Huelva (Spain); Nieto, J.M. [Department of Geology, University of Huelva, Avda Fuerzas Armadas s/n, 21071 Huelva (Spain); Shepherd, T.J.; Nowell, G. [Department of Earth Sciences, University of Durham, Science Laboratories, Durham DH1 3LE (United Kingdom); Bebianno, M.J., E-mail: mbebian@ualg.pt [CIMA, University of Algarve, Campus de Gambelas, 8005-139 Faro (Portugal)

    2011-01-17

    Coastal areas and estuaries are particularly sensitive to metal contamination from anthropogenic sources and in the last few decades the study of space-time distribution and variation of metals has been extensively researched. The Gulf of Cadiz is no exception, with several rivers draining one of the largest concentrations of sulphide deposits in the world, the Iberian Pyrite Belt (IPB). Of these rivers, the Guadiana, one of the most important in the Iberian Peninsula, together with smaller rivers like the Tinto and Odiel, delivers a very high metal load to the adjacent coastal areas. The purpose of this work was to study the source and impact of lead (Pb) drained from historical or active mining areas in the IPB on the activity of a Pb inhibited enzyme ({delta}-aminolevulinic acid dehydratase, ALAD) in several bivalve species along the Gulf of Cadiz. Seven marine species (Chamelea gallina, Mactra corallina, Donax trunculus, Cerastoderma edule, Mytilus galloprovincialis, Scrobicularia plana and Crassostrea angulata) were collected at 12 sites from Mazagon, near the mouth of the rivers Tinto and Odiel (Spain), to Cacela Velha (Ria Formosa lagoon system, Portugal). Lead concentrations, ALAD activity and lead isotope ratios ({sup 206}Pb/{sup 204}Pb, {sup 207}Pb/{sup 204}Pb and {sup 208}Pb/{sup 204}Pb) were determined in the whole soft tissues. The highest Pb concentrations were determined in S. plana (3.50 {+-} 1.09 {mu}g g{sup -1} Pb d.w.) and D. trunculus (1.95 {+-} 0.10 {mu}g g{sup -1} Pb d.w.), while M. galloprovincialis and C. angulata showed the lowest Pb levels (<0.38 {mu}g g{sup -1} Pb d.w.). In general, ALAD activity is negatively correlated with total Pb concentration. However this relationship is species dependent (e.g. linear for C. gallina ALAD = -0.36[Pb] + 0.79; r = 0.837; or exponential for M. galloprovincialis ALAD = 2.48e{sup -8.3[Pb]}; r = 0.911). This indicates that ALAD activity has considerable potential as a biomarker of Pb and moreover, in

  7. Artificial radioactivity in the environmental samples as IAEA reference materials

    International Nuclear Information System (INIS)

    Salagean, M.; Pantelica, A.

    1998-01-01

    Radioactivity levels of 110m Ag, 241 Am, 60 Co, 134 Cs, 137 Cs, 106 Ru, 125 Sb in some biological and environmental materials have been determined by gamma-ray spectrometry in the frame of 15 intercomparison runs organized by IAEA during 1986-1995. The investigated materials were polluted by various nuclear activities, as follows: 1. Nuclear experiments: IAEA-367, sediment collected in 1982 at the Enewetak Atoll (Marshall Islands in the Pacific Ocean). This atoll was used by the USA during 1948-1958 to test nuclear devices; IAEA-368, sediment collected in June 1989 from the Pacific Ocean at the Mururoa Atoll. Since 1966 this atoll has been used by France to test different nuclear devices. 2. Nuclear installations: IAEA-134, cockle flesh of Cardium edule collected in March 1991 from the Irish Sea (Morecambe Bay), England, about 45 km S-E of Sellafield radioactive discharge; IAEA-135, sediment collected in July 1991 in Lune Estuary-England. This area is influenced by the radioactive discharges of the nuclear installations of Sellafield; IAEA-326, soil collected in 1990 in the region of Kursk Atomic Power Plant (Russia). 3. Nuclear accidents (Chernobyl): IAEA-306, sediment collected in the Baltic Sea during October-November 1986; IAEA-307, seaplant Posidonia oceanica, collected in October 1986 in Mediterranean Sea along the shore, in the vicinity of the Principality of Monaco; IAEA-308, mixed seaweeds collected in October 1986 in Mediterranean Sea along the shore, in the vicinity of the Principality of Monaco; IAEA-156, clover collected during the summer harvest 1986 in Austria; IAEA-321, milk powder collected in autumn 1987 from a processing plant in Europe; IAEA-352, tuna fish flesh collected in April 1988 in the Western Mediterranean Sea; IAEA-373, grass collected from Kiev region during the summer harvest 1990; IAEA-375, soil collected in July 1990 from Brjansk region, Russia; IAEA-300, sediment collected in July 1992 in Bothnian Sea (Baltic Sea). 4

  8. Aplicación de tratamiento térmico, recubrimiento comestible y baño químico como tratamientos poscosecha para la conservación de hortalizas mínimamente procesadas

    Directory of Open Access Journals (Sweden)

    Alejandro Escobar Hernández

    2014-01-01

    Full Text Available El consumo creciente ha estimulado el desarrollo de los vegetales cuarta gama o mínimamente procesados. Actualmente, se promueve el uso de tecnologías aplicadas a estos productos que les brinden mayor duración y garanticen la reducción de pérdidas poscosecha. En esta investigación se evaluó el efecto de tres de estas tecnologías poscosecha sobre la intensidad de la respiración y la calidad sensorial general de las hortalizas mínimamente procesadas: brócoli (Brassica oleracea var. Itálica, coliflor (Brassica oleracea var. Botrytis, zucchini (Cucurbita pepo L., apio (Apium graveolens, zanahoria (Daucus carota y chayote (Sechium edule. Para el recubrimiento comestible se utilizó pectina de bajo metoxilo (2%, cera carnauba (1%, glicerol (1.5% y ácido ascórbico (0.05%. El tratamiento térmico se hizo a 60 °C durante 2 min, con adición de ácido ascórbico (0.25%, ácido cítrico (0.5% y cloruro de calcio (0.025%. El baño químico se realizó con una solución de ácido cítrico (0.5%, ácido ascórbico (0.05% y cloruro de calcio (0.05%. La tasa de producción de CO2 se midió por el método estático, monitoreando la composición de los gases del espacio de cabeza durante 24 h a 8 °C y humedad relativa de 90%. La evaluación sensorial de color, aroma, crujencia y sabor objetable fueron las características organolépticas tomadas en cuenta para evaluar la calidad general de cada vegetal, la cual fue realizada con un panel de siete jueces previamente entrenados. Se utilizó un diseño de bloques completos al azar, siendo los bloques cada uno de los vegetales y las variables de respuesta la tasa de respiración y la calidad sensorial general. Se encontró que el tratamiento térmico y el recubrimiento comestible permitieron que los vegetales conservaran la calidad sensorial. El análisis estadístico no mostró diferencias significativas respecto al control (P > 0.05. La celeridad de la respiración disminuyó en el apio, el br

  9. Motor abilities, movement skills and their relationship before and after eight weeks of martial arts training in people with intellectual disability [Motorické schopnosti, pohybové dovednosti a vztah mezi nimi u osob s mentálním postižením před osmitýdenním kurzem bojových umění a po jeho ukončení

    Directory of Open Access Journals (Sweden)

    Damir Karpljuk

    2012-06-01

    judokas had been noted. The effects of the training program should be verified in future studies. It is worth reiterating that by improving motor abilities and expanding the boundaries of skills, people with intellectual disability enhance their quality of life. Attention in the future and thus contributes to a higher quality of intellectually disabled people’s engagement in sport as well as in life.[VÝCHODISKA: Je známo, že část populace osob s mentálním postižením má sklon k obezitě a horšímu zdravotnímu stavu. Proto by v jejich životech měl hrát významnou roli sport. Navrhnout vědecky a profesionálně účinné tréninkové programy pro sportovní vyžití osob s mentálním postižením, sestávající z nezbytné metodiky a didaktických pokynů, je sice těžký úkol, ale stává se nezbytností pro blízkou budoucnost. CÍLE: Cílem studie je stanovit vzájemný vztah mezi vy branými motorickými schopnostmi a pohybovými dovednostmi v rámci bojových umění, jakož i to, jak a do jaké míry osoby s mentálním postižením (MP, které pravidelně trénují judo, mohou po osmitýdenním tréninkovém kurzu ve svých dovednostech v oblasti bojových umění (judo, karate, box a šerm dosáhnout zlepšení. Zajímalo nás také, zda došlo k jakýmkoli změnám ve vybraných motorických dovednostech. METODIKA: Měření motorických schopností a dovedností v oblasti vybraných bojových umění bylo provedeno dvakrát – v březnu 2008, týden před začátkem kurzu, a v květnu 2008, týden po jeho ukončení. Tréninkový kurz trval dva měsíce v rozsahu dvou lekcí týdně. Zkoumaný vzorek sestával z 5 žen a 18 mužů ve věku mezi 16 a 36 lety s mírným až středně těžkým mentálním postižením. Studie byla provedena pomocí 8 testů pro hodnocení motorických schopností a 9 testů pro hodnocení dovedností v oblasti bojových umění. VÝSLEDKY: Výsledky t-testu pro závislé vzorky prokázaly statisticky v

  10. Jüri Talvet maailmaluule tõlgendajana / Jüri Talvet’s Interpretations of World Poetry

    Directory of Open Access Journals (Sweden)

    Lauri Pilter

    2016-12-01

    Full Text Available Teesid: Tartu Ülikooli maailmakirjanduse professori, luuletaja, kirjandusteadlase ja hispaaniakeelse kirjanduse spetsialisti Jüri Talveti tõlketegevuse viljade hulka kuulub luulet ja proosat nii sajandeid vanast Hispaania klassikast kui ka 20. sajandil või tänapäeval romaani keeltes või inglise keeles loodud teostest. Käesolev artikkel keskendub sellele, kuidas professor Talvet on tõlgendanud luule ja poeetika, kuid ka kirjandusajaloo, iseäranis barokk-kirjanduse alaseid küsimusi oma kirjandusteaduslikes esseedes. Vaadeldakse ka tema tõlketegevuse mahtu ja tõlketöö põhimõtteid.   Jüri Talvet (born in 1945 is a poet and a scholar of comparative literature, Chair Professor of World Literature at the University of Tartu. His numerous translations of poetry and poetical fiction from the Romance languages and, to a lesser extent, from English, reflect his views on world poetry. Those views are also expressed in his theoretical writings from the years of 1977 to 2015. Having studied English literature as the main subject at the University of Tartu, he early developed an interest in Spanish, in other Iberian languages, and in the Iberoamerican literatures. His translations from that area include works from medieval and early modern literature as well as notable literary achievements from the 20th century and the contemporary era. Talvet’s interpretations of Federico García Lorca and the “Latin American boom” authors are supported by profound insights into the philosophy, aesthetics, and poetics of the 17th century Spanish Baroque literature, known as the literary Golden Age of Spain. The influence which Talvet’s activities have exerted has widened the horizons of Estonia’s literary culture: while in the early 20th century, the previous German, Russian and Finnish leanings were supplemented by orientations to, and translations from, French and Italian literatures, Talvet has helped to enrich the Estonian literary landscape

  11. Murdelisest tegelaskõnest "Tõe ja õiguse" I osas / Dialect in the Speech of Characters in A. H. Tammsaare’s Truth and Justice Part I

    Directory of Open Access Journals (Sweden)

    Maria Mandri

    2015-06-01

    Full Text Available Teesid: Artikkel keskendub A. H. Tammsaare „Tõe ja õiguse“ pentaloogia I osas leiduvale murdelisele tegelaskõnele. Murdeline tegelaskõne on ilukirjanduslik võte, mis lähtub autori loomingulistest taotlustest ning on seega lahutamatu teose sisust. Keele- ja kirjandusteadust ühendades pakub artikkel seni puudu nud kontekstisidusa käsitluse „Tõe ja õiguse“ I osa tegelaskõnes kasutatud murdepärasuste omadustest ning funktsioonist teose sisu ja kompositsiooni toetamisel. Murdeline tegelaskõne osutab geograafiliselt kesk- ja läänemurde alale, iseloomustab tegelasi kui talurahva hulka kuulujaid, taotleb külaühiskonna realistlikku esitlust, toetab keeleliselt Vargamäe Ees- ja Tagapere ning vanade ja noorte vastandust.    SU M M A R Y   The use of language in Part I of A. H. Tammsaare’s five-volume novel Truth and Justice (Tõde ja Õigus has received quite a bit of scholarly attention. However, up till now there have been few treatments of dialect in characters’ speech that also take into account the coherence of context and the writer’s aesthetic goals. Features of dialect in characters’ speech have been noticed by many researchers, but they mostly limited themselves to giving descriptive accounts of dialect words. These earlier accounts often approached these passages as authentic specimens of dialect, and did not interpret them in context or as aspects of literary form. This article is based on the literary dialect theory of linguist and literary scholar Sumner Ives, who argues from the principle that dialect phenomena in literature cannot be studied as authentic specimens of dialect. In literature, when characters speak in dialect, this serves goals related to the content and composition of the work, and does not attempt to be a precise representation of real dialect speech. In this spirit, I will examine dialect in the characters’ speech in the first volume of Tammsaare’s cycle of novels Truth and Justice