WorldWideScience

Sample records for hu weisong shi

  1. Women stereotypes in Shi Zhecun's short stories.

    Science.gov (United States)

    Rosenmeier, Christopher

    2010-01-01

    This article analyses the representation of women in two 1933 short story collections by Shi Zhecun: An Evening of Spring Rain and Exemplary Conduct of Virtuous Women. It discusses how the New Woman image was a site of contestation in Republican China, and argues that Shi Zhecun’s short stories contain four basic stereotypes: the enigmatic woman, the estranged wife, the prostitute, and the inhibited woman. Using these narratives of women and how they were perceived by men, Shi Zhecun deconstructed the New Woman image by subverting the various ways modernity was projected onto women.

  2. Dr. Shi Hanzhang's Experience in Treating Andropathy

    Institute of Scientific and Technical Information of China (English)

    2007-01-01

    @@ Dr. Shi Hanzhang (施汉章) of Dongzhimen Hospital affiliated to Beijing University of Traditional Chinese Medicine is experienced in both teaching and clinical practice, especially in treating andropathy, such as sexual disorder, infertility, and hyperplasia of the prostate. The author has the honour to follow him for study and really learned a lot from him. A brief introduction to Dr. Shi's way of thinking in treatment is as follows.

  3. Civil Engineering for the SHiP facility

    CERN Document Server

    Osborne, John Andrew

    2015-01-01

    The enlarged scope of the recently proposed experiment to search for Heavy Neutral Leptons, SPSC-EOI-010, is a general purpose fixed target facility which in the initial phase is aimed at a general Search for Hidden Particles (SHiP) as well as tau neutrino physics. This report represents an annex to the SHiP Technical Proposal summarizing the civil engineering considerations for SHiP.

  4. Radiation protection studies for the SHiP facility

    CERN Document Server

    Strabel, Claudia Christina; Vincke, Helmut

    2015-01-01

    The enlarged scope of the recently proposed experiment to search for Heavy Neutral Leptons, SPSC-EOI-010, is a general purpose fixed target facility which in the initial phase is aimed at a general Search for Hidden Particles (SHiP) as well as tau neutrino physics. This report summarizes radiation protection considerations for the SHiP facility and the primary beam extraction for SHiP.

  5. Dicty_cDB: SHI251 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SH (Link to library) SHI251 (Link to dictyBase) - - - Contig-U11819-1 - (Link to Or...iginal site) SHI251F 125 - - - - - - Show SHI251 Library SH (Link to library) Clone ID SHI251 (Link to dicty...Base) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U11819-1 Original site URL http://dictycdb.b...XX sequence update 2002.10.25 Translated Amino Acid sequence ilfqilkistnk**IKNYYVNRVYEIIIIINICT...YKKK--- Translated Amino Acid sequence (All Frames) Frame A: ilfqilkistnk**IKNYYVNRVYEIIIIINICT

  6. Dicty_cDB: SHI867 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SH (Link to library) SHI867 (Link to dictyBase) - - - Contig-U11503-1 - (Link to Or...iginal site) SHI867F 646 - - - - - - Show SHI867 Library SH (Link to library) Clone ID SHI867 (Link to dicty...Base) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U11503-1 Original site URL http://dictycdb.b...fsl*iy*YMIRKSNNFSILFAIFLKIVFVVSAPLCPNSTILLNYNILTVYNSSEGC GFNNEPICTSLKDAVSRAFLLISNNSRVCIGIIGNINVTSEQITLGNYCGA...l*lsif--- Frame C: qkkqfsl*iy*YMIRKSNNFSILFAIFLKIVFVVSAPLCPNSTILLNYNILTVYNSSEGC GFNNEPICT

  7. Dicty_cDB: SHI777 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SH (Link to library) SHI777 (Link to dictyBase) - - - Contig-U12085-1 - (Link to Or...iginal site) SHI777F 332 - - - - - - Show SHI777 Library SH (Link to library) Clone ID SHI777 (Link to dicty...Base) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U12085-1 Original site URL http://dictycdb.b...IKEIIQHAKEYGIRVELEIDMPGHAYSWGIGYPS VLPANFSHSIQCQPSICTNK***ikknk*kk*kniylkikkkx*kk...IKEIIQHAKEYGIRVELEIDMPGHAYSWGIGYPS VLPANFSHSIQCQPSICTNK***ikknk*kk*kniylkikkkx*kk

  8. Dark matter at the SHiP experiment

    International Nuclear Information System (INIS)

    Timiryasov, Inar

    2016-01-01

    We study prospects of dark matter searches in the SHiP experiment. SHiP (Search for Hidden Particles) is the recently proposed fixed target experiment which will exploit the high-intensity beam of 400 GeV protons from the CERN SPS. In addition to the hidden sector detector, SHiP will be equipped with the ν_τ detector, which presumably would be sensitive to dark matter particles. We describe appropriate production and detection channels and estimate SHiP’s sensitivity for a scalar dark matter coupled to the Standard model through the vector mediator

  9. HuMax-CD4

    DEFF Research Database (Denmark)

    Skov, Lone; Kragballe, Knud; Zachariae, Claus

    2003-01-01

    BACKGROUND: Psoriasis is characterized by infiltration with mononuclear cells. Especially activated memory CD4+ T cells are critical in the pathogenesis. Interaction between the CD4 receptor and the major histocompatibility complex class II molecule is important for T-cell activation. OBJECTIVE......: To test safety and efficacy of a fully human monoclonal anti-CD4 antibody (HuMax-CD4) in the treatment of psoriasis. DESIGN: Multicenter, double-blind, placebo-controlled, randomized clinical trial. Patients Eighty-five patients with moderate to severe psoriasis. INTERVENTIONS: Subcutaneous infusions...... dose level, 6 (38%) of 16 patients obtained more than 25% reduction of PASI and 3 (19%) obtained more than 50% reduction of PASI. A dose-dependent decrease in total lymphocyte count was seen and was parallel to a dose-dependent decrease in CD4+ T cells. This decrease was due to a decrease in the memory...

  10. Pengenalan Pose Tangan Menggunakan HuMoment

    Directory of Open Access Journals (Sweden)

    Dina Budhi Utami

    2017-02-01

    Full Text Available Computer vision yang didasarkan pada pengenalan bentuk memiliki banyak potensi dalam interaksi manusia dan komputer. Pose tangan dapat dijadikan simbol interaksi manusia dengan komputer seperti halnya pada penggunaan berbagai pose tangan pada bahasa isyarat. Berbagai pose tangan dapat digunakan untuk menggantikan fungsi mouse, untuk mengendalikan robot, dan sebagainya. Penelitian ini difokuskan pada pembangunan sistem pengenalan pose tangan menggunakan HuMoment. Proses pengenalan pose tangan dimulai dengan melakukan segmentasi citra masukan untuk menghasilkan citra ROI (Region of Interest yaitu area telapak tangan. Selanjutnya dilakukan proses deteksi tepi. Kemudian dilakukan ekstraksi nilai HuMoment. Nilai HuMoment dikuantisasikan ke dalam bukukode yang dihasilkan dari proses pelatihan menggunakan K-Means. Proses kuantisasi dilakukan dengan menghitung nilai Euclidean Distance terkecil antara nilai HuMomment citra masukan dan bukukode. Berdasarkan hasil penelitian, nilai akurasi sistem dalam mengenali pose tangan adalah 88.57%.

  11. Infecciones en huéspedes inmunocomprometidos

    OpenAIRE

    Cuéllar Ponce de León, Luis Ernesto

    2013-01-01

    Las infecciones son causa frecuente de morbimortalidad en huéspedes inmunocomprometidos. La frecuencia y diversidad de infecciones en esta población dependerá del tipo de inmunocompromiso, tratamiento recibido y aspecto epidemiológico. Los huéspedes con neutropenia desarrollan infecciones por bacterias extracelulares no encapsuladas y hongos levaduriformes y filamentosos; el diagnóstico precoz y tratamiento oportuno de las mismas son considerados una emergencia por su severidad y gran mortali...

  12. The SHiP physics program

    Science.gov (United States)

    De Lellis, Giovanni

    2018-05-01

    The discovery of the Higgs boson has fully confirmed the Standard Model of particles and fields. Nevertheless, there are still fundamental phenomena, like the existence of dark matter and the baryon asymmetry of the Universe, which deserve an explanation that could come from the discovery of new particles. The SHiP experiment at CERN meant to search for very weakly coupled particles in the few GeV mass domain has been recently proposed. The existence of such particles, foreseen in different theoretical models beyond the Standard Model, is largely unexplored. A beam dump facility using high intensity 400 GeV protons is a copious source of such unknown particles in the GeV mass range. The beam dump is also a copious source of neutrinos and in particular it is an ideal source of tau neutrinos, the less known particle in the Standard Model. Indeed, tau anti-neutrinos have not been directly observed so far. We report the physics potential of such an experiment including the tau neutrino magnetic moment.

  13. Why investors shy away from coal

    International Nuclear Information System (INIS)

    Roling, D.A.

    1994-01-01

    Why do investors shy away from coal? This may sound like a strange question given the change in ownership of many major coal companies in recent years, but the ongoing consolidation within the coal industry is quite different from any actual new investment in the industry. To begin to understand why, one must return to the early '70s, a time of low-cost, abundant energy. The price of oil was about $2-4/bbl until 1973. The price of natural gas was about 60 cents/M ft 3 , and coal was approximately $7/st. This, however, was before the first Organization of the Petroleum Exporting Countries (OPEC) shock. The price of coal declined throughout the 1980s, and continues its downward path in some markets. Many coal investments have not achieved their expected return, such as the case of a 1M st/yr mine in West Virginia, which was developed in the early '80s only to be put immediately on a care-and-maintenance basis, where it languished until it was sold in 1990. Other mines, such as the large open-pit mines in the Powder River Basin in Wyoming, never reached their targeted production rates. Some of these large mines had equipment that remained in crates for years, only later to be sold at a loss. The extent of losses on investments in coal mines is discussed

  14. The SHiP project at CERN

    Science.gov (United States)

    De Lellis, G.; SHiP Collaboration

    2016-07-01

    The discovery of the Higgs boson has fully confirmed the Standard Model of particles and fields. Nevertheless, there are still fundamental phenomena, like the existence of dark matter and the baryon asymmetry, which deserve an explanation that could come from the discovery of new particles. Searches for new physics with accelerators are performed at the LHC, looking for high massive particles coupled to matter with ordinary strength. A new experimental facility at CERN meant to search for very weakly coupled particles in the few GeV mass domain has been recently proposed. The existence of such particles, foreseen in different theoretical models beyond the Standard Model, is largely unexplored. A beam dump facility using 400 GeV protons is a copious factory of charmed hadrons and could be used to probe the existence of such particles. The beam dump is also a copious source of neutrinos and in particular it is an ideal source of tau neutrinos, the less known particle in the Standard Model. Indeed, tau anti-neutrinos have not been directly observed so far. We report the physics potential of such an experiment. Resistive Plate Chambers could play a role in the SHiP detector.

  15. The SHiP experiment at CERN

    Science.gov (United States)

    Bonivento, Walter M.

    2017-07-01

    The discovery of the Higgs boson has fully confirmed the Standard Model of particles and fields. Nevertheless, there are still fundamental phenomena, like the existence of dark matter and the baryon asymmetry of the Universe, deserving an explanation that could come from the discovery of new particles. Searches for new physics with accelerators are performed at the LHC, looking for high massive particles coupled to matter with ordinary strength. A new experiment at CERN meant to search for very weakly coupled particles in the few GeV mass domain has been recently proposed. The existence of such particles, foreseen in different theoretical models beyond the Standard Model, is largely unexplored. A beam dump facility using high intensity 400 GeV protons is a copious source of such unknown particles in the GeV mass range. The beam dump is also a copious source of neutrinos and in particular it is an ideal source of tau neutrinos, the less known particle in the Standard Model. The neutrino detector can also search for dark matter through its scattering off the electrons. We report the physics potential of the SHiP experiment.

  16. A probabilistic Hu-Washizu variational principle

    Science.gov (United States)

    Liu, W. K.; Belytschko, T.; Besterfield, G. H.

    1987-01-01

    A Probabilistic Hu-Washizu Variational Principle (PHWVP) for the Probabilistic Finite Element Method (PFEM) is presented. This formulation is developed for both linear and nonlinear elasticity. The PHWVP allows incorporation of the probabilistic distributions for the constitutive law, compatibility condition, equilibrium, domain and boundary conditions into the PFEM. Thus, a complete probabilistic analysis can be performed where all aspects of the problem are treated as random variables and/or fields. The Hu-Washizu variational formulation is available in many conventional finite element codes thereby enabling the straightforward inclusion of the probabilistic features into present codes.

  17. Assessment of benzene-induced hematotoxicity using a human-like hematopoietic lineage in NOD/Shi-scid/IL-2Rγnull mice.

    Directory of Open Access Journals (Sweden)

    Masayuki Takahashi

    Full Text Available Despite recent advancements, it is still difficult to evaluate in vivo responses to toxicants in humans. Development of a system that can mimic the in vivo responses of human cells will enable more accurate health risk assessments. A surrogate human hematopoietic lineage can be established in NOD/Shi-scid/IL-2Rγ(null (NOG mice by transplanting human hematopoietic stem/progenitor cells (Hu-NOG mice. Here, we first evaluated the toxic response of human-like hematopoietic lineage in NOG mice to a representative toxic agent, benzene. Flow cytometric analysis showed that benzene caused a significant decrease in the number of human hematopoietic stem/progenitor cells in the bone marrow and the number of human leukocytes in the peripheral blood and hematopoietic organs. Next, we established chimeric mice by transplanting C57BL/6 mouse-derived bone marrow cells into NOG mice (Mo-NOG mice. A comparison of the degree of benzene-induced hematotoxicity in donor-derived hematopoietic lineage cells within Mo-NOG mice indicated that the toxic response of Hu-NOG mice reflected interspecies differences in susceptibilities to benzene. Responses to the toxic effects of benzene were greater in lymphoid cells than in myeloid cells in Mo-NOG and Hu-NOG mice. These findings suggested that Hu-NOG mice may be a powerful in vivo tool for assessing hematotoxicity in humans, while accounting for interspecies differences.

  18. Hu on poolel teel / James Miles

    Index Scriptorium Estoniae

    Miles, James

    2006-01-01

    2007. aastal toimuv kommunistliku partei 17. kongress tähistab Hiina presidendi Hu Jintao jaoks oma võimuaja poole peale jõudmist, ees ootavad sellised väljakutsed nagu olümpiamängude korraldamine, valimiskeeris Taiwanis ning hullunud majanduse stabiliseerimine. Vt samas: Hiina avanemise pidu

  19. Infecciones en huéspedes inmunocomprometidos

    Directory of Open Access Journals (Sweden)

    Luis Ernesto Cuéllar Ponce de León

    2013-04-01

    Full Text Available Las infecciones son causa frecuente de morbimortalidad en huéspedes inmunocomprometidos. La frecuencia y diversidad de infecciones en esta población dependerá del tipo de inmunocompromiso, tratamiento recibido y aspecto epidemiológico. Los huéspedes con neutropenia desarrollan infecciones por bacterias extracelulares no encapsuladas y hongos levaduriformes y filamentosos; el diagnóstico precoz y tratamiento oportuno de las mismas son considerados una emergencia por su severidad y gran mortalidad asociada. El compromiso de la inmunidad humoral se relaciona con infecciones por microorganismos encapsulados (bacterias extracelulares y hongos; la secuencia clínica presentada en estas infecciones es neumonía aguda-bacteremia/fungemia-meningoencefalitis aguda/crónica. Muchas de estas infecciones son inmunoprevenibles. Los huéspedes con compromiso de la inmunidad celular desarrollan infecciones por microorganismos intracelulares y también por algunos extracelulares; muchas de las infecciones ocurren por reactivación; a menudo requieren profilaxis antimicrobiana tanto primaria como secundaria. El tratamiento medicamentoso (quimioterapia, drogas inmunosupresoras, etc. y los procedimientos invasivos facilitan el desarrollo de determinadas infecciones. El aspecto epidemiológico, que incluye el estilo de vida, ocupación, viajes previos, etc. permite evaluar y determinar el riesgo de potenciales infecciones. En conclusión, la prevención de las infecciones y el uso racional de antimicrobianos son los pilares fundamentales en el manejo efectivo de los huéspedes inmunocomprometidos.

  20. Brothers or Rivals? Iran and the Shi'a of Iraq

    National Research Council Canada - National Science Library

    Hunter, Robert C

    2006-01-01

    This thesis examines the loyalty of the Shi a of Iraq. While some Sunni Arab leaders have recently accused the Shi a of Iraq of pledging loyalty to Iran, in fact the Iraqi Shi a are loyal to their own nation...

  1. Extraction and beam transfer for the SHiP facility

    CERN Document Server

    Goddard, Brennan; Borburgh, Jan; Balhan, Bruno; Le Godec, Gilles; Zerlauth, Markus; Tommasini, Davide; Kain, Verena; Cornelis, Karel; Wenninger, Jorg; Jensen, Lars; Todd, Benjamin; Bauche, Jeremie; Puccio, Bruno

    2015-01-01

    This document summarises the key feasibility issues associated with the SPS extraction and beam transfer systems required for the SHiP facility. It describes the expected performance limits of the electrostatic septa, the expected beam losses during extraction and consequences, the design of the new beamline geometry and equipment systems and the expected extracted spill structure.

  2. [Doctor HUANG Shi-ping's acupuncture with golden needles].

    Science.gov (United States)

    Chen, Teng-Fei; Ma, Zeng-Bin; Xin, Si-Yuan; Zhu, Jiang

    2013-08-01

    Taking Doctor HUANG Shi-ping as the representative, the school of Huang's golden needle is based on Chinese martial art. Golden needles are adopted as main tool. Attaching great importance on the combination of acupuncture and moxibustioin, it is also characterized with penetrating needling with long needles. Through the development of three generations, it once outshone other schools in the field of acupuncture, and became famous all over the world. It made great contribution to the development of the course of acupuncture. However, with the development of the history, the form of acupuncture education as well as apparatus were all undergone an unified reform. Therefore, Doctor HUANG Shi-ping's acupuncture school be lost gradually.

  3. A SHiP to explore new routes

    CERN Multimedia

    Antonella Del Rosso

    2015-01-01

    SHiP (Search for Hidden Particles) is a proposed new facility for CERN's SPS accelerator. Its challenging goals include a direct search for hidden non-Standard-Model particles. Predicted by a large number of theoretical models, such particles could have slipped under the radar of the LHC experiments because of their specific features. In its first symposium held at CERN on 2 July, SHiP scientists showed the broader scientific community how they plan to unveil the hidden world.     The SHiP experiment is designed to be installed next to the SPS North Area.  Powerful accelerators like the LHC allow physicists to explore extensively the primordial phenomena at energy densities equivalent to those that existed just a few moments after the Big Bang. In this way, thanks to the high precision of the LHC experiments, scientists have been able to comprehensively confirm the predictions of the Standard Model (SM), including the existence of a Higgs boson. However, new...

  4. R and D of tritium technology as SHI (Sumitomo Heavy Industries)

    International Nuclear Information System (INIS)

    Yokogawa, N.

    1997-01-01

    Sumitomo Heavy Industries (SHI) participated in an R and D programme on tritium processing for the first time in 1967 by joining the advanced thermal reactor project. (The thermal reactor is cooled by light water and moderated by heavy water.) From that time SHI has developed various kind of tritium handling technologies. On the basis of cooperation with Sulzer (Sulzer Chemtech Ltd. Switzerland), SHI developed a system for removing waste water for fuel reprocessing plants by water distillation technology. In the field of fusion technology, SHI has developed a hydrogen isotope separation system by cryogenic distillation and thermal diffusion methods, and a tritium storage bed. Fundamental data required for the system design were obtained through the production and operation of the above prototype systems. Recently, SHI has also been taking part in the design and planning of ITER. In the future, along with ITER design, SHI will aim at developing tritium measuring technology. (author)

  5. $\\mu$-flux measurements for SHiP using NA61/SHINE

    CERN Document Server

    Dijkstra, H; Korzenev, A; Mermod, P

    2016-01-01

    A major concern for the design of the SHiP experiment is the lack of a precise knowledge of the muon flux. This is a proposal to measure the expected muon flux in the SHiP experiment by installing a replica of the SHiP target in a 400 GeV/c proton beam in front of the NA61/SHINE spectrometer. We propose to do a first measurement in june 2017.

  6. Calibrating the SHiP muon-flux using NA61/SHINE

    CERN Document Server

    Van Herwijnen, Eric; Korzenev, Alexander; Mermod, Philippe

    2016-01-01

    A major concern for the design of the SHiP experiment is the lack of a precise knowledge of the muon flux. This is a proposal to measure the expected muon flux in the SHiP experiment by installing a replica of the SHiP target in a 400 GeV proton beam in front of the NA61/SHINE spectrometer. We propose to do a first measurement in 2017.

  7. SHI induced irradiation effect on Mo/Si interface

    International Nuclear Information System (INIS)

    Agarwal, Garima; Agarwal, Shivani; Jain, Rajkumar; Lal, Chhagan; Jain, I.P.; Kabiraj, D.; Pandey, Akhilesh

    2006-01-01

    Present parametric study investigates the characteristics of SHI induced mixed molybdenum silicide film with various ion fluences. The deposition of molybdenum thin films onto the Silicon substrate was performed using e-beam evaporation, while the heavy Au ion irradiation with energy 120 MeV was subsequently applied to form molybdenum silicide. The samples have been characterized by grazing incidence X-ray diffraction (GIXRD) for the identification of phase formation at the interface. Formation of t-Mo 5 Si 3 mixed molybdenum silicide was observed on increasing the ion irradiation fluences. (author)

  8. Notas sobre el paisaje de Huánuco Pampa

    OpenAIRE

    Román Godines, Oscar; Ministerio de Cultura

    2013-01-01

    El complejo arqueológico Huánuco Pampa se encuentra ubicado en la provincia Dos de Mayo en el departamento de Huánuco y en la actualidad es quizás el principal vestigio de la cosmovisión y la planificación urbana inca.

  9. Sparks sädeleb Rabarocki öös. Ettevaatust! Eliidi rünnak. Hu? Hu da hell?

    Index Scriptorium Estoniae

    2007-01-01

    Ameerika ansamblist Sparks. Vaiko Eplik & Eliit heliplaatidest "1: Aastaajad", "2: Aastaajad" ja "3: Kosmoseodüsseia", esinemisest festivalil Rabarock. Hannaliisa Uusma, Leslie Da Bassi ja DJ Criticali projektist HU?, singlitest "Kosmos" ja "Absoluutselt" (Rabarockil esitusel materjal HU? debüütalbumilt "Film")

  10. Search for New Physics in SHiP and at future colliders

    CERN Document Server

    AUTHOR|(CDS)2080890; Serra, Nicola; Storaci, Barbara

    2015-01-01

    SHiP is a newly proposed fixed-target experiment at the CERN SPS with the aim of searching for hidden particles that interact very weakly with SM particles. The work presented in this document investigates SHiP's physics reach in the parameter space of the Neutrino Minimal Standard Model ($\

  11. First steps towards geometry optimization for Spectrometer Straw Tracker of SHiP detector

    CERN Document Server

    Solovev, Vladimir

    2017-01-01

    This report contains details of CERN Summer Student project which was performed for SHiP experiment (Search for Hidden Particles). The main aim of the project is optimization of Spectrometer Straw Tracker (SST) geometry implemented in FairSHiP simulation program.

  12. Interaction and conflict between Sufism and Shi`ism during Safavid era

    Directory of Open Access Journals (Sweden)

    E Naghibi

    2017-10-01

    Full Text Available 14th century was considered as the conciliation of Imami Shi`ism and Sufism. But, the relation at the beginning of Safavid dynasty developed to the extent that concepts such as guardianship in a mixture of Shi’ite and Sufi themes made the situation prone to political functions. Imami Shi`ism became official for the first time by Safavids however, their reliance on the support of Turkmen to acquire power urged them to make Sufism superior to Shi`ism. Thus, Ghezelbash people representing Sufism depicted a great kinglike image of the Absent Imam which did not comply with religion and was against the claim of jurists. The perspective did not remain stable after Safavid dynasty was completely established. The idea was in conflict with the interests of the ruling authority, so Safavid rulers turned to Shi`ism from Sufism. The issue not only made Shi`ism and jurists superior to Sufism but also caused Shi`ites confront Sufism for several centuries. The aim of the present article is to investigate the process of peace and conflict between Sufism and Shi`ism during Safavid dynasty.

  13. Social surrogacy and adjustment: exploring the correlates of having a "social helper" for shy and non-shy young adolescents.

    Science.gov (United States)

    Markovic, Andrea; Bowker, Julie C

    2015-01-01

    A social surrogate is an individual who offers help and comfort in social situations or makes social events more exciting. In this study of 157 young adolescents (55% female; Mage = 13.84 years, SD = 0.75 years), the authors examined whether the linear and curvilinear associations between self-reported social surrogate use and adjustment outcomes (social problems, loneliness, anxiety symptoms, depressive symptoms) varied as a function of shyness and gender, after accounting for the effects of positive friendship quality. Regression analyses revealed that low and high levels of social surrogate use were related to greater social problems for all adolescents. In addition, shyness emerged as a moderator for several curvilinear effects. Specifically, results indicated that (a) high levels of social surrogate use were associated with greater anxiety for adolescents high in shyness; and (b) low levels of social surrogate use were associated with greater depressive symptoms for adolescents low in shyness. Findings highlight the developmental importance of specific types of relationship experiences during early adolescence and point to different implications of social surrogate use for shy and non-shy young adolescents.

  14. Search for hidden particles with the SHiP experiment

    Energy Technology Data Exchange (ETDEWEB)

    Hagner, Caren; Bick, Daniel; Bieschke, Stefan; Ebert, Joachim; Schmidt-Parzefall, Walter [Universitaet Hamburg, Institut fuer Experimentalphysik, Luruper Chaussee 149, 22761 Hamburg (Germany)

    2016-07-01

    Many theories beyond the standard model predict long lived neutral (hidden) particles. There might be a whole Hidden Sector (HS) of weakly interacting particles, which cannot be detected in existing high energy experiments. The SHiP experiment (Search for Hidden Particles) requires a high intensity beam dump, which could be realized by a new facility at the CERN SPS accelerator. New superweakly interacting particles with masses below O(10) GeV could be produced in the beam dump and detected in a general purpose Hidden Sector (HS) detector. In addition there will be a dedicated tau neutrino subdetector. I present the major requirements and technical challenges for the HS detector and discuss how the HS can be accessed through several portals: neutrino portal, scalar portal, vector portal and many more.

  15. The computer-assisted interview In My Shoes can benefit shy preschool children's communication

    Science.gov (United States)

    Salari, Raziye; Eriksson, Maria; Sarkadi, Anna

    2017-01-01

    Interviewing children is a cognitively, socially, and emotionally challenging situation, especially for young and shy children. Thus, finding methods that aid rapport and increase these children’s communication is important. The present study investigated whether children’s verbal and non-verbal communicative behavior developed differently during the rapport phase, depending on whether children were situationally shy or not, and whether the interview was conducted using the computer-assisted interview In My Shoes (IMS) or a Standard verbal interview. The sample consisted of 60 children aged 4 to 5-years-old. The results showed that for the shy children in the IMS group their talkativeness increased and their answer latency decreased including the amount of encouragement the child needed to talk, while no changes were observed for the shy children in the Standard verbal interview group. There were no significant differences in the non-verbal behavior for the shy children regardless of the interview method used. For the non-shy children, overall, the interview method did not affect either the verbal or the non-verbal outcomes. Our findings indicate that IMS can be a useful tool during the rapport-building phase with shy children as it helps these children to improve their verbal communication. PMID:28813534

  16. Quantitative assessment of periimplant bone density (HU) on CBCT image

    International Nuclear Information System (INIS)

    Goo, Jong Gook; Kim, Jin Soo; Kim, Jae Duk

    2008-01-01

    The primary aims of this retrospective study were to compare subjective bone quality and bone quality based on the Hounsfield scale in different segments of the edentulous jaw, and to establish quantitative and objective assessment of the bone quality. Twenty eight randomly selected cone-beam computed tomographic (CBCT) scans were analyzed. For evaluation one hundred and twelve edentulous areas were selected. Implant recipient sites were evaluated visually for Lekholm and Zarb classification. The same sites were subsequently evaluated digitally using the Hounsfield scale with Vimplant 2.0 TM , and the results were correlated with visual classification. Data was subject for statistical analysis in order to determine correlation between recorded HU and the regions of the mouth with the Kruskal-Wallis test. The highest unit/mean density value (311 HU) was found in the anterior mandible, followed by 259 HU for the posterior mandible, 216 HU for the anterior maxilla, and 127 HU for the posterior maxilla. These results demonstrate a strong correlation for HU depending on the region of the mouth (p TM with Vimplant TM software.

  17. Revolution, Modernity and (Trans)National Shi`i Islam: Rethinking Religious Conversion in Senegal.

    Science.gov (United States)

    Leichtman, Mara A

    2009-07-01

    The establishment of a Shi`i Islamic network in Senegal is one alternative to following the country's dominant Sufi orders. I examine Senegalese conversion narratives and the central role played by the Iranian Revolution, contextualizing life stories (trans)nationally in Senegal's political economy and global networks with Iran and Lebanon. Converts localize foreign religious ideologies into a 'national' Islam through the discourse that Shi`i education can bring peace and economic development to Senegal. Senegalese Shi`a perceive that proselytizing, media technologies, and Muslim networking can lead to social, cultural and perhaps even political change through translating the Iranian Revolution into a non-violent reform movement.

  18. Muon-flux measurements for SHiP at H4

    CERN Document Server

    van Herwijnen, E

    2017-01-01

    A major concern for the design of the SHiP experiment is the lack of a precise knowledge of the muon flux. This is a proposal to measure the expected muon flux in the SHiP experiment by installing a replica of the SHiP target in a 400 GeV/c proton beam at H4. We intend building a spectrometer using the drift tube prototypes that were constructed for OPERA. A muon tagger will be built using RPCs, which will also serve as a module-0 for SHiP. We propose to do this measurement in early 2018. Accumulating $\\sim 10^{11}$ 400 GeV/c POT will enable us to make a more realistic design of the muon shield. With some modifications, this setup can also be used to measure the charm cross section (including the cascade production). We intend to test this setup after the measurement of the muon flux.

  19. The Best Friendships of Shy/Withdrawn Children: Prevalence, Stability, and Relationship Quality

    Science.gov (United States)

    Rubin, Kenneth H.; Wojslawowicz, Julie C.; Rose-Krasnor, Linda; Booth-LaForce, Cathryn; Burgess, Kim B.

    2013-01-01

    The mutual best friendships of shy/withdrawn and control children were examined for prevalence, stability, best friend’s characteristics, and friendship quality. Using peer nominations of shy/socially withdrawn and aggressive behaviors, two groups of children were identified from a normative sample of fifth-grade children: shy/withdrawn (n = 169) and control (nonaggressive/nonwithdrawn; n = 163). Friendship nominations, teacher reports, and friendship quality data were gathered. Results revealed that shy/withdrawn children were as likely as control children to have mutual stable best friendships. Withdrawn children’s friends were more withdrawn and victimized than were the control children’s best friends; further, similarities in social withdrawal and peer victimization were revealed for withdrawn children and their friends. Withdrawn children and their friends reported lower friendship quality than did control children. Results highlight the importance of both quantitative and qualitative measures of friendship when considering relationships as risk and/or protective factors. PMID:16485175

  20. Why I Am Not SHY: A Reply to Tononi and Cirelli

    Directory of Open Access Journals (Sweden)

    Marcos Gabriel Frank

    2013-01-01

    Full Text Available In a recent article I reviewed an influential theory of sleep function, the “synaptic homeostasis hypothesis (SHY.” According to SHY, sleep renormalizes synapses that are potentiated during prior wakefulness. I concluded that while SHY is a seminal theory with important implications about sleep function and the brain, its underlying mechanisms are poorly defined. In an accompanying article, the authors of SHY responded at length. Their reply is thoughtful and provocative, but unfortunately many of the points I raised were not accurately represented or addressed. In this brief commentary, I attempt to clarify some points of confusion. I also explain why any theory of sleep function is incomplete without an understanding of the underlying cellular mechanisms.

  1. Sensitivity of the SHiP experiment to a light scalar particle mixing with the Higgs

    CERN Document Server

    Lanfranchi, Gaia

    2017-01-01

    This conceptual study shows the ultimate sensitivity of the SHiP experiment for the search of a light scalar particle mixing with the Higgs for a dataset corresponding to 5-years of SHiP operation at a nominal intensity of 4 1013 protons on target per second. The sensitivity as a function of the length of the vessel and of its distance from the target as well as a function of the background contamination is also studied.

  2. Neutrino scattering physics with the SHiP Experiment

    CERN Document Server

    AUTHOR|(CDS)2083090

    2015-01-01

    SHiP (Search for Hidden Particles) is a new general purpose fixed target facility, proposed at the CERN SPS accelerator. In its initial phase the 400 GeV protons beam will be dumped on a heavy target with the aim of integrating 2 × 1020 pot in five years. A dedicated detector downstream the target will allow to probe a variety of models with the light long-lived exotic particles and masses below O(10) GeV/c2. Another dedicated detector will allow the study of active neutrino cross-sections and angular distributions. In particular, the neutrino deep-inelastic cross-sections will be performed with a statistics 1000 times larger than currently available, with the extraction of the F4 and F5 structure functions, never measured so far. Tau neutrinos will be distinguished by anti-neutrinos, thus providing the first observation of the tau anti-neutrino. With muon neutrinos it will be possible to study the strangeness content of the nucleon.

  3. The SHiP experiment at CERN SPS

    CERN Document Server

    Di Crescenzoon, A

    2016-01-01

    SHiP is a new general purpose fixed target facility, whose Technical Proposal has been recently submitted to the CERN SPS Committee. In its initial phase, the 400 GeV proton beam extracted from the SPS will be dumped on a heavy target with the aim of integrating 2 × 1020 pot in 5 years. A dedicated detector located downstream of the target, based on a long vacuum tank followed by a spectrometer and particle identification detectors, will allow probing a variety of models with light long-lived exotic particles and masses below a few GeV/c2. The beam dump is also an ideal source of tau neutrinos, the less known particle in the Standard Model. Another dedicated detector, based on the Emulsion Cloud Chamber technology already used in the OPERA experiment, will allow to perform for the first time measurements of the tau neutrino deep inelastic scattering cross section. Tau neutrinos will be distinguished from tau anti-neutrinos, thus providing the first observation of the tau anti-neutrino.

  4. Neutrino scattering physics with the SHiP Experiment

    CERN Document Server

    Di Crescenzo, Antonia

    2016-01-01

    SHiP (Search for Hidden Particles) is a new general purpose fixed target facility, proposed at the CERN SPS accelerator. In its initial phase the 400 GeV protons beam will be dumped on a heavy target with the aim of integrating $2 \\times 10^{20}$ pot in five years. A dedicated detector downstream the target will allow to probe a variety of models with the light long-lived exotic particles and masses below O(10) GeV/c2. Another dedicated detector will allow the study of active neutrino cross-sections and angular distributions. In particular, the neutrino deep-inelastic cross-sections will be performed with a statistics 1000 times larger than currently available, with the extraction of the F4 and F5 structure functions, never measured so far. Tau neutrinos will be distinguished by anti-neutrinos, thus providing the first observation of the tau anti-neutrino. With muon neutrinos it will be possible to study the strangeness content of the nucleon.

  5. Neutrino physics with the SHiP experiment

    CERN Document Server

    AUTHOR|(SzGeCERN)759942

    2015-01-01

    Despite the Standard Model (SM) has been strongly confirmed by the Higgs discovery, several experimental facts are still not explained. The SHiP experiment (Search for Hidden Particles), a beam dump experiment at CERN, aims at the observation of long lived particles very weakly coupled with ordinary matter. These particles of the GeV mass scale, foreseen in many extensions of the SM, might come from the decay of charmed hadrons produced in the collision of a 400 GeV proton beam on a target. High rates of all the three active neutrinos are also expected. For the first time the properties and the cross section of the ντ will be studied thanks to a detector based on nuclear emulsions, with the micrometric resolution needed to identify the tau lepton produced in neutrino interactions. Measuring the charge of the tau daughters, will enable the first observation of the ν ̄τ and the study of its cross section.

  6. Different Influences on Tacrolimus Pharmacokinetics by Coadministrations of Zhi Ke and Zhi Shi in Rats

    Directory of Open Access Journals (Sweden)

    Shiuan-Pey Lin

    2011-01-01

    Full Text Available Tacrolimus, an immunosuppressant with narrow therapeutic window, has been used widely in transplant patients. Grapefruit juice and pomelo have been reported to increase the blood levels of tacrolimus. Zhi Ke and Zhi Shi, the ripe peels and unripe fruits of Citrus aurantium which is chemotaxonomically related to grapefruit and pomelo, are in wide use in clinical Chinese medicine. To investigate the possible interaction of these two Citrus herbs with tacrolimus, male Sprague-Dawley rats were orally given tacrolimus (1.5 mg/kg with and without Zhi Ke and Zhi Shi decoctions in a cross-over design. Blood samples were withdrawn via cardiopuncture at specific time and quantitated by a microparticle enzyme immunoassay. In addition, to explore the mechanism of interaction, LS 180 cell line was used for the transport study of rhodamine 123, a typical substrate of P-glycoprotein (P-gp. The results showed that Zhi Shi significantly decreased the Cmax⁡ and AUC0-t of tacrolimus by 72.4% and 72.0%, respectively, whereas Zhi Ke did not affect tacrolimus pharmacokinetics. LS 180 cell line study indicated that Zhi Shi increased the efflux activity of P-gp, enabling us to explain the decreased oral bioavailability of tacrolimus caused by Zhi Shi. Hence, we suggest that Zhi Shi be contraindicated for transplant patients treated with tacrolimus to reduce the risk of allograft rejection.

  7. Different Influences on Tacrolimus Pharmacokinetics by Coadministrations of Zhi Ke and Zhi Shi in Rats

    Science.gov (United States)

    Lin, Shiuan-Pey; Wu, Ping-Ping; Hou, Yu-Chi; Tsai, Shang-Yuan; Wang, Meng-Ju; Fang, Shih-Hua; Chao, Pei-Dawn Lee

    2011-01-01

    Tacrolimus, an immunosuppressant with narrow therapeutic window, has been used widely in transplant patients. Grapefruit juice and pomelo have been reported to increase the blood levels of tacrolimus. Zhi Ke and Zhi Shi, the ripe peels and unripe fruits of Citrus aurantium which is chemotaxonomically related to grapefruit and pomelo, are in wide use in clinical Chinese medicine. To investigate the possible interaction of these two Citrus herbs with tacrolimus, male Sprague-Dawley rats were orally given tacrolimus (1.5 mg/kg) with and without Zhi Ke and Zhi Shi decoctions in a cross-over design. Blood samples were withdrawn via cardiopuncture at specific time and quantitated by a microparticle enzyme immunoassay. In addition, to explore the mechanism of interaction, LS 180 cell line was used for the transport study of rhodamine 123, a typical substrate of P-glycoprotein (P-gp). The results showed that Zhi Shi significantly decreased the C max and AUC0−t of tacrolimus by 72.4% and 72.0%, respectively, whereas Zhi Ke did not affect tacrolimus pharmacokinetics. LS 180 cell line study indicated that Zhi Shi increased the efflux activity of P-gp, enabling us to explain the decreased oral bioavailability of tacrolimus caused by Zhi Shi. Hence, we suggest that Zhi Shi be contraindicated for transplant patients treated with tacrolimus to reduce the risk of allograft rejection. PMID:21318106

  8. Subunit-specific phenotypes of Salmonella typhimurium HU mutants.

    OpenAIRE

    Hillyard, D R; Edlund, M; Hughes, K T; Marsh, M; Higgins, N P

    1990-01-01

    Salmonella hupA and hupB mutants were studied to determine the reasons for the high degree of conservation in HU structure in bacteria. We found one HU-1-specific effect; the F'128 plasmid was 25-fold less stable in hupB compared with hupA or wild-type cells. F' plasmids were 120-fold more unstable in hupA hupB double mutants compared with wild-type cells, and the double mutant also had a significant alteration in plasmid DNA structure. pBR322 DNA isolated from hupA hupB strains was deficient...

  9. Abundances of the planetary nebula Hu 1-2

    NARCIS (Netherlands)

    Pottasch, [No Value; Hyung, S; Aller, LH; Beintema, DA; Bernard-Salas, J; Feibelman, WA; Klockner, HR

    The ISO and IUE spectra of the "elliptical" nebula Hu 1-2 are presented. These spectra are combined with new, high resolution spectra in the visual wavelength region to obtain a complete, extinction corrected, spectrum. The chemical composition of the nebula is then calculated and compared to

  10. [Contribution of Professor SHI Xue-min's academic thoughts to treatment of stroke].

    Science.gov (United States)

    Liu, Jian; Fan, Xiao-Nong; Wang, Shu

    2014-01-01

    Based on the thought of Zhishen (a kind of mind regulation), Professor SHI Xue-min, academician of the China Academy of Engineering, found the Xingnao Kaiqiao (to refresh the mind and to cause resuscitation) acupuncture method, which still plays an important role in the acupuncture treatment of wind stroke nowadays. Meanwhile, great importance is attached to the comprehensive treatment of wind stroke. Danqi Piantan capsule (see text) is developed and "wind stroke unit" is set up. In recent years, Professor SHI shifts the center of research to the treatment of hypertension, the risk factor of wind stroke. Taking Renying (ST 9) as the major acupoint, acupuncture with standard measurement and manipulations is established. And good clinical effect has been obtained as well. Therefore, this article focuses on the introduction of Professor SHI Xue-min's contribution to wind stroke treatment.

  11. The SPS beam parameters, the operational cycle, and proton sharing with the SHiP facility

    CERN Document Server

    Arduini, Gianluigi; Gatignon, Lau; Cornelis, Karel

    2015-01-01

    The SHiP experiment aims at acquiring a total of 4×1019 protons on target per year. Based on demonstrated SPS performance for CNGS, the expected proton sharing between the TCC2 targets and SHiP is estimated taking into account the constraints in the super-cycle composition. We review the SPS beam parameters, the operational cycles taking into account the concurrent operation of the SPS as LHC injector and for the TCC2 experiments and the limitations on the maximum possible power dissipation and the expected sharing of the protons on target of the SHiP facility with the TCC2 targets. As a typical example this aim could be achieved while maintaining a duty cycle for the other fixed target experiments of about 18%.

  12. TianShuiShi space breeding current situation and developing trend

    International Nuclear Information System (INIS)

    Wang Fuquan; Song Jianrong; Zhang Zhongping; Guo Zhenfang

    2011-01-01

    TianShuiShi is located in xian to lanzhou among two big cities, the five space launch, has vegetables, food, grasses, flowers, rape, melon and fruit, Chinese traditional medicine, amount of 8 categories of crops, such as the 22 new material after carrying the ground breeding work. Only vegetables on identified 23 aerospace new varieties. After ten years of space breeding, summarizes the present situation of TianShuiShi space breeding, development experience, characteristic, trends, and puts forward the development space breeding TianShuiShi organization and breeding of talent from the matching policy and grow up incentive mechanism, strengthen the cooperation and all over the country, establishing fiscal policy support from the aspects such as advice. (authors)

  13. Targeting Mycobacterium tuberculosis nucleoid-associated protein HU with structure-based inhibitors

    Science.gov (United States)

    Bhowmick, Tuhin; Ghosh, Soumitra; Dixit, Karuna; Ganesan, Varsha; Ramagopal, Udupi A.; Dey, Debayan; Sarma, Siddhartha P.; Ramakumar, Suryanarayanarao; Nagaraja, Valakunja

    2014-06-01

    The nucleoid-associated protein HU plays an important role in maintenance of chromosomal architecture and in global regulation of DNA transactions in bacteria. Although HU is essential for growth in Mycobacterium tuberculosis (Mtb), there have been no reported attempts to perturb HU function with small molecules. Here we report the crystal structure of the N-terminal domain of HU from Mtb. We identify a core region within the HU-DNA interface that can be targeted using stilbene derivatives. These small molecules specifically inhibit HU-DNA binding, disrupt nucleoid architecture and reduce Mtb growth. The stilbene inhibitors induce gene expression changes in Mtb that resemble those induced by HU deficiency. Our results indicate that HU is a potential target for the development of therapies against tuberculosis.

  14. Spontaneous hemoperitoneum in pregnancy (SHiP) and endometriosis - A systematic review of the recent literature.

    Science.gov (United States)

    Lier, Marit C I; Malik, Romana F; Ket, Johannes C F; Lambalk, Cornelis B; Brosens, Ivo A; Mijatovic, Velja

    2017-12-01

    Spontaneous Hemoperitoneum in Pregnancy (SHiP), an unprovoked (nontraumatic) intraperitoneal bleeding in pregnancy (up to 42days postpartum), is associated with serious adverse pregnancy outcomes. To evaluate the clinical consequences of SHiP and its association with endometriosis, a systematic review was conducted according to the PRISMA guidelines. PubMed, Embase.com and Thomson Reuters/Web of Science were searched for articles published since the latest review (August 2008) until September 2016. After assessment for eligibility, forty-four articles were included in this systematic review, describing 59 cases of SHiP. Endometriosis was present in 33/59 cases (55.9%), most often diagnosed prior to pregnancy. An association between the severity of SHiP and the stage of endometriosis could not be found. In the majority of cases, SHiP occurred in the third trimester of pregnancy (30/59 cases (50.8%)); women presented with (sub)acute abdominal pain (56/59 cases (94.9%)), hypovolemic shock (28/59 cases (47.5%)) and/or a decreased level of hemoglobin (37/59 cases (62.7%)). Signs of fetal distress were observed in 24/59 cases (40.7%). Imaging confirmed free peritoneal fluid in (37/59 cases (62.7%)). At time of surgery active bleeding was revealed in 51/56 cases (91,1%), originating from endometriotic implants (11/51 cases (21.6%)), ruptured utero-ovarian vessels (29/51 cases (56.8%)), hemorrhagic nodules of decidualized cells (1/51 cases (2.0%)) or a combination (10/51 cases (19.6%)). Median amount of hemoperitoneum was 1600mL (IQR 1000mL-2500mL). From the 45/59 cases (76.3%) in which surgical interventions was carried out during pregnancy, 7/45 cases (15.6%) reported a successful continuation of pregnancy. 5/59 cases reported recurrence of SHiP (recurrence rate 8.5%). The perinatal mortality rate was 26.9% (18/67 fetus), one maternal death was reported (1/59 cases (1,7%)). In conclusion, SHiP is a very serious complication of pregnancy, highly associated with adverse

  15. Preliminary Evaluation of a Social Skills Training and Facilitated Play Early Intervention Programme for Extremely Shy Young Children in China

    Science.gov (United States)

    Li, Yan; Coplan, Robert J.; Wang, Yuemin; Yin, Jingtong; Zhu, Jingjing; Gao, Zhuqing; Li, Linhui

    2016-01-01

    The goal of this study was to provide a preliminary evaluation of a social skills and facilitated play early intervention programme to promote social interaction, prosocial behaviours and socio-communicative skills among young extremely shy children in China. Participants were a sample of n = 16 extremely shy young children attending kindergarten…

  16. Defining According to Its Essence: An Analysis on the Concept of Tong Shi Education (General Education) in the Native Chinese Context

    Science.gov (United States)

    Lu, Yi; Xu, Yuan

    2018-01-01

    The authors review the concept of Tong Shi (Chinese characters omitted) in ancient Chinese philosophical texts, illustrate the Chinese cultural attributes unique to the characters Tong and Shi, and confirm that the name and essence of Tong Shi Education has a clear directivity and irreplaceable coverage to university general education in…

  17. Etude linguistique chez les Baráshi/Banyaambo du Rwanda ...

    African Journals Online (AJOL)

    Among the main African Languages spoken in Rwanda besides Kinyarwaanda: amashí in the South, olucigá in the North and ikiráshi/ikinyaambo in the East, only olucigá has been particularly described: J.-B. Murekezi (1984), F.-X. Bangamwabo (1989); others are just mentioned in global sociolinguistic studies: B.

  18. Cytoplasmic Hu-Antigen R (HuR) Expression is Associated with Poor Survival in Patients with Surgically Resected Cholangiocarcinoma Treated with Adjuvant Gemcitabine-Based Chemotherapy.

    Science.gov (United States)

    Toyota, Kazuhiro; Murakami, Yoshiaki; Kondo, Naru; Uemura, Kenichiro; Nakagawa, Naoya; Takahashi, Shinya; Sueda, Taijiro

    2018-05-01

    Hu-antigen R (HuR) is an RNA-binding protein that regulates the stability, translation, and nucleus-to-cytoplasm translocation of messenger RNAs (mRNAs). The aim of this study was to investigate the prognostic significance of HuR in cholangiocarcinoma patients who received adjuvant gemcitabine-based chemotherapy (AGC) after surgical resection. Nuclear and cytoplasmic HuR expression was investigated immunohistochemically in 131 patients with resected cholangiocarcinoma, including 91 patients administered AGC and 40 patients who did not receive adjuvant chemotherapy. The correlation between HuR expression and survival was evaluated by statistical analysis. High nuclear and cytoplasmic HuR expression was observed in 67 (51%) and 45 (34%) patients, respectively. Cytoplasmic HuR expression was significantly associated with lymph node metastasis (p < 0.01), while high cytoplasmic HuR expression was significantly associated with poor disease-free survival [DFS] (p = 0.03) and overall survival [OS] (p = 0.001) in the 91 patients who received AGC, but not in the 40 patients who did not receive AGC (DFS p = 0.17; OS p = 0.07). In the multivariate analysis of patients who received AGC, high cytoplasmic HuR expression was an independent predictor of poor DFS (hazard ratio [HR] 1.77; p = 0.04) and OS (HR 2.09; p = 0.02). Nuclear HuR expression did not affect the survival of enrolled patients. High cytoplasmic HuR expression was closely associated with the efficacy of AGC in patients with cholangiocarcinoma. The current findings warrant further investigations to optimize adjuvant chemotherapy regimens for resectable cholangiocarcinoma.

  19. Interface reactions between Pd thin films and SiC by thermal annealing and SHI irradiation

    Energy Technology Data Exchange (ETDEWEB)

    Njoroge, E.G., E-mail: eric.njoroge@up.ac.za [Department of Physics, University of Pretoria, Pretoria (South Africa); Theron, C.C. [Department of Physics, University of Pretoria, Pretoria (South Africa); Skuratov, V.A. [Joint Institute for Nuclear Research, Dubna (Russian Federation); Wamwangi, D. [School of Physics, University of Witwatersrand, Johannesburg (South Africa); Hlatshwayo, T.T. [Department of Physics, University of Pretoria, Pretoria (South Africa); Comrie, C.M. [MRD, iThemba LABS, P.O. Box 722, Somerset West 7129 (South Africa); Malherbe, J.B. [Department of Physics, University of Pretoria, Pretoria (South Africa)

    2016-03-15

    The solid-state reactions between Pd thin films and 6H-SiC substrates induced by thermal annealing, room temperature swift heavy ion (SHI) irradiation and high temperature SHI irradiation have been investigated by in situ and real-time Rutherford backscattering spectrometry (RBS) and Grazing incidence X-ray diffraction (GIXRD). At room temperature, no silicides were detected to have formed in the Pd/SiC samples. Two reaction growth zones were observed in the samples annealed in situ and analysed by real time RBS. The initial reaction growth region led to formation of Pd{sub 3}Si or (Pd{sub 2}Si + Pd{sub 4}Si) as the initial phase(s) to form at a temperature of about 450 °C. Thereafter, the reaction zone did not change until a temperature of 640 °C was attained where Pd{sub 2}Si was observed to form in the reaction zone. Kinetic analysis of the initial reaction indicates very fast reaction rates of about 1.55 × 10{sup 15} at cm{sup −2}/s and the Pd silicide formed grew linear with time. SHI irradiation of the Pd/SiC samples was performed by 167 MeV Xe{sup 26+} ions at room temperature at high fluences of 1.07 × 10{sup 14} and 4 × 10{sup 14} ions/cm{sup 2} and at 400 °C at lower fluences of 5 × 10{sup 13} ions/cm{sup 2}. The Pd/SiC interface was analysed by RBS and no SHI induced diffusion was observed for room temperature irradiations. The sample irradiated at 400 °C, SHI induced diffusion was observed to occur accompanied with the formation of Pd{sub 4}Si, Pd{sub 9}Si{sub 2} and Pd{sub 5}Si phases which were identified by GIXRD analysis.

  20. Overexpression of the AtSHI gene in poinsettia, Euphorbia pulcherrima, results in compact plants.

    Directory of Open Access Journals (Sweden)

    M Ashraful Islam

    Full Text Available Euphorbia pulcherrima, poinsettia, is a non-food and non-feed vegetatively propagated ornamental plant. Appropriate plant height is one of the most important traits in poinsettia production and is commonly achieved by application of chemical growth retardants. To produce compact poinsettia plants with desirable height and reduce the utilization of growth retardants, the Arabidopsis SHORT INTERNODE (AtSHI gene controlled by the cauliflower mosaic virus 35S promoter was introduced into poinsettia by Agrobacterium-mediated transformation. Three independent transgenic lines were produced and stable integration of transgene was verified by PCR and Southern blot analysis. Reduced plant height (21-52% and internode lengths (31-49% were obtained in the transgenic lines compared to control plants. This correlates positively with the AtSHI transcript levels, with the highest levels in the most dwarfed transgenic line (TL1. The indole-3-acetic acid (IAA content appeared lower (11-31% reduction in the transgenic lines compared to the wild type (WT controls, with the lowest level (31% reduction in TL1. Total internode numbers, bract numbers and bract area were significantly reduced in all transgenic lines in comparison with the WT controls. Only TL1 showed significantly lower plant diameter, total leaf area and total dry weight, whereas none of the AtSHI expressing lines showed altered timing of flower initiation, cyathia abscission or bract necrosis. This study demonstrated that introduction of the AtSHI gene into poinsettia by genetic engineering can be an effective approach in controlling plant height without negatively affecting flowering time. This can help to reduce or avoid the use of toxic growth retardants of environmental and human health concern. This is the first report that AtSHI gene was overexpressed in poinsettia and transgenic poinsettia plants with compact growth were produced.

  1. Design of a detector to study associated charm production in the SHiP beam dump facility

    CERN Document Server

    Iuliano, Antonio; Di Crescenzo, Antonia

    A dedicated experiment has been proposed by the SHiP Collaboration, to study associated charm production and decay of charmed hadrons. In this thesis we report the first design of such an experiment. This work has been carried out within the Naples neutrino group that participates to the SHiP experiment. The aim of the experiment designed in this thesis is to measure the differential associated charm production cross sections with respect to the angular and energy spectra of charmed particles. This measurement could give the acceptance of the SHiP detector for hidden particles and tau neutrinos, which are produced from charmed hadron decays.

  2. HuPSON: the human physiology simulation ontology.

    Science.gov (United States)

    Gündel, Michaela; Younesi, Erfan; Malhotra, Ashutosh; Wang, Jiali; Li, Hui; Zhang, Bijun; de Bono, Bernard; Mevissen, Heinz-Theodor; Hofmann-Apitius, Martin

    2013-11-22

    Large biomedical simulation initiatives, such as the Virtual Physiological Human (VPH), are substantially dependent on controlled vocabularies to facilitate the exchange of information, of data and of models. Hindering these initiatives is a lack of a comprehensive ontology that covers the essential concepts of the simulation domain. We propose a first version of a newly constructed ontology, HuPSON, as a basis for shared semantics and interoperability of simulations, of models, of algorithms and of other resources in this domain. The ontology is based on the Basic Formal Ontology, and adheres to the MIREOT principles; the constructed ontology has been evaluated via structural features, competency questions and use case scenarios.The ontology is freely available at: http://www.scai.fraunhofer.de/en/business-research-areas/bioinformatics/downloads.html (owl files) and http://bishop.scai.fraunhofer.de/scaiview/ (browser). HuPSON provides a framework for a) annotating simulation experiments, b) retrieving relevant information that are required for modelling, c) enabling interoperability of algorithmic approaches used in biomedical simulation, d) comparing simulation results and e) linking knowledge-based approaches to simulation-based approaches. It is meant to foster a more rapid uptake of semantic technologies in the modelling and simulation domain, with particular focus on the VPH domain.

  3. ν{sub τ}-physics with the SHiP experiment

    Energy Technology Data Exchange (ETDEWEB)

    Bick, Daniel; Bieschke, Stefan; Ebert, Joachim; Hagner, Caren; Schmidt-Parzefall, Walter [Universitaet Hamburg, Institut fuer Experimentalphysik, Luruper Chaussee 149, 22761 Hamburg (Germany)

    2016-07-01

    SHiP stands for Search for Hidden Particles and is a recently proposed new general-purpose fixed target facility at the SPS at CERN. The main aim is the search for hidden particles predicted by different models capable of explaining dark matter, neutrino masses or the origin of baryon asymmetry in the Universe. Furthermore, a huge number of (τ-)neutrinos will be produced at such a facility making it an ideal place for ν{sub τ}-physics and thus giving the opportunity for a measurement of the τ-neutrino cross-sections or a first-time experimental evidence of the anti-τ-neutrino. This talk will give an overview of the neutrino experiment at the SHiP experiment. An emphasis is given to the reconstruction of muons from interactions in the neutrino target using a magnetic spectrometer.

  4. Overexpression of the AtSHI gene in poinsettia, Euphorbia pulcherrima, results in compact plants

    DEFF Research Database (Denmark)

    Islam, M. Ashraful; Lütken, Henrik Vlk; Haugslien, Sissel

    2013-01-01

    of the AtSHI gene into poinsettia by genetic engineering can be an effective approach in controlling plant height without negatively affecting flowering time. This can help to reduce or avoid the use of toxic growth retardants of environmental and human health concern. This is the first report that At......Euphorbia pulcherrima, poinsettia, is a non-food and non-feed vegetatively propagated ornamental plant. Appropriate plant height is one of the most important traits in poinsettia production and is commonly achieved by application of chemical growth retardants. To produce compact poinsettia plants...... integration of transgene was verified by PCR and Southern blot analysis. Reduced plant height (21–52%) and internode lengths (31–49%) were obtained in the transgenic lines compared to control plants. This correlates positively with the AtSHI transcript levels, with the highest levels in the most dwarfed...

  5. SUPPORT FOR HU CFRT SUMMER HIGH SCHOOL FUSION WORKSHOP

    International Nuclear Information System (INIS)

    Punjabi, Alkesh

    2010-01-01

    Nine summer fusion science research workshops for minority and female high school students were conducted at the Hampton University Center for Fusion Research and Training from 1996 to 2005. Each workshop was of the duration of eight weeks. In all 35 high school students were mentored. The students presented 28 contributed papers at the annual meetings of the American Physical Society Division of Plasma Physics. These contributed papers were very well received by the plasma physics and fusion science research community. The students won a number of prestigious local, state, and national honors, awards, prizes, and scholarships. The notable among these are the two regional finalist positions in the 1999 Siemens-Westinghouse Science and Technology Competitions; 1st Place U.S. Army Award, 2006; 1st Place U.S. Naval Science Award, 2006; Yale Science and Engineering Association Best 11th Grade Project, 2006; Society of Physics Students Book Award, 2006; APS Corporate Minority Scholarship and others. This workshop program conducted by the HU CFRT has been an exemplary success, and served the minority and female students exceptionally fruitfully. The Summer High School Fusion Science Workshop is an immensely successful outreach activity conducted by the HU CFRT. In this workshop, we train, motivate, and provide high quality research experiences to young and talented high school scholars with emphasis on under-represented minorities and female students in fusion science and related areas. The purpose of this workshop is to expose minority and female students to the excitement of research in science at an early stage in their academic lives. It is our hope that this may lead the high school students to pursue higher education and careers in physical sciences, mathematics, and perhaps in fusion science. To our knowledge, this workshop is the first and only one to date, of fusion science for under-represented minorities and female high school students at an HBCU. The faculty

  6. Addendum to Technical Proposal: A Facility to Search for Hidden Particles (SHiP) at the CERN SPS

    CERN Document Server

    SHiP Collaboration

    2015-01-01

    With the Technical Proposal submitted to the SPSC committee in April 2015, the SHiP collaboration declared its interest in proceeding towards a Comprehensive Design Study phase with the aim of preparing for the Technical Design Reports pending an approval by the CERN committees. Following the recommendation by the SPSC, it has been decided to complement the TP with this addendum that provides an update of the key aspects for the review of the SHiP project.

  7. Temperature dependence of HU values for various water equivalent phantom materials

    International Nuclear Information System (INIS)

    Homolka, P.; Nowotny, R.; Gahleitner, A.

    2002-01-01

    The temperature dependence of water equivalent phantom materials used in radiotherapy and diagnostic imaging has been investigated. Samples of phantom materials based on epoxy resin, polyethylene, a polystyrene-polypropylene mixture and commercially available phantom materials (Solid Water TM , Gammex RMI and Plastic Water TM , Nuclear Associates) were scanned at temperatures from 15 to 40 deg. C and HU values determined. At a reference temperature of 20 deg. C materials optimized for CT applications give HU values close to zero while the commercial materials show an offset of 119.77 HU (Plastic Water) and 27.69 HU (Solid Water). Temperature dependence was lowest for epoxy-based materials (EPX-W: -0.23 HU deg. C -1 ; Solid Water: -0.25 HU deg. C -1 ) and highest for a polyethylene-based material (X0: -0.72 HU deg. C -1 ). A material based on a mixture of polystyrene and polypropylene (PSPP1: -0.27 HU deg. C -1 ) is comparable to epoxy-based materials and water (-0.29 HU deg. C -1 ). (author)

  8. Study of nu-tau properties with the SHiP experiment

    CERN Document Server

    AUTHOR|(CDS)2209555

    The SHiP experiment (Search for Hidden Particles) is a beam dump experiment proposed at the CERN SPS with the submission of a Technical Proposal in April 2015. SHiP aims at the observation of long lived particles very weakly coupled with ordinary matter. These particles are mostly produced in the decay of charmed hadrons whose production is therefore enhanced through the definition of the characteristics of both the beam and the proton target. This makes the SHiP experiment a Standard Model neutrino factory too, in particular of tau neutrinos produced by the Ds decay chain. My studies have mainly focused on the design of the neutrino detector and on the evaluation of its performances. The Neutrino Detector is placed in a magnetic field and it exploits the Emulsion Cloud Chamber Technology with the micrometric position resolution needed to disentangle the tau lepton decay vertex from the neutrino interaction vertex. This peculiarity, together with the high electron identification efficiency, makes this det...

  9. Development of a Summarized Health Index (SHI for use in predicting survival in sea turtles.

    Directory of Open Access Journals (Sweden)

    Tsung-Hsien Li

    Full Text Available Veterinary care plays an influential role in sea turtle rehabilitation, especially in endangered species. Physiological characteristics, hematological and plasma biochemistry profiles, are useful references for clinical management in animals, especially when animals are during the convalescence period. In this study, these factors associated with sea turtle surviving were analyzed. The blood samples were collected when sea turtles remained alive, and then animals were followed up for surviving status. The results indicated that significantly negative correlation was found between buoyancy disorders (BD and sea turtle surviving (p < 0.05. Furthermore, non-surviving sea turtles had significantly higher levels of aspartate aminotranspherase (AST, creatinine kinase (CK, creatinine and uric acid (UA than surviving sea turtles (all p < 0.05. After further analysis by multiple logistic regression model, only factors of BD, creatinine and UA were included in the equation for calculating summarized health index (SHI for each individual. Through evaluation by receiver operating characteristic (ROC curve, the result indicated that the area under curve was 0.920 ± 0.037, and a cut-off SHI value of 2.5244 showed 80.0% sensitivity and 86.7% specificity in predicting survival. Therefore, the developed SHI could be a useful index to evaluate health status of sea turtles and to improve veterinary care at rehabilitation facilities.

  10. HU deviation in lung and bone tissues: Characterization and a corrective strategy.

    Science.gov (United States)

    Ai, Hua A; Meier, Joseph G; Wendt, Richard E

    2018-05-01

    In the era of precision medicine, quantitative applications of x-ray Computed Tomography (CT) are on the rise. These require accurate measurement of the CT number, also known as the Hounsfield Unit. In this study, we evaluated the effect of patient attenuation-induced beam hardening of the x-ray spectrum on the accuracy of the HU values and a strategy to correct for the resulting deviations in the measured HU values. A CIRS electron density phantom was scanned on a Siemens Biograph mCT Flow CT scanner and a GE Discovery 710 CT scanner using standard techniques that are employed in the clinic to assess the HU deviation caused by beam hardening in different tissue types. In addition, an anthropomorphic ATOM adult male upper torso phantom was scanned on the GE Discovery 710 scanner. Various amounts of Superflab bolus material were wrapped around the phantoms to simulate different patient sizes. The mean HU values that were measured in the phantoms were evaluated as a function of the water-equivalent area (A w ), a parameter that is described in the report of AAPM Task Group 220. A strategy by which to correct the HU values was developed and tested. The variation in the HU values in the anthropomorphic ATOM phantom under different simulated body sizes, both before and after correction, were compared, with a focus on the lung and bone tissues. Significant HU deviations that depended on the simulated patient size were observed. A positive correlation between HU and A w was observed for tissue types that have an HU of less than zero, while a negative correlation was observed for tissue types with HU values that are greater than zero. The magnitude of the difference increases as the underlying attenuation property deviates further away from that of water. In the electron density phantom study, the maximum observed HU differences between the measured and reference values in the cortical bone and lung materials were 426 and 94 HU, respectively. In the anthropomorphic phantom

  11. HuD Regulates Coding and Noncoding RNA to Induce APP→Aβ Processing

    Directory of Open Access Journals (Sweden)

    Min-Ju Kang

    2014-06-01

    Full Text Available The primarily neuronal RNA-binding protein HuD is implicated in learning and memory. Here, we report the identification of several HuD target transcripts linked to Alzheimer’s disease (AD pathogenesis. HuD interacted with the 3′ UTRs of APP mRNA (encoding amyloid precursor protein and BACE1 mRNA (encoding β-site APP-cleaving enzyme 1 and increased the half-lives of these mRNAs. HuD also associated with and stabilized the long noncoding (lncRNA BACE1AS, which partly complements BACE1 mRNA and enhances BACE1 expression. Consistent with HuD promoting production of APP and APP-cleaving enzyme, the levels of APP, BACE1, BACE1AS, and Aβ were higher in the brain of HuD-overexpressing mice. Importantly, cortex (superior temporal gyrus from patients with AD displayed significantly higher levels of HuD and, accordingly, elevated APP, BACE1, BACE1AS, and Aβ than did cortical tissue from healthy age-matched individuals. We propose that HuD jointly promotes the production of APP and the cleavage of its amyloidogenic fragment, Aβ.

  12. [A review for a traditional Chinese medical journal Shou Shi Yi Bao].

    Science.gov (United States)

    Xiao, Mei-Hua; Sun, Wen-Zhong

    2009-06-01

    Shou Shi Yi Bao was a journal of traditional Chinese medicine (TCM) during the period from 1935 to 1937, and was originated by Chen Huan-yun, a TCM physician in Suzhou. It is mainly to transmit the knowledge of TCM and to promote the epidemic prevention capacity of local public. The editorial characteristics and historical value of the journal were explored in initial background, staff writers, editorial policies, contents and the Editor Chen's medical ideas. Shou Shi Yi Bao was supported by many famous TCM physicians, although the journal was originated from the civil society. It was an academic TCM journal with perfect practicability for orientating to the public and highlighting the academic spirit. Chen Huan-yun was a resolute defender of TCM, and had many opinions on clinical practice and lots of scientific suggestions on TCM development. Shou Shi Yi Bao reflected the main characteristics of TCM journals in 1930s. The journal was one of the important documents to study the TCM history during the period of the Republic of China in Jiangsu Province, and it also set a stage for the struggle between TCM and Western medicine at that time. The documentary information of the journal has literature and history values in reflecting the historical process of TCM self-improvement. The success of the journal was due to not only the broken-up sectarian bias and cooperation of the TCM practitioners but also the preponderant geographic and cultural circumstances of Suzhou as well as Chen Huan-yun's profound knowledge in traditional Chinese culture and medicine.

  13. SHiP: a new facility to search for heavy neutrinos and study $\

    CERN Document Server

    De Serio, Marilisa

    2016-01-01

    SHiP (Search for Hidden Particles) is a newly designed fixed target facility, proposed at the CERN SPS accelerator, with the aim of complementing searches for New Physics at LHC by searching for light long-lived exotic particles with masses below a few GeV/c2. The sensitivity to Heavy Neutrinos will allow for the first time probing a region of the parameter space where Baryogenesis and active neutrino masses and oscillation could also be explained. A dedicated detector, based on OPERA-like bricks, will provide the first observation of the tau anti-neutrino. Moreover, $\

  14. [Shi Weishan, the pioneer of the western medicine in Hubei in the Late Qing Dynasty].

    Science.gov (United States)

    Liu, F W

    2017-07-28

    The Englishman Shi Weishan (Frederick Porter Smith) is the first Christianity medical missionary sent to Central China, who is also the founder of the first mission hospital named 'Hospital of Universal Love' in Hubei. Arrived at Hankou in May 1864, he started medical work in July, and left Hankou in December 1870 because of health problem. In addition to medical mission, he tried to communicate with Chinese doctors in Hankou, then enlightened local people with health knowledge by written several books and articles, which brought some success. He also devoted to the translation of Chinese proper names and also wrote related book.

  15. Etude linguistique chez les Baráshi/Banyaambo du Rwanda

    African Journals Online (AJOL)

    User

    ont quitté le Nkóle et ont gagné le Mutára, puis le Mubarí qui est une large bande frontalière située au nord du lac Ihema jouxtant la région tanzanienne de Karágwe. Puis le mouvement s'est poursuivi vers le sud, ce qui explique donc la présence aujourd'hui d'une communauté Baráshi/Banyaambo au. Gisaká autour des ...

  16. Measurement of hard tissue density of head phantom based on the HU by using CBCT

    International Nuclear Information System (INIS)

    Kim, Moon Sun; Kang, Dong Wan; Kim, Jae Duk

    2009-01-01

    The purpose of this study was to determine a conversion coefficient for Hounsfield Units(HU) to material density (g cm -3 ) obtained from cone-beam computed tomography (CBMercuRay TM ) data and to measure the hard tissue density based on the Hounsfield scale on dental head phantom. CT Scanner Phantom (AAPM) equipped with CT Number Insert consists of five cylindrical pins of materials with different densities and teflon ring was scanned by using the CBMercuRay TM (Hitachi, Tokyo, Japan) volume scanner. The raw data were converted into DICOM format and the HU of different areas of CT number insert measured by using CBWorks TM . Linear regression analysis and Student t-test were performed statistically. There was no significant difference (P>0.54) between real densities and measured densities. A linear regression was performed using the density, ρ (g cm -3 ), as the dependent variable in terms of the HU (H). The regression equation obtained was ρ=0.00072 H-0.01588 with an R2 value of 0.9968. Density values based on the Hounsfield scale was 1697.1 ± 24.9 HU in cortical bone, 526.5 ± 44.4 HU in trabecular bone, 2639.1 ± 48.7 HU in enamel, 1246.1 ± 39.4 HU in dentin of dental head phantom. CBCT provides an effective option for determination of material density expressed as Hounsfield Units.

  17. Nanosystems based on siRNA silencing HuR expression counteract diabetic retinopathy in rat.

    Science.gov (United States)

    Amadio, Marialaura; Pascale, Alessia; Cupri, Sarha; Pignatello, Rosario; Osera, Cecilia; D Agata, Velia; D Amico, Agata Grazia; Leggio, Gian Marco; Ruozi, Barbara; Govoni, Stefano; Drago, Filippo; Bucolo, Claudio

    2016-09-01

    We evaluated whether specifically and directly targeting human antigen R (HuR), a member of embryonic lethal abnormal vision (ELAV) proteins family, may represent a new potential therapeutic strategy to manage diabetic retinopathy. Nanosystems loaded with siRNA silencing HuR expression (lipoplexes), consisting of solid lipid nanoparticles (SLN) and liposomes (SUV) were prepared. Photon correlation spectroscopy analysis, Zeta potential measurement and atomic force microscopy (AFM) studies were carried out to characterize the complexation of siRNA with the lipid nanocarriers. Nanosystems were evaluated by using AFM and scanning electron microscopy. The lipoplexes were injected into the eye of streptozotocin (STZ)-induced diabetic rats. Retinal HuR and VEGF levels were detected by Western blot and ELISA, respectively. Retinal histology was also carried out. The results demonstrated that retinal HuR and VEGF are significantly increased in STZ-rats and are blunted by HuR siRNA treatment. Lipoplexes with a weak positive surface charge and with a 4:1 N/P (cationic lipid nitrogen to siRNA phosphate) ratio exert a better transfection efficiency, significantly dumping retinal HuR and VEGF levels. In conclusion, we demonstrated that siRNA can be efficiently delivered into the rat retina using lipid-based nanocarriers, and some of the lipoplexes loaded with siRNA silencing HuR expression are potential candidates to manage retinal diseases. Copyright © 2016 Elsevier Ltd. All rights reserved.

  18. Occurrence of chai hu (Bupleuri radix) in prescriptions of Chinese herbal medicine in Switzerland.

    Science.gov (United States)

    Klein, Sabine D; Becker, Simon; Wolf, Ursula

    2012-01-01

    Chai hu (Bupleuri radix), one of the most frequently used herbs in Chinese herbal medicine, has 3 major functions, depending on dosage and combination with other herbs. The aim of this study was to investigate how chai hu is prescribed in everyday practice in Switzerland, and whether these prescription patterns reflect its various applications. A random sample of 1,053 prescriptions was drawn from the database of Lian Chinaherb AG, Wollerau, Switzerland, and analyzed regarding the most frequently used classical formulas containing chai hu, daily dosages and combinations with other herbs. 29.0% of all prescriptions contained chai hu, and 98.0% of these were in granular form. The most frequently used classical formulas were xiao yao san ('rambling powder'), jia wei xiao yao san ('augmented rambling powder') and chai hu shu gan san ('Bupleurum powder to spread the liver'). In more than half of the prescriptions, chai hu was combined with bai shao (Paeoniae Radix Alba), dang gui (Angelicae sinensis radix) or fu ling (Poria). 51.8% of the prescriptions contained a low daily dosage of chai hu, 24.9% a medium and 15.1% a high dosage. Chai hu was generally prescribed in classic combinations with other herbs and in a medium dosage. Due to the addition of supplementary herbs to classical formulas, its daily dose was often diminished from a high or medium dose to a low dose. This raises the question if chai hu would then still exert its desired function of, e.g., moving liver-qi in these prescriptions.

  19. Do temperamentally shy children process emotion differently than nonshy children? Behavioral, psychophysiological, and gender differences in reticent preschoolers.

    Science.gov (United States)

    Theall-Honey, Laura A; Schmidt, Louis A

    2006-04-01

    We examined regional brain electrical activity (EEG), heart rate, and subjective responses at rest and during the presentation of videoclips designed to elicit a range of emotions (e.g., sadness, anger, happiness, fear) among a sample of healthy 4-year-old children selected for temperamental shyness. We found that shy children exhibited significantly greater relative right central EEG activation at rest and during the presentation of the fear-eliciting videoclip than nonshy children. Shy females displayed greater relative right mid-frontal EEG activation during the sad, happy, and fear videoclips than shy males who displayed greater relative left mid-frontal EEG activation. These results (1) suggest that recent frontal EEG activation/emotion models might be gender-specific and (2) appear to provide the first empirical evidence for recent theoretical notions linking the origins and maintenance of temperamental shyness in children to difficulty in regulating fear responses. Copyright (c) 2006 Wiley Periodicals, Inc.

  20. Metabolic aspects of growth in HU-treated crown-gall tissue cultures. II. Helianthus annuus

    Directory of Open Access Journals (Sweden)

    Aldona Rennert

    2015-01-01

    Full Text Available The dynamics of growth and changes in nucleic acid and protein contents in sunflower calluses and tumours cultured in hydroxyurea (HU containing media were examined. HU-induced changes in healthy tissues ran in parallel always in the same direction, in tumourous ones however an uncoupling between DNA synthesis and tissue growth on one hand and RNA and protein synthesis on the other took place. A detailed analysis of the results allows to suppose that the specific activity of HU on tumourous tissue could be an index of: 1 quantitative disturbances in its genes function (2 degree of the lass of sensitivity to the factors of regulation.

  1. Blocking Breast Cancer Metastasis by Targeting RNA-Binding Protein HuR

    Science.gov (United States)

    2017-10-01

    AWARD NUMBER: W81XWH-16-1-0730 TITLE: Blocking Breast Cancer Metastasis by Targeting RNA-Binding Protein HuR PRINCIPAL INVESTIGATOR: Danny Welch...NUMBER Blocking Breast Cancer Metastasis by Targeting RNA-Binding Protein HuR 5b. GRANT NUMBER 5c. PROGRAM ELEMENT NUMBER 6. AUTHOR(S) 5d. PROJECT...increased aggressiveness in breast cancer , the primary objective of this proposal is to assess whether HuR (or analogs) prevent and/or treat metastasis and/or

  2. SHiP: a new multipurpose beam-dump experiment at the SPS.

    CERN Document Server

    AUTHOR|(SzGeCERN)387671

    2016-01-01

    SHiP is an experiment to look for very weakly interacting particles at a new to be constructed beam-dum p facility at the CERN SPS. The SHiP Technical Proposal has been submitted to the CERN SPS Committee in April 2015. The 400 GeV/c proton beam extracted from the SPS will be dumped on a heavy target with the aim of integ rating $2\\times 10^{20}$ proton on target in five years. A detector located downstream of the target, based on a long vacuum tank followed by a spectrometer and particle identification detectors, will allow probing a variety of models with light long-lived exotic particles and masses below a few GeV/c$^2$. The main focus will be the physics of the so-called Hidden Portals, i.e. search for Dark Photons, Light scalars and pseudo-scalars, and Heavy Neutral Leptons (HNL). The sensitivity to HNL will allow for the first time to probe, in the mass range between the kaon and the charm meson mass, a coupling range for which Baryogenesis and active neutrino masses could also be explained...

  3. Personality Development Within a Generational Context: Life Course Outcomes of Shy Children.

    Science.gov (United States)

    Schmidt, Louis A; Tang, Alva; Day, Kimberly L; Lahat, Ayelet; Boyle, Michael H; Saigal, Saroj; Van Lieshout, Ryan J

    2017-08-01

    Studies have shown that shy children born in the 1920s and 1950s had delayed marriage and parenthood, less stable careers, and lower occupational attainment as adults than other children. Do these effects still hold true? We examined demographic and social outcomes of children born between 1977 and 1982 in a prospective longitudinal study. We assessed shyness in childhood (age 8), adolescence (age 12-16), young adulthood (age 22-26), and adulthood (age 30-35), and derived three shyness trajectories (i.e., decreasing, increasing, and low-stable). Social and demographic outcomes for shy children who outgrew their shyness (i.e., decreasing trajectory) were indistinguishable from those who were consistently low on shyness measures. However, a shyness trajectory beginning in adolescence and increasing to adulthood was associated with poorer outcomes, similar to previous studies. These findings highlight the importance of multiple assessments in long-term longitudinal studies and the need to consider personality development within a generational context.

  4. [Brief discussion on acupuncture technique "controlling Qihai to regulate blood pressure" proposed by academician SHI Xuemin].

    Science.gov (United States)

    Yu, Liang; Xu, Xifa; Liu, Jian; Fan, Xiaonong

    2017-08-12

    According to Qihai theory, academician SHI Xuemin established the acupuncture technique "controlling Qihai to regulate blood pressure" which focused on Renying (ST 9), and achieved favorable effects in clinical application. In this paper, based on the Qihai theory, from aspects of Yuan qi , Zong qi , Ying qi and Wei qi and relations among qi , blood and veins in TCM, and cardiac output, sympathetic nerve activity and blood vessels in modern medicine, the understanding on hypertension was explained. As a result, both TCM and modern medicine had consistency in the understanding of hypertension, reflecting the scientificity and practicability of this acupuncture technique. Besides, according to Qihai theory and "wind leading to vertigo" theory, academician SHI Xuemin brought forward the key pathogenesis of hypertension was "dysfunction of Qihai ", and the acupoint selected Renying (ST 9), Quchi (LI 11), Hegu (LI 4), Zusanli (ST 36) and Taichong (LR 3). At the same time, the operation specification of each acupoint was mainly discussed, and the references of acupoint selection was explained based on TCM theory and modern clinical research.

  5. High quality draft genome sequence of Staphylococcus cohnii subsp. cohnii strain hu-01

    OpenAIRE

    Hu, XinJun; Li, Ang; Lv, LongXian; Yuan, Chunhui; Guo, Lihua; Jiang, Xiawei; Jiang, Haiyin; Qian, GuiRong; Zheng, BeiWen; Guo, Jing; Li, LanJuan

    2014-01-01

    Staphylococcus cohnii subsp. cohnii belongs to the family Staphylococcaceae in the order Bacillales , class Bacilli and phylum Firmicutes . The increasing relevance of S. cohnii to human health prompted us to determine the genomic sequence of Staphylococcus cohnii subsp. cohnii strain hu-01, a multidrug-resistant isolate from a hospital in China. Here we describe the features of S. cohnii subsp. cohnii strain hu-01, together with the genome sequence and its annotation. This is the first genom...

  6. Zebrafish transgenic line huORFZ is an effective living bioindicator for detecting environmental toxicants.

    Directory of Open Access Journals (Sweden)

    Hung-Chieh Lee

    Full Text Available Reliable animal models are invaluable for monitoring the extent of pollution in the aquatic environment. In this study, we demonstrated the potential of huORFZ, a novel transgenic zebrafish line that harbors a human upstream open reading frame of the chop gene fused with GFP reporter, as an animal model for monitoring environmental pollutants and stress-related cellular processes. When huORFZ embryos were kept under normal condition, no leaked GFP signal could be detected. When treated with hazardous chemicals, including heavy metals and endocrine-disrupting chemicals near their sublethal concentrations (LC50, huORFZ embryos exhibited different tissue-specific GFP expression patterns. For further analysis, copper (Cu2+, cadmium (Cd2+ and Chlorpyrifos were applied. Cu2+ triggered GFP responses in skin and muscle, whereas Cd2+ treatment triggered GFP responses in skin, olfactory epithelium and pronephric ducts. Moreover, fluorescence intensity, as exhibited by huORFZ embryos, was dose-dependent. After surviving treated embryos were returned to normal condition, survival rates, as well as TUNEL signals, returned to pretreatment levels with no significant morphological defects observed. Such results indicated the reversibility of treatment conditions used in this study, as long as embryos survived such conditions. Notably, GFP signals decreased along with recovery, suggesting that GFP signaling of huORFZ embryos likely reflected the overall physiological condition of the individual. To examine the performance of the huORFZ line under real-world conditions, we placed huORFZ embryos in different river water samples. We found that the huORFZ embryos correctly detected the presence of various kinds of pollutants. Based on these findings, we concluded that such uORFchop-based system can be integrated into a first-line water alarm system monitoring the discharge of hazardous pollutants.

  7. Zebrafish Transgenic Line huORFZ Is an Effective Living Bioindicator for Detecting Environmental Toxicants

    Science.gov (United States)

    Chu, Chien; Li, Hong-Ping; Tsai, Huai-Jen

    2014-01-01

    Reliable animal models are invaluable for monitoring the extent of pollution in the aquatic environment. In this study, we demonstrated the potential of huORFZ, a novel transgenic zebrafish line that harbors a human upstream open reading frame of the chop gene fused with GFP reporter, as an animal model for monitoring environmental pollutants and stress-related cellular processes. When huORFZ embryos were kept under normal condition, no leaked GFP signal could be detected. When treated with hazardous chemicals, including heavy metals and endocrine-disrupting chemicals near their sublethal concentrations (LC50), huORFZ embryos exhibited different tissue-specific GFP expression patterns. For further analysis, copper (Cu2+), cadmium (Cd2+) and Chlorpyrifos were applied. Cu2+ triggered GFP responses in skin and muscle, whereas Cd2+ treatment triggered GFP responses in skin, olfactory epithelium and pronephric ducts. Moreover, fluorescence intensity, as exhibited by huORFZ embryos, was dose-dependent. After surviving treated embryos were returned to normal condition, survival rates, as well as TUNEL signals, returned to pretreatment levels with no significant morphological defects observed. Such results indicated the reversibility of treatment conditions used in this study, as long as embryos survived such conditions. Notably, GFP signals decreased along with recovery, suggesting that GFP signaling of huORFZ embryos likely reflected the overall physiological condition of the individual. To examine the performance of the huORFZ line under real-world conditions, we placed huORFZ embryos in different river water samples. We found that the huORFZ embryos correctly detected the presence of various kinds of pollutants. Based on these findings, we concluded that such uORFchop-based system can be integrated into a first-line water alarm system monitoring the discharge of hazardous pollutants. PMID:24594581

  8. dNTP deficiency induced by HU via inhibiting ribonucleotide reductase affects neural tube development

    International Nuclear Information System (INIS)

    Guan, Zhen; Wang, Xiuwei; Dong, Yanting; Xu, Lin; Zhu, Zhiqiang; Wang, Jianhua; Zhang, Ting; Niu, Bo

    2015-01-01

    Highlights: • Murine NTDs were successfully induced by means of hydroxyurea (HU). • The impairment of dNTP was induced via inhibition of ribonucleotide reductase. • dNTP deficiency induced by HU caused defective DNA synthesis and repair. • Abnormal apoptosis and proliferation induced by HU affected neural tube development. - Abstract: Exposure to environmental toxic chemicals in utero during the neural tube development period can cause developmental disorders. To evaluate the disruption of neural tube development programming, the murine neural tube defects (NTDs) model was induced by interrupting folate metabolism using methotrexate in our previous study. The present study aimed to examine the effects of dNTP deficiency induced by hydroxyurea (HU), a specific ribonucleotide reductase (RNR) inhibitor, during murine neural tube development. Pregnant C57BL/6J mice were intraperitoneally injected with various doses of HU on gestation day (GD) 7.5, and the embryos were checked on GD 11.5. RNR activity and deoxynucleoside triphosphate (dNTP) levels were measured in the optimal dose. Additionally, DNA damage was examined by comet analysis and terminal deoxynucleotidyl transferase mediated dUTP nick end-labeling (TUNEL) assay. Cellular behaviors in NTDs embryos were evaluated with phosphorylation of histone H3 (PH-3) and caspase-3 using immunohistochemistry and western blot analysis. The results showed that NTDs were observed mostly with HU treatment at an optimal dose of 225 mg/kg b/w. RNR activity was inhibited and dNTP levels were decreased in HU-treated embryos with NTDs. Additionally, increased DNA damage, decreased proliferation, and increased caspase-3 were significant in NTDs embryos compared to the controls. Results indicated that HU induced murine NTDs model by disturbing dNTP metabolism and further led to the abnormal cell balance between proliferation and apoptosis

  9. Different modes of interaction by TIAR and HuR with target RNA and DNA.

    Science.gov (United States)

    Kim, Henry S; Wilce, Matthew C J; Yoga, Yano M K; Pendini, Nicole R; Gunzburg, Menachem J; Cowieson, Nathan P; Wilson, Gerald M; Williams, Bryan R G; Gorospe, Myriam; Wilce, Jacqueline A

    2011-02-01

    TIAR and HuR are mRNA-binding proteins that play important roles in the regulation of translation. They both possess three RNA recognition motifs (RRMs) and bind to AU-rich elements (AREs), with seemingly overlapping specificity. Here we show using SPR that TIAR and HuR bind to both U-rich and AU-rich RNA in the nanomolar range, with higher overall affinity for U-rich RNA. However, the higher affinity for U-rich sequences is mainly due to faster association with U-rich RNA, which we propose is a reflection of the higher probability of association. Differences between TIAR and HuR are observed in their modes of binding to RNA. TIAR is able to bind deoxy-oligonucleotides with nanomolar affinity, whereas HuR affinity is reduced to a micromolar level. Studies with U-rich DNA reveal that TIAR binding depends less on the 2'-hydroxyl group of RNA than HuR binding. Finally we show that SAXS data, recorded for the first two domains of TIAR in complex with RNA, are more consistent with a flexible, elongated shape and not the compact shape that the first two domains of Hu proteins adopt upon binding to RNA. We thus propose that these triple-RRM proteins, which compete for the same binding sites in cells, interact with their targets in fundamentally different ways.

  10. A facility to search for hidden particles at the CERN SPS: the SHiP physics case.

    Science.gov (United States)

    Alekhin, Sergey; Altmannshofer, Wolfgang; Asaka, Takehiko; Batell, Brian; Bezrukov, Fedor; Bondarenko, Kyrylo; Boyarsky, Alexey; Choi, Ki-Young; Corral, Cristóbal; Craig, Nathaniel; Curtin, David; Davidson, Sacha; de Gouvêa, André; Dell'Oro, Stefano; deNiverville, Patrick; Bhupal Dev, P S; Dreiner, Herbi; Drewes, Marco; Eijima, Shintaro; Essig, Rouven; Fradette, Anthony; Garbrecht, Björn; Gavela, Belen; Giudice, Gian F; Goodsell, Mark D; Gorbunov, Dmitry; Gori, Stefania; Grojean, Christophe; Guffanti, Alberto; Hambye, Thomas; Hansen, Steen H; Helo, Juan Carlos; Hernandez, Pilar; Ibarra, Alejandro; Ivashko, Artem; Izaguirre, Eder; Jaeckel, Joerg; Jeong, Yu Seon; Kahlhoefer, Felix; Kahn, Yonatan; Katz, Andrey; Kim, Choong Sun; Kovalenko, Sergey; Krnjaic, Gordan; Lyubovitskij, Valery E; Marcocci, Simone; Mccullough, Matthew; McKeen, David; Mitselmakher, Guenakh; Moch, Sven-Olaf; Mohapatra, Rabindra N; Morrissey, David E; Ovchynnikov, Maksym; Paschos, Emmanuel; Pilaftsis, Apostolos; Pospelov, Maxim; Reno, Mary Hall; Ringwald, Andreas; Ritz, Adam; Roszkowski, Leszek; Rubakov, Valery; Ruchayskiy, Oleg; Schienbein, Ingo; Schmeier, Daniel; Schmidt-Hoberg, Kai; Schwaller, Pedro; Senjanovic, Goran; Seto, Osamu; Shaposhnikov, Mikhail; Shchutska, Lesya; Shelton, Jessie; Shrock, Robert; Shuve, Brian; Spannowsky, Michael; Spray, Andy; Staub, Florian; Stolarski, Daniel; Strassler, Matt; Tello, Vladimir; Tramontano, Francesco; Tripathi, Anurag; Tulin, Sean; Vissani, Francesco; Winkler, Martin W; Zurek, Kathryn M

    2016-12-01

    This paper describes the physics case for a new fixed target facility at CERN SPS. The SHiP (search for hidden particles) experiment is intended to hunt for new physics in the largely unexplored domain of very weakly interacting particles with masses below the Fermi scale, inaccessible to the LHC experiments, and to study tau neutrino physics. The same proton beam setup can be used later to look for decays of tau-leptons with lepton flavour number non-conservation, [Formula: see text] and to search for weakly-interacting sub-GeV dark matter candidates. We discuss the evidence for physics beyond the standard model and describe interactions between new particles and four different portals-scalars, vectors, fermions or axion-like particles. We discuss motivations for different models, manifesting themselves via these interactions, and how they can be probed with the SHiP experiment and present several case studies. The prospects to search for relatively light SUSY and composite particles at SHiP are also discussed. We demonstrate that the SHiP experiment has a unique potential to discover new physics and can directly probe a number of solutions of beyond the standard model puzzles, such as neutrino masses, baryon asymmetry of the Universe, dark matter, and inflation.

  11. Understanding Relations among Children's Shy and Antisocial/Aggressive Behaviors and Mothers' Parenting: The Role of Maternal Beliefs

    Science.gov (United States)

    Evans, Cortney A.; Nelson, Larry J.; Porter, Christin L.; Nelson, David A.; Hart, Craig H.

    2012-01-01

    This study assesses the relationships between children's shy and antisocial/aggressive behaviors and maternal beliefs, and concomitant parenting behaviors. Structural equation models examined 199 mothers' perceptions of aggression and shyness in their preschool-age children (average age = 59.63 months); maternal beliefs (i.e., locus of control,…

  12. First reliability test of a surface micromachined microengine using SHiMMeR

    Energy Technology Data Exchange (ETDEWEB)

    Tanner, D.M.; Smith, N.F.; Bowman, D.J. [and others

    1997-08-01

    The first-ever reliability stress test on surface micromachined microengines developed at Sandia National Laboratories (SNL) has been completed. We stressed 41 microengines at 36,000 RPM and inspected the functionality at 60 RPM. We have observed an infant mortality region, a region of low failure rate (useful life), and no signs of wearout in the data. The reliability data are presented and interpreted using standard reliability methods. Failure analysis results on the stressed microengines are presented. In our effort to study the reliability of MEMS, we need to observe the failures of large numbers of parts to determine the failure modes. To facilitate testing of large numbers of micromachines. The Sandia High Volume Measurement of Micromachine Reliability (SHiMMeR) system has computer controlled positioning and the capability to inspect moving parts. The development of this parallel testing system is discussed in detail.

  13. Effects of Climate Change and Fisheries Bycatch on Shy Albatross (Thalassarche cauta) in Southern Australia.

    Science.gov (United States)

    Thomson, Robin B; Alderman, Rachael L; Tuck, Geoffrey N; Hobday, Alistair J

    2015-01-01

    The impacts of climate change on marine species are often compounded by other stressors that make direct attribution and prediction difficult. Shy albatrosses (Thalassarche cauta) breeding on Albatross Island, Tasmania, show an unusually restricted foraging range, allowing easier discrimination between the influence of non-climate stressors (fisheries bycatch) and environmental variation. Local environmental conditions (rainfall, air temperature, and sea-surface height, an indicator of upwelling) during the vulnerable chick-rearing stage, have been correlated with breeding success of shy albatrosses. We use an age-, stage- and sex-structured population model to explore potential relationships between local environmental factors and albatross breeding success while accounting for fisheries bycatch by trawl and longline fisheries. The model uses time-series of observed breeding population counts, breeding success, adult and juvenile survival rates and a bycatch mortality observation for trawl fishing to estimate fisheries catchability, environmental influence, natural mortality rate, density dependence, and productivity. Observed at-sea distributions for adult and juvenile birds were coupled with reported fishing effort to estimate vulnerability to incidental bycatch. The inclusion of rainfall, temperature and sea-surface height as explanatory variables for annual chick mortality rate was statistically significant. Global climate models predict little change in future local average rainfall, however, increases are forecast in both temperatures and upwelling, which are predicted to have detrimental and beneficial effects, respectively, on breeding success. The model shows that mitigation of at least 50% of present bycatch is required to offset losses due to future temperature changes, even if upwelling increases substantially. Our results highlight the benefits of using an integrated modeling approach, which uses available demographic as well as environmental data

  14. Effects of Climate Change and Fisheries Bycatch on Shy Albatross (Thalassarche cauta in Southern Australia.

    Directory of Open Access Journals (Sweden)

    Robin B Thomson

    Full Text Available The impacts of climate change on marine species are often compounded by other stressors that make direct attribution and prediction difficult. Shy albatrosses (Thalassarche cauta breeding on Albatross Island, Tasmania, show an unusually restricted foraging range, allowing easier discrimination between the influence of non-climate stressors (fisheries bycatch and environmental variation. Local environmental conditions (rainfall, air temperature, and sea-surface height, an indicator of upwelling during the vulnerable chick-rearing stage, have been correlated with breeding success of shy albatrosses. We use an age-, stage- and sex-structured population model to explore potential relationships between local environmental factors and albatross breeding success while accounting for fisheries bycatch by trawl and longline fisheries. The model uses time-series of observed breeding population counts, breeding success, adult and juvenile survival rates and a bycatch mortality observation for trawl fishing to estimate fisheries catchability, environmental influence, natural mortality rate, density dependence, and productivity. Observed at-sea distributions for adult and juvenile birds were coupled with reported fishing effort to estimate vulnerability to incidental bycatch. The inclusion of rainfall, temperature and sea-surface height as explanatory variables for annual chick mortality rate was statistically significant. Global climate models predict little change in future local average rainfall, however, increases are forecast in both temperatures and upwelling, which are predicted to have detrimental and beneficial effects, respectively, on breeding success. The model shows that mitigation of at least 50% of present bycatch is required to offset losses due to future temperature changes, even if upwelling increases substantially. Our results highlight the benefits of using an integrated modeling approach, which uses available demographic as well as

  15. Effect of swift heavy ion (SHI) irradiation on transparent conducting oxide electrodes for dye-sensitized solar cell applications

    International Nuclear Information System (INIS)

    Singh, Hemant Kr.; Avasthi, D.K.; Aggarwal, Shruti

    2015-01-01

    Highlights: •The objective is to study the effect of swift heavy ion (SHI) irradiation on photoanode of DSSC for better efficiency. •This work presents the effect of SHI irradiation on various Transparent conducting oxides (TCOs). •Effects are studied in terms of conductivity and transmittance of TCOs. •ITO-PET gives best results in comparison to ITO and FTO for DSSC application under SHI irradiation. -- Abstract: Transparent conducting oxides (TCOs) are used as electrodes in dye-sensitized solar cells (DSSCs) because of their properties such as high transmittance and low resistivity. In the present work, the effects of swift heavy ion (SHI) irradiation on various types of TCOs are presented. The objective of this study is to investigate the effect of SHI on TCOs. For the present study, three different types of TCOs are considered, namely, (a) FTO (fluorine-doped tin oxide, SnO 2 :F) on a Nippon glass substrate, (b) ITO (indium tin oxide, In 2 O 3 :Sn) coated on polyethylene terephthalate (PET) on a Corning glass substrate, and (c) ITO on a Corning glass substrate. These films are irradiated with 120 MeV Ag +9 ions at fluences ranging from 3.0 × 10 11 ions/cm 2 to 3.0 × 10 13 ions/cm 2 . The structural, morphological, optical and electrical properties are studied via X-ray diffraction (XRD), atomic force microscopy (AFM), UV–Vis absorption spectroscopy and four-probe resistivity measurements, respectively. The ITO-PET electrode is found to exhibit superior conductivity and transmittance properties in comparison with the others after irradiation and, therefore, to be the most suitable for solar cell applications

  16. Effect of swift heavy ion (SHI) irradiation on transparent conducting oxide electrodes for dye-sensitized solar cell applications

    Energy Technology Data Exchange (ETDEWEB)

    Singh, Hemant Kr. [University School of Basic and Applied Sciences, Guru Gobind Singh Indraprastha University, New Delhi (India); Avasthi, D.K. [Inter University Accelerator Center, Post Box 10502, New Delhi (India); Aggarwal, Shruti, E-mail: shruti.al@gmail.com [University School of Basic and Applied Sciences, Guru Gobind Singh Indraprastha University, New Delhi (India)

    2015-06-15

    Highlights: •The objective is to study the effect of swift heavy ion (SHI) irradiation on photoanode of DSSC for better efficiency. •This work presents the effect of SHI irradiation on various Transparent conducting oxides (TCOs). •Effects are studied in terms of conductivity and transmittance of TCOs. •ITO-PET gives best results in comparison to ITO and FTO for DSSC application under SHI irradiation. -- Abstract: Transparent conducting oxides (TCOs) are used as electrodes in dye-sensitized solar cells (DSSCs) because of their properties such as high transmittance and low resistivity. In the present work, the effects of swift heavy ion (SHI) irradiation on various types of TCOs are presented. The objective of this study is to investigate the effect of SHI on TCOs. For the present study, three different types of TCOs are considered, namely, (a) FTO (fluorine-doped tin oxide, SnO{sub 2}:F) on a Nippon glass substrate, (b) ITO (indium tin oxide, In{sub 2}O{sub 3}:Sn) coated on polyethylene terephthalate (PET) on a Corning glass substrate, and (c) ITO on a Corning glass substrate. These films are irradiated with 120 MeV Ag{sup +9} ions at fluences ranging from 3.0 × 10{sup 11} ions/cm{sup 2} to 3.0 × 10{sup 13} ions/cm{sup 2}. The structural, morphological, optical and electrical properties are studied via X-ray diffraction (XRD), atomic force microscopy (AFM), UV–Vis absorption spectroscopy and four-probe resistivity measurements, respectively. The ITO-PET electrode is found to exhibit superior conductivity and transmittance properties in comparison with the others after irradiation and, therefore, to be the most suitable for solar cell applications.

  17. SHI/STY Genes Affect Pre- and Post-meiotic Anther Processes in Auxin Sensing Domains in Arabidopsis

    Directory of Open Access Journals (Sweden)

    Leandro H. Estornell

    2018-02-01

    Full Text Available In flowering plants, mature sperm cells are enclosed in pollen grains formed in structures called anthers. Several cell layers surrounding the central sporogenous cells of the anther are essential for directing the developmental processes that lead to meiosis, pollen formation, and the subsequent pollen release. The specification and function of these tissues are regulated by a large number of genetic factors. Additionally, the plant hormone auxin has previously been shown to play important roles in the later phases of anther development. Using the R2D2 auxin sensor system we here show that auxin is sensed also in the early phases of anther cell layer development, suggesting that spatiotemporal regulation of auxin levels is important for early anther morphogenesis. Members of the SHI/STY transcription factor family acting as direct regulators of YUC auxin biosynthesis genes have previously been demonstrated to affect early anther patterning. Using reporter constructs we show that SHI/STY genes are dynamically active throughout anther development and their expression overlaps with those of three additional downstream targets, PAO5, EOD3 and PGL1. Characterization of anthers carrying mutations in five SHI/STY genes clearly suggests that SHI/STY transcription factors affect anther organ identity. In addition, their activity is important to repress periclinal cell divisions as well as premature entrance into programmed cell death and cell wall lignification, which directly influences the timing of anther dehiscence and the pollen viability. The SHI/STY proteins also prevent premature pollen germination suggesting that they may play a role in the induction or maintenance of pollen dormancy.

  18. The synthetic cannabinoid HU210 induces spatial memory deficits and suppresses hippocampal firing rate in rats.

    Science.gov (United States)

    Robinson, L; Goonawardena, A V; Pertwee, R G; Hampson, R E; Riedel, G

    2007-07-01

    Previous work implied that the hippocampal cannabinoid system was particularly important in some forms of learning, but direct evidence for this hypothesis is scarce. We therefore assessed the effects of the synthetic cannabinoid HU210 on memory and hippocampal activity. HU210 (100 microg kg(-1)) was administered intraperitoneally to rats under three experimental conditions. One group of animals were pre-trained in spatial working memory using a delayed-matching-to-position task and effects of HU210 were assessed in a within-subject design. In another, rats were injected before acquisition learning of a spatial reference memory task with constant platform location. Finally, a separate group of animals was implanted with electrode bundles in CA1 and CA3 and single unit responses were isolated, before and after HU210 treatment. HU210 treatment had no effect on working or short-term memory. Relative to its control Tween 80, deficits in acquisition of a reference memory version of the water maze were obtained, along with drug-related effects on anxiety, motor activity and spatial learning. Deficits were not reversed by the CB(1) receptor antagonists SR141716A (3 mg kg(-1)) or AM281 (1.5 mg kg(-1)). Single unit recordings from principal neurons in hippocampal CA3 and CA1 confirmed HU210-induced attenuation of the overall firing activity lowering both the number of complex spikes fired and the occurrence of bursts. These data provide the first direct evidence that the underlying mechanism for the spatial memory deficits induced by HU210 in rats is the accompanying abnormality in hippocampal cell firing.

  19. HuR represses Wnt/β-catenin-mediated transcriptional activity by promoting cytoplasmic localization of β-catenin

    Energy Technology Data Exchange (ETDEWEB)

    Kim, Inae; Hur, Jung; Jeong, Sunjoo, E-mail: sjsj@dankook.ac.kr

    2015-01-30

    Highlights: • Wnt signaling as well as β-catenin overexpression enhance HuR cytoplasmic export. • HuR overexpression promotes cytoplasmic localization of β-catenin from the perinuclear fraction. • Wnt/β-catenin-mediated transcriptional activity is repressesed by HuR. - Abstract: β-Catenin is the key transcriptional activator of canonical Wnt signaling in the nucleus; thus, nuclear accumulation of β-catenin is a critical step for expressing target genes. β-Catenin accumulates in the nucleus of cancer cells where it activates oncogenic target genes. Hu antigen R (HuR) is a RNA binding protein that regulates multiple post-transcriptional processes including RNA stability. Thus, cytoplasmic HuR protein may be involved in tumorigenesis by stabilizing oncogenic transcripts, but the molecular mechanism remains unclear. Here, we observed that Wnt/β-catenin signaling induced export of the HuR protein, whereas HuR overexpression promoted accumulation of the β-catenin protein in the cytoplasm. Thus, Wnt/β-catenin-mediated transcriptional activity in the nucleus was reduced by overexpressing HuR. These results suggest novel and uncharacterized cytoplasmic β-catenin functions related to HuR-mediated RNA metabolism in cancer cells.

  20. HuR represses Wnt/β-catenin-mediated transcriptional activity by promoting cytoplasmic localization of β-catenin

    International Nuclear Information System (INIS)

    Kim, Inae; Hur, Jung; Jeong, Sunjoo

    2015-01-01

    Highlights: • Wnt signaling as well as β-catenin overexpression enhance HuR cytoplasmic export. • HuR overexpression promotes cytoplasmic localization of β-catenin from the perinuclear fraction. • Wnt/β-catenin-mediated transcriptional activity is repressesed by HuR. - Abstract: β-Catenin is the key transcriptional activator of canonical Wnt signaling in the nucleus; thus, nuclear accumulation of β-catenin is a critical step for expressing target genes. β-Catenin accumulates in the nucleus of cancer cells where it activates oncogenic target genes. Hu antigen R (HuR) is a RNA binding protein that regulates multiple post-transcriptional processes including RNA stability. Thus, cytoplasmic HuR protein may be involved in tumorigenesis by stabilizing oncogenic transcripts, but the molecular mechanism remains unclear. Here, we observed that Wnt/β-catenin signaling induced export of the HuR protein, whereas HuR overexpression promoted accumulation of the β-catenin protein in the cytoplasm. Thus, Wnt/β-catenin-mediated transcriptional activity in the nucleus was reduced by overexpressing HuR. These results suggest novel and uncharacterized cytoplasmic β-catenin functions related to HuR-mediated RNA metabolism in cancer cells

  1. Estudo da anomalia de Pelger-Huët em núcleo familiar Pelger-Huët anomaly study in a family

    Directory of Open Access Journals (Sweden)

    Patrícia H. O. Calderan

    2008-02-01

    Full Text Available The Pelger-Huët anomaly is a dominant autosomal disease, characterized by the incomplete segmentation of the granulocytes nucleus without lost of the cellular function. The heterozygotes form of this anomaly is assintomatic and it did not possess physic meant, while the homozygote form is rare and can be lethal, being therefore, important differentiates of other infectious alterations. The pseudo-anomaly can occasionally be observed in cases of granulocitic leukemia, mieloproliferatives Diseases, some infections and after exposition the determined drugs. We evaluate eleven members of a familiar nucleus and, after the blood cells analysis, six of then had presented neutrophils and eosinophils with nuclei characteristic of the heterozygotes form of the Pelger-Huët anomaly. The recognition of this leukocyte anomaly, mainly in patients without infection and presenting great number of not segmented neutrophils, can prevent wrong interpretations of the blood cells count and unnecessary clinical and therapeutically behaviors.

  2. Activity-dependent expression of ELAV/Hu RBPs and neuronal mRNAs in seizure and cocaine brain.

    Science.gov (United States)

    Tiruchinapalli, Dhanrajan M; Caron, Marc G; Keene, Jack D

    2008-12-01

    Growing evidence indicates that both seizure (glutamate) and cocaine (dopamine) treatment modulate synaptic plasticity within the mesolimbic region of the CNS. Activation of glutamatergic neurons depends on the localized translation of neuronal mRNA products involved in modulating synaptic plasticity. In this study, we demonstrate the dendritic localization of HuR and HuD RNA-binding proteins (RBPs) and their association with neuronal mRNAs following these two paradigms of seizure and cocaine treatment. Both the ubiquitously expressed HuR and neuronal HuD RBPs were detected in different regions as well as within dendrites of the brain and in dissociated neurons. Quantitative analysis revealed an increase in HuR, HuD and p-glycogen synthase kinase 3beta (GSK3beta) protein levels as well as neuronal mRNAs encoding Homer, CaMKIIalpha, vascular early response gene, GAP-43, neuritin, and neuroligin protein products following either seizure or cocaine treatment. Inhibition of the Akt/GSK3beta signaling pathway by acute or chronic LiCl treatment revealed changes in HuR, HuD, pGSK3beta, p-Akt, and beta-catenin protein levels. In addition, a genetically engineered hyperdopaminergic mouse model (dopamine transporter knockout) revealed decreased expression of HuR protein levels, but no significant change was observed in HuD or fragile-X mental retardation protein RBPs. Finally, our data suggest that HuR and HuD RBPs potentially interact directly with neuronal mRNAs important for differentiation and synaptic plasticity.

  3. An experimental study of mechanism in treatment for endometriosis with Xiao Chai Hu Tang in rats

    International Nuclear Information System (INIS)

    Zhang Hui; Zuo Liandong; Li Hongyi

    2005-01-01

    To explore the mechanism of Xiao Chai Hu Tang in treatment for endometriosis in rats, the rat model of endometriosis was established. Using immunohistochemistry method, Fas and Caspase-3 protein expression in endometrium and endometriotic tissue of each group were observed. The results showed that in the group treated with Xiao Chai Hu Tang, the protein expressions of Fas and Caspase-3 in endometriotic tissue were higher than those in endometrium, while in the control group, the result was just opposite. The difference was not obvious in the group treated with Danazol . The higher levels of the protein expression of Fas in endometriotic tissue may related to the pathogenesis of the endometriosis. The mechanism of Xiao Chai Hu Tang treatment may be partly to increase apoptosis in endometriotic tissue. (authors)

  4. Effets des sels organiques de tributyletain sur l'huître adulte Crassostrea gigas

    OpenAIRE

    Heral, Maurice; Alzieu, Claude; Caux, O.; Razet, Daniel; Garnier, Jacqueline

    1983-01-01

    La toxicité des composés organostanniques a été mise en évidence à l'égard de l'huître Crassostrea gigas tant aux stades larvaires (His & Robert, 1980) que chez l'adulte (Alzieu & al., 1980, 1981). Parallèlement ces mêmes auteurs ont montré l'accumulation d'étain dans les huîtres contaminées expérimentalement ainsi que le rôle que peut jouer le fluorure de TBT dans la perturbation de la croissance (Héral & al. 1981) et dans la malformation de la coquille des huîtres (Alzieu & al., 1981). Dans...

  5. Nilai Kalor Bakar Limbah Padat (HuWAC Sebagai Bahan Bakar Alternatif dalam Produksi Batu Bata

    Directory of Open Access Journals (Sweden)

    Soeparjono Soeparjono

    2009-02-01

    Full Text Available Menipisnya persediaan minyak bumi dan sulitnya mendapatkan kayu bakar dengan harga murah sebagai bahan bakar untuk kalangan industri kecil produksi batu bata, diperlukan adanya pemikiran mencari bahan bakar alternatif dan murah. Penelitian ini bertujuan mengetahui nilai kalor bakar limbah HuWAC sebagai bahan bakar alternatif untuk produksi batu merah. Sasarannya limbah HuWAC pabrik monosodium glutamat AJINOMOTO Mojokerto dengan sampel acak yang dikeringkan panas matahari. Penelitian menggunakan pendekatan kuantitatif rancangan deskriptif. Unsur-unsur yang terbakar dalam sampel dilakukan koreksi. Pengambilan data dilakukan secara langsung dengan alat Kalorimeter. Hasil penelitian menunjukkan bahwa nilai kalor bakar yang dihitung dengan formula Dulong, LVH = 2614 kcal/kg dan HHV = 2745 kcal/kg, sedangkan dari alat Kalorimeter Hgr = 2728 kcal/kg. Hal ini menunjukkan bahwa HuWAC dapat digunakan sebagai bahan bakar alternatif di kalangan industri kecil produksi batu bata.

  6. HuMOVE: a low-invasive wearable monitoring platform in sexual medicine.

    Science.gov (United States)

    Ciuti, Gastone; Nardi, Matteo; Valdastri, Pietro; Menciassi, Arianna; Basile Fasolo, Ciro; Dario, Paolo

    2014-10-01

    To investigate an accelerometer-based wearable system, named Human Movement (HuMOVE) platform, designed to enable quantitative and continuous measurement of sexual performance with minimal invasiveness and inconvenience for users. Design, implementation, and development of HuMOVE, a wearable platform equipped with an accelerometer sensor for monitoring inertial parameters for sexual performance assessment and diagnosis, were performed. The system enables quantitative measurement of movement parameters during sexual intercourse, meeting the requirements of wearability, data storage, sampling rate, and interfacing methods, which are fundamental for human sexual intercourse performance analysis. HuMOVE was validated through characterization using a controlled experimental test bench and evaluated in a human model during simulated sexual intercourse conditions. HuMOVE demonstrated to be a robust and quantitative monitoring platform and a reliable candidate for sexual performance evaluation and diagnosis. Characterization analysis on the controlled experimental test bench demonstrated an accurate correlation between the HuMOVE system and data from a reference displacement sensor. Experimental tests in the human model during simulated intercourse conditions confirmed the accuracy of the sexual performance evaluation platform and the effectiveness of the selected and derived parameters. The obtained outcomes also established the project expectations in terms of usability and comfort, evidenced by the questionnaires that highlighted the low invasiveness and acceptance of the device. To the best of our knowledge, HuMOVE platform is the first device for human sexual performance analysis compatible with sexual intercourse; the system has the potential to be a helpful tool for physicians to accurately classify sexual disorders, such as premature or delayed ejaculation. Copyright © 2014 Elsevier Inc. All rights reserved.

  7. High quality draft genome sequence of Staphylococcus cohnii subsp. cohnii strain hu-01.

    Science.gov (United States)

    Hu, XinJun; Li, Ang; Lv, LongXian; Yuan, Chunhui; Guo, Lihua; Jiang, Xiawei; Jiang, Haiyin; Qian, GuiRong; Zheng, BeiWen; Guo, Jing; Li, LanJuan

    2014-06-15

    Staphylococcus cohnii subsp. cohnii belongs to the family Staphylococcaceae in the order Bacillales, class Bacilli and phylum Firmicutes. The increasing relevance of S. cohnii to human health prompted us to determine the genomic sequence of Staphylococcus cohnii subsp. cohnii strain hu-01, a multidrug-resistant isolate from a hospital in China. Here we describe the features of S. cohnii subsp. cohnii strain hu-01, together with the genome sequence and its annotation. This is the first genome sequence of the species Staphylococcus cohnii.

  8. Different modes of interaction by TIAR and HuR with target RNA and DNA

    OpenAIRE

    Kim, Henry S.; Wilce, Matthew C. J.; Yoga, Yano M. K.; Pendini, Nicole R.; Gunzburg, Menachem J.; Cowieson, Nathan P.; Wilson, Gerald M.; Williams, Bryan R. G.; Gorospe, Myriam; Wilce, Jacqueline A.

    2011-01-01

    TIAR and HuR are mRNA-binding proteins that play important roles in the regulation of translation. They both possess three RNA recognition motifs (RRMs) and bind to AU-rich elements (AREs), with seemingly overlapping specificity. Here we show using SPR that TIAR and HuR bind to both U-rich and AU-rich RNA in the nanomolar range, with higher overall affinity for U-rich RNA. However, the higher affinity for U–rich sequences is mainly due to faster association with U-rich RNA, which we propose i...

  9. A facility to Search for Hidden Particles at the CERN SPS: the SHiP physics case

    CERN Document Server

    Alekhin, Sergey; Asaka, Takehiko; Batell, Brian; Bezrukov, Fedor; Bondarenko, Kyrylo; Boyarsky, Alexey; Choi, Ki-Young; Corral, Cristobal; Craig, Nathaniel; Curtin, David; Davidson, Sacha; de Gouvea, Andre; Dell'Oro, Stefano; deNiverville, Patrick; Bhupal Dev, P.S.; Dreiner, Herbi; Drewes, Marco; Eijima, Shintaro; Essig, Rouven; Fradette, Anthony; Garbrecht, Bjorn; Gavela, Belen; Giudice, Gian F.; Goodsell, Mark D.; Gorbunov, Dmitry; Gori, Stefania; Grojean, Christophe; Guffanti, Alberto; Hambye, Thomas; Hansen, Steen H.; Helo, Juan Carlos; Hernandez, Pilar; Ibarra, Alejandro; Ivashko, Artem; Izaguirre, Eder; Jaeckel, Joerg; Jeong, Yu Seon; Kahlhoefer, Felix; Kahn, Yonatan; Katz, Andrey; Kim, Choong Sun; Kovalenko, Sergey; Krnjaic, Gordan; Lyubovitskij, Valery E.; Marcocci, Simone; Mccullough, Matthew; McKeen, David; Mitselmakher, Guenakh; Moch, Sven-Olaf; Mohapatra, Rabindra N.; Morrissey, David E.; Ovchynnikov, Maksym; Paschos, Emmanuel; Pilaftsis, Apostolos; Pospelov, Maxim; Reno, Mary Hall; Ringwald, Andreas; Ritz, Adam; Roszkowski, Leszek; Rubakov, Valery; Ruchayskiy, Oleg; Schienbein, Ingo; Schmeier, Daniel; Schmidt-Hoberg, Kai; Schwaller, Pedro; Senjanovic, Goran; Seto, Osamu; Shaposhnikov, Mikhail; Shchutska, Lesya; Shelton, Jessie; Shrock, Robert; Shuve, Brian; Spannowsky, Michael; Spray, Andy; Staub, Florian; Stolarski, Daniel; Strassler, Matt; Tello, Vladimir; Tramontano, Francesco; Tripathi, Anurag; Tulin, Sean; Vissani, Francesco; Winkler, Martin W.; Zurek, Kathryn M.; CERN. Geneva. SPS and PS Experiments Committee; SPSC

    2016-10-24

    This paper describes the physics case for a new fixed target facility at CERN SPS. The SHiP (Search for Hidden Particles) experiment is intended to hunt for new physics in the largely unexplored domain of very weakly interacting particles with masses below the Fermi scale, inaccessible to the LHC experiments, and to study tau neutrino physics. The same proton beam setup can be used later to look for decays of tau-leptons with lepton flavour number non-conservation, $\\tau\\to 3\\mu$ and to search for weakly-interacting sub-GeV dark matter candidates. We discuss the evidence for physics beyond the Standard Model and describe interactions between new particles and four different portals - scalars, vectors, fermions or axion-like particles. We discuss motivations for different models, manifesting themselves via these interactions, and how they can be probed with the SHiP experiment and present several case studies. The prospects to search for relatively light SUSY and composite particles at SHiP are also discussed....

  10. THE SUNNI-SHI'ITE RIVALRY AND ITS INFLUENCE ON THE GEOPOLITICAL SITUATION OF THE MIDDLE EAST

    Directory of Open Access Journals (Sweden)

    Alexander A. Kuznetsov

    2014-01-01

    Full Text Available The article "The Sunni-Shi'ite rivalry and its influence on the geopolitical situation of the Middle East" is dedicated to the sectarian conflicts in the Middle East region in last 30 years. Author considers the Islamic revolution of 1979 in Iran as the point of departure of this conflict. Author of the article makes a difference between the Shi'ite Islamic revolutionary doctrine of Khomeini and the Salafi Islamic fundamentalism of Saudi Arabia. Author realizes the analysis of the war between Iran and Iraq in 1980-1988. This analysis is emphasized on the regional geopolitical situation and positions of the outside actors (Saudi Arabia, USA, France, Germany. Then it is covered the American invasion of Iraq in 2003 and its geopolitical consequences. To the author's mind this aggression and further empowerment of the Shi'ite majority reduced to the civil war in Iraq and exacerbation of the sectarian conflict. Author of the article considers these events as a part of the geopolitical rivalry between Iran and Saudi Arabia to unfold in the areas of Iraq, Syria and Lebanon.

  11. The Sunni-Shi'ite Rivalry And Its Influence On The Geopolitical Situation Of The Middle East

    Directory of Open Access Journals (Sweden)

    Alexander A. Kuznetsov

    2014-01-01

    Full Text Available The article "The Sunni-Shi'ite rivalry and its influence on the geopolitical situation of the Middle East" is dedicated to the sectarian conflicts in the Middle East region in last 30 years. Author considers the Islamic revolution of 1979 in Iran as the point of departure of this conflict. Author of the article makes a difference between the Shi'ite Islamic revolutionary doctrine of Khomeini and the Salafi Islamic fundamentalism of Saudi Arabia. Author realizes the analysis of the war between Iran and Iraq in 1980-1988. This analysis is emphasized on the regional geopolitical situation and positions of the outside actors (Saudi Arabia, USA, France, Germany. Then it is covered the American invasion of Iraq in 2003 and its geopolitical consequences. To the author's mind this aggression and further empowerment of the Shi'ite majority reduced to the civil war in Iraq and exacerbation of the sectarian conflict. Author of the article considers these events as a part of the geopolitical rivalry between Iran and Saudi Arabia to unfold in the areas of Iraq, Syria and Lebanon.

  12. SHI induced modification in structural, optical, dielectric and thermal properties of poly ethylene oxide films

    Energy Technology Data Exchange (ETDEWEB)

    Patel, Gnansagar B.; Bhavsar, Shilpa [Department of Physics, The M.S. University of Baroda, Vadodara 390002 (India); Singh, N.L., E-mail: nl.singh-phy@msubaroda.ac.in [Department of Physics, The M.S. University of Baroda, Vadodara 390002 (India); Singh, F.; Kulriya, P.K. [Inter University Accelerator Centre, Aruna Asaf Ali Marg, New Delhi 110067 (India)

    2016-07-15

    Poly ethylene oxide (PEO) films were synthesized by solution cast method. These self-standing films were exposed with 60 MeV C{sup +5} ion and 100 MeV Ni{sup +7} ion at different fluences. SHI induced effect was investigated by employing various techniques. The crystalline size decreased upon irradiation as observed from XRD analysis. FTIR analysis reveals the decrement in the peak intensity upon irradiation. Tauc’s method was used to determine the optical band gap (E{sub g}), which shows decreasing trends with increase of fluence. The dielectric properties were investigated in the frequency range 10 Hz to 10 MHz for unirradiated and irradiated films. The dielectric constant remains same for the broad-spectrum of frequency and increases at lower frequency. The dielectric loss also moderately influence as a function of frequency due to irradiation. DSC analysis validated the results of XRD. Scanning electron microscopy (SEM) reveals that there is significant change in the surface morphology due to irradiation.

  13. Shi Cihang 航慈釋. The First Case of Mummified Buddhist in Taiwan

    Directory of Open Access Journals (Sweden)

    Stefania Travagnin

    2006-01-01

    Full Text Available Shi Cihang 航慈釋 (1895-1954, is one of the eminent figures in the so-called Modern Buddhism in Taiwan. Engaged in improving education and training of Buddhist monks and nuns, and promoter of the so-called renjian fojiao 教佛間人 (Buddhism for the Human Realm, which refuses any sort of superstitious understanding and practice of Buddhism and calls for the return to the original and pure essence of the Dharma, Cihang is also the first Buddhist monk in Taiwan who attempted to, and eventually succeeded in, preserving his body afterdeath. Nowadays, the gilded relic-body of Cihang is enshrined and venerated in Xizhi, Taipei county, as well as being included in the list of the roushen pusa 薩菩身肉 (flesh-body Bodhisattvas who appeared in the history of Chinese Buddhism. This paper analyses Cihang’s relic-body as case-study of Chinese mummified Buddhist in the scene of contemporary Taiwan and modern Taiwanese Buddhim, discussing the Buddhist significance, sociological implications and eventual impact of mummification within the reality of the new renjian fojiao.

  14. The Variation of Riverbed Material due to Tropical Storms in Shi-Wen River, Taiwan

    Directory of Open Access Journals (Sweden)

    Chin-Ping Lin

    2014-01-01

    Full Text Available Taiwan, because of its location, is a flood prone region and is characterised by typhoons which brings about two-thirds to three quarters of the annual rainfall amount. Consequently, enormous flows result in rivers and entrain some fractions of the grains that constitute the riverbed. Hence, the purpose of the study is to quantify the impacts of these enormous flows on the distribution of grain size in riverbeds. The characteristics of riverbed material prior to and after the typhoon season are compared in Shi-Wen River located at southern Taiwan. These include grain size variation, bimodality, and roughness coefficient. A decrease (65% and increase (50% in geometric mean size of grains were observed for subsurface and surface bed material, respectively. Geometric standard deviation decreased in all sites after typhoon. Subsurface material was bimodal prior to typhoons and polymodal after. For surface material, modal class is in the gravel class, while after typhoons it shifts towards cobble class. The reduction in geometric mean resulted to a decrease in roughness coefficient by up to 30%. Finally, the relationship of Shields and Froude numbers are studied and a change in the bed form to antidunes and transition form is observed, respectively.

  15. The variation of riverbed material due to tropical storms in Shi-Wen River, Taiwan.

    Science.gov (United States)

    Lin, Chin-Ping; Wang, Yu-Min; Tfwala, Samkele S; Chen, Ching-Nuo

    2014-01-01

    Taiwan, because of its location, is a flood prone region and is characterised by typhoons which brings about two-thirds to three quarters of the annual rainfall amount. Consequently, enormous flows result in rivers and entrain some fractions of the grains that constitute the riverbed. Hence, the purpose of the study is to quantify the impacts of these enormous flows on the distribution of grain size in riverbeds. The characteristics of riverbed material prior to and after the typhoon season are compared in Shi-Wen River located at southern Taiwan. These include grain size variation, bimodality, and roughness coefficient. A decrease (65%) and increase (50%) in geometric mean size of grains were observed for subsurface and surface bed material, respectively. Geometric standard deviation decreased in all sites after typhoon. Subsurface material was bimodal prior to typhoons and polymodal after. For surface material, modal class is in the gravel class, while after typhoons it shifts towards cobble class. The reduction in geometric mean resulted to a decrease in roughness coefficient by up to 30%. Finally, the relationship of Shields and Froude numbers are studied and a change in the bed form to antidunes and transition form is observed, respectively.

  16. Neurologic deterioration with progressive CT changes in a child with Kearns-Shy syndrome

    International Nuclear Information System (INIS)

    Yoda, Satoru; Kitahara, Fuminori; Akabane, Taro; Terauchi, Akiko.

    1984-01-01

    A case of the rare juvenile form of Kearns-Shy syndrome with progressive external ophthalmoplegia and lid ptosis, carditis, skeletal muscle weakness, seizures, mental subnormality, short stature, EEG abnormality and deafness is presented. Electromyography revealed a myopathic pattern. Histochemical studies on quadriceps biopsy specimens showed atrophy of type II fibers and ''ragged-red fibers.'' On electron microscopy these muscle cells were seen to contain an increased amount of glycogen particles and abnormal mitochondria were increased in number and size. It is of interest that abrupt deterioration of neurological findings such as seizures, mental subnormality, speech disturbance and deafness was present in our case. Computed tomographic scanning showed progressive changes of cerebral atrophy, low density of cerebral white matter and basal ganglia calcification, which were well associated with the clinical deterioration. A review of the literature also indicated that some patients with this syndrome showed abrupt neurological deterioration in childhood. Involvement of the central nervous system in this syndrome has to be considered as the cause of sudden deterioration and death in childhood. (author)

  17. Prevalence of consanguineous marriages among shi'a populations of Lebanon.

    Science.gov (United States)

    El-Kheshen, Ghadir; Saadat, Mostafa

    2013-09-01

    In genetics, a consanguineous marriage means union between couples who are related as second cousins or closer. The present cross-sectional study was carried out in order to illustrate the prevalence and types of consanguineous marriages in the Shi'a population living in widespread territories in Lebanon including the Bekaa Valley, the south of Lebanon and the southern suburb of Beirut. Data on types of marriages were collected using a simple questionnaire. The total number of couples in the study was 1203. Consanguineous marriage was classified by the degree of relationship between couples. The overall frequency of consanguinity was found to be 28.4%, with first cousin marriages (21.3%) being the most common type followed by first cousins once removed (5.5%), then double first cousins (0.8%). The frequencies of second cousin and beyond second cousin marriages were the same at 0.4% of all the marriages. The mean inbreeding coefficient (α) was estimated at about 0.0161 for the population. There were no significant differences between the three studied territories for frequencies of different types of marriages (p>0.1), nor were there significant differences between the rural and urban areas (p>0.1).

  18. CATS, continuous automated testing of seismological, hydroacoustic, and infrasound (SHI) processing software.

    Science.gov (United States)

    Brouwer, Albert; Brown, David; Tomuta, Elena

    2017-04-01

    To detect nuclear explosions, waveform data from over 240 SHI stations world-wide flows into the International Data Centre (IDC) of the Comprehensive Nuclear-Test-Ban Treaty Organization (CTBTO), located in Vienna, Austria. A complex pipeline of software applications processes this data in numerous ways to form event hypotheses. The software codebase comprises over 2 million lines of code, reflects decades of development, and is subject to frequent enhancement and revision. Since processing must run continuously and reliably, software changes are subjected to thorough testing before being put into production. To overcome the limitations and cost of manual testing, the Continuous Automated Testing System (CATS) has been created. CATS provides an isolated replica of the IDC processing environment, and is able to build and test different versions of the pipeline software directly from code repositories that are placed under strict configuration control. Test jobs are scheduled automatically when code repository commits are made. Regressions are reported. We present the CATS design choices and test methods. Particular attention is paid to how the system accommodates the individual testing of strongly interacting software components that lack test instrumentation.

  19. arXiv Search for new physics with the SHiP experiment at CERN

    CERN Document Server

    Lantwin, Oliver

    2017-12-01

    SHiP is a new general purpose fixed target experiment at the CERN SPS designed to complement LHC experiments in the search for new physics. In its initial phase, the $400$ GeV proton beam extracted from the SPS will be dumped on a heavy target with the aim of integrating $2\\times10^{20}$ pot in 5 years. Shielded by an active muon shield, a dedicated detector, based on a long decay volume followed by a spectrometer and particle identification detectors, will allow probing a variety of models with light long-lived exotic particles with masses below $\\mathcal{O}(10)\\; \\mathrm{GeV}/{c^2}$. The main focus will be the physics of the so-called Hidden Portals, i.e. search for Dark Photons, Light scalars and pseudo-scalars, and Heavy Neutral Leptons. The sensitivity to Heavy Neutral Leptons will allow for the first time to probe, in the mass range above the kaon mass, a coupling range for which Baryogenesis and active neutrino masses could also be explained. A dedicated emulsion-based detector will allow detection of ...

  20. Nuevos centros de almacenamiento inca en Huánuco Pampa

    OpenAIRE

    Ordóñez Inga, Carlo José Alonso

    2013-01-01

    Se proporcionan nuevos alcances sobre la identificación y el estudio de nuevos lugares de almacenamiento o colcas asociados al Centro Administrativo Inca de Huánuco Pampa, los mismos que no fueron reconocidos por otros investigadores que trabajaron en la zona.

  1. Rare Association of Anti-Hu Antibody Positive Paraneoplastic Neurological Syndrome and Transitional Cell Bladder Carcinoma

    Directory of Open Access Journals (Sweden)

    S. Lukacs

    2012-01-01

    Full Text Available Introduction. Paraneoplastic encephalomyelitis (PEM and subacute sensory neuronopathy (SSN are remote effects of cancer, usually associated with small-cell lung carcinoma and positive anti-Hu antibody. We describe the rare association of bladder transitional cell carcinoma (TCC with anti-Hu antibody positivity resulting in this paraneoplastic neurological syndrome. Patient. A 76-year-old female presented with bilateral muscle weakness and paraesthesia of the upper and lower limbs in a length-dependent “glove and stocking” distribution. Central nervous system symptoms included cognitive problems, personality change, and truncal ataxia. Case notes and the literature were reviewed. Result. Autoantibody screening was positive for anti-Hu antibody (recently renamed antineuronal nuclear antibody 1, ANNA-1. The diagnosis of PEM and SSN was supported by MRI and lumbar puncture results. A superficial bladder TCC was demonstrated on CT and subsequently confirmed on histology. No other primary neoplasm was found on full-body imaging. The neurological symptoms were considered to be an antibody-mediated paraneoplastic neurological syndrome and improved after resection of the tumour. Discussion. The association of anti-Hu positive paraneoplastic neurological syndrome and TCC has not been described in the literature previously. We emphasize the need for detailed clinical examination and the importance of a multidisciplinary thought process and encourage further awareness of this rare association.

  2. The herbal mixture Xiao-Chai-Hu Tang (XCHT) induces apoptosis of ...

    African Journals Online (AJOL)

    Background: Xiao-Chai-Hu Tang (XCHT) is an extract of seven herbs with anticancer properties, but its mechanism of action is unknown. In this study, we evaluated XCHT-treated hepatocellular carcinoma (HCC) for anti-proliferative and pro-apoptotic effects. Materials and Methods: Using a hepatic cancer xenograft model, ...

  3. Extended Hu¨ckel Calculations on Solids Using the Avogadro Molecular Editor and Visualizer

    Science.gov (United States)

    Avery, Patrick; Ludoweig, Herbert; Autschbach, Jochen; Zurek, Eva

    2018-01-01

    The "Yet Another extended Hu¨ckel Molecular Orbital Package" (YAeHMOP) has been merged with the Avogadro open-source molecular editor and visualizer. It is now possible to perform YAeHMOP calculations directly from the Avogadro graphical user interface for materials that are periodic in one, two, or three dimensions, and to visualize…

  4. Simultaneous Administration of ADSCs-Based Therapy and Gene Therapy Using Ad-huPA Reduces Experimental Liver Fibrosis.

    Science.gov (United States)

    Meza-Ríos, Alejandra; García-Benavides, Leonel; García-Bañuelos, Jesus; Salazar-Montes, Adriana; Armendáriz-Borunda, Juan; Sandoval-Rodríguez, Ana

    2016-01-01

    hADSCs transplantation in cirrhosis models improves liver function and reduces fibrosis. In addition, Ad-huPA gene therapy diminished fibrosis and increased hepatocyte regeneration. In this study, we evaluate the combination of these therapies in an advanced liver fibrosis experimental model. hADSCs were expanded and characterized before transplantation. Ad-huPA was simultaneously administrated via the ileac vein. Animals were immunosuppressed by CsA 24 h before treatment and until sacrifice at 10 days post-treatment. huPA liver expression and hADSCs biodistribution were evaluated, as well as the percentage of fibrotic tissue, hepatic mRNA levels of Col-αI, TGF-β1, CTGF, α-SMA, PAI-I, MMP2 and serum levels of ALT, AST and albumin. hADSCs homed mainly in liver, whereas huPA expression was similar in Ad-huPA and hADSCs/Ad-huPA groups. hADSCs, Ad-huPA and hADSCs/Ad-huPA treatment improves albumin levels, reduces liver fibrosis and diminishes Collagen α1, CTGF and α-SMA mRNA liver levels. ALT and AST serum levels showed a significant decrease exclusively in the hADSCs group. These results showed that combinatorial effect of cell and gene-therapy does not improve the antifibrogenic effects of individual treatments, whereas hADSCs transplantation seems to reduce liver fibrosis in a greater proportion.

  5. Immunostimulatory effects of natural human interferon-alpha (huIFN-alpha) on carps Cyprinus carpio L.

    Science.gov (United States)

    Watanuki, Hironobu; Chakraborty, Gunimala; Korenaga, Hiroki; Kono, Tomoya; Shivappa, R B; Sakai, Masahiro

    2009-10-15

    Human interferon-alpha (huIFN-alpha) is an important immunomodulatory substance used in the treatment and prevention of numerous infectious and immune-related diseases in animals. However, the immunostimulatory effects of huIFN-alpha in fish remain to be investigated. In the current study, the immune responses of the carp species Cyprinus carpio L. to treatment with huIFN-alpha were analyzed via measurement of superoxide anion production, phagocytic activity and the expression of cytokine genes including interleukin-1beta, tumor necrosis factor-alpha and interleukin 10. Low doses of huIFN-alpha were administered orally once a day for 3 days, and sampling was carried out at 1, 3 and 5 days post-treatment. Our results indicate that a low dose of huIFN-alpha significantly increased phagocytic activity and superoxide anion production in the carp kidney. The huIFN-alpha-treated fish also displayed a significant upregulation in cytokine gene expression. The current study demonstrates the stimulatory effects of huIFN-alpha on the carp immune system and highlights the immunomodulatory role of huIFN-alpha in fish.

  6. Drug Transporter Expression and Activity in Human Hepatoma HuH-7 Cells

    Directory of Open Access Journals (Sweden)

    Elodie Jouan

    2016-12-01

    Full Text Available Human hepatoma cells may represent a valuable alternative to the use of human hepatocytes for studying hepatic drug transporters, which is now a regulatory issue during drug development. In the present work, we have characterized hepatic drug transporter expression, activity and regulation in human hepatoma HuH-7 cells, in order to determine the potential relevance of these cells for drug transport assays. HuH-7 cells displayed notable multidrug resistance-associated protein (MRP activity, presumed to reflect expression of various hepatic MRPs, including MRP2. By contrast, they failed to display functional activities of the uptake transporters sodium taurocholate co-transporting polypeptide (NTCP, organic anion-transporting polypeptides (OATPs and organic cation transporter 1 (OCT1, and of the canalicular transporters P-glycoprotein and breast cancer resistance protein (BCRP. Concomitantly, mRNA expressions of various sinusoidal and canalicular hepatic drug transporters were not detected (NTCP, OATP1B1, organic anion transporter 2 (OAT2, OCT1 and bile salt export pump or were found to be lower (OATP1B3, OATP2B1, multidrug and toxin extrusion protein 1, BCRP and MRP3 in hepatoma HuH-7 cells than those found in human hepatocytes, whereas other transporters such as OAT7, MRP4 and MRP5 were up-regulated. HuH-7 cells additionally exhibited farnesoid X receptor (FXR- and nuclear factor erythroid 2-related factor 2 (Nrf2-related up-regulation of some transporters. Such data indicate that HuH-7 cells, although expressing rather poorly some main hepatic drug transporters, may be useful for investigating interactions of drugs with MRPs, notably MRP2, and for studying FXR- or Nrf2-mediated gene regulation.

  7. Transcriptomic-Wide Discovery of Direct and Indirect HuR RNA Targets in Activated CD4+ T Cells.

    Directory of Open Access Journals (Sweden)

    Patsharaporn Techasintana

    Full Text Available Due to poor correlation between steady state mRNA levels and protein product, purely transcriptomic profiling methods may miss genes posttranscriptionally regulated by RNA binding proteins (RBPs and microRNAs (miRNAs. RNA immunoprecipitation (RIP methods developed to identify in vivo targets of RBPs have greatly elucidated those mRNAs which may be regulated via transcript stability and translation. The RBP HuR (ELAVL1 and family members are major stabilizers of mRNA. Many labs have identified HuR mRNA targets; however, many of these analyses have been performed in cell lines and oftentimes are not independent biological replicates. Little is known about how HuR target mRNAs behave in conditional knock-out models. In the present work, we performed HuR RIP-Seq and RNA-Seq to investigate HuR direct and indirect targets using a novel conditional knock-out model of HuR genetic ablation during CD4+ T activation and Th2 differentiation. Using independent biological replicates, we generated a high coverage RIP-Seq data set (>160 million reads that was analyzed using bioinformatics methods specifically designed to find direct mRNA targets in RIP-Seq data. Simultaneously, another set of independent biological replicates were sequenced by RNA-Seq (>425 million reads to identify indirect HuR targets. These direct and indirect targets were combined to determine canonical pathways in CD4+ T cell activation and differentiation for which HuR plays an important role. We show that HuR may regulate genes in multiple canonical pathways involved in T cell activation especially the CD28 family signaling pathway. These data provide insights into potential HuR-regulated genes during T cell activation and immune mechanisms.

  8. WE-AB-202-06: Correlating Lung CT HU with Transformation-Based and Xe-CT Derived Ventilation

    International Nuclear Information System (INIS)

    Du, K; Patton, T; Bayouth, J; Reinhardt, J; Christensen, G

    2016-01-01

    Purpose: Regional lung ventilation is useful to reduce radiation-induced function damage during lung cancer radiation therapy. Recently a new direct HU (Hounsfield unit)-based method was proposed to estimate the ventilation potential without image registration. The purpose of this study is to examine if there is a functional dependence between HU values and transformation-based or Xe-CT derived ventilation. Methods: 4DCT images acquired from 13 patients prior to radiation therapy and 4 mechanically ventilated sheep subjects which also have associated Xe-CT images were used for this analysis. Transformation-based ventilation was computed using Jacobian determinant of the transformation field between peak-exhale and peak-inhale 4DCT images. Both transformation and Xe-CT derived ventilation was computed for each HU bin. Color scatter plot and cumulative histogram were used to compare and validate the direct HU-based method. Results: There was little change of the center and shape of the HU histograms between free breathing CT and 4DCT average, with or without smoothing, and between the repeated 4DCT scans. HU of −750 and −630 were found to have the greatest transformation-based ventilation for human and sheep subjects, respectively. Maximum Xe-CT derived ventilation was found to locate at HU of −600 in sheep subjects. The curve between Xe-CT ventilation and HU was noisy for tissue above HU −400, possibly due to less intensity change of Xe gas during wash-out and wash-in phases. Conclusion: Both transformation-based and Xe-CT ventilation demonstrated that lung tissues with HU values in the range of (-750, −600) HU have the maximum ventilation potential. The correlation between HU and ventilation suggests that HU might be used to help guide the ventilation calculation and make it more robust to noise and image registration errors. Research support from NIH grants CA166703 and CA166119 and a gift from Roger Koch.

  9. WE-AB-202-06: Correlating Lung CT HU with Transformation-Based and Xe-CT Derived Ventilation

    Energy Technology Data Exchange (ETDEWEB)

    Du, K; Patton, T; Bayouth, J [University of Wisconsin, Madison, WI (United States); Reinhardt, J; Christensen, G [The University of Iowa, Iowa City, IA (United States)

    2016-06-15

    Purpose: Regional lung ventilation is useful to reduce radiation-induced function damage during lung cancer radiation therapy. Recently a new direct HU (Hounsfield unit)-based method was proposed to estimate the ventilation potential without image registration. The purpose of this study is to examine if there is a functional dependence between HU values and transformation-based or Xe-CT derived ventilation. Methods: 4DCT images acquired from 13 patients prior to radiation therapy and 4 mechanically ventilated sheep subjects which also have associated Xe-CT images were used for this analysis. Transformation-based ventilation was computed using Jacobian determinant of the transformation field between peak-exhale and peak-inhale 4DCT images. Both transformation and Xe-CT derived ventilation was computed for each HU bin. Color scatter plot and cumulative histogram were used to compare and validate the direct HU-based method. Results: There was little change of the center and shape of the HU histograms between free breathing CT and 4DCT average, with or without smoothing, and between the repeated 4DCT scans. HU of −750 and −630 were found to have the greatest transformation-based ventilation for human and sheep subjects, respectively. Maximum Xe-CT derived ventilation was found to locate at HU of −600 in sheep subjects. The curve between Xe-CT ventilation and HU was noisy for tissue above HU −400, possibly due to less intensity change of Xe gas during wash-out and wash-in phases. Conclusion: Both transformation-based and Xe-CT ventilation demonstrated that lung tissues with HU values in the range of (-750, −600) HU have the maximum ventilation potential. The correlation between HU and ventilation suggests that HU might be used to help guide the ventilation calculation and make it more robust to noise and image registration errors. Research support from NIH grants CA166703 and CA166119 and a gift from Roger Koch.

  10. The Elav-like protein HuR exerts translational control of viral internal ribosome entry sites

    International Nuclear Information System (INIS)

    Rivas-Aravena, Andrea; Ramdohr, Pablo; Vallejos, Maricarmen; Valiente-Echeverria, Fernando; Dormoy-Raclet, Virginie; Rodriguez, Felipe; Pino, Karla; Holzmann, Cristian; Huidobro-Toro, J. Pablo; Gallouzi, Imed-Eddine; Lopez-Lastra, Marcelo

    2009-01-01

    The human embryonic-lethal abnormal vision (ELAV)-like protein, HuR, has been recently found to be involved in the regulation of protein synthesis. In this study we show that HuR participates in the translational control of the HIV-1 and HCV IRES elements. HuR functions as a repressor of HIV-1 IRES activity and acts as an activator of the HCV IRES. The effect of HuR was evaluated in three independent experimental systems, rabbit reticulocyte lysate, HeLa cells, and Xenopus laevis oocytes, using both overexpression and knockdown approaches. Furthermore, results suggest that HuR mediated regulation of HIV-1 and HCV IRESes does not require direct binding of the protein to the RNA nor does it need the nuclear translocation of the IRES-containing RNAs. Finally, we show that HuR has a negative impact on post-integration steps of the HIV-1 replication cycle. Thus, our observations yield novel insights into the role of HuR in the post-transcriptional regulation of HCV and HIV-1 gene expression.

  11. HuR/ELAVL1 RNA binding protein modulates interleukin-8 induction by muco-active ribotoxin deoxynivalenol

    International Nuclear Information System (INIS)

    Choi, Hye Jin; Yang, Hyun; Park, Seong Hwan; Moon, Yuseok

    2009-01-01

    HuR/Elav-like RNA binding protein 1 (ELAVL1) positively regulates mRNA stability of AU-rich elements (ARE)-containing transcript such as pro-inflammatory cytokines. Ribotoxic stresses can trigger the production of pro-inflammatory mediators by enhancing mRNA stability and the transcriptional activity. We investigated the effects of ribotoxin deoxynivalenol (DON) on HuR translocation and its involvement in the regulation of the pro-inflammatory interleukin-8 (IL-8) mRNA stability. Exposure to the muco-active DON induced nuclear export of both endogenous and exogenous HuR RNA binding protein in human intestinal epithelial cells. Moreover, the interference with HuR protein production suppressed ribotoxic DON-induced IL-8 secretion and its mRNA stability. Cytoplasmic HuR protein interacted with IL-8 mRNA and the complex stabilization was due to the presence of 3'-untranslated region of the transcript. Partly in terms of IL-8-modulating transcription factors, HuR protein was demonstrated to be positively and negatively associated with DON-induced early growth response gene 1 (EGR-1) and activating transcription factor 3 (ATF3), respectively. HuR was a critical mechanistic link between ribotoxic stress and the pro-inflammatory cytokine production, and may have a broader functional significance with regard to mucosal insults since ribotoxic stress responses are also produced upon interactions with the diverse environment of gut.

  12. SU-E-T-470: Importance of HU-Mass Density Calibration Technique in Proton Pencil Beam Dose Calculation

    Energy Technology Data Exchange (ETDEWEB)

    Penfold, S; Miller, A [University of Adelaide, Adelaide, SA (Australia)

    2015-06-15

    Purpose: Stoichiometric calibration of Hounsfield Units (HUs) for conversion to proton relative stopping powers (RStPs) is vital for accurate dose calculation in proton therapy. However proton dose distributions are not only dependent on RStP, but also on relative scattering power (RScP) of patient tissues. RScP is approximated from material density but a stoichiometric calibration of HU-density tables is commonly neglected. The purpose of this work was to quantify the difference in calculated dose of a commercial TPS when using HU-density tables based on tissue substitute materials and stoichiometric calibrated ICRU tissues. Methods: Two HU-density calibration tables were generated based on scans of the CIRS electron density phantom. The first table was based directly on measured HU and manufacturer quoted density of tissue substitute materials. The second was based on the same CT scan of the CIRS phantom followed by a stoichiometric calibration of ICRU44 tissue materials. The research version of Pinnacle{sup 3} proton therapy was used to compute dose in a patient CT data set utilizing both HU-density tables. Results: The two HU-density tables showed significant differences for bone tissues; the difference increasing with increasing HU. Differences in density calibration table translated to a difference in calculated RScP of −2.5% for ICRU skeletal muscle and 9.2% for ICRU femur. Dose-volume histogram analysis of a parallel opposed proton therapy prostate plan showed that the difference in calculated dose was negligible when using the two different HU-density calibration tables. Conclusion: The impact of HU-density calibration technique on proton therapy dose calculation was assessed. While differences were found in the calculated RScP of bony tissues, the difference in dose distribution for realistic treatment scenarios was found to be insignificant.

  13. Metabolic aspects of growth in HU-treated crown-gall tissue cultures. I. Nicotiana tabacum

    Directory of Open Access Journals (Sweden)

    Aldona Rennert

    2015-01-01

    Full Text Available An influence of hydroxyurea (HU on the growth, DNA and RNA contents and protein synthesis in the tobacco tumour tissue culture was studied in comparison with a homologous callus tissue. In conformity with expectations considerable decrease of DNA level in both tissues is a primary effect of HU activity. This results in the growth inhibition and in the secondary metabolic effects; these effects depend not only on the concentration of inhibitor but also on the age of tissue. In spite of some common features the character of these changes shows a distinct differentiation depending on the tissue type. TMs points to specific modifications of the biochemical regulation of growth in a tumour.

  14. Cooperative interplay of let-7 mimic and HuR with MYC RNA.

    Science.gov (United States)

    Gunzburg, Menachem J; Sivakumaran, Andrew; Pendini, Nicole R; Yoon, Je-Hyun; Gorospe, Myriam; Wilce, Matthew C J; Wilce, Jacqueline A

    2015-01-01

    Both RNA-binding proteins (RBP) and miRNA play important roles in the regulation of mRNA expression, often acting together to regulate a target mRNA. In some cases the RBP and miRNA have been reported to act competitively, but in other instances they function cooperatively. Here, we investigated HuR function as an enhancer of let-7-mediated translational repression of c-Myc despite the separation of their binding sites. Using an in vitro system, we determined that a let-7 mimic, consisting of single-stranded (ss)DNA complementary to the let-7 binding site, enhanced the affinity of HuR for a 122-nt MYC RNA encompassing both binding sites. This finding supports the biophysical principle of cooperative binding by an RBP and miRNA purely through interactions at distal mRNA binding sites.

  15. Acute Hepatitis Induced by Chinese Hepatoprotective Herb, Xiao-Chai-Hu-Tang

    Directory of Open Access Journals (Sweden)

    Li-Ming Hsu

    2006-02-01

    Full Text Available Xiao-chai-hu-tang (syo-saiko-to in Japanese is a herbal remedy that has been widely used in China for treatment of respiratory, hepatobiliary, and gastrointestinal diseases, particularly among patients with chronic liver disease. However, its safety has recently been challenged. We, herein, report a Chinese patient with acute hepatitis induced by this herb. A 52-year-old woman presented with weakness, fatigue, and tea-colored urine after continual consumption of the decoction of xiao-chai-hu-tang for 1.5 months. Laboratory studies disclosed acute hepatitis even though all of the viral hepatitis markers were negative. Liver biopsy also revealed a picture of acute hepatocellular hepatitis. The symptoms improved after discontinuing the drug, and liver biochemical tests normalized 2 months later. The case report reminds us of the probable adverse drug reaction of herbs, even in some that are claimed to have hepatoprotective effects.

  16. Breast cancer detection via Hu moment invariant and feedforward neural network

    Science.gov (United States)

    Zhang, Xiaowei; Yang, Jiquan; Nguyen, Elijah

    2018-04-01

    One of eight women can get breast cancer during all her life. This study used Hu moment invariant and feedforward neural network to diagnose breast cancer. With the help of K-fold cross validation, we can test the out-of-sample accuracy of our method. Finally, we found that our methods can improve the accuracy of detecting breast cancer and reduce the difficulty of judging.

  17. Violence against women in the context of war: experiences of Shi'i women and Palestinian refugee women in Lebanon.

    Science.gov (United States)

    Holt, Maria

    2013-03-01

    In times of war, women are likely to experience, in addition to the "normal" violence of peacetime, random cruelties perpetrated by the enemy against all members of the community. During research conducted with Palestinian refugees and Shi'i Muslims in Lebanon, women described various forms of violence and, in this article, I examine violence suffered by women in the context of conflict from three perspectives: victimization, trauma, and resistance. I argue that traumatic events have the effect of obliterating identity, but they can also strengthen the resolve to resist.

  18. Downregulation of β-Adrenoceptors in Isoproterenol-Induced Cardiac Remodeling through HuR.

    Directory of Open Access Journals (Sweden)

    Qian Yin

    Full Text Available β-adrenergic receptors (β-ARs play an important role in cardiac remodeling, which is the key pathological process in various heart diseases and leads to heart failure. However, the regulation of β-AR expression in remodeling hearts is still unclear. This study aims to clarify the possible mechanisms underlying the regulation of β1- and β2-AR expression in cardiac remodeling. The rat model of cardiac remodeling was established by subcutaneous injection of isoproterenol(ISO at the dose of 0.25 mg·kg(-1·d(-1 for 7 days. We found that the expression of β1- and β2-ARs decreased in the remodeling heart. The mechanisms may include the inhibition of DNA transcription and the increase of mRNA degradation. cAMP-response element binding protein(CREB is a well-known transcription factor of β-AR. However, the expression and activation of CREB was not changed in the remodeling heart. Further, human Antigen-R (HuR, a RNA binding protein, which binds to the 3'-untranslated region of the β-AR mRNA and promotes RNA degradation, was increased in the remodeling model. And in vitro, HuR deficiency reversed the reduction of β-AR mRNA induced by ISO. Therefore, the present findings indicate that HuR, but not CREB, is responsible for the reduction of β-AR expression in ISO induced cardiac remodeling.

  19. HuAc: Human Activity Recognition Using Crowdsourced WiFi Signals and Skeleton Data

    Directory of Open Access Journals (Sweden)

    Linlin Guo

    2018-01-01

    Full Text Available The joint of WiFi-based and vision-based human activity recognition has attracted increasing attention in the human-computer interaction, smart home, and security monitoring fields. We propose HuAc, the combination of WiFi-based and Kinect-based activity recognition system, to sense human activity in an indoor environment with occlusion, weak light, and different perspectives. We first construct a WiFi-based activity recognition dataset named WiAR to provide a benchmark for WiFi-based activity recognition. Then, we design a mechanism of subcarrier selection according to the sensitivity of subcarriers to human activities. Moreover, we optimize the spatial relationship of adjacent skeleton joints and draw out a corresponding relationship between CSI and skeleton-based activity recognition. Finally, we explore the fusion information of CSI and crowdsourced skeleton joints to achieve the robustness of human activity recognition. We implemented HuAc using commercial WiFi devices and evaluated it in three kinds of scenarios. Our results show that HuAc achieves an average accuracy of greater than 93% using WiAR dataset.

  20. Coordination of genomic structure and transcription by the main bacterial nucleoid-associated protein HU

    Science.gov (United States)

    Berger, Michael; Farcas, Anca; Geertz, Marcel; Zhelyazkova, Petya; Brix, Klaudia; Travers, Andrew; Muskhelishvili, Georgi

    2010-01-01

    The histone-like protein HU is a highly abundant DNA architectural protein that is involved in compacting the DNA of the bacterial nucleoid and in regulating the main DNA transactions, including gene transcription. However, the coordination of the genomic structure and function by HU is poorly understood. Here, we address this question by comparing transcript patterns and spatial distributions of RNA polymerase in Escherichia coli wild-type and hupA/B mutant cells. We demonstrate that, in mutant cells, upregulated genes are preferentially clustered in a large chromosomal domain comprising the ribosomal RNA operons organized on both sides of OriC. Furthermore, we show that, in parallel to this transcription asymmetry, mutant cells are also impaired in forming the transcription foci—spatially confined aggregations of RNA polymerase molecules transcribing strong ribosomal RNA operons. Our data thus implicate HU in coordinating the global genomic structure and function by regulating the spatial distribution of RNA polymerase in the nucleoid. PMID:20010798

  1. Chromatographic isolation of nanoparticles from Ma-Xing-Shi-Gan-Tang decoction and their characterization.

    Science.gov (United States)

    Zhou, Jianwu; Gao, Guanzhen; Chu, Qiuping; Wang, Huiqin; Rao, Pingfan; Ke, Lijing

    2014-02-12

    The herbal decoction is a complex dispersion system containing solutes, colloid, aggregates, emulsions and precipitates. In which phase bioactive phytochemicals are dispersed determines their delivery, action and metabolism. This study took ephedrine, a well-studied and widely used phytochemical, as an example to elucidate its exact distribution in the phases of Ma-Xing-Shi-Gan-Tang decoction (MXSGT), which is an Ephedra sinica Stapf. containing traditional Chinese medicinal formula, and the biological meaning of this distribution correspondingly. It may provide an important update to the safety and efficacy assessment of the herbal decoction and its active phytochemicals. In this study, the decoction was fractionated with size-exclusion chromatography coupled with multi-angle laser light scattering detector. The morphology of fractionated nanoparticles was observed with AFM and SEM. The bioactivities of the decoction, the ephedrine alkaloids loaded NPs (prepared by chromatography isolation) and the synthetic ephedrine were assessed by cell proliferation tests using five cell lines, namely Caco-2, L-02, Hep-G2, NR-8383, and Hela-229. Nanoparticles with radii of gyration ranged from 50 to 150 nm were isolated, in spherical shape. Further analysis of nanoparticles on the subsequent reversed phase chromatography revealed that the majority of ephedrine (99.7%) and pseudoephedrine (95.5%) were associated with these nanoparticles, rather than dispersed freely in the real solution. The addition of both the herbal decoction and the separated ephedrine-loaded nanoparticles reserved higher cell viability/proliferation than that of the sole synthetic ephedrine among the Caco-2, L-02, Hep-G2, and NR-8383 cells. In contrast, the nanoparticles reduced the proliferating power of ephedrine on Hela-229 cells. In general, the ephedrine-loaded NPs conducted the intermediate influences on the cell viability, in either way. The colloidal nanoparticles were separated from the decoction

  2. The inhibition, reactivation and mechanism of VX-, sarin-, fluoro-VX and fluoro-sarin surrogates following their interaction with HuAChE and HuBuChE.

    Science.gov (United States)

    Chao, Chih-Kai; Balasubramanian, Narayanaganesh; Gerdes, John M; Thompson, Charles M

    2018-06-16

    In this study, the mechanisms of HuAChE and HuBChE inhibition by Me-P(O) (OPNP) (OR) [PNP = p-nitrophenyl; R = CH 2 CH 3 , CH 2 CH 2 F, OCH(CH 3 ) 2 , OCH(CH 3 ) (CH 2 F)] representing surrogates and fluoro-surrogates of VX and sarin were studied by in vitro kinetics and mass spectrometry. The in vitro measures showed that the VX- and fluoro-VX surrogates were relatively strong inhibitors of HuAChE and HuBChE (k i  ∼ 10 5 -10 6  M -1 min -1 ) and underwent spontaneous and 2-PAM-mediated reactivation within 30 min. The sarin surrogates were weaker inhibitors of HuAChE and HuBChE (k i  ∼ 10 4 -10 5  M -1 min -1 ), and in general did not undergo spontaneous reactivation, although HuAChE adducts were partially reactivatable at 18 h using 2-PAM. The mechanism of HuAChE and HuBChE inhibition by the surrogates was determined by Q-TOF and MALDI-TOF mass spectral analyses. The surrogate-adducted proteins were trypsin digested and the active site-containing peptide bearing the OP-modified serine identified by Q-TOF as triply- and quadruply-charged ions representing the respective increase in mass of the attached OP moiety. Correspondingly, monoisotopic ions of the tryptic peptides representing the mass increase of the OP-adducted peptide was identified by MALDI-TOF. The mass spectrometry analyses validated the identity of the OP moiety attached to HuAChE or HuBChE as MeP(O) (OR)-O-serine peptides (loss of the PNP leaving group) via mechanisms consistent with those found with chemical warfare agents. MALDI-TOF MS analyses of the VX-modified peptides versus time showed a steady reduction in adduct versus parent peptide (reactivation), whereas the sarin-surrogate-modified peptides remained largely intact over the course of the experiment (24 h). Overall, the presence of a fluorine atom on the surrogate modestly altered the rate constants of inhibition and reactivation, however, the mechanism of inhibition (ejection of PNP group) did not change

  3. Computed tomography imaging for the characterisation of drugs with radiation density measurements and HU spectroscopy.

    Science.gov (United States)

    Sieron, Dominik A; Steib, Moritz; Suter, Dominik; Obmann, Verena C; Huber, Adrian T; Ebner, Lukas; Inderbitzin, Daniel; Christe, Andreas

    2018-01-29

    To investigate the computed tomography (CT) density of frequently administered medications (1) for the better characterisation of substances on abdominal CT, (2) to allow radiologists to narrow down possibilities in the identification of hyperdense material in the bowel and (3) to provide forensic doctors with a tool to identify gastric contents before an autopsy. From the list of the local hospital pharmacy, the 50 most frequently used medications were identified and scanned twice with a 128 row CT scanner (Acquillion, Toshiba, Tokyo, Japan). The protocol comprised two tube voltages of 100 kVp and 120 kVp, with a tube current of 100 mAs, a collimation of 0.5 mm and a slice thickness of 0.5 mm. Two readers were asked to measure the density (in Hounsfield units) and the noise (standard deviation of the Hounsfield units) of each pill in the two scans (100/120 kVp). After 4 weeks, both readers repeated the measurements to test repeatability (intra-rater agreement). The behaviour of each pill in hydrochloric acid (pH 2) was examined and the dissolution time was determined. The most dense pill was Cordarone (7265 HU), and the least was Perenterol (529 HU), with an attenuation that was lower than fat density (standard deviation of pixel density (noise) reflects inhomogeneity of the pharmacological product, varying from 9 to 1592 HU among the different pills (at 120 kVp). The absolute average HU increase per pill when changing to lower voltage was 78 ± 253 HU, with a linear fitting line with a slope of 0.21 as a constant variable in the density spectroscopy. After 4 hours in hydrochloric acid, only six tablets were still intact, including Flagyl and Dafalgan. The intra- and inter-rater agreements for all measurements were nearly perfect, with a correlation coefficient r of ≥0.99 (p <0.0001). Our data suggest that measuring the attenuation of drugs on CT images, including the homogeneity, and applying CT spectroscopy can narrow down possible identities of the most

  4. When people in close relationships are not prepared to listen to emotional disclosures. The role of social constraints in shy people’s functioning

    Directory of Open Access Journals (Sweden)

    Irena Dzwonkowska

    2007-12-01

    Full Text Available The following article comprises a presentation of research carried out on a group of 268 adults. The survey aimed at finding answers to questions posed about the meditative role played by social constraints in the relationship between shyness and certain aspects of emotional and social functioning. The results indicate that social constraints are a destructive factor in the everyday functioning of those facing everyday problems. Many shy people experience social constraints - people in close relationships: family, relatives, and friends react inadequately and negatively, demonstrating a lack of empathy, thus discouraging people who are shy from expressing their personal thoughts and emotions. Regression analyses, conducted in order to detect the meditative effects of social constraints, show that their destructive influence is particularly severe in the case of shy people leading to their low self-esteem, a high level of depressive symptoms and a low perception of social support.

  5. The cytoskeletal inhibitors latrunculin A and blebbistatin exert antitumorigenic properties in human hepatocellular carcinoma cells by interfering with intracellular HuR trafficking

    Energy Technology Data Exchange (ETDEWEB)

    Doller, Anke; Badawi, Amel [Pharmazentrum Frankfurt/ZAFES, Klinikum der Goethe-Universität Frankfurt, Frankfurt/Main (Germany); Schmid, Tobias; Brauß, Thilo [Institut für Biochemie I (Pathobiochemie), Klinikum der Goethe-Universität Frankfurt, Frankfurt/Main (Germany); Pleli, Thomas [Medizinische Klinik 1, Schwerpunkt Gastroenterologie und Hepatologie, Klinikum der Goethe-Universität Frankfurt, Frankfurt/Main (Germany); Meyer zu Heringdorf, Dagmar [Pharmazentrum Frankfurt/ZAFES, Klinikum der Goethe-Universität Frankfurt, Frankfurt/Main (Germany); Piiper, Albrecht [Medizinische Klinik 1, Schwerpunkt Gastroenterologie und Hepatologie, Klinikum der Goethe-Universität Frankfurt, Frankfurt/Main (Germany); Pfeilschifter, Josef [Pharmazentrum Frankfurt/ZAFES, Klinikum der Goethe-Universität Frankfurt, Frankfurt/Main (Germany); Eberhardt, Wolfgang, E-mail: w.eberhardt@em.uni-frankfurt.de [Pharmazentrum Frankfurt/ZAFES, Klinikum der Goethe-Universität Frankfurt, Frankfurt/Main (Germany)

    2015-01-01

    The impact of the RNA-binding protein HuR for the post-transcriptional deregulation of tumor-relevant genes is well established. Despite of elevations in HuR expression levels, an increase in cytoplasmic HuR abundance in many cases correlates with a high grade of malignancy. Here, we demonstrated that administration of the actin-depolymerizing macrolide latrunculin A, or blebbistatin, an inhibitor of myosin II ATPase activity, caused a dose- and time-dependent reduction in the high cytoplasmic HuR content of HepG2 and Huh7 hepatocellular carcinoma (HCC) cells. Subcellular fractionation revealed that in addition, both inhibitors strongly attenuated cytoskeletal and membrane-bound HuR abundance and conversely increased the HuR amount in nuclear cell fractions. Concomitant with changes in intracellular HuR localization, both cytoskeletal inhibitors markedly decreased the half-lives of cyclooxygenase-2 (COX-2), cyclin A and cyclin D{sub 1} encoding mRNAs resulting in a significant reduction in their expression levels in HepG2 cells. Importantly, a similar reduction in the expression of these HuR targets was achieved by a RNA interference (RNAi)-mediated knockdown of either HuR or nonmuscle myoin IIA. Using polysomal fractionation, we further demonstrate that the decrease in cytoplasmic HuR by latrunculin A or blebbistatin is accompanied by a marked change in the allocation of HuR and its mRNA cargo from polysomes to ribonucleoprotein (RNP) particles. Functionally, the basal migration and prostaglandin E{sub 2} synthesis are similarly impaired in inhibitor-treated and stable HuR-knockdown HepG2 cells. Our data demonstrate that interfering with the actomyosin-dependent HuR trafficking may comprise a valid therapeutic option for antagonizing pathologic posttranscriptional gene expression by HuR and furthermore emphasize the potential benefit of HuR inhibitory strategies for treatment of HCC. - Highlights: • We tested the effects of latrunculin A and blebbistatin on

  6. The cytoskeletal inhibitors latrunculin A and blebbistatin exert antitumorigenic properties in human hepatocellular carcinoma cells by interfering with intracellular HuR trafficking

    International Nuclear Information System (INIS)

    Doller, Anke; Badawi, Amel; Schmid, Tobias; Brauß, Thilo; Pleli, Thomas; Meyer zu Heringdorf, Dagmar; Piiper, Albrecht; Pfeilschifter, Josef; Eberhardt, Wolfgang

    2015-01-01

    The impact of the RNA-binding protein HuR for the post-transcriptional deregulation of tumor-relevant genes is well established. Despite of elevations in HuR expression levels, an increase in cytoplasmic HuR abundance in many cases correlates with a high grade of malignancy. Here, we demonstrated that administration of the actin-depolymerizing macrolide latrunculin A, or blebbistatin, an inhibitor of myosin II ATPase activity, caused a dose- and time-dependent reduction in the high cytoplasmic HuR content of HepG2 and Huh7 hepatocellular carcinoma (HCC) cells. Subcellular fractionation revealed that in addition, both inhibitors strongly attenuated cytoskeletal and membrane-bound HuR abundance and conversely increased the HuR amount in nuclear cell fractions. Concomitant with changes in intracellular HuR localization, both cytoskeletal inhibitors markedly decreased the half-lives of cyclooxygenase-2 (COX-2), cyclin A and cyclin D 1 encoding mRNAs resulting in a significant reduction in their expression levels in HepG2 cells. Importantly, a similar reduction in the expression of these HuR targets was achieved by a RNA interference (RNAi)-mediated knockdown of either HuR or nonmuscle myoin IIA. Using polysomal fractionation, we further demonstrate that the decrease in cytoplasmic HuR by latrunculin A or blebbistatin is accompanied by a marked change in the allocation of HuR and its mRNA cargo from polysomes to ribonucleoprotein (RNP) particles. Functionally, the basal migration and prostaglandin E 2 synthesis are similarly impaired in inhibitor-treated and stable HuR-knockdown HepG2 cells. Our data demonstrate that interfering with the actomyosin-dependent HuR trafficking may comprise a valid therapeutic option for antagonizing pathologic posttranscriptional gene expression by HuR and furthermore emphasize the potential benefit of HuR inhibitory strategies for treatment of HCC. - Highlights: • We tested the effects of latrunculin A and blebbistatin on different Hu

  7. SHI induced effects on the electrical and optical properties of HfO_2 thin films deposited by RF sputtering

    International Nuclear Information System (INIS)

    Manikanthababu, N.; Dhanunjaya, M.; Nageswara Rao, S.V.S.; Pathak, A.P.

    2016-01-01

    The continuous downscaling of Metal Oxide Semiconductor (MOS) devices has reached a limit with SiO_2 as a gate dielectric material. Introducing high-k dielectric materials as a replacement for the conservative SiO_2 is the only alternative to reduce the leakage current. HfO_2 is a reliable and an impending material for the wide usage as a gate dielectric in semiconductor industry. HfO_2 thin films were synthesized by RF sputtering technique. Here, we present a study of Swift Heavy Ion (SHI) irradiation with100 MeV Ag ions for studying the optical properties as well as 80 MeV Ni ions for studying the electrical properties of HfO_2/Si thin films. Rutherford Backscattering Spectrometry (RBS), Field Emission Scanning Electron Microscope (FESEM), energy-dispersive X-ray spectroscopy (EDS), profilometer and I–V (leakage current) measurements have been employed to study the SHI induced effects on both the structural, electrical and optical properties.

  8. Effect of swift heavy ion (SHI) irradiation on transparent conducting oxide electrodes for dye-sensitized solar cell applications

    Science.gov (United States)

    Singh, Hemant Kr.; Avasthi, D. K.; Aggarwal, Shruti

    2015-06-01

    Transparent conducting oxides (TCOs) are used as electrodes in dye-sensitized solar cells (DSSCs) because of their properties such as high transmittance and low resistivity. In the present work, the effects of swift heavy ion (SHI) irradiation on various types of TCOs are presented. The objective of this study is to investigate the effect of SHI on TCOs. For the present study, three different types of TCOs are considered, namely, (a) FTO (fluorine-doped tin oxide, SnO2:F) on a Nippon glass substrate, (b) ITO (indium tin oxide, In2O3:Sn) coated on polyethylene terephthalate (PET) on a Corning glass substrate, and (c) ITO on a Corning glass substrate. These films are irradiated with 120 MeV Ag+9 ions at fluences ranging from 3.0 × 1011 ions/cm2 to 3.0 × 1013 ions/cm2. The structural, morphological, optical and electrical properties are studied via X-ray diffraction (XRD), atomic force microscopy (AFM), UV-Vis absorption spectroscopy and four-probe resistivity measurements, respectively. The ITO-PET electrode is found to exhibit superior conductivity and transmittance properties in comparison with the others after irradiation and, therefore, to be the most suitable for solar cell applications.

  9. Innate Immune Activation Can Trigger Experimental Spondyloarthritis in HLA-B27/Huβ2m Transgenic Rats

    NARCIS (Netherlands)

    van Tok, Melissa N.; Satumtira, Nimman; Dorris, Martha; Pots, Desirée; Slobodin, Gleb; van de Sande, Marleen G.; Taurog, Joel D.; Baeten, Dominique L.; van Duivenvoorde, Leonie M.

    2017-01-01

    Spondyloarthritis (SpA) does not display the typical features of auto-immune disease. Despite the strong association with MHC class I, CD8(+) T cells are not required for disease induction in the HLA-B27/Huβ2m transgenic rats. We used Lewis HLA-B27/Huβ2m transgenic rats [21-3 × 283-2]F1,

  10. HuR binds to a single site on the C/EBPβ mRNA of 3T3-L1 adipocytes

    International Nuclear Information System (INIS)

    Jones, Heath; Carver, Melinda; Pekala, Phillip H.

    2007-01-01

    HuR is a ligand for nuclear mRNAs containing adenylate-uridylate rich elements in the 3'-untranslated region. Once bound to the mRNA, HuR is recognized by adapter proteins which then facilitate nuclear export of the complex. In the cytosol HuR is thought to function to control stability and translation of its ligand message. In the 3T3-L1 cells HuR is constitutively expressed and localized predominantly to the nucleus in the preadipocytes. However within 30 min of exposure to the differentiation stimulus, the HuR content in the cytosol increases consistent with HuR regulating the availability of relevant mRNAs for translation. Using in vitro RNA gel shifts, we have demonstrated that the C/EBPβ message is a ligand for HuR and that the single binding site is an adenylate-uridylate rich element in the 3'-untranslated region

  11. A kinetic analysis of kappa-opioid agonist binding using the selective radioligand (/sup 3/H)U69593

    Energy Technology Data Exchange (ETDEWEB)

    Smith, J.A.; Hunter, J.C.; Hill, R.G.; Hughes, J.

    1989-07-01

    The interaction of the nonselective opioid ligand (3H)bremazocine and of the kappa-opioid (3H)U69593 with the kappa-receptor was investigated in guinea-pig cortical membranes. Each radioligand bound to a single population of high-affinity sites, although (3H)U69593 apparently recognised only 70% of those sites labelled by (3H)bremazocine. Naloxone and the kappa-selective ligands U69593 and PD117302 exhibited full inhibition of the binding of both radioligands. Kinetic analysis demonstrated biphasic rates of association and dissociation for both (3H)bremazocine and (3H)U69593. Detailed analysis of the binding of (3H)U69593 revealed that the fast rate of association was dependent on radioligand concentration, in contrast to the slow rate, which was independent of ligand concentration. Guanylyl-5'-imidodiphosphate (GppNHp) inhibited binding of (3H)U69593; saturation analysis demonstrated that the inhibitory effects of GppNHp resulted in a decrease in affinity without any significant change in binding capacity. GppNHp attenuated the formation of the slow component of (3H)U69593 binding, while accelerating the fast component. The data are consistent with the formation of a high-affinity complex between the kappa-receptor and a guanine nucleotide binding protein. Guanine nucleotides promote the dissociation of this ternary complex and the stabilisation of a lower-affinity state of the receptor.

  12. Domain-specific phosphomimetic mutation allows dissection of different protein kinase C (PKC) isotype-triggered activities of the RNA binding protein HuR.

    Science.gov (United States)

    Schulz, Sebastian; Doller, Anke; Pendini, Nicole R; Wilce, Jacqueline A; Pfeilschifter, Josef; Eberhardt, Wolfgang

    2013-12-01

    The ubiquitous mRNA binding protein human antigen R (HuR) participates in the post-transcriptional regulation of many AU-rich element (ARE)-bearing mRNAs. Previously, by using in vitro kinase assay, we have identified serines (Ser) 158, 221 and 318 as targets of protein kinase C (PKC)-triggered phosphorylation. In this study, we tested whether GFP- or GST-tagged HuR constructs bearing a phosphomimetic Ser (S)-to-Asp (D) substitution at the different PKC target sites, would affect different HuR functions including HuR nucleo-cytoplasmic redistribution and binding to different types of ARE-containing mRNAs. The phosphomimetic GFP-tagged HuR protein bearing a phosphomimetic substitution in the hinge region of HuR (HuR-S221D) showed an increased cytoplasmic abundance when compared to wild-type HuR. Conversely, data from in vitro kinase assay and electrophoretic mobility shift assay (EMSA), implicates that phosphorylation at Ser 221 is not relevant for mRNA binding of HuR. Quantification of in vitro binding affinities of GST-tagged wild-type HuR and corresponding HuR proteins bearing a phosphomimetic substitution in either RRM2 (HuR-S158D) or in RRM3 (HuR-S318D) by microscale thermophoresis (MST) indicates a specific binding of wild-type HuR to type I, II or type III-ARE-oligonucleotides in the high nanomolar range. Interestingly, phosphomimetic mutation at position 158 or 318 had a negative influence on HuR binding to type I- and type II-ARE-mRNAs whereas it significantly enhanced HuR affinity to a type III-ARE substrate. Our data suggest that differential phosphorylation of HuR by PKCs at different HuR domains coordinates subcellular HuR distribution and leads to a preferential binding to U-rich bearing target mRNA. © 2013.

  13. 'Hu Hong' (bad thing): parental perceptions of teenagers' sexuality in urban Vietnam.

    Science.gov (United States)

    Do, Lan Anh Thi; Boonmongkon, Pimpawun; Paek, Seung Chun; Guadamuz, Thomas E

    2017-02-28

    Teenagers under 18 years old in Vietnam are considered as minors who usually lack the autonomy to make decisions. They are also sometimes viewed as contributors to social evils including crime, violence and substance use. Moreover, most Vietnamese teenagers have unsafe sex before marriage. The objective of this study is to explore the parental perceptions relating to their teenagers' sexuality, particularly the social and cultural forces, that may hinder access to sexuality information. Guided by a Community Advisory Board (CAB), this qualitative study uses four focus group discussions (FGDs) consisting of 12 mothers and 12 fathers, as well as twelve individual in-depth interviews (IDIs) with a diverse sample of parents of teens in Ho Chi Minh City (HCMC), Vietnam. Content and discourse analysis were conducted, based on Foucauldian concepts. Four themes emerged: 1) Meanings of sexuality and sexuality education, 2) Early sexual intercourse destroys teenagers' future, 3) Teenagers are not hu hong (spoil/bad thing), are innocent and virgin, and 4) Policing and controlling of sexual intercourse among teens. Parents did not view their teenage children as sexual beings; those who are sexual are considered hu hong. Parents believed that teens need to be policed and controlled to prevent them from becoming hu hong, particularly girls. Controlling of sexuality information by parents was therefore common in HCMC, but differed by gender and educational levels of parents. For example, fathers more than mothers were not comfortable teaching their teenage children about sex and sexuality. Parents with higher education police their teenage children's usage of the Internet and social media, while parents with lower education control who can be friends with their teenage children. Vietnamese parents in general have negative views of sex and sexuality education for their teenage children. Recognizing that many Vietnamese teenagers have unsafe sex before marriage, parents need to

  14. Effects of weaning age on growth, nutrient digestibility and metabolism, and serum parameters in Hu lambs

    Directory of Open Access Journals (Sweden)

    Jianmin Chai

    2015-12-01

    Full Text Available This study was conducted to investigate the effect of weaning age on growth performance, nutrient digestion and metabolism, and serological indicators, and to obtain an optimal weaning age in Hu lambs. Forty-eight newborn Hu lambs (birth weight, 2.53 ± 0.14 kg were randomly divided into 4 groups. The lambs in control group (ER suckled their dams. The lambs in other three experimental groups were weaned on milk replacer at 10, 20, and 30 days of age (EW10, EW20, and EW30 groups, respectively. The results were as follows: 1 lambs in EW10 and EW30 groups had a lower (P  0.05 among groups; however, the apparent digestibility and deposition of calcium in early weaned lambs were lower (P < 0.05 than those in ewe-reared lambs. 4 The albumin content in EW30 group was lower (P < 0.05 than that in ER group; the globulin content in EW30 group was higher (P < 0.05 than that in other groups; the content of serum insulin-like growth factor-Ⅰ in weaned lambs tended to increase compared with lambs in ER group. Finally, the growth rate of lambs decreased within 10 days post-weaning, but early weaning boosted creep feed intake, leading to better growth and health later in life. The Hu lambs can be weaned on milk replacer and creep feed at 10 days of age.

  15. Preferencias de los huéspedes de hostels de la ciudad de La Plata

    OpenAIRE

    De la Cruz, Gastón Miguel

    2013-01-01

    La presente tesis tiene como objeto estudiar las preferencias de huéspedes de un grupo de hostels de la ciudad de La Plata, con el fin de determinar la existencia de una demanda que tenga como principal preferencia a un atributo de índole social. Para cumplir con este objetivo se utilizó la técnica estadística análisis conjunto (conjoint analysis en inglés) la cual obligó a descomponer el concepto hostel en seis (6) atributos, de los cuales tres (3) atributos entran en la definición de índole...

  16. Cooperative interplay of let-7 mimic and HuR with MYC RNA

    OpenAIRE

    Gunzburg, Menachem J; Sivakumaran, Andrew; Pendini, Nicole R; Yoon, Je-Hyun; Gorospe, Myriam; Wilce, Matthew Cj; Wilce, Jacqueline A

    2015-01-01

    Both RNA-binding proteins (RBP) and miRNA play important roles in the regulation of mRNA expression, often acting together to regulate a target mRNA. In some cases the RBP and miRNA have been reported to act competitively, but in other instances they function cooperatively. Here, we investigated HuR function as an enhancer of let-7-mediated translational repression of c-Myc despite the separation of their binding sites. Using an in vitro system, we determined that a let-7 mimic, consisting of...

  17. Inhibition of cell division in hupA hupB mutant bacteria lacking HU protein.

    OpenAIRE

    Dri, A M; Rouviere-Yaniv, J; Moreau, P L

    1991-01-01

    Escherichia coli hupA hypB double mutants that lack HU protein have severe cellular defects in cell division, DNA folding, and DNA partitioning. Here we show that the sfiA11 mutation, which alters the SfiA cell division inhibitor, reduces filamentation and production of anucleate cells in AB1157 hupA hupB strains. However, lexA3(Ind-) and sfiB(ftsZ)114 mutations, which normally counteract the effect of the SfiA inhibitor, could not restore a normal morphology to hupA hupB mutant bacteria. The...

  18. MicroRNA-16 Modulates HuR Regulation of Cyclin E1 in Breast Cancer Cells

    Directory of Open Access Journals (Sweden)

    Xun Guo

    2015-03-01

    Full Text Available RNA binding protein (RBPs and microRNAs (miRNAs or miRs are post-transcriptional regulators of gene expression that are implicated in development of cancers. Although their individual roles have been studied, the crosstalk between RBPs and miRNAs is under intense investigation. Here, we show that in breast cancer cells, cyclin E1 upregulation by the RBP HuR is through specific binding to regions in the cyclin E1 mRNA 3' untranslated region (3'UTR containing U-rich elements. Similarly, miR-16 represses cyclin E1, dependent on its cognate binding sites in the cyclin E1 3'UTR. Evidence in the literature indicates that HuR can regulate miRNA expression and recruit or dissociate RNA-induced silencing complexes (RISC. Despite this, miR-16 and HuR do not affect the other’s expression level or binding to the cyclin E1 3'UTR. While HuR overexpression partially blocks miR-16 repression of a reporter mRNA containing the cyclin E1 3'UTR, it does not block miR-16 repression of endogenous cyclin E1 mRNA. In contrast, miR-16 blocks HuR-mediated upregulation of cyclin E1. Overall our results suggest that miR-16 can override HuR upregulation of cyclin E1 without affecting HuR expression or association with the cyclin E1 mRNA.

  19. Getting to "No": Locating Critical Peace Education within Resistance and Anti-Oppression Pedagogy at a Shi'a Islamic School in Lebanon

    Science.gov (United States)

    Zakharia, Zeena

    2017-01-01

    This paper critically engages observations from a school that was aligned with a resistance movement in Lebanon during a post-war period of sustained political violence (2006-2007). Focusing on the pedagogical practices at one community-centered and community-led Shi'a Islamic urban school, the paper draws on extensive ethnographic data to…

  20. HuH-7 reference genome profile: complex karyotype composed of massive loss of heterozygosity.

    Science.gov (United States)

    Kasai, Fumio; Hirayama, Noriko; Ozawa, Midori; Satoh, Motonobu; Kohara, Arihiro

    2018-05-17

    Human cell lines represent a valuable resource as in vitro experimental models. A hepatoma cell line, HuH-7 (JCRB0403), has been used extensively in various research fields and a number of studies using this line have been published continuously since it was established in 1982. However, an accurate genome profile, which can be served as a reliable reference, has not been available. In this study, we performed M-FISH, SNP microarray and amplicon sequencing to characterize the cell line. Single cell analysis of metaphases revealed a high level of heterogeneity with a mode of 60 chromosomes. Cytogenetic results demonstrated chromosome abnormalities involving every chromosome in addition to a massive loss of heterozygosity, which accounts for 55.3% of the genome, consistent with the homozygous variants seen in the sequence analysis. We provide empirical data that the HuH-7 cell line is composed of highly heterogeneous cell populations, suggesting that besides cell line authentication, the quality of cell lines needs to be taken into consideration in the future use of tumor cell lines.

  1. Inhibition of cell division in hupA hupB mutant bacteria lacking HU protein.

    Science.gov (United States)

    Dri, A M; Rouviere-Yaniv, J; Moreau, P L

    1991-01-01

    Escherichia coli hupA hypB double mutants that lack HU protein have severe cellular defects in cell division, DNA folding, and DNA partitioning. Here we show that the sfiA11 mutation, which alters the SfiA cell division inhibitor, reduces filamentation and production of anucleate cells in AB1157 hupA hupB strains. However, lexA3(Ind-) and sfiB(ftsZ)114 mutations, which normally counteract the effect of the SfiA inhibitor, could not restore a normal morphology to hupA hupB mutant bacteria. The LexA repressor, which controls the expression of the sfiA gene, was present in hupA hupB mutant bacteria in concentrations half of those of the parent bacteria, but this decrease was independent of the specific cleavage of the LexA repressor by activated RecA protein. One possibility to account for the filamentous morphology of hupA hupB mutant bacteria is that the lack of HU protein alters the expression of specific genes, such as lexA and fts cell division genes. Images PMID:2019558

  2. Validation of whole-blood transcriptome signature during microdose recombinant human erythropoietin (rHuEpo) administration.

    Science.gov (United States)

    Wang, Guan; Durussel, Jérôme; Shurlock, Jonathan; Mooses, Martin; Fuku, Noriyuki; Bruinvels, Georgie; Pedlar, Charles; Burden, Richard; Murray, Andrew; Yee, Brendan; Keenan, Anne; McClure, John D; Sottas, Pierre-Edouard; Pitsiladis, Yannis P

    2017-11-14

    Recombinant human erythropoietin (rHuEpo) can improve human performance and is therefore frequently abused by athletes. As a result, the World Anti-Doping Agency (WADA) introduced the Athlete Biological Passport (ABP) as an indirect method to detect blood doping. Despite this progress, challenges remain to detect blood manipulations such as the use of microdoses of rHuEpo. Forty-five whole-blood transcriptional markers of rHuEpo previously derived from a high-dose rHuEpo administration trial were used to assess whether microdoses of rHuEpo could be detected in 14 trained subjects and whether these markers may be confounded by exercise (n = 14 trained subjects) and altitude training (n = 21 elite runners and n = 4 elite rowers, respectively). Differential gene expression analysis was carried out following normalisation and significance declared following application of a 5% false discovery rate (FDR) and a 1.5 fold-change. Adaptive model analysis was also applied to incorporate these markers for the detection of rHuEpo. ALAS2, BCL2L1, DCAF12, EPB42, GMPR, SELENBP1, SLC4A1, TMOD1 and TRIM58 were differentially expressed during and throughout the post phase of microdose rHuEpo administration. The CD247 and TRIM58 genes were significantly up- and down-regulated, respectively, immediately following exercise when compared with the baseline both before and after rHuEpo/placebo. No significant gene expression changes were found 30 min after exercise in either rHuEpo or placebo groups. ALAS2, BCL2L1, DCAF12, SLC4A1, TMOD1 and TRIM58 tended to be significantly expressed in the elite runners ten days after arriving at altitude and one week after returning from altitude (FDR > 0.059, fold-change varying from 1.39 to 1.63). Following application of the adaptive model, 15 genes showed a high sensitivity (≥ 93%) and specificity (≥ 71%), with BCL2L1 and CSDA having the highest sensitivity (93%) and specificity (93%). Current results provide further evidence that

  3. The Use of Soluble Transferrin Receptor in the Detection of rHuEPO abuse in Sports

    Directory of Open Access Journals (Sweden)

    Donovan McGrowder

    2010-01-01

    Full Text Available Erythropoietin (EPO increases the number of circulating erythrocytes and muscle oxygenation. The recombinant forms of EPO have indiscriminately been used by athletes, mainly in endurance sports to increase their erythrocytes concentration, thus generating a better delivery of oxygen to the muscle tissue. The administration of recombinant human erythropoietin (rHuEPO except for therapeutic use was prohibited by the International Olympic Committee (IOC and its unauthorized use considered as doping. In the last few years, a number of studies using parameters indicative of accelerated erythropoiesis have investigated a number of indirect methods for the detection of rHuEPO abuse. No single indirect marker has been found that can satisfactorily demonstrated rHuEPO misuse. Soluble transferrin receptor (sTfR is a new marker of iron status and erythropoietic activity. It has been included in multivariable blood testing models for the detection of performance enhancing EPO abuse in sports. Indirect markers of altered erythropoiesis give reliable evidence of current or discontinued rHuEPO usage. This review describes the physical, biological and pharmacokinetic properties of endogenous EPO and its recombinant form. It also discusses the available strategies for the detection of rHuEPO abuse in sports, involving the use of sTfR concentration directly or in mathematical multivariate models.

  4. HuR binding to AU-rich elements present in the 3' untranslated region of Classical swine fever virus

    Directory of Open Access Journals (Sweden)

    Huang Chin-Cheng

    2011-07-01

    Full Text Available Abstract Background Classical swine fever virus (CSFV is the member of the genus Pestivirus under the family Flaviviridae. The 5' untranslated region (UTR of CSFV contains the IRES, which is a highly structured element that recruits the translation machinery. The 3' UTR is usually the recognition site of the viral replicase to initiate minus-strand RNA synthesis. Adenosine-uridine rich elements (ARE are instability determinants present in the 3' UTR of short-lived mRNAs. However, the presence of AREs in the 3' UTR of CSFV conserved in all known strains has never been reported. This study inspects a possible role of the ARE in the 3' UTR of CSFV. Results Using RNA pull-down and LC/MS/MS assays, this study identified at least 32 possible host factors derived from the cytoplasmic extracts of PK-15 cells that bind to the CSFV 3' UTR, one of which is HuR. HuR is known to bind the AREs and protect the mRNA from degradation. Using recombinant GST-HuR, this study demonstrates that HuR binds to the ARE present in the 3' UTR of CSFV in vitro and that the binding ability is conserved in strains irrespective of virulence. Conclusions This study identified one of the CSFV 3' UTR binding proteins HuR is specifically binding to in the ARE region.

  5. Comparison of the Debye–Hückel and the Mean Spherical Approximation Theories for Electrolyte Solutions

    DEFF Research Database (Denmark)

    Maribo-Mogensen, Bjørn; Kontogeorgis, Georgios M.; Thomsen, Kaj

    2012-01-01

    The thermodynamics of electrolyte solutions has been investigated by many scientists throughout the last century. While several theories have been presented, the most popular models for the electrostatic interactions are based on the Debye–Hückel and mean spherical approximation (MSA) theories....... In this paper we investigate the differences between the Debye–Hückel and the MSA theories, and comparisons of the numerical results for the Helmholtz energy and its derivatives with respect to temperature, volume and composition are presented. The investigation shows that the nonrestricted primitive MSA...... theory performs similarly to Debye–Hückel, despite the differences in the derivation. We furthermore show that the static permittivity is a key parameter for both models and that in many cases it completely dominates the results obtained from the two models. Consequently, we conclude that the simpler...

  6. Hu Hong’ (bad thing: parental perceptions of teenagers’ sexuality in urban Vietnam

    Directory of Open Access Journals (Sweden)

    Lan Anh Thi Do

    2017-02-01

    Full Text Available Abstract Background Teenagers under 18 years old in Vietnam are considered as minors who usually lack the autonomy to make decisions. They are also sometimes viewed as contributors to social evils including crime, violence and substance use. Moreover, most Vietnamese teenagers have unsafe sex before marriage. The objective of this study is to explore the parental perceptions relating to their teenagers’ sexuality, particularly the social and cultural forces, that may hinder access to sexuality information. Methods Guided by a Community Advisory Board (CAB, this qualitative study uses four focus group discussions (FGDs consisting of 12 mothers and 12 fathers, as well as twelve individual in-depth interviews (IDIs with a diverse sample of parents of teens in Ho Chi Minh City (HCMC, Vietnam. Content and discourse analysis were conducted, based on Foucauldian concepts. Results Four themes emerged: 1 Meanings of sexuality and sexuality education, 2 Early sexual intercourse destroys teenagers’ future, 3 Teenagers are not hu hong (spoil/bad thing, are innocent and virgin, and 4 Policing and controlling of sexual intercourse among teens. Parents did not view their teenage children as sexual beings; those who are sexual are considered hu hong. Parents believed that teens need to be policed and controlled to prevent them from becoming hu hong, particularly girls. Controlling of sexuality information by parents was therefore common in HCMC, but differed by gender and educational levels of parents. For example, fathers more than mothers were not comfortable teaching their teenage children about sex and sexuality. Parents with higher education police their teenage children’s usage of the Internet and social media, while parents with lower education control who can be friends with their teenage children. Conclusions Vietnamese parents in general have negative views of sex and sexuality education for their teenage children. Recognizing that many

  7. Characterization of the hypothermic effect of the synthetic cannabinoid HU-210 in the rat. Relation to the adrenergic system and endogenous pyrogens.

    Science.gov (United States)

    Ovadia, H; Wohlman, A; Mechoulam, R; Weidenfeld, J

    1995-02-01

    In the present study we have characterized the hypothermic effect of the psychoactive cannabinoid HU-210, by investigating its interaction with the endogenous pyrogens, IL-1 and PGE2. We also studied the involvement of the adrenergic system in mediation of this hypothermic effect. Injection of HU-210 directly into the preoptic area caused a dose dependent reduction of rectal temperature from 37 to 32.1 degrees C. Injection of the non-psychoactive analog, HU-211 which does not bind to brain cannabinoid receptor, did not affect body temperature. Injection of the adrenergic agonists, CGP-12177 and clonidine (beta, and alpha adrenergic agonists, respectively) abrogated the hypothermia induced by HU-210. Injection of the adrenergic antagonists, prazosin (alpha 1) and propranolol (beta) enhanced the hypothermic effect of HU-210. Intracerebral administration of IL-1 or PGE2 to rats pretreated with HU-210 caused a transient inhibition of the hypothermia. The ex vivo rate of basal or bacterial endotoxin-induced synthesis of PGE2 by different brain regions, including the preoptic area was not affected by HU-210 administration. These results suggest that the synthetic cannabinoid HU-210 acts in the preoptic area, probably via the brain cannabinoid receptor to induce hypothermia. The hypothermic effect can be antagonized by adrenergic agonists and enhanced by adrenergic antagonists. HU-210 does not interfere with the pyrogenic effect of IL-1 or PGE2.

  8. Iodine-131-labelled CDR grafted monoclonal antibody huA33 metastatic colorectal carcinoma: A case study

    International Nuclear Information System (INIS)

    Thomas, D.L.; Lee, F.T.; Scott, A.M.

    1997-01-01

    Full text: A 58-year-old woman was diagnosed with metastatic colorectal carcinoma two years after initial surgery for sigmoid carcinoma. As part of the staging work-up she was initially referred for a 18 F-FDG PET scan at the PET Centre. FDG PET scans of the abdomen and pelvis demonstrated multiple hepatic lesions, but there was no evidence of disease outside the liver. On the basis of extensive hepatic disease, the patient was scheduled for a laparotomy for insertion of an hepatic artery catheter for chemotherapy. In view of her clinical presentation, the patient was eligible for a Phase 1 trial with 131 l-labelled huA33, and agreed to participate. HuA33 is a humanised CDR-grafted recombinant monoclonal antibody directed against an antigen found on >95 per cent of all colorectal carcinomas, and on small bowel and colonic mucosa. The phase 1 trial is a protein dose escalation study designed to examine the biodistribution, pharmacokinetics, dosimetry and safety profile of huA33, and sequential gamma camera images of the whole body were obtained daily until seven days post infusion. SPECT images were obtained on day 6. Excellent localisation of 131 l-huA33 was seen in hepatic lesions. Calculation of whole body retention and tumour uptake was performed, and pharmacokinetic analysis also undertaken. Biopsies of tumour obtained at surgery were used to quantitate tumour uptake and cellular trafficking of 131 l-huA33. On the basis of this phase 1 study, future therapeutic trials of 131 I-huA33 are planned

  9. National Cooperative rHu Erythropoietin Study in patients with chronic renal failure--an interim report. The National Cooperative rHu Erythropoietin Study Group.

    Science.gov (United States)

    Levin, N W; Lazarus, J M; Nissenson, A R

    1993-08-01

    This second interim report of the National Cooperative rHu Erythropoietin Study presents data from 324 patients new to recombinant human erythropoietin (Epoetin alfa) who completed at least 12 months of study participation. Mean hematocrit levels increased to approximately 30% by month 3 in patients on hemodialysis (n = 293) and stabilized for the remainder of the study whether Epoetin alfa was administered by the intravenous (n = 250) or subcutaneous (n = 42) route. The intravenous dosage level ranged between 106.9 and 121.6 U/kg/wk; subcutaneous dosing ranged between 87.4 and 108.0 U/kg/wk; dosing levels in patients on peritoneal dialysis (n = 31) were similar, although there was a trend towards slightly higher hematocrit levels. Throughout the 12 months of the study, there was no relationship between blood pressure and either hematocrit level or Epoetin alfa dose. Approximately two thirds of the patients were receiving iron supplementation at any given time, and there was a trend towards the increased use of oral iron supplements. The incidence of adverse events in this cohort of patients was low throughout the study, and there was no relationship between the incidence of adverse events and either hematocrit level or Epoetin alfa dose. Based on an analysis of data from baseline to first follow-up, Epoetin alfa therapy resulted in improvement in several quality-of-life factors, most notable of which was vitality. Improvement occurred in all patient subgroups with some variability in the level and intensity of effect. Overall, these data demonstrate that Epoetin alfa therapy is safe and effective when used in a broad cross-section of patients on dialysis.(ABSTRACT TRUNCATED AT 250 WORDS)

  10. First International Workshop on Human Factors in Modeling (HuFaMo 2015)

    DEFF Research Database (Denmark)

    Störrle, Harald; Chaudron, Michel R. V.; Amaral, Vasco

    2015-01-01

    human factors in modeling. Our goal is to improve the state of the science and professionalism in empirical research in the Model Based Engineering community. Typical examples of research questions might consider the usability of a certain approach, such as a method or language, or the emotional states......Modeling is a human-intensive enterprise. As such, many research questions related to modeling can only be answered by empirical studies employing human factors. The International Workshop Series on Human Factors in Modeling (HuFaMo) is dedicated to the discussion of empirical research involving...... or personal judgements of modelers. While concerned with foundations and framework support for modeling, the community has been somehow neglecting the issue of human factors in this context. There is a growing need from the community concerned with quality factors to understand the best practices...

  11. La voz y la letra en "Un huésped", de Yoko Tawada

    Directory of Open Access Journals (Sweden)

    María Lucía Correa

    2009-05-01

    Full Text Available Los textos de Yoko Tawada, escritorajaponesa residente en Alemania,hacen presente el desgarramientode quien vive fuera de la lenguamaterna. Es una obra que se balanceasobre el límite entre loscódigos, donde nada hay evidente,donde la palabra parece tener vidapropia. Entre los textos que tomanesta extrañeza del lenguaje comosustrato, se encuentra el relato"Un huésped", cuya particular referenciaa la voz y a la letra comodos registros que se entrelazan yse repelen alternativamente, loconvierte en una valiosa fuente dereflexiones sobre lo oral, la voz, laletra, la lectura y la escritura.Palabras clave: Yoko Tawada, literaturajaponesa contemporánea, voz,letra, escritura.

  12. Spectroscopy of bright Algol-type semi-detached close binary system HU Tauri (HR 1471)

    Science.gov (United States)

    Parthasarathy, M.

    2018-01-01

    Radial velocities of the primary component (B8V) of HU Tauri derived from the photographic spectra obtained during January 1974 to December 1974 and spectroscopic orbital elements from the analysis of the radial velocity curve of the B8V primary are given. The H line of the late type secondary component is clearly detected on the photographic spectra taken around the quadratures and radial velocities of the secondary component are derived. The radial velocity semi amplitudes of the primary (K) and secondary (K) are found to be 60 km/sec and 234 km/sec respectively. The mass ratio M/M = K/K is found to be 0.2564. The detection of the H line of the secondary is confirmed from the high resolution spectra that I obtained during 1981 and 1983 at quadratures using the 2.1-m McDonald observatory Otto Struve reflector telescope and high resolution coude Reticon spectrograph.

  13. The complete chloroplast genome sequence of the relict woody plant Metasequoia glyptostroboides Hu et Cheng

    Directory of Open Access Journals (Sweden)

    Jinhui eChen

    2015-06-01

    Full Text Available Metasequoia glyptostroboides Hu et Cheng is the only species in the genus Metasequoia Miki ex Hu et Cheng, which belongs to the Cupressaceae family. There were around ten species in the Metasequoia genus, which were widely spread across the Northern Hemisphere during the Cretaceous of the Mesozoic and in the Cenozoic. M. glyptostroboides is the only remaining representative of this genus. Here, we report the complete chloroplast (cp genome sequence and the cp genomic features of M. glyptostroboides. The M. glyptostroboides cp genome is 131,887 bp in length, with a total of 117 genes comprised of 82 protein-coding genes, 31 tRNA genes and four rRNA genes. In this genome, 11 forward repeats, nine palindromic repeats and 15 tandem repeats were detected. A total of 188 perfect microsatellites were detected through simple sequence repeat (SSR analysis and these were distributed unevenly within the cp genome. Comparison of the cp genome structure and gene order to those of several other land plants indicated that a copy of the inverted repeat (IR region, which was found to be IR region A (IRA, was lost in the M. glyptostroboides cp ge-nome. The five most divergent and five most conserved genes were determined and further phylogenetic analysis was performed among plant species, especially for relat-ed species in conifers. Finally, phylogenetic analysis demonstrated that M. glyptostro-boides is a sister species to Cryptomeria japonica (L. F. D. Don and to Taiwania cryptomerioides Hayata. The complete cp genome sequence information of M. glyp-tostroboides will be great helpful for further investigations of this endemic relict woody plant and for in-depth understanding of the evolutionary history of the conif-erous cp genomes, especially for the position of M. glyptostroboides in plant systemat-ics and evolution.

  14. The complete chloroplast genome sequence of the relict woody plant Metasequoia glyptostroboides Hu et Cheng.

    Science.gov (United States)

    Chen, Jinhui; Hao, Zhaodong; Xu, Haibin; Yang, Liming; Liu, Guangxin; Sheng, Yu; Zheng, Chen; Zheng, Weiwei; Cheng, Tielong; Shi, Jisen

    2015-01-01

    Metasequoia glyptostroboides Hu et Cheng is the only species in the genus Metasequoia Miki ex Hu et Cheng, which belongs to the Cupressaceae family. There were around 10 species in the Metasequoia genus, which were widely spread across the Northern Hemisphere during the Cretaceous of the Mesozoic and in the Cenozoic. M. glyptostroboides is the only remaining representative of this genus. Here, we report the complete chloroplast (cp) genome sequence and the cp genomic features of M. glyptostroboides. The M. glyptostroboides cp genome is 131,887 bp in length, with a total of 117 genes comprised of 82 protein-coding genes, 31 tRNA genes and four rRNA genes. In this genome, 11 forward repeats, nine palindromic repeats, and 15 tandem repeats were detected. A total of 188 perfect microsatellites were detected through simple sequence repeat (SSR) analysis and these were distributed unevenly within the cp genome. Comparison of the cp genome structure and gene order to those of several other land plants indicated that a copy of the inverted repeat (IR) region, which was found to be IR region A (IRA), was lost in the M. glyptostroboides cp genome. The five most divergent and five most conserved genes were determined and further phylogenetic analysis was performed among plant species, especially for related species in conifers. Finally, phylogenetic analysis demonstrated that M. glyptostroboides is a sister species to Cryptomeria japonica (L. F.) D. Don and to Taiwania cryptomerioides Hayata. The complete cp genome sequence information of M. glyptostroboides will be great helpful for further investigations of this endemic relict woody plant and for in-depth understanding of the evolutionary history of the coniferous cp genomes, especially for the position of M. glyptostroboides in plant systematics and evolution.

  15. Anti-Inflammatory and Osteoprotective Effects of Cannabinoid-2 Receptor Agonist HU-308 in a Rat Model of Lipopolysaccharide-Induced Periodontitis.

    Science.gov (United States)

    Ossola, Cesar A; Surkin, Pablo N; Mohn, Claudia E; Elverdin, Juan C; Fernández-Solari, Javier

    2016-06-01

    Anti-inflammatory and immunologic properties of cannabinoids have been reported in several tissues. Expression of cannabinoid receptor Type 2 was reported in osteoblasts and osteoclasts, suggesting a key role in bone metabolism. The aim of this study is to assess the effect of treatment with cannabinoid-2 receptor agonist HU-308 in the oral health of rats subjected to lipopolysaccharide (LPS)-induced periodontitis. Twenty-four rats were distributed in four groups (six rats per group): 1) control rats; 2) sham rats; 3) rats submitted to experimental periodontitis (LPS); and 4) rats submitted to experimental periodontitis and treated with HU-308 (LPS+HU). In groups LPS and LPS+HU, periodontitis was induced by LPS (1 mg/mL) injected into the gingival tissue (GT) of maxillary and mandibular first molars and into the interdental space between the first and second molars, 3 days per week for 6 weeks. In group LPS+HU, HU-308 (500 ng/mL) was applied topically to the GT daily. Alveolar bone loss resulting from LPS-induced periodontitis was significantly attenuated with HU-308 treatment (LPS+HU), measured by macroscopic and histologic examination. Treatment also reduced gingival production of inflammatory mediators augmented in LPS-injected rats, such as: 1) inducible nitric oxide (iNOS) activity (LPS: 90.18 ± 36.51 pmol/minute/mg protein versus LPS+HU: 16.37 ± 4.73 pmol/minute/mg protein; P periodontitis on the salivary secretory response to pilocarpine. Moreover, iNOS activity and PGE2 content, which were increased by LPS-induced periodontitis in the submandibular gland, returned to control values after HU-308 treatment. This study demonstrates anti-inflammatory, osteoprotective, and prohomeostatic effects of HU-308 in oral tissues of rats with LPS-induced periodontitis.

  16. Isolation and characterization of a catalase gene "HuCAT3" from pitaya (Hylocereus undatus) and its expression under abiotic stress.

    Science.gov (United States)

    Nie, Qiong; Gao, Guo-Li; Fan, Qing-jie; Qiao, Guang; Wen, Xiao-Peng; Liu, Tao; Peng, Zhi-Jun; Cai, Yong-Qiang

    2015-05-25

    Abiotic stresses usually cause H2O2 accumulation, with harmful effects, in plants. Catalase may play a key protective role in plant cells by detoxifying this excess H2O2. Pitaya (Hylocereus undatus) shows broad ecological adaptation due to its high tolerance to abiotic stresses, e.g. drought, heat and poor soil. However, involvement of the pitaya catalase gene (HuCAT) in tolerance to abiotic stresses is unknown. In the present study, a full-length HuCAT3 cDNA (1870 bp) was isolated from pitaya based on our previous microarray data and RACE method. The cDNA sequence and deduced amino acid sequence shared 73-77% and 75-80% identity with other plant catalases, respectively. HuCAT3 contains conserved catalase family domain and catalytic sites. Pairwise comparison and phylogenetic analysis indicated that HuCAT3 is most similar to Eriobotrya japonica CAT, followed by Dimocarpus longan CAT and Nicotiana tabacum CAT1. Expression profile analysis demonstrated that HuCAT3 is mainly expressed in green cotyledons and mature stems, and was regulated by H2O2, drought, cold and salt stress, whereas, its expression patterns and maximum expression levels varied with stress types. HuCAT activity increased as exposure to the tested stresses, and the fluctuation of HuCAT activity was consistent with HuCAT3 mRNA abundance (except for 0.5 days upon drought stress). HuCAT3 mRNA elevations and HuCAT activities changes under cold stress were also in conformity with the cold tolerances among the four genotypes. The obtained results confirmed a major role of HuCAT3 in abiotic stress response of pitaya. This may prove useful in understanding pitaya's high tolerance to abiotic stresses at molecular level. Copyright © 2015 Elsevier B.V. All rights reserved.

  17. The histone-like protein HU has a role in gene expression during the acid adaptation response in Helicobacter pylori.

    Science.gov (United States)

    Álvarez, Alhejandra; Toledo, Héctor

    2017-08-01

    Gastritis, ulcers, and gastric malignancy have been linked to human gastric epithelial colonization by Helicobacter pylori. Characterization of the mechanisms by which H. pylori adapts to the human stomach environment is of crucial importance to understand H. pylori pathogenesis. In an effort to extend our knowledge of these mechanisms, we used proteomic analysis and qRT-PCR to characterize the role of the histone-like protein HU in the response of H. pylori to low pH. Proteomic analysis revealed that genes involved in chemotaxis, oxidative stress, or metabolism are under control of the HU protein. Also, expression of the virulence factors Ggt and NapA is affected by the null mutation of hup gene both at neutral and acid pH, as evidenced by qRT-PCR analysis. Those results showed that H. pylori gene expression is altered by shift to low pH, thus confirming that acid exposure leads to profound changes in genomic expression, and suggest that the HU protein is a regulator that may help the bacterium adapt to the acid stress. In accordance with previous reports, we found that the HU protein participates in gene expression regulation when the microorganism is exposed to acid stress. Such transcriptional regulation underlies protein accumulation in the H. pylori cell. © 2017 John Wiley & Sons Ltd.

  18. Preliminary crystallographic analysis of the RNA-binding domain of HuR and its poly(U)-binding properties

    International Nuclear Information System (INIS)

    Wang, Hong; Li, Heng; Shi, Hui; Liu, Yang; Liu, Huihui; Zhao, Hui; Niu, Liwen; Teng, Maikun; Li, Xu

    2011-01-01

    Here, the recombinant ARE-binding region of HuR (residues 18–186) was crystallized in space group P2 1 2 1 2, with unit-cell parameters a = 41.2, b = 133.1, c = 31.4 Å. Human antigen R (HuR), a ubiquitously expressed member of the Hu protein family, is an important post-transcriptional regulator which has three RNA-recognition motif (RRM) domains. The two tandem N-terminal RRM domains can selectively bind to the AU-rich element (ARE), while the third one interacts with the poly(A) tail and other proteins. Here, the recombinant ARE-binding region of HuR (residues 18–186) was crystallized in space group P2 1 2 1 2, with unit-cell parameters a = 41.2, b = 133.1, c = 31.4 Å. X-ray diffraction data were collected to a resolution of 2.8 Å. Mutagenesis analysis and SPR assays revealed its poly(U)-binding properties

  19. Peripheral blood progenitor cell transplantation mobilised by r-metHuG-CSF (filgrastim); a less costly alternative to autologous bone marrow transplantation

    NARCIS (Netherlands)

    C.A. Uyl-de Groot (Carin); D.J. Richel (Dirk); F.F.H. Rutten (Frans)

    1994-01-01

    textabstractIn a retrospective study, we calculated the treatment costs of 63 patients who received either autologous bone marrow transplantation (ABMT) with recombinant human granulocyte colony-stimulating factor (r-metHuG-CSF) (filgrastim) (n=13) or without r-metHuG-CSF (n=22) or altenatively,

  20. Treatment of Common Cold Patients with the Shi-Cha Capsule: A Multicenter, Double-Blind, Randomized, Placebo-Controlled, Dose-Escalation Trial

    Science.gov (United States)

    Chang, Jing; Dong, Shou-Jin; She, Bin; Zhang, Rui-Ming; Meng, Mao-Bin; Xu, Yan-Ling; Wan, Li-Ling; Shi, Ke-Hua; Pan, Jun-Hun; Mao, Bing

    2012-01-01

    This study was designed to determine the therapeutic efficacy and safety of the Shi-cha capsule, a Chinese herbal formula, in the treatment of patients with wind-cold type common cold. In our multi-center, prospective, double-blind, randomized, placebo-controlled, dose-escalation trial, patients with wind-cold type common cold received 0.6 g of Shi-cha capsule plus 0.6 g placebo (group A), 1.2 g of Shi-cha capsule (group B), or 1.2 g placebo (group C), three times daily for 3 days and followed up to 10 days. The primary end point was all symptom duration. The secondary end points were main symptom duration, minor symptom duration, the changes in cumulative symptom score, main symptom score, and minor symptom score 4 days after the treatment, as well as adverse events. A total of 377 patients were recruited and 360 met the inclusive criteria; 120 patients constituted each treatment group. Compared with patients in group C, patients in groups A and B had significant improvement in the all symptom duration, main symptom duration, minor symptom duration, as well as change from baseline of cumulative symptom score, main symptom score, and minor symptom score at day 4. The symptom durations and scores showed slight superiority of group B over group A, although these differences were not statistically significant. There were no differences in adverse events. The Shi-cha capsule is efficacious and safe for the treatment of patients with wind-cold type common cold. Larger trials are required to fully assess the benefits and safety of this treatment for common cold. PMID:23346193

  1. See Religious Influences from Su Shi and John Milton's Memorial Poems%苏轼与弥尔顿悼亡诗中不同的宗教影响

    Institute of Scientific and Technical Information of China (English)

    Liu Lili; Li Feng

    2008-01-01

    Based on comparative study between the poetic works of John Milton and Su Shi,this thesis takes the only love sonnet of John Milton Methought l Saw My Late EspouscM Saint(On His Deceased Wife)and Su Shi's first memorial poem Jiangchengzi(Riverside Town)as examples tries to analyze the different religious influences between the two memorial poems.

  2. Comparison of HuRAM+ and HERA for Development of Data Worksheet for Simulator based HERA Databank

    International Nuclear Information System (INIS)

    Choi, Sunyoung; Jung, Wondea

    2013-01-01

    We also compared the existing HERA methods and HERA database to select essential data fields. We performed a preliminary study to see the possibility to induce the operator's emergency operating procedure (EOP) noncompliance behaviors under a simulated emergency. The purpose of this paper is to compare the HuRAM + and HERA to obtain an insight into the construction of a data worksheet for a qualitative HERA. In this paper, we performed a case study for applying simulator training data to HuRAM + and HERA. With this insight, as well as the results of the researches mentioned above, we have a plan to develop a systematic and qualitative HERA and a data worksheet for the work. In this paper, we compared HuRAM + and HERA to obtain an insight into the construction of a data worksheet for a qualitative HERA and performed a case study. HERA requires a burden to analyze and input an event data due to too many data fields even though it is well designed to estimate Heaps. It is somewhat more convenient to input data into the HuRAM + ; however, it is difficult to analyze the organization and safety culture factors. We are now trying to develop the framework of a data worksheet for a qualitative HERA based on simulator training data. The purpose of our data worksheet is to provide key information for HEP estimation and to enhance the understanding of an operators' behavior under an off-normal plant status. We aim less encumbered means of obtaining the needed data for HERA by changing the existing data worksheet framework of HuRAM + and HERA and by reducing data fields that require reading the between the lines

  3. SHiP: a new facility for searching for long-lived neutral particles and studying the tau neutrino properties

    CERN Document Server

    AUTHOR|(SzGeCERN)658186

    2016-01-01

    SHiP (Search for Hidden Particles) is a new general purpose fixed target facility, proposed at the CERN SPS accelerator. In its initial phase, the 400 GeV proton beam will be dumped on a heavy target, integrating $2\\times 10^{20}$ protons on target in 5 years. A dedicated detector located downstream of the target, based on a long vacuum tank and a spectrometer and particle identification detectors, will allow probing a variety of models with light long-lived neutral and very weakly interacting particles and masses below 10 GeV. The main focus will be the physics of the so-called Hidden Portals, i.e. search for Dark Photons, Light scalars and pseudo-scalars, and Heavy Neutrinos. The sensitivity to Heavy Neutrinos will allow for the first time to probe, in the mass range between the kaon and the charm meson mass, a coupling range for which the baryon asymmetry of the Universe could be explained. Direct detection of light and long-lived SUSY particles, such as RPV neutralinos and pseudo-Dirac gauginos could als...

  4. Cumulative approaches to track formation under swift heavy ion (SHI) irradiation: Phenomenological correlation with formation energies of Frenkel pairs

    Energy Technology Data Exchange (ETDEWEB)

    Crespillo, M.L., E-mail: mcrespil@utk.edu [Centro de Microanálisis de Materiales, CMAM-UAM, Cantoblanco, Madrid 28049 (Spain); Department of Materials Science & Engineering, University of Tennessee, Knoxville, TN 37996 (United States); Agulló-López, F., E-mail: fal@uam.es [Centro de Microanálisis de Materiales, CMAM-UAM, Cantoblanco, Madrid 28049 (Spain); Zucchiatti, A. [Centro de Microanálisis de Materiales, CMAM-UAM, Cantoblanco, Madrid 28049 (Spain)

    2017-03-01

    Highlights: • Extensive survey formation energies Frenkel pairs and electronic stopping thresholds. • Correlation: track formation thresholds and the energies for Frenkel pair formation. • Formation energies Frenkel pairs discussed in relation to the cumulative mechanisms. • Amorphous track formation mechanisms: defect accumulation models versus melting. • Advantages cumulative models to deal with new hot topics: nuclear-electronic synergy. - Abstract: An extensive survey for the formation energies of Frenkel pairs, as representative candidates for radiation-induced point defects, is presented and discussed in relation to the cumulative mechanisms (CM) of track formation in dielectric materials under swift heavy ion (SHI) irradiation. These mechanisms rely on the generation and accumulation of point defects during irradiation followed by collapse of the lattice once a threshold defect concentration is reached. The physical basis of those approaches has been discussed by Fecht as a defect-assisted transition to an amorphous phase. Although a first quantitative analysis of the CM model was previously performed for LiNbO{sub 3} crystals, we have, here, adopted a broader phenomenological approach. It explores the correlation between track formation thresholds and the energies for Frenkel pair formation for a broad range of materials. It is concluded that the threshold stopping powers can be roughly scaled with the energies required to generate a critical Frenkel pair concentration in the order of a few percent of the total atomic content. Finally, a comparison with the predictions of the thermal spike model is discussed within the analytical Szenes approximation.

  5. The RNA binding protein HuR does not interact directly with HIV-1 reverse transcriptase and does not affect reverse transcription in vitro

    Directory of Open Access Journals (Sweden)

    Gronenborn Angela M

    2010-05-01

    Full Text Available Abstract Background Lemay et al recently reported that the RNA binding protein HuR directly interacts with the ribonuclease H (RNase H domain of HIV-1 reverse transcriptase (RT and influences the efficiency of viral reverse transcription (Lemay et al., 2008, Retrovirology 5:47. HuR is a member of the embryonic lethal abnormal vision protein family and contains 3 RNA recognition motifs (RRMs that bind AU-rich elements (AREs. To define the structural determinants of the HuR-RT interaction and to elucidate the mechanism(s by which HuR influences HIV-1 reverse transcription activity in vitro, we cloned and purified full-length HuR as well as three additional protein constructs that contained the N-terminal and internal RRMs, the internal and C-terminal RRMs, or the C-terminal RRM only. Results All four HuR proteins were purified and characterized by biophysical methods. They are well structured and exist as monomers in solution. No direct protein-protein interaction between HuR and HIV-1 RT was detected using NMR titrations with 15N labeled HuR variants or the 15N labeled RNase H domain of HIV-1 RT. Furthermore, HuR did not significantly affect the kinetics of HIV-1 reverse transcription in vitro, even on RNA templates that contain AREs. Conclusions Our results suggest that HuR does not impact HIV-1 replication through a direct protein-protein interaction with the viral RT.

  6. 89Zr-huJ591 immuno-PET imaging in patients with advanced metastatic prostate cancer

    International Nuclear Information System (INIS)

    Pandit-Taskar, Neeta; Solomon, Stephen B.; Durack, Jeremy C.; Carrasquillo, Jorge A.; Lefkowitz, Robert A.; Osborne, Joseph R.; O'Donoghue, Joseph A.; Beylergil, Volkan; Ruan, Shutian; Cheal, Sarah M.; Lyashchenko, Serge; Gonen, Mithat; Lewis, Jason S.; Holland, Jason P.; Reuter, Victor E.; Loda, Massimo F.; Smith-Jones, Peter M.; Weber, Wolfgang A.; Larson, Steven M.; Bander, Neil H.; Scher, Howard I.; Morris, Michael J.

    2014-01-01

    Given the bone tropism of prostate cancer, conventional imaging modalities poorly identify or quantify metastatic disease. 89 Zr-huJ591 positron emission tomography (PET) imaging was performed in patients with metastatic prostate cancer to analyze and validate this as an imaging biomarker for metastatic disease. The purpose of this initial study was to assess safety, biodistribution, normal organ dosimetry, and optimal imaging time post-injection for lesion detection. Ten patients with metastatic prostate cancer received 5 mCi of 89 Zr-huJ591. Four whole-body scans with multiple whole-body count rate measurements and serum activity concentration measurements were obtained in all patients. Biodistribution, clearance, and lesion uptake by 89 Zr-huJ591 immuno-PET imaging was analyzed and dosimetry was estimated using MIRD techniques. Initial assessment of lesion targeting of 89 Zr-huJ591 was done. Optimal time for imaging post-injection was determined. The dose was well tolerated with mild chills and rigors seen in two patients. The clearance of 89 Zr-huJ591 from serum was bi-exponential with biological half-lives of 7 ± 4.5 h (range 1.1-14 h) and 62 ± 13 h (range 51-89 h) for initial rapid and later slow phase. Whole-body biological clearance was 219 ± 48 h (range 153-317 h). The mean whole-body and liver residence time was 78.7 and 25.6 h, respectively. Dosimetric estimates to critical organs included liver 7.7 ± 1.5 cGy/mCi, renal cortex 3.5 ± 0.4 cGy/mCi, and bone marrow 1.2 ± 0.2 cGy/mCi. Optimal time for patient imaging after injection was 7 ± 1 days. Lesion targeting of bone or soft tissue was seen in all patients. Biopsies were performed in 8 patients for a total 12 lesions, all of which were histologically confirmed as metastatic prostate cancer. One biopsy-proven lesion was not positive on 89 Zr-huJ591, while the remaining 11 lesions were 89 Zr-huJ591 positive. Two biopsy-positive nodal lesions were noted only on 89 Zr-huJ591 study, while the

  7. {sup 89}Zr-huJ591 immuno-PET imaging in patients with advanced metastatic prostate cancer

    Energy Technology Data Exchange (ETDEWEB)

    Pandit-Taskar, Neeta; Solomon, Stephen B.; Durack, Jeremy C.; Carrasquillo, Jorge A.; Lefkowitz, Robert A.; Osborne, Joseph R. [Memorial Sloan Kettering Cancer Center, Department of Radiology, New York, NY (United States); Weill Cornell Medical College, Department of Radiology, New York, NY (United States); O' Donoghue, Joseph A. [Memorial Sloan Kettering Cancer Center, Department of Medical Physics, New York, NY (United States); Beylergil, Volkan; Ruan, Shutian; Cheal, Sarah M. [Memorial Sloan Kettering Cancer Center, Department of Radiology, New York, NY (United States); Lyashchenko, Serge [Memorial Sloan Kettering Cancer Center, Department of Radiochemistry and Molecular Imaging Probes Core, New York, NY (United States); Gonen, Mithat [Memorial Sloan Kettering Cancer Center, Department of Epidemiology and Biostatistics, New York, NY (United States); Lewis, Jason S. [Memorial Sloan Kettering Cancer Center, Department of Radiology, New York, NY (United States); Memorial Sloan Kettering Cancer Center, Department of Radiochemistry and Molecular Imaging Probes Core, New York, NY (United States); Memorial Sloan Kettering Cancer Center, Program in Molecular Pharmacology and Chemistry, New York, NY (United States); Weill Cornell Medical College, Department of Radiology, New York, NY (United States); Holland, Jason P. [Memorial Sloan Kettering Cancer Center, Department of Radiology, New York, NY (United States); Harvard Medical School, Department of Radiology of Massachusetts General Hospital, Boston, MA (United States); Reuter, Victor E. [Memorial Sloan Kettering Cancer Center, Department of Pathology, New York, NY (United States); Weill Cornell Medical College, Department of Pathology, New York, NY (United States); Loda, Massimo F. [Dana-Farber Cancer Institute, Boston, MA (United States); Broad Institute of Harvard and MIT, Cambridge, MA (United States); Smith-Jones, Peter M. [Memorial Sloan Kettering Cancer Center, Department of Radiology, New York, NY (United States); Department of Psychiatry and Behavioral Science of Stony Brook University, Stony Brook, NY (United States); Weber, Wolfgang A.; Larson, Steven M. [Memorial Sloan Kettering Cancer Center, Department of Radiology, New York, NY (United States); Memorial Sloan Kettering Cancer Center, Program in Molecular Pharmacology and Chemistry, New York, NY (United States); Weill Cornell Medical College, Department of Radiology, New York, NY (United States); Bander, Neil H. [Memorial Sloan Kettering Cancer Center, Department of Surgery, New York, NY (United States); Weill Cornell Medical College, Department of Urology, New York, NY (United States); Scher, Howard I.; Morris, Michael J. [Memorial Sloan Kettering Cancer Center, Department of Medicine, New York, NY (United States); Weill Cornell Medical College, Department of Medicine, New York, NY (United States)

    2014-11-15

    Given the bone tropism of prostate cancer, conventional imaging modalities poorly identify or quantify metastatic disease. {sup 89}Zr-huJ591 positron emission tomography (PET) imaging was performed in patients with metastatic prostate cancer to analyze and validate this as an imaging biomarker for metastatic disease. The purpose of this initial study was to assess safety, biodistribution, normal organ dosimetry, and optimal imaging time post-injection for lesion detection. Ten patients with metastatic prostate cancer received 5 mCi of {sup 89}Zr-huJ591. Four whole-body scans with multiple whole-body count rate measurements and serum activity concentration measurements were obtained in all patients. Biodistribution, clearance, and lesion uptake by {sup 89}Zr-huJ591 immuno-PET imaging was analyzed and dosimetry was estimated using MIRD techniques. Initial assessment of lesion targeting of {sup 89}Zr-huJ591 was done. Optimal time for imaging post-injection was determined. The dose was well tolerated with mild chills and rigors seen in two patients. The clearance of {sup 89}Zr-huJ591 from serum was bi-exponential with biological half-lives of 7 ± 4.5 h (range 1.1-14 h) and 62 ± 13 h (range 51-89 h) for initial rapid and later slow phase. Whole-body biological clearance was 219 ± 48 h (range 153-317 h). The mean whole-body and liver residence time was 78.7 and 25.6 h, respectively. Dosimetric estimates to critical organs included liver 7.7 ± 1.5 cGy/mCi, renal cortex 3.5 ± 0.4 cGy/mCi, and bone marrow 1.2 ± 0.2 cGy/mCi. Optimal time for patient imaging after injection was 7 ± 1 days. Lesion targeting of bone or soft tissue was seen in all patients. Biopsies were performed in 8 patients for a total 12 lesions, all of which were histologically confirmed as metastatic prostate cancer. One biopsy-proven lesion was not positive on {sup 89}Zr-huJ591, while the remaining 11 lesions were {sup 89}Zr-huJ591 positive. Two biopsy-positive nodal lesions were noted only on

  8. Characterization of a novel xylanase gene from rumen content of Hu sheep.

    Science.gov (United States)

    Wang, Qian; Luo, Yang; He, Bo; Jiang, Lin-Shu; Liu, Jian-Xin; Wang, Jia-Kun

    2015-12-01

    A novel xylanase gene, xyn-lxy, was cloned from a metagenomic fosmid library, which was previously constructed from the rumen contents of Hu sheep and was functionally characterized in Escherichia coli. The open reading frame was composed of 1923 bp and encoded for 640 amino acids, including a catalytic domain of glycosyl hydrolase family 10 and carbohydrate-binding module 9. The gene showed 97 % identity with uncultured bacterium Contig1552 but low similarity with xylanases from known cellulolytic-degrading microorganisms in the rumen. The recombinant XYN-LXY showed a specific activity of 664.7 U mg(-1). The optimal temperature and pH of the enzyme were 50 °C and 6.0, respectively. Specifically, XYN-LXY was exclusively activated by Mn(2+) among all of the cations and reducing agents tested in this study. An enzymatic hydrolysis assay revealed that XYN-LXY degraded birchwood xylan into xylooligosaccharide with a low degree of polymerization. After incubation for 4 h, the concentration of the dominant product, xylobiose, was 2.297 ± 0.175 mg ml(-1) (74.07 % of total product) followed by xylose with a concentration of 0.656 ± 0.010 mg ml(-1) (21.14 % of total product). The XYN-LXY exhibited deep degradation effects on the xylan substrate, which were rarely observed with endo-xylanase, making it a promising candidate for industrial application, especially in biofuel production.

  9. Feasibility of CBCT-based dose calculation: Comparative analysis of HU adjustment techniques

    International Nuclear Information System (INIS)

    Fotina, Irina; Hopfgartner, Johannes; Stock, Markus; Steininger, Thomas; Lütgendorf-Caucig, Carola; Georg, Dietmar

    2012-01-01

    Background and purpose: The aim of this work was to compare the accuracy of different HU adjustments for CBCT-based dose calculation. Methods and materials: Dose calculation was performed on CBCT images of 30 patients. In the first two approaches phantom-based (Pha-CC) and population-based (Pop-CC) conversion curves were used. The third method (WAB) represents override of the structures with standard densities for water, air and bone. In ROI mapping approach all structures were overridden with average HUs from planning CT. All techniques were benchmarked to the Pop-CC and CT-based plans by DVH comparison and γ-index analysis. Results: For prostate plans, WAB and ROI mapping compared to Pop-CC showed differences in PTV D median below 2%. The WAB and Pha-CC methods underestimated the bladder dose in IMRT plans. In lung cases PTV coverage was underestimated by Pha-CC method by 2.3% and slightly overestimated by the WAB and ROI techniques. The use of the Pha-CC method for head–neck IMRT plans resulted in difference in PTV coverage up to 5%. Dose calculation with WAB and ROI techniques showed better agreement with pCT than conversion curve-based approaches. Conclusions: Density override techniques provide an accurate alternative to the conversion curve-based methods for dose calculation on CBCT images.

  10. Antioxidant and antidermatophytic activities of essential oil and extracts of Metasequoia glyptostroboides Miki ex Hu.

    Science.gov (United States)

    Bajpai, Vivek K; Yoon, Jung In; Chul Kang, Sun

    2009-06-01

    This study was undertaken to assess the antioxidant and antidermatophytic potential of the essential oil and extracts (hexane, chloroform, ethyl acetate and methanol) of Metasequoia glyptostroboides Miki ex Hu. Antioxidant activity was evaluated by using 1,1-diphenyl-2-picrylhydrazyl (DPPH) assay. The free radical scavenging activities of the oil and ethyl acetate extract were found to be superior (IC(50)=9.1 and 14.24 microg/ml, respectively) as compared to butylatedhydroxyanisole (BHA), (IC(50)=18.27 microg/ml). Also the ethyl acetate extract revealed the highest phenolic contents (93.26 mg/g of dry wt) as compared to the other extracts. Further, oil (1250 microg/disc) and extracts (1750 microg/disc) revealed 35.33-67.66 and 18.0-53.3% antidermatophytic effect, respectively, along with their respective MIC values (62.5-500 and 250-4000 microg/ml) against Trichophyton rubrum KCTC 6345, T. rubrum KCTC 6375, T. rubrum KCTC 6352, T. mentagrophytes KCTC 6085, T. mentagrophytes KCTC 6077, T. mentagrophytes KCTC 6316, Microsporum canis KCTC 6591, M. canis KCTC 6348 and M. canis KCTC 6349. The oil also had a strong detrimental effect on spore germination as well as concentration and time-dependent kinetic inhibition of M. canis KCTC 6591.

  11. La huída en la obra de Mario Vargas Llosa

    Directory of Open Access Journals (Sweden)

    German Arce Ross

    Full Text Available Se trata de poner en perspectiva la mayor parte de novelas de Mario Vargas Llosa en función del tema de la huída, partiendo del hecho que é1 solicitó la nacionalidad Española inmediatamente después de haber perdido las elecciones para la Presidencia del Perú y de haber escrito El pez en el agua. Nuestro análisis intenta demostrar la importancia de la figura paterna – principalmente en el sentido de su ausencia y de sus bruscas reapariciones – en la cristalización sintomática del tema de la fuga. Es por eso que una analogía con la posición fóbica, en relación al padre o a sus substitutos, nos ha parecido pertinente. Teniendo como pivot el análisis de la forma, del contexto y del contenido de su libro de memorias, este trabajo definiría así las bases de una contribución literaria de la obra de Vargas Llosa a la clinica de la fobia.

  12. Systematics of a kleptoplastidal dinoflagellate, Gymnodinium eucyaneum Hu (Dinophyceae), and its cryptomonad endosymbiont.

    Science.gov (United States)

    Xia, Shuang; Zhang, Qi; Zhu, Huan; Cheng, Yingyin; Liu, Guoxiang; Hu, Zhengyu

    2013-01-01

    New specimens of the kleptoplastidal dinoflagellate Gymnodinium eucyaneum Hu were collected in China. We investigated the systematics of the dinoflagellate and the origin of its endosymbiont based on light morphology and phylogenetic analyses using multiple DNA sequences. Cells were dorsoventrally flattened with a sharply acute hypocone and a hemispherical epicone. The confusion between G. eucyaneum and G. acidotum Nygaard still needs to be resolved. We found that the hypocone was conspicuously larger than the epicone in most G. eucyaneum cells, which differed from G. acidotum, but there were a few cells whose hypocone and epicone were of nearly the same size. In addition, there was only one site difference in the partial nuclear LSU rDNA sequences of a sample from Japan given the name G. acidotum and G. eucyaneum in the present study, which suggest that G. eucyaneum may be a synonym of G. acidotum. Spectroscopic analyses and phylogenetic analyses based on nucleomorph SSU rDNA sequences and chloroplast 23 s rDNA sequences suggested that the endosymbiont of G. eucyaneum was derived from Chroomonas (Cryptophyta), and that it was most closely related to C. coerulea Skuja. Moreover, the newly reported kleptoplastidal dinoflagellates G. myriopyrenoides and G. eucyaneum in our study were very similar, and the taxonomy of kleptoplastidal dinoflagellates was discussed.

  13. Systematics of a kleptoplastidal dinoflagellate, Gymnodinium eucyaneum Hu (Dinophyceae, and its cryptomonad endosymbiont.

    Directory of Open Access Journals (Sweden)

    Shuang Xia

    Full Text Available New specimens of the kleptoplastidal dinoflagellate Gymnodinium eucyaneum Hu were collected in China. We investigated the systematics of the dinoflagellate and the origin of its endosymbiont based on light morphology and phylogenetic analyses using multiple DNA sequences. Cells were dorsoventrally flattened with a sharply acute hypocone and a hemispherical epicone. The confusion between G. eucyaneum and G. acidotum Nygaard still needs to be resolved. We found that the hypocone was conspicuously larger than the epicone in most G. eucyaneum cells, which differed from G. acidotum, but there were a few cells whose hypocone and epicone were of nearly the same size. In addition, there was only one site difference in the partial nuclear LSU rDNA sequences of a sample from Japan given the name G. acidotum and G. eucyaneum in the present study, which suggest that G. eucyaneum may be a synonym of G. acidotum. Spectroscopic analyses and phylogenetic analyses based on nucleomorph SSU rDNA sequences and chloroplast 23 s rDNA sequences suggested that the endosymbiont of G. eucyaneum was derived from Chroomonas (Cryptophyta, and that it was most closely related to C. coerulea Skuja. Moreover, the newly reported kleptoplastidal dinoflagellates G. myriopyrenoides and G. eucyaneum in our study were very similar, and the taxonomy of kleptoplastidal dinoflagellates was discussed.

  14. Pathological brain detection based on wavelet entropy and Hu moment invariants.

    Science.gov (United States)

    Zhang, Yudong; Wang, Shuihua; Sun, Ping; Phillips, Preetha

    2015-01-01

    With the aim of developing an accurate pathological brain detection system, we proposed a novel automatic computer-aided diagnosis (CAD) to detect pathological brains from normal brains obtained by magnetic resonance imaging (MRI) scanning. The problem still remained a challenge for technicians and clinicians, since MR imaging generated an exceptionally large information dataset. A new two-step approach was proposed in this study. We used wavelet entropy (WE) and Hu moment invariants (HMI) for feature extraction, and the generalized eigenvalue proximal support vector machine (GEPSVM) for classification. To further enhance classification accuracy, the popular radial basis function (RBF) kernel was employed. The 10 runs of k-fold stratified cross validation result showed that the proposed "WE + HMI + GEPSVM + RBF" method was superior to existing methods w.r.t. classification accuracy. It obtained the average classification accuracies of 100%, 100%, and 99.45% over Dataset-66, Dataset-160, and Dataset-255, respectively. The proposed method is effective and can be applied to realistic use.

  15. Managing Stability in the Taiwan Strait: Non-Military Policy towards Taiwan under Hu Jintao

    Directory of Open Access Journals (Sweden)

    Wu-ueh Chang

    2009-10-01

    Full Text Available China’s Taiwan policy has been one of coupling intimidation (the “stick” approach with coercion (the “carrot” approach, a policy mix which, in the near term, is not likely to change, as is evidenced by the passage of the “Anti-Secession Law” in March, 2005. However, under Hu Jintao, the focus has been on pragmatism. The warm atmosphere that presently reigns in the Taiwan Strait area is unprecedented. Further talks are expected before the two cross-Strait leaders are slated to step down, simultaneously, in 2012. An era of reconciliation and negotiations has dawned. For the first time there is consensus regarding norms of interaction between the two sides. Cross-Strait relations have stabilized after years of tumult. More open, stable and predictable cross-Strait relations are in the interests of both sides. Difficulties surely lie ahead, but they will be dealt with in a different manner than what has been witnessed in the past.

  16. Effect of SHI irradiation on structural, surface morphological and optical studies of CVT grown ZnSSe single crystals

    International Nuclear Information System (INIS)

    Kannappan, P.; Asokan, K.; Krishna, J.B.M.; Dhanasekaran, R.

    2013-01-01

    Highlights: •CVT grown ZnSSe single crystals were irradiated with 120 MeV Au ion. •The GIXRD results show the FWHM increases with increasing ion fluency. •The AFM study show the surface roughness increases with ion fluency. •The optical band gap energy vary with increasing ion fluency. •The PL emission decreases with increasing ion fluency. -- Abstract: The ZnSSe single crystals grown by chemical vapour transport (CVT) method have been irradiated by 120 MeV Au 9+ ions at room temperature with fluences of 1 × 10 12 and 5 × 10 12 ions/cm 2 . The grazing incidence X-ray diffraction (GIXRD) results show that the full width at half maximum (FWHM) value for the as grown ZnSSe crystal is 0.215°; and for the irradiated samples, the FWHM values are 0.413° and 0.625°, with the increase of ion fluences. The atomic force microscopy (AFM) studies reveal the formation of the pits and islands due to irradiation. The optical absorption cut off wavelength is found to be 441 nm for as grown ZnSSe crystal. The cut off values are increased to 447 nm and 457 nm for the irradiated samples with increasing ion fluency. The photoluminescence studies show the emission for the as grown ZnSSe is 590 nm whereas for the irradiated samples in the emission range it is 580–590 nm and 575–595 nm due to SHI irradiation. FT-Raman spectra analysis has been made for the ZnSSe single crystals and irradiated samples. The results are discussed in detail

  17. Effect of SHI irradiation on structural, surface morphological and optical studies of CVT grown ZnSSe single crystals

    Energy Technology Data Exchange (ETDEWEB)

    Kannappan, P. [Crystal Growth Centre, Anna University, Chennai 600 025 (India); Asokan, K. [Inter University Accelerator Centre, Aruna Asaf Ali Marg, New Delhi 110 067 (India); Krishna, J.B.M. [UGC-DAE Consortium for Scientific Research, III-/LB-8, Bidhan nagar, Kolkata 700 098 (India); Dhanasekaran, R., E-mail: rdcgc@yahoo.com [Crystal Growth Centre, Anna University, Chennai 600 025 (India)

    2013-12-15

    Highlights: •CVT grown ZnSSe single crystals were irradiated with 120 MeV Au ion. •The GIXRD results show the FWHM increases with increasing ion fluency. •The AFM study show the surface roughness increases with ion fluency. •The optical band gap energy vary with increasing ion fluency. •The PL emission decreases with increasing ion fluency. -- Abstract: The ZnSSe single crystals grown by chemical vapour transport (CVT) method have been irradiated by 120 MeV Au{sup 9+} ions at room temperature with fluences of 1 × 10{sup 12} and 5 × 10{sup 12} ions/cm{sup 2}. The grazing incidence X-ray diffraction (GIXRD) results show that the full width at half maximum (FWHM) value for the as grown ZnSSe crystal is 0.215°; and for the irradiated samples, the FWHM values are 0.413° and 0.625°, with the increase of ion fluences. The atomic force microscopy (AFM) studies reveal the formation of the pits and islands due to irradiation. The optical absorption cut off wavelength is found to be 441 nm for as grown ZnSSe crystal. The cut off values are increased to 447 nm and 457 nm for the irradiated samples with increasing ion fluency. The photoluminescence studies show the emission for the as grown ZnSSe is 590 nm whereas for the irradiated samples in the emission range it is 580–590 nm and 575–595 nm due to SHI irradiation. FT-Raman spectra analysis has been made for the ZnSSe single crystals and irradiated samples. The results are discussed in detail.

  18. Bridging the Divide: Literature, Dao and the Case for Subjective Access in the Thought of Su Shi

    Directory of Open Access Journals (Sweden)

    Curie Virág

    2014-10-01

    Full Text Available In the 11th century in China, there was an unusual moment in which a number of philosophers, later associated with the Daoxue—or Neo-Confucian—school, confronted what they perceived as a long-standing sense of disjunction between inner, subjective reality and the structured patterns of the cosmos. One way they sought to overcome this disjunction was by positing new theories of the cosmos that focused on the underlying, shared reality behind the myriad differentiations of phenomena. A potential tension was born that affected how thinkers understood the relationship between wen 文 (writing, literature, culture and Dao 道 (the cosmic process, the ultimate reality, the normative path. Some thinkers, like Zhou Dunyi 周敦頤 (1017–1073, believed that wen was simply a vehicle for carrying the Dao, and was thus, implicitly, dispensable. This idea was met with resistance from one of the leading intellectual figures of the time—the philosopher, poet and statesman Su Shi 蘇軾 (1037–1101. While some of Su’s contemporaries, in their attempts to demonstrate that the world was real, and that truth was knowable, downplayed the role of individual experience and perception, Su stressed the necessity of subjective, individual experience as giving access, and concrete expression, to Dao. Su’s philosophical project came in the form of defending the enterprise of wen—writing as a creative, individual endeavor—and asserting that the quest for unity with the Dao could only be realized through direct, personal engagement in wen and other forms of meaningful practice. Through his philosophy of wen, Su sought to show that the search for truth, meaning and order did not—and could not—be achieved by transcending subjective experience. Instead, it had to be carried out at the point of encounter between self and the world, in the realm of practice.

  19. Supplier evaluation system of the wood processing enterprise in the region of the CZ, SK, HU and AT

    OpenAIRE

    Muselíková, Vladislava

    2015-01-01

    The Bachelor thesis Supplier evaluation system of the wood processing enterprise in the region of the CR, the SK, HU and AT deals with the analysis of the current supplier evaluation system in IKEA Industry company in Malacky. The theoretical part is based on literature review and contains a description of the purchasing process and methodology for selection and evaluation of suppliers. The practical part is devoted to the analysis of the Supplier Classification in IKEA. The main output of th...

  20. HTLV-1 Infection and Neuropathogenesis in the Context of Rag1-/-γc-/- (RAG1-Hu) and BLT Mice.

    Science.gov (United States)

    Ginwala, Rashida; Caruso, Breanna; Khan, Zafar K; Pattekar, Ajinkya; Chew, Glen M; Corley, Michael J; Loonawat, Ronak; Jacobson, Steven; Sreedhar, Sreesha; Ndhlovu, Lishomwa C; Jain, Pooja

    2017-09-01

    To date, the lack of a suitable small animal model has hindered our understanding of Human T-cell lymphotropic virus (HTLV)-1 chronic infection and associated neuropathogenesis defined as HTLV-1-associated myelopathy/tropical spastic paraparesis (HAM/TSP). The host immune response plays a critical role in the outcome of HTLV-1 infection, which could be better tested in the context of humanized (hu) mice. Thus, we employ here the Balb/c-Rag1 -/- γc -/- or Rag1 as well as Bone marrow-Liver-Thymic (BLT) mouse models for engraftment of human CD34 + hematopoietic stem cells. Flow cytometry and histological analyses confirmed reconstitution of Rag1 and BLT mice with human immune cells. Following HTLV-1 infection, proviral load (PVL) was detected in the blood of Rag-1 and BLT hu-mice as early as 2 weeks post-infection (wpi) with sustained elevation in the subsequent weeks followed by Tax expression. Additionally, infection was compared between adult and neonatal Rag1 mice with both PVL and Tax expression considerably higher in the adult Rag1 mice as compared to the neonates. Establishment of peripheral infection led to lymphocytic infiltration with concomitant Tax expression and resulting myelin disruption within the central nervous system of infected mice. In addition, up-regulation in the expression of several immune checkpoint mediators such as programmed cell death-1 (PD-1), T-cell Ig and ITIM domain (TIGIT), and T cell Ig and mucin domain-3 protein (Tim-3) were observed on CD8 + T cells in various organs including the CNS of infected hu-mice. Collectively, these studies represent the first attempt to establish HTLV-1 neuropathogenesis in the context of Rag-1 and BLT hu-mice as potential novel tools for understanding HTLV-1 neuropathogenesis and testing of novel therapies such as immune checkpoint blockade in the amelioration of chronic HTLV-1 infection.

  1. Tra stabilità sociale e pornografia: giochi di parole sovversivi e armonizzazione su Internet nell’era Hu Jintao

    Directory of Open Access Journals (Sweden)

    Nazarena Fazzari

    2017-07-01

    Full Text Available The purpose of this paper is to analyze the policies adopted by the government of Hu Jintao (2002-2012 about the Internet. Such laws have been partially translated into Italian. Their aim alternates between the fight against pornography and the protection of social stability. The ‘digital resistance’ attempts to evade censorship through homophony, e.g. through the Baidu ten mythical creatures, the most famous being Caonima.

  2. HuD and the Survival Motor Neuron Protein Interact in Motoneurons and Are Essential for Motoneuron Development, Function, and mRNA Regulation.

    Science.gov (United States)

    Hao le, Thi; Duy, Phan Q; An, Min; Talbot, Jared; Iyer, Chitra C; Wolman, Marc; Beattie, Christine E

    2017-11-29

    Motoneurons establish a critical link between the CNS and muscles. If motoneurons do not develop correctly, they cannot form the required connections, resulting in movement defects or paralysis. Compromised development can also lead to degeneration because the motoneuron is not set up to function properly. Little is known, however, regarding the mechanisms that control vertebrate motoneuron development, particularly the later stages of axon branch and dendrite formation. The motoneuron disease spinal muscular atrophy (SMA) is caused by low levels of the survival motor neuron (SMN) protein leading to defects in vertebrate motoneuron development and synapse formation. Here we show using zebrafish as a model system that SMN interacts with the RNA binding protein (RBP) HuD in motoneurons in vivo during formation of axonal branches and dendrites. To determine the function of HuD in motoneurons, we generated zebrafish HuD mutants and found that they exhibited decreased motor axon branches, dramatically fewer dendrites, and movement defects. These same phenotypes are present in animals expressing low levels of SMN, indicating that both proteins function in motoneuron development. HuD binds and transports mRNAs and one of its target mRNAs, Gap43 , is involved in axonal outgrowth. We found that Gap43 was decreased in both HuD and SMN mutants. Importantly, transgenic expression of HuD in motoneurons of SMN mutants rescued the motoneuron defects, the movement defects, and Gap43 mRNA levels. These data support that the interaction between SMN and HuD is critical for motoneuron development and point to a role for RBPs in SMA. SIGNIFICANCE STATEMENT In zebrafish models of the motoneuron disease spinal muscular atrophy (SMA), motor axons fail to form the normal extent of axonal branches and dendrites leading to decreased motor function. SMA is caused by low levels of the survival motor neuron (SMN) protein. We show in motoneurons in vivo that SMN interacts with the RNA binding

  3. A Conjugated Aptamer-Gold Nanoparticle Fluorescent Probe for Highly Sensitive Detection of rHuEPO-α

    Directory of Open Access Journals (Sweden)

    Zhaoyang Zhang

    2011-11-01

    Full Text Available We present here a novel conjugated aptamer-gold nanoparticle (Apt-AuNPs fluorescent probe and its application for specific detection of recombinant human erythropoietin-α (rHuEPO-α. In this nanobiosensor, 12 nm AuNPs function as both a nano-scaffold and a nano-quencher (fluorescent energy acceptor, on the surface of which the complementary sequences are linked (as cODN-AuNPs and pre-hybridized with carboxymethylfluorescein (FAM-labeled anti-rHuEPO-α aptamers. Upon target protein binding, the aptamers can be released from the AuNP surface and the fluorescence signal is restored. Key variables such as the length of linker, the hybridization site and length have been designed and optimized. Full performance evaluation including sensitivity, linear range and interference substances are also described. This nanobiosensor provides a promising approach for a simple and direct quantification of rHuEPO-α concentrations as low as 0.92 nM within a few hours.

  4. Comment on "Tropospheric temperature response to stratospheric ozone recovery in the 21st century" by Hu et al. (2011

    Directory of Open Access Journals (Sweden)

    C. McLandress

    2012-03-01

    Full Text Available In a recent paper Hu et al. (2011 suggest that the recovery of stratospheric ozone during the first half of this century will significantly enhance free tropospheric and surface warming caused by the anthropogenic increase of greenhouse gases, with the effects being most pronounced in Northern Hemisphere middle and high latitudes. These surprising results are based on a multi-model analysis of CMIP3 model simulations with and without prescribed stratospheric ozone recovery. Hu et al. suggest that in order to properly quantify the tropospheric and surface temperature response to stratospheric ozone recovery, it is necessary to run coupled atmosphere-ocean climate models with stratospheric ozone chemistry. The results of such an experiment are presented here, using a state-of-the-art chemistry-climate model coupled to a three-dimensional ocean model. In contrast to Hu et al., we find a much smaller Northern Hemisphere tropospheric temperature response to ozone recovery, which is of opposite sign. We suggest that their result is an artifact of the incomplete removal of the large effect of greenhouse gas warming between the two different sets of models.

  5. HuR and GRSF1 modulate the nuclear export and mitochondrial localization of the lncRNA RMRP

    Science.gov (United States)

    Noh, Ji Heon; Kim, Kyoung Mi; Abdelmohsen, Kotb; Yoon, Je-Hyun; Panda, Amaresh C.; Munk, Rachel; Kim, Jiyoung; Curtis, Jessica; Moad, Christopher A.; Wohler, Christina M.; Indig, Fred E.; de Paula, Wilson; Dudekula, Dawood B.; De, Supriyo; Piao, Yulan; Yang, Xiaoling; Martindale, Jennifer L.; de Cabo, Rafael; Gorospe, Myriam

    2016-01-01

    Some mitochondrial long noncoding RNAs (lncRNAs) are encoded by nuclear DNA, but the mechanisms that mediate their transport to mitochondria are poorly characterized. Using affinity RNA pull-down followed by mass spectrometry analysis, we found two RNA-binding proteins (RBPs), HuR (human antigen R) and GRSF1 (G-rich RNA sequence-binding factor 1), that associated with the nuclear DNA-encoded lncRNA RMRP and mobilized it to mitochondria. In cultured human cells, HuR bound RMRP in the nucleus and mediated its CRM1 (chromosome region maintenance 1)-dependent export to the cytosol. After RMRP was imported into mitochondria, GRSF1 bound RMRP and increased its abundance in the matrix. Loss of GRSF1 lowered the mitochondrial levels of RMRP, in turn suppressing oxygen consumption rates and modestly reducing mitochondrial DNA replication priming. Our findings indicate that RBPs HuR and GRSF1 govern the cytoplasmic and mitochondrial localization of the lncRNA RMRP, which is encoded by nuclear DNA but has key functions in mitochondria. PMID:27198227

  6. Publicidad y consumo de alimentos en estudiantes de Huánuco (Perú

    Directory of Open Access Journals (Sweden)

    María Luisa Sevillano García

    2012-10-01

    Full Text Available Las importantes carencias nutritivas apreciadas en estudiantes del distrito de Huánuco (Perú, junto con la publicidad televisiva de productos de dudosa calidad nutricional observada, nos llevó a plantear y desarrollar una investigación con el objeto de analizar la relación entre ambos fenómenos titulada: Influencia de los anuncios televisivos en el consumo de alimentos publicitados durante el 2010, cuyo resumen se presenta en este artículo. En la investigación planteamos un estudio correlacional con una muestra de 120 escolares de diversas instituciones educativas, a quienes se aplicaron satisfactoriamente encuestas, entrevistas y guía de evaluación física; también se analizó la publicidad emitida por los canales de televisión sobre alimentos y su contenido nutricional. El análisis inferencial aplicado fue Ji cuadrado (?2. Con esta investigación se ha demostrado que el estado de salud de los escolares está afectado, siendo muy agudo respecto a la caries dental, problema que se atribuye al consumo de ciertos alimentos. Se constata que existe relación positiva, con alta significancia estadística, entre la adherencia a los anuncios televisivos y el consumo de alimentos publicitados de alto contenido en sodio, calcio, azúcar y de calorías por los escolares estudiados; así mismo, se prueba la interdependencia entre la exposición a los anuncios televisivos y el consumo de alimentos con productos de alto contenido en grasa que merecen ser vigilados y controlados por los responsables.

  7. ZASTOSOWANIE FUNKCJONAŁU HU-WASHIZU W PLASTYCZNEJ ANALIZIE MES PŁYT GRUBYCH

    Directory of Open Access Journals (Sweden)

    Jakub LEWANDOWSKI

    2016-07-01

    Full Text Available W pracy sformułowano oryginalny, autorski funkcjonał dla zagadnień teorii plastyczności. Podstawą był funkcjonał Hu-Washizu z teorii sprężystości. Przyrostowa postać funkcjonału pozwala w prosty sposób budować algorytmy MES. Zastosowanie funkcjonału przedstawiono na przykładzie płyty grubej. Zastosowano model warstwowy aby uwzględnić częściowe uplastycznienie przekroju płyty. Algorytm MES dla płyty grubej zbudowano w oparciu o trójkątny trzy węzłowy element skończony z liniowymi funkcjami kształtu dla wszystkich przemieszczeń uogólnionych. Naprężenia i odkształcenia w tego typu elemencie przyjmuje się jako stałe. Przedstawiony algorytm nie wymaga żadnych dodatkowych równań teorii plastyczności i jest równoważny stowarzyszonemu prawu płynięcia plastycznego. Algorytm prowadzi do nieliniowego, przyrostowego układu równań algebraicznych, który rozwiązuje się metodą Newtona. Kilka prostych przykładów pozytywnie weryfikuje przyjęte założenia i stosowane algorytmy.

  8. Effects of Bai-Hu decoction on fever induced by lipopolysaccharide

    Directory of Open Access Journals (Sweden)

    Li-Long Jia

    2013-03-01

    Full Text Available This study was designed to investigate the antifebrile effect and mechanisms of Bai-Hu decoction (BHD, a traditional Chinese medical (TCM prescription. The rabbits used in this study received an intravenous injection of lipopolysaccharide (LPS after being orally administered with BHD, ibuprofen, or saline, and their rectal temperatures were monitored by a copper–constantan thermocouple. Concentrations of interleukin-1 beta (IL-1β and tumor necrosis factor alpha (TNF-α in serum and hypothalamus were assayed using the commercially available rabbit IL-1β and TNF-α enzyme-linked immunosorbent assay kits following the manufacturer’s instructions. The BHD treatment group exhibited a significant fall in body temperature in both peaks compared with the LPS group (p<0.05. BHD reduced the concentrations of IL-1β and TNF-α in serum, and of TNF-α in hypothalamus to control the febrile responses at 1 hour. Besides the levels of IL-1β in hypothalamus and serum, the concentration of TNF-α in hypothalamus was decreased remarkably in the BHD group than in the LPS group at 3 hours. The main findings, the partial mechanisms of BHD in reducing biphasic fever elicited by LPS, were that treatments with the crude extract of BHD could remarkably reduce the increased concentrations of IL-1β and TNF-α, not only in serum but also in hypothalamus. The results indicated that BHD would be a valuable candidate for further investigation as a traditional antifebrile and anti-inflammatory natural drug.

  9. Critical experiments on low-enriched uranium oxide system with H/U=1.25

    International Nuclear Information System (INIS)

    Oh, I.; Rothe, R.E.; Tuck, G.

    1982-01-01

    Fifteen (15) critical experiments were performed on a horizontal split table machine using 4.48%-enriched sup(235)U uranium oxide(U 3 O 8 ). The oxide was compacted to a density of 4.68g/cm 3 and placed in 152 mm cubical aluminum cans. Water was added to achive an H/U of 1.25. Various arrays of oxide cans were distributed on each half of the split table, and the separation between halves reduced until criticality occurred. The critical table separation varied from 3.59 mm to 18.40 mm. Twelve (12) experiments required the addition of a high-enriched(-93 %sup(235)U) metal or solution driver to achieve criticality. These experiments were performed in a plastic, concrete, or thin steel reflector. Three additional experiments in the plastic reflector contained either 9.3-mm- or 24.3-mm-thick plastic moderator material between the oxide cans and did not require a driver to achieve criticality. Critical uranium driver masses ranged from 9.999 kg to 14.000 kg (solution driver), and from 25.378 kg to 29.278 kg (metal driver) for 5X5X5 arrays of uranium oxide cans. Always, one or four of these 125 cans had to be removed to make room for the drivers. Therefore, the uranium oxide masses used were 1823.8 kg and 1863.5 kg. For the moderated experiments, the uranium oxide mass ranged between 574.4 kg and 1210.0 kg. (Author)

  10. HuMiTar: A sequence-based method for prediction of human microRNA targets

    Directory of Open Access Journals (Sweden)

    Chen Ke

    2008-12-01

    Full Text Available Abstract Background MicroRNAs (miRs are small noncoding RNAs that bind to complementary/partially complementary sites in the 3' untranslated regions of target genes to regulate protein production of the target transcript and to induce mRNA degradation or mRNA cleavage. The ability to perform accurate, high-throughput identification of physiologically active miR targets would enable functional characterization of individual miRs. Current target prediction methods include traditional approaches that are based on specific base-pairing rules in the miR's seed region and implementation of cross-species conservation of the target site, and machine learning (ML methods that explore patterns that contrast true and false miR-mRNA duplexes. However, in the case of the traditional methods research shows that some seed region matches that are conserved are false positives and that some of the experimentally validated target sites are not conserved. Results We present HuMiTar, a computational method for identifying common targets of miRs, which is based on a scoring function that considers base-pairing for both seed and non-seed positions for human miR-mRNA duplexes. Our design shows that certain non-seed miR nucleotides, such as 14, 18, 13, 11, and 17, are characterized by a strong bias towards formation of Watson-Crick pairing. We contrasted HuMiTar with several representative competing methods on two sets of human miR targets and a set of ten glioblastoma oncogenes. Comparison with the two best performing traditional methods, PicTar and TargetScanS, and a representative ML method that considers the non-seed positions, NBmiRTar, shows that HuMiTar predictions include majority of the predictions of the other three methods. At the same time, the proposed method is also capable of finding more true positive targets as a trade-off for an increased number of predictions. Genome-wide predictions show that the proposed method is characterized by 1.99 signal

  11. DNA clasping by mycobacterial HU: the C-terminal region of HupB mediates increased specificity of DNA binding.

    Directory of Open Access Journals (Sweden)

    Sandeep Kumar

    Full Text Available BACKGROUND: HU a small, basic, histone like protein is a major component of the bacterial nucleoid. E. coli has two subunits of HU coded by hupA and hupB genes whereas Mycobacterium tuberculosis (Mtb has only one subunit of HU coded by ORF Rv2986c (hupB gene. One noticeable feature regarding Mtb HupB, based on sequence alignment of HU orthologs from different bacteria, was that HupB(Mtb bears at its C-terminal end, a highly basic extension and this prompted an examination of its role in Mtb HupB function. METHODOLOGY/PRINCIPAL FINDINGS: With this objective two clones of Mtb HupB were generated; one expressing full length HupB protein (HupB(Mtb and another which expresses only the N terminal region (first 95 amino acid of hupB (HupB(MtbN. Gel retardation assays revealed that HupB(MtbN is almost like E. coli HU (heat stable nucleoid protein in terms of its DNA binding, with a binding constant (K(d for linear dsDNA greater than 1000 nM, a value comparable to that obtained for the HUalphaalpha and HUalphabeta forms. However CTR (C-terminal Region of HupB(Mtb imparts greater specificity in DNA binding. HupB(Mtb protein binds more strongly to supercoiled plasmid DNA than to linear DNA, also this binding is very stable as it provides DNase I protection even up to 5 minutes. Similar results were obtained when the abilities of both proteins to mediate protection against DNA strand cleavage by hydroxyl radicals generated by the Fenton's reaction, were compared. It was also observed that both the proteins have DNA binding preference for A:T rich DNA which may occur at the regulatory regions of ORFs and the oriC region of Mtb. CONCLUSIONS/SIGNIFICANCE: These data thus point that HupB(Mtb may participate in chromosome organization in-vivo, it may also play a passive, possibly an architectural role.

  12. Regional asymmetry of metabolic and antioxidant profile in the sciaenid fish shi drum (Umbrina cirrosa white muscle. Response to starvation and refeeding

    Directory of Open Access Journals (Sweden)

    M. Carmen Hidalgo

    2017-04-01

    Full Text Available The objective of the present study is to characterize the metabolic and antioxidant profile of white muscle of shi drum in two sites of the body, anterior dorsal (AM and posterior dorsal (PM portions. In addition, it will be analyzed the possible effect of starvation and a subsequent refeeding, with two different protocols, pair feeding and ad libitum. Activities of key enzymes of intermediary metabolism and of antioxidant enzymes, as well as lipid peroxidation, as an index of oxidative stress, were evaluated. The results indicate the existence of a regional asymmetry of the metabolic capacities of the white muscle of shi drum, which is likely related to the different contribution to swimming of the body regions examined. Starvation induces a metabolic depression that is more marked in those activities that support burst swimming in PM, while those activities supporting maintenance requirements are conserved. The greatest energy demands during starvation appear to lie in AM, which showed the highest oxidative metabolism rate. The increased use of fatty acids as energy source for AM leads to oxidative stress. A period of more than four weeks of refeeding for full restoration of metabolic capacities in AM is needed, probably related to the higher muscle mass located in this region. On the contrary, all enzyme activities in PM returned to control levels in both refeeding protocols, but pair feeding seems to be advantageous since compensatory growth has been taking place without signs of oxidative stress. This work was addressed to gain knowledge on the physiology of a promising fish species in aquaculture like shi drum. The results displayed here show how the starving and further re-feeding events could generate oxidative stress situations characterized by high lipid peroxidation levels which may influence negatively on the quality of the edible part of the fish. This study opens an interesting field on this fish species which deserves being

  13. miR-29b, miR-205 and miR-221 enhance chemosensitivity to gemcitabine in HuH28 human cholangiocarcinoma cells.

    Directory of Open Access Journals (Sweden)

    Kinya Okamoto

    Full Text Available BACKGROUND AND AIMS: Cholangiocarcinoma (CCA is highly resistant to chemotherapy, including gemcitabine (Gem treatment. MicroRNAs (miRNAs are endogenous, non-coding, short RNAs that can regulate multiple genes expression. Some miRNAs play important roles in the chemosensitivity of tumors. Here, we examined the relationship between miRNA expression and the sensitivity of CCA cells to Gem. METHODS: Microarray analysis was used to determine the miRNA expression profiles of two CCA cell lines, HuH28 and HuCCT1. To determine the effect of candidate miRNAs on Gem sensitivity, expression of each candidate miRNA was modified via either transfection of a miRNA mimic or transfection of an anti-oligonucleotide. Ontology-based programs were used to identify potential target genes of candidate miRNAs that were confirmed to affect the Gem sensitivity of CCA cells. RESULTS: HuCCT1 cells were more sensitive to Gem than were HuH28 cells, and 18 miRNAs were differentially expressed whose ratios over ± 2log2 between HuH28 and HuCCT1. Among these 18 miRNAs, ectopic overexpression of each of three downregulated miRNAs in HuH28 (miR-29b, miR-205, miR-221 restored Gem sensitivity to HuH28. Suppression of one upregulated miRNA in HuH28, miR-125a-5p, inhibited HuH28 cell proliferation independently to Gem treatment. Selective siRNA-mediated downregulation of either of two software-predicted targets, PIK3R1 (target of miR-29b and miR-221 or MMP-2 (target of miR-29b, also conferred Gem sensitivity to HuH28. CONCLUSIONS: miRNA expression profiling was used to identify key miRNAs that regulate Gem sensitivity in CCA cells, and software that predicts miRNA targets was used to identify promising target genes for anti-tumor therapies.

  14. Effect of the synthetic cannabinoid HU-210 on quorum sensing and on the production of quorum sensing-mediated virulence factors by Vibrio harveyi

    OpenAIRE

    Soni, Divya; Smoum, Reem; Breuer, Aviva; Mechoulam, Raphael; Steinberg, Doron

    2015-01-01

    Background Bacterial populations communicate through the cell density-dependent mechanism of quorum sensing (QS). Vibrio harveyi, one of the best studied model organisms for QS, was used to explore effects of the synthetic cannabinoid HU-210 on QS and different QS-regulated physiological processes in bacteria. Results Analysis of QS-regulated bioluminescence in wild-type and mutant strains of V. harveyi revealed that HU-210 affects the autoinducer-2 (AI-2) pathway, one of three known QS casca...

  15. Once Bitten, Twice Shy

    DEFF Research Database (Denmark)

    Andersen, Steffen; Hanspal, Tobin; Meisner Nielsen, Kasper

    We study how personal experiences affect individual risk taking. To separate the intertwining effects of personal experiences and wealth changes, our identification strategy relies on the decision to keep unexpected inheritances of risky assets. Experience derives from investments in banks...... that defaulted in the aftermath of the financial crisis. To differentiate the effect of personal experiences, we classify the degrees of experiences into first-hand experiences from personal losses, second-hand experiences from the losses of close family members, and third-hand experiences from living...... in municipalities where banks defaulted. We find that third-hand experiences result in marginally lower risk taking. Second-hand experiences have a relatively stronger negative effect, whereas the effect of first-hand experiences on risk taking is strongly negative. Overall, our results demonstrate that personal...

  16. Once Bitten, Twice Shy

    DEFF Research Database (Denmark)

    Andersen, Steffen; Hanspal, Tobin; Meisner Nielsen, Kasper

    We study how inertia and personal experiences affect individual risk taking. Our research design relies on active portfolio decisions relating to inheritances to separate the effect of personal experiences from inertia, which otherwise would be observationally equivalent. Experience derives from...... results demonstrate that experiences gained personally, aside from inertia or common shocks, explain substantial heterogeneity in individuals' risk taking....

  17. Changes in Cellular mRNA Stability, Splicing, and Polyadenylation through HuR Protein Sequestration by a Cytoplasmic RNA Virus

    Directory of Open Access Journals (Sweden)

    Michael D. Barnhart

    2013-11-01

    Full Text Available The impact of RNA viruses on the posttranscriptional regulation of cellular gene expression is unclear. Sindbis virus causes a dramatic relocalization of the cellular HuR protein from the nucleus to the cytoplasm in infected cells. This is to the result of the expression of large amounts of viral RNAs that contain high-affinity HuR binding sites in their 3′ UTRs effectively serving as a sponge for the HuR protein. Sequestration of HuR by Sindbis virus is associated with destabilization of cellular mRNAs that normally bind HuR and rely on it to regulate their expression. Furthermore, significant changes can be observed in nuclear alternative polyadenylation and splicing events on cellular pre-mRNAs as a result of sequestration of HuR protein by the 3′ UTR of transcripts of this cytoplasmic RNA virus. These studies suggest a molecular mechanism of virus-host interaction that probably has a significant impact on virus replication, cytopathology, and pathogenesis.

  18. SHiP: a new facility with a dedicated detector to search for new neutral particles and studying tau neutrino properties

    Directory of Open Access Journals (Sweden)

    Shevchenko V.

    2017-01-01

    Full Text Available SHiP (Search for Hidden Particles is a new general purpose fixed target facility, whose Technical Proposal has been recently reviewed by the CERN SPS Committee and by the CERN Research Board. The two boards recommended that the experiment proceeds further to a Comprehensive Design phase in the context of the new CERNWorking group "Physics Beyond Colliders", aiming at presenting a CERN strategy for the European Strategy meeting of 2019. In the initial phase of SHiP, the 400 GeV proton beam extracted from the SPS will be dumped on a heavy target with the aim of integrating 2×1020 pot in 5 years. A dedicated detector, based on a long vacuum tank followed by a spectrometer and particle identification detectors, will allow probing a variety of models with light long-lived exotic particles and masses below O(10 GeV/c2. The main focus will be the physics of the so-called Hidden Portals, i.e. search for Dark Photons, Light scalars and pseudo-scalars, and Heavy Neutrinos. The sensitivity to Heavy Neutrinos will allow for the first time to probe, in the mass range between the kaon and the charm meson mass, a coupling range for which Baryogenesis and active neutrino masses could also be explained. Another dedicated detector will allow the study of neutrino cross-sections and angular distributions.

  19. SHI induced effects on the electrical and optical properties of HfO{sub 2} thin films deposited by RF sputtering

    Energy Technology Data Exchange (ETDEWEB)

    Manikanthababu, N.; Dhanunjaya, M.; Nageswara Rao, S.V.S.; Pathak, A.P., E-mail: appsp@uohyd.ernet.in

    2016-07-15

    The continuous downscaling of Metal Oxide Semiconductor (MOS) devices has reached a limit with SiO{sub 2} as a gate dielectric material. Introducing high-k dielectric materials as a replacement for the conservative SiO{sub 2} is the only alternative to reduce the leakage current. HfO{sub 2} is a reliable and an impending material for the wide usage as a gate dielectric in semiconductor industry. HfO{sub 2} thin films were synthesized by RF sputtering technique. Here, we present a study of Swift Heavy Ion (SHI) irradiation with100 MeV Ag ions for studying the optical properties as well as 80 MeV Ni ions for studying the electrical properties of HfO{sub 2}/Si thin films. Rutherford Backscattering Spectrometry (RBS), Field Emission Scanning Electron Microscope (FESEM), energy-dispersive X-ray spectroscopy (EDS), profilometer and I–V (leakage current) measurements have been employed to study the SHI induced effects on both the structural, electrical and optical properties.

  20. Raman and time resolved photoluminescence studies on the effect of temperature on disorder production in SHI irradiated N-doped 6H-SiC crystals

    Energy Technology Data Exchange (ETDEWEB)

    Sivaji, K., E-mail: sivaji.krishnan@yahoo.com [Materials Science Centre, Department of Nuclear Physics, University of Madras, Guindy Campus, Chennai 600025 (India); Viswanathan, E. [Materials Science Centre, Department of Nuclear Physics, University of Madras, Guindy Campus, Chennai 600025 (India); Selvakumar, S. [Materials Science Centre, Department of Nuclear Physics, University of Madras, Guindy Campus, Chennai 600025 (India); University of Tsukuba Tandem Accelerator Complex, University of Tsukuba, Tennodai 1-1-1, Ibaraki 305-8577 (Japan); Sankar, S. [Department of Physics, MIT Campus, Anna University, Chennai 600044 (India); Kanjilal, D. [Inter-University Accelerator Centre, Aruna Asaf Ali Marg, P.O. Box 10502, New Delhi 110067 (India)

    2014-02-25

    Highlights: • N doped SiC were irradiated with 150 MeV Ag{sup 12+} (1 × 10{sup 12} to 5 × 10{sup 13} ions/cm{sup 2}). • Local disorder are analyzed by studying the LO Raman mode of the irradiated sample. • The TRPL studies provided evidence of the formation of radiative centers at 80 K. -- Abstract: In this report, the effect of disorder accumulation in Swift Heavy Ion (SHI) irradiated 6H-SiC is distinguished with respect to the irradiation temperature, viz., 80 K and 300 K. The samples were irradiated with 150 MeV Ag{sup 12+} ions with different fluences ranging from 1 × 10{sup 12} to 5 × 10{sup 13} ions/cm{sup 2}. The structural and optical properties of N-doped 6H-SiC in its pristine condition and after SHI irradiation have been studied. The changes observed by Raman spectroscopy and Time resolved photoluminescence (TRPL) spectroscopy were ascribed to the disorder accumulation in 6H-SiC. The local disorder has been analyzed by studying the LO Raman mode of the irradiated sample in comparison to the pristine sample. The TRPL studies have provided evidence of the formation of radiative centers after irradiation at 80 K.

  1. Effect of the partial replacement of fish meal and oil by vegetable products on performance and quality traits of juvenile shi drum (Umbrina cirrosa L.

    Directory of Open Access Journals (Sweden)

    Igino Andrighetto

    2010-01-01

    Full Text Available A four-month growth trial was carried out in order to evaluate performance and quality traits of juvenile shi drum fedwith two isonitrogenous and isoenergetic diets having different amounts of vegetable products (Vegetable diet vs. Controldiet. Compared to the Control diet, the Vegetable diet was formulated by increasing the replacement of fish meal (14%with soybean and cereal products, and fish oil (12% with a mixture of vegetable oil. On June, 4 groups of 225 fish (2replicates per dietary treatment were sorted according to live weight and reared in fibreglass tanks over a four- monthlong experimental period. Fish were hand fed to apparent satiety. Offered feed, growth parameters and feed efficiencywere recorded as productive performance. At the end of the trial (October biometric, chemical and reological traits wereexamined to assess fish quality. The dietary treatments showed similar productive performance. The relatively high inclusionof vegetable sources led to a significant modification of body shape, mesenteric fat and viscera weight. Among qualitytraits, Vegetable diet-fed fish demonstrated a significantly lower whole body and fillet crude protein content.Yellowness value of the cooked fillet was significantly lower in the Control diet-fed fish, whereas fillet texture was similar.The results of this research showed that shi drum is a suitable candidate for Mediterranean marine aquaculture andits dietary formulation might include at least the amount of vegetable sources used in this trial.

  2. Innate Immune Activation Can Trigger Experimental Spondyloarthritis in HLA-B27/Huβ2m Transgenic Rats

    Directory of Open Access Journals (Sweden)

    Melissa N. van Tok

    2017-08-01

    Full Text Available Spondyloarthritis (SpA does not display the typical features of auto-immune disease. Despite the strong association with MHC class I, CD8+ T cells are not required for disease induction in the HLA-B27/Huβ2m transgenic rats. We used Lewis HLA-B27/Huβ2m transgenic rats [21-3 × 283-2]F1, HLA-B7/Huβ2m transgenic rats [120-4 × 283-2]F1, and wild-type rats to test our hypothesis that SpA may be primarily driven by the innate immune response. In vitro, splenocytes were stimulated with heat-inactivated Mycobacterium tuberculosis and cytokine expression and production was measured. In vivo, male and female rats were immunized with 30, 60, or 90 µg of heat-inactivated M. tuberculosis and clinically monitored for spondylitis and arthritis development. After validation of the model, we tested whether prophylactic and therapeutic TNF targeting affected spondylitis and arthritis. In vitro stimulation with heat-inactivated M. tuberculosis strongly induced gene expression of pro-inflammatory cytokines such as TNF, IL-6, IL-1α, and IL-1β, in the HLA-B27 transgenic rats compared with controls. In vivo immunization induced an increased spondylitis and arthritis incidence and an accelerated and synchronized onset of spondylitis and arthritis in HLA-B27 transgenic males and females. Moreover, immunization overcame the protective effect of orchiectomy. Prophylactic TNF targeting resulted in delayed spondylitis and arthritis development and reduced arthritis severity, whereas therapeutic TNF blockade did not affect spondylitis and arthritis severity. Collectively, these data indicate that innate immune activation plays a role in the initiation of HLA-B27-associated disease and allowed to establish a useful in vivo model to study the cellular and molecular mechanisms of disease initiation and progression.

  3. HuR and podoplanin expression is associated with a high risk of malignant transformation in patients with oral preneoplastic lesions.

    Science.gov (United States)

    Habiba, Umma; Kitamura, Tetsuya; Yanagawa-Matsuda, Aya; Higashino, Fumihiro; Hida, Kyoko; Totsuka, Yasunori; Shindoh, Masanobu

    2016-11-01

    The risk of malignant transformation in oral preneoplastic lesions (OPLs) is challenging to assess. The objective of the present study was to determine the expression of ELAV like RNA binding protein 1 (HuR) and podoplanin in OPLs, and to evaluate the use of each protein as biomarkers for the risk assessment of malignant transformations. Immunohistochemistry for HuR and podoplanin was performed on the tissues of 51 patients with OPL, including cases of low grade dysplasia (LGD) and high grade dysplasia (HGD). The association between the protein expression patterns and clinicopathological parameters, including oral cancer free survival (OCFS) time, was analyzed during the follow-up period. HuR and podoplanin expression was observed in 28 (55%) and 36 (71%) of 51 patients, respectively. Kaplan-Meier analysis showed that the expression of HuR and podoplanin was associated with the risk of progression to oral cancer (P<0.05). Multivariate analysis revealed that HuR and podoplanin expression was associated with a 2.93-fold (95% confidence interval (CI), 0.98-10.34; P=0.055) and 2.06-fold (95% CI, 0.55-8.01; P=0.283) increase in risk of malignant transformation, respectively. The risk of OPL malignant transformation was considerably increased with the coexpression of HuR and podoplanin compared with the histological grading (95% CI, 1.64-23.59; P=0.005). The results of the present study demonstrated that the expression of HuR and podoplanin associates with malignant transformation and suggests that the proteins may be used as biomarkers to identify OPL patients with an increased risk of cancer development.

  4. HuB (elavl2 mRNA is restricted to the germ cells by post-transcriptional mechanisms including stabilisation of the message by DAZL.

    Directory of Open Access Journals (Sweden)

    Sophie E Wiszniak

    Full Text Available The ability of germ cells to carry out a gene regulatory program distinct from the surrounding somatic tissue, and their capacity to specify an entire new organism has made them a focus of many studies that seek to understand how specific regulatory mechanisms, particularly post-transcriptional mechanisms, contribute to cell fate. In zebrafish, germ cells are specified through the inheritance of cytoplasmic determinants, termed the germ plasm, which contains a number of maternal mRNAs and proteins. Investigation of several of these messages has revealed that the restricted localisation of these mRNAs to the germ plasm and subsequent germ cells is due to cis-acting sequence elements present in their 3'UTRs. Here we show that a member of the Hu family of RNA-binding proteins, HuB, is maternally provided in the zebrafish embryo and exhibits germ cell specific expression during embryogenesis. Restriction of HuB mRNA to the germ cells is dependent on a number of sequence elements in its 3'UTR, which act to degrade the mRNA in the soma and stabilise it in the germ cells. In addition, we show that the germ cell specific RNA-binding protein DAZL is able to promote HuB mRNA stability and translation in germ cells, and further demonstrate that these activities require a 30 nucleotide element in the 3'UTR. Our study suggests that DAZL specifically binds the HuB 3'UTR and protects the message from degradation and/or enhances HuB translation, leading to the germ cell specific expression of HuB protein.

  5. Treatment of depression with Chai Hu Shu Gan San: a systematic review and meta-analysis of 42 randomized controlled trials.

    Science.gov (United States)

    Sun, Yan; Xu, Xia; Zhang, Jinping; Chen, Yuanyuan

    2018-02-17

    Depression is a common mental disorder. Chai Hu Shu Gan San, a traditional Chinese medicine, is used to treat depression empirically. We present a systematic review and meta-analysis of the therapeutic efficacy and safety of Chai Hu Shu Gan San in treating depression. Several databases, including PubMed, China National Knowledge Internet, Wanfang, Chongqing VIP, and the Cochrane library, were systematically searched from their date of foundation to January 1, 2017. In this review, wehave included randomized control trials that compared Chai Hu Shu Gan San (or its combination with a regular Western medicine) with a regular Western medicine alone for the treatment of depression. Two investigators independently extracted and analyzed the data using RevMan 5.2.0 software. Mean difference (with a 95% confidence interval) was used as efficacy indices for outcomes. We included 42 studies involving 3234 patients with depression in 15 different types of diseases. Meta analyses showed better effect of Chai Hu Shu Gan San than fluoxetine for pure depression (MD = - 1.59, from - 2.82 to - 0.37, 4 trials, I 2  = 26%), for post-stroke depression (MD = - 4.20, from - 6.20 to - 2.19, 7 trials, I 2  = 96%), and for postpartum depression (MD = - 4.10, from - 7.48 to - 0.72 7 trials, I 2  = 86%). None of the articles reported severe adverse events of oral administration of Chai Hu Shu Gan San. Furthermore, any adverse effects of using Chai Hu Shu Gan San alone were fewer than those of regular Western medicines. This review found that Chai Hu Shu Gan San has some advantages in treating depression, especially post-stroke depression and post-partum depression. A meticulously designed and conducted randomized control trial is needed for further evaluation.

  6. One of the Two Genes Encoding Nucleoid-Associated HU Proteins in Streptomyces coelicolor Is Developmentally Regulated and Specifically Involved in Spore Maturation▿ †

    Science.gov (United States)

    Salerno, Paola; Larsson, Jessica; Bucca, Giselda; Laing, Emma; Smith, Colin P.; Flärdh, Klas

    2009-01-01

    Streptomyces genomes encode two homologs of the nucleoid-associated HU proteins. One of them, here designated HupA, is of a conventional type similar to E. coli HUα and HUβ, while the other, HupS, is a two-domain protein. In addition to the N-terminal part that is similar to that of HU proteins, it has a C-terminal domain that is similar to the alanine- and lysine-rich C termini of eukaryotic linker histones. Such two-domain HU proteins are found only among Actinobacteria. In this phylum some organisms have only a single HU protein of the type with a C-terminal histone H1-like domain (e.g., Hlp in Mycobacterium smegmatis), while others have only a single conventional HU. Yet others, including the streptomycetes, produce both types of HU proteins. We show here that the two HU genes in Streptomyces coelicolor are differentially regulated and that hupS is specifically expressed during sporulation, while hupA is expressed in vegetative hyphae. The developmental upregulation of hupS occurred in sporogenic aerial hyphal compartments and was dependent on the developmental regulators whiA, whiG, and whiI. HupS was found to be nucleoid associated in spores, and a hupS deletion mutant had an average nucleoid size in spores larger than that in the parent strain. The mutant spores were also defective in heat resistance and spore pigmentation, although they possessed apparently normal spore walls and displayed no increased sensitivity to detergents. Overall, the results show that HupS is specifically involved in sporulation and may affect nucleoid architecture and protection in spores of S. coelicolor. PMID:19717607

  7. pp32 (ANP32A expression inhibits pancreatic cancer cell growth and induces gemcitabine resistance by disrupting HuR binding to mRNAs.

    Directory of Open Access Journals (Sweden)

    Timothy K Williams

    Full Text Available The expression of protein phosphatase 32 (PP32, ANP32A is low in poorly differentiated pancreatic cancers and is linked to the levels of HuR (ELAV1, a predictive marker for gemcitabine response. In pancreatic cancer cells, exogenous overexpression of pp32 inhibited cell growth, supporting its long-recognized role as a tumor suppressor in pancreatic cancer. In chemotherapeutic sensitivity screening assays, cells overexpressing pp32 were selectively resistant to the nucleoside analogs gemcitabine and cytarabine (ARA-C, but were sensitized to 5-fluorouracil; conversely, silencing pp32 in pancreatic cancer cells enhanced gemcitabine sensitivity. The cytoplasmic levels of pp32 increased after cancer cells are treated with certain stressors, including gemcitabine. pp32 overexpression reduced the association of HuR with the mRNA encoding the gemcitabine-metabolizing enzyme deoxycytidine kinase (dCK, causing a significant reduction in dCK protein levels. Similarly, ectopic pp32 expression caused a reduction in HuR binding of mRNAs encoding tumor-promoting proteins (e.g., VEGF and HuR, while silencing pp32 dramatically enhanced the binding of these mRNA targets. Low pp32 nuclear expression correlated with high-grade tumors and the presence of lymph node metastasis, as compared to patients' tumors with high nuclear pp32 expression. Although pp32 expression levels did not enhance the predictive power of cytoplasmic HuR status, nuclear pp32 levels and cytoplasmic HuR levels associated significantly in patient samples. Thus, we provide novel evidence that the tumor suppressor function of pp32 can be attributed to its ability to disrupt HuR binding to target mRNAs encoding key proteins for cancer cell survival and drug efficacy.

  8. Efficacy of the Frame and Hu mathematical model for the quantitative analysis of agents influencing growth of chick embryo fibroblasts

    International Nuclear Information System (INIS)

    Korohoda, K.; Czyz, J.

    1994-01-01

    The experiments on the effect of various sera and substratum surface area upon growth of chick embryo fibroblasts-like in secondary cultures are described and discussed on the grounds of a mathematical model for growth of anchorage-dependent cells proposed by Frame and Hu. The model and presented results demonstrate the mutual independence of the effects of agent influencing of rate of cell proliferation (i.e. accelerating or retarding growth) and the agents that modify the limitation of cell proliferation (i.e. maximum cell density at confluence). The model proposed by Frame and Hu due to its relative simplicity offers and easy mode of description and quantitative evaluation of experiments concerning cell growth regulation. It is shown that various sera added at constant concentration significantly modify the rate of cell proliferation with little effect upon the maximum cell density attainable. The cells grew much more slowly in the presence of calf serum than in the presence of chick serum and the addition of iron and zinc complexes to calf serum significantly accelerated cell growth. An increase in the substratum surface area by the addition of glass wool to culture vessels significantly increased cell density per constant volume of medium even when retardation of growth was observed. The results presented point to the need of direct cell counting for estimation of cell growth curves and discussion of effects of agents influencing parameters characterizing cell proliferation. (author). 34 refs, 5 figs, 2 tabs

  9. HuR cytoplasmic expression is associated with increased cyclin A expression and poor outcome with upper urinary tract urothelial carcinoma

    International Nuclear Information System (INIS)

    Liang, Peir-In; Shiue, Yow-Ling; Huang, Hsuan-Ying; Hsu, Han-Ping; Chen, Li-Tzon; Lin, Ching-Yih; Tai, Chein; Lin, Chun-Mao; Li, Chien-Feng; Li, Wei-Ming; Wang, Yu-Hui; Wu, Ting-Feng; Wu, Wen-Ren; Liao, Alex C; Shen, Kun-Hung; Wei, Yu-Ching; Hsing, Chung-Hsi

    2012-01-01

    HuR is an RNA-binding protein that post-transcriptionally modulates the expressions of various target genes implicated in carcinogenesis, such as CCNA2 encoding cyclin A. No prior study attempted to evaluate the significance of HuR expression in a large cohort with upper urinary tract urothelial carcinomas (UTUCs). In total, 340 cases of primary localized UTUC without previous or concordant bladder carcinoma were selected. All of these patients received ureterectomy or radical nephroureterectomy with curative intents. Pathological slides were reviewed, and clinical findings were collected. Immunostaining for HuR and cyclin A was performed and evaluated by using H-score. The results of cytoplasmic HuR and nuclear cyclin A expressions were correlated with disease-specific survival (DSS), metastasis-free survival (MeFS), urinary bladder recurrence-free survival (UBRFS), and various clinicopathological factors. HuR cytoplasmic expression was significantly related to the pT status, lymph node metastasis, a higher histological grade, the pattern of invasion, vascular and perineurial invasion, and cyclin A expression (p = 0.005). Importantly, HuR cytoplasmic expression was strongly associated with a worse DSS (p < 0.0001), MeFS (p < 0.0001), and UBRFS (p = 0.0370) in the univariate analysis, and the first two results remained independently predictive of adverse outcomes (p = 0.038, relative risk [RR] = 1.996 for DSS; p = 0.027, RR = 1.880 for MeFS). Cyclin A nuclear expression was associated with a poor DSS (p = 0.0035) and MeFS (p = 0.0015) in the univariate analysis but was not prognosticatory in the multivariate analyses. High-risk patients (pT3 or pT4 with/without nodal metastasis) with high HuR cytoplasmic expression had better DSS if adjuvant chemotherapy was performed (p = 0.015). HuR cytoplasmic expression was correlated with adverse phenotypes and cyclin A overexpression and also independently predictive of worse DSS and MeFS, suggesting its roles in

  10. The RNA binding protein HuR differentially regulates unique subsets of mRNAs in estrogen receptor negative and estrogen receptor positive breast cancer

    Directory of Open Access Journals (Sweden)

    Chen Jing

    2010-04-01

    Full Text Available Abstract Background The discordance between steady-state levels of mRNAs and protein has been attributed to posttranscriptional control mechanisms affecting mRNA stability and translation. Traditional methods of genome wide microarray analysis, profiling steady-state levels of mRNA, may miss important mRNA targets owing to significant posttranscriptional gene regulation by RNA binding proteins (RBPs. Methods The ribonomic approach, utilizing RNA immunoprecipitation hybridized to microarray (RIP-Chip, provides global identification of putative endogenous mRNA targets of different RBPs. HuR is an RBP that binds to the AU-rich elements (ARE of labile mRNAs, such as proto-oncogenes, facilitating their translation into protein. HuR has been shown to play a role in cancer progression and elevated levels of cytoplasmic HuR directly correlate with increased invasiveness and poor prognosis for many cancers, including those of the breast. HuR has been described to control genes in several of the acquired capabilities of cancer and has been hypothesized to be a tumor-maintenance gene, allowing for cancers to proliferate once they are established. Results We used HuR RIP-Chip as a comprehensive and systematic method to survey breast cancer target genes in both MCF-7 (estrogen receptor positive, ER+ and MDA-MB-231 (estrogen receptor negative, ER- breast cancer cell lines. We identified unique subsets of HuR-associated mRNAs found individually or in both cell types. Two novel HuR targets, CD9 and CALM2 mRNAs, were identified and validated by quantitative RT-PCR and biotin pull-down analysis. Conclusion This is the first report of a side-by-side genome-wide comparison of HuR-associated targets in wild type ER+ and ER- breast cancer. We found distinct, differentially expressed subsets of cancer related genes in ER+ and ER- breast cancer cell lines, and noted that the differential regulation of two cancer-related genes by HuR was contingent upon the cellular

  11. Test of Shi et al. Method to Infer the Magnetic Reconnection Geometry from Spacecraft Data: MHD Simulation with Guide Field and Antiparallel Kinetic Simulation

    Science.gov (United States)

    Denton, R.; Sonnerup, B. U. O.; Swisdak, M.; Birn, J.; Drake, J. F.; Heese, M.

    2012-01-01

    When analyzing data from an array of spacecraft (such as Cluster or MMS) crossing a site of magnetic reconnection, it is desirable to be able to accurately determine the orientation of the reconnection site. If the reconnection is quasi-two dimensional, there are three key directions, the direction of maximum inhomogeneity (the direction across the reconnection site), the direction of the reconnecting component of the magnetic field, and the direction of rough invariance (the "out of plane" direction). Using simulated spacecraft observations of magnetic reconnection in the geomagnetic tail, we extend our previous tests of the direction-finding method developed by Shi et al. (2005) and the method to determine the structure velocity relative to the spacecraft Vstr. These methods require data from four proximate spacecraft. We add artificial noise and calibration errors to the simulation fields, and then use the perturbed gradient of the magnetic field B and perturbed time derivative dB/dt, as described by Denton et al. (2010). Three new simulations are examined: a weakly three-dimensional, i.e., quasi-two-dimensional, MHD simulation without a guide field, a quasi-two-dimensional MHD simulation with a guide field, and a two-dimensional full dynamics kinetic simulation with inherent noise so that the apparent minimum gradient was not exactly zero, even without added artificial errors. We also examined variations of the spacecraft trajectory for the kinetic simulation. The accuracy of the directions found varied depending on the simulation and spacecraft trajectory, but all the directions could be found within about 10 for all cases. Various aspects of the method were examined, including how to choose averaging intervals and the best intervals for determining the directions and velocity. For the kinetic simulation, we also investigated in detail how the errors in the inferred gradient directions from the unmodified Shi et al. method (using the unperturbed gradient

  12. MSA Mimic? Rare Occurrence of Anti-Hu Autonomic Failure and Thymoma in a Patient with Parkinsonism: Case Report and Literature Review

    Directory of Open Access Journals (Sweden)

    Vito A. G. Ricigliano

    2018-01-01

    Full Text Available Thymoma is a tumor originating from thymic gland, frequently manifesting with paraneoplastic neurological disorders. Its association with paraneoplastic dysautonomia is relatively uncommon. Here, we describe the challenging case of a 71 year-old female who developed subacute autonomic failure with digestive pseudo-obstruction, dysphagia, urinary tract dysfunction and orthostatic hypotension complicating an underlying extrapyramidal syndrome that had started 3 months before hospital admission. Autonomic symptoms had 2-month course and acutely worsened just before and during hospitalization. Combination of severe dysautonomia and parkinsonism mimicked rapidly progressing multiple system atrophy. However, diagnostic exams showed thymic tumor with positive anti-Hu antibodies on both serum and cerebrospinal fluid. Complete response of dysautonomia to immunoglobulins followed by thymectomy confirmed the diagnosis of anti-Hu-related paraneoplastic neurological syndrome. With regards to extrapyramidal symptoms, despite previous descriptions of paraneoplastic parkinsonism caused by other antineuronal antibodies, in our case no relation between anti-Hu and parkinsonism could be identified. A literature review of published reports describing anti-Hu positivity in thymic neoplasms highlighted that a definite autonomic disease due to anti-Hu antibodies is extremely rare in patients with thymoma but without myasthenia gravis, with only one case published so far.

  13. Comparison between two treatment protocols with recombinant Human Erythropoietin (rHuEpo in the treatment of late anemia in neonates with Rh-Isoimmunization

    Directory of Open Access Journals (Sweden)

    A.A. Zuppa

    2012-08-01

    Full Text Available Objectve. The Rh-hemolytic disease can lead to a late anemia by hemolytic and hyporigenerative mechanism. We compared the effectiveness of rHuEPO in two care protocols that differ for doses of rHuEPO administrated and for timing of administration. Methods. A cohort of 14 neonates was investigated. The neonates were treated with two different protocols. Protocol A: a dose of 200 U/kg/day of rHuEpo administered subcutaneously starting from the end of the second week of life; Protocol B: a dose of 400 U/kg/day of rHuEpo administered subcutaneously starting from the end of the first week of life. Results. The hematocrit values in the protocol A group decreased during treatment (32,5% vs 25,2%, whereas the hematocrit value in protocol B group remained almost stable (38,7% vs 42,8%. The mean numbers of platelets remained stable in both groups while neutrophils increased in protocol A group and decreased in protocol B (p<0,05. Reticulocyte count increased during treatment in both groups, although only in protocol B group it was statistically significative (p<0,05. Conclusions. Our results suggest a similar efficacy between the two treatment protocols. Increasing doses of rHuEPO do not seem enhancing their effectiveness and the incidence of side effects.

  14. Effect of the synthetic cannabinoid HU-210 on quorum sensing and on the production of quorum sensing-mediated virulence factors by Vibrio harveyi.

    Science.gov (United States)

    Soni, Divya; Smoum, Reem; Breuer, Aviva; Mechoulam, Raphael; Steinberg, Doron

    2015-08-12

    Bacterial populations communicate through the cell density-dependent mechanism of quorum sensing (QS). Vibrio harveyi, one of the best studied model organisms for QS, was used to explore effects of the synthetic cannabinoid HU-210 on QS and different QS-regulated physiological processes in bacteria. Analysis of QS-regulated bioluminescence in wild-type and mutant strains of V. harveyi revealed that HU-210 affects the autoinducer-2 (AI-2) pathway, one of three known QS cascades of V. harveyi. Furthermore, QS-mediated biofilm formation and swimming motility in the mutant strain BB152 (AI-1(-), AI-2(+)) were significantly reduced in the presence of HU-210. HU-210 inhibited QS-mediated virulence factor production without any inhibitory effect on bacterial growth. It also alters the expression of several genes, which are regulated by QS, specifically downregulating the genes of the AI-2 QS cascade. First evidence is being provided for interference of bacterial signal-transduction systems by a synthetic cannabinoid. The effect of HU-210 was specific to the AI-2 cascade in V. harveyi. AI-2 is known as a "universal autoinducer" and interference with its activity opens a broad spectrum of applications for synthetic cannabinoids in future research as a potential anti-QS agent.

  15. Studies for the electro-magnetic calorimeter {\\em SplitCal} for the SHiP experiment at CERN with shower direction reconstruction capability

    CERN Document Server

    2018-01-01

    This paper describes the basic ideas and the first simulation results of a new electro-magnetic calorimeter concept, named {\\it SplitCal}, aimed at optimising the measurement of photon direction in fixed-target experiment configuration, with high photon detection efficiency. This calorimeter was designed for the invariant mass reconstruction of axion-like particles decaying into two photons in the mass range 200~MeV to 1~GeV for the proposed proton beam dump experiment SHiP at CERN. Preliminary results indicate that angular resolutions better than obtained by past experiments can be achieved with this design. An implementation of this concept with real technologies is under study.

  16. Studies for the electro-magnetic calorimeter SplitCal for the SHiP experiment at CERN with shower direction reconstruction capability

    Science.gov (United States)

    Bonivento, Walter M.

    2018-02-01

    This paper describes the basic ideas and the first simulation results of a new electro-magnetic calorimeter concept, named SplitCal, aimed at optimising the measurement of photon direction in fixed-target experiment configuration, with high photon detection efficiency. This calorimeter was designed for the invariant mass reconstruction of axion-like particles decaying into two photons in the mass range 200 MeV to 1 GeV for the proposed proton beam dump experiment SHiP at CERN. Preliminary results indicate that angular resolutions better than obtained by past experiments can be achieved with this design. An implementation of this concept with real technologies is under study.

  17. Measurement of parameters of scintillating bars with wavelength-shifting fibres and silicon photomultiplier readout for the SHiP Muon Detector

    CERN Document Server

    Montanari, Alessandro; Baldini, Wander; Calcaterra, Alessandro; Lanfranchi, Gaia; Saputi, Alessandro; Khotyantsev, Alexey; Kudenko, Yury; Mefodev, Aleksandr; Mineev, Oleg

    2016-01-01

    The light yield and the time resolution of different types of 3 m long scintillating bars instrumented with wavelength shifting fibres and read out by different models of silicon photomultipliers have been measured at a test beam at the T9 area at the CERN Proton Synchrotron. The results obtained with different configurations are presented. A time resolution better than 800 ps, constant along the bar length within 20%, and a light yield of 140 (70) photo-electrons are obtained for bars 3 m long, 4.5 (5) cm wide and 2 (0.7) cm thick. These results nicely match the requirements for the Muon Detector of the SHiP experiment.

  18. [Non-pharmaceutical therapy of candidates for geriatric rehabilitation: Non-pharmaceutical therapy prescribed by SHI-accredited doctors after application for outpatient geriatric rehabilitative care].

    Science.gov (United States)

    Krupp, Sonja; Schnoor, Maike; Lohse, Kristina; Katalinic, Alexander; Willkomm, Martin

    2015-06-01

    The rejection of an application for ambulant geriatric rehabilitation (AGRV) is usually justified by the argument that non-pharmaceutical therapy prescribed by doctors accredited by social housing institutions (SHI) would suffice. The reality in healthcare during the 6 months following an application is unknown. In this study 203 patients who had made an application for AGRV in the second half of 2010 in Flensburg, Lübeck or Ratzeburg were interviewed by telephone. The survey revealed that 25.7% of the applications for AGRV had been rejected. The majority of these patients received no ambulant non-pharmaceutical therapy (e.g. physical therapy, physiotherapy, occupational therapy, speech therapy or psychological therapy), less than 20% received more than 12 therapy sessions and in most cases exclusively physiotherapy. The 141 successful AGRV applicants received additional ambulant therapies of a similar magnitude. The difference between the intensified interdisciplinary therapy offered in the AGRV and additionally and the offer to rejected applicants is substantial.

  19. Development and Characterization of a Humanized Anti-HER2 Antibody HuA21 with Potent Anti-Tumor Properties in Breast Cancer Cells

    Directory of Open Access Journals (Sweden)

    Ruilin Li

    2016-04-01

    Full Text Available Human epidermal growth factor receptor 2 (HER2 is one of the most studied tumor-associated antigens for cancer immunotherapy. An engineered anti-HER-2 chimeric A21 antibody (chA21 is a chimeric antibody targeted to subdomain I of the HER2 extracellular domain. Here, we report the anti-tumor activity of the novel engineered monoclonal antibody humanized chA21 (HuA21 that targets HER2 on the basis of chA21, and we describe the underlying mechanisms. Our results reveal that HuA21 markedly inhibits the proliferation and migration of HER2-overexpressing breast cancer cells and causes enhanced antibody-dependent cell-mediated cytotoxicity potency against HER2-overexpressing tumor cells. In particular, HuA21, but not trastuzumab (Tra, markedly suppresses growth and enhances the internalization of the antibody in Tra-resistant BT-474 breast cancer cells. These characteristics are highly associated with the intrinsic ability of HuA21 to down-regulate HER2 activation and inhibit the extracellular signal-regulated kinase 1/2 (ERK1/2 and protein kinase B (Akt signaling pathways. Furthermore, the combination of HuA21 with Tra synergistically enhances the anti-tumor effects in vitro and in vivo and inhibits HER2 activation and the ERK1/2 and Akt signaling pathways. Altogether, our results suggest that HuA21 may represent a unique anti-HER2 antibody with potential as a therapeutic candidate alone or in combination with other anti-HER2 reagents in cancer therapy.

  20. TH-CD-207B-11: Multi-Vendor Phantom Study of CT Lung Density Metrics: Is a Reproducibility of Less Than 1 HU Achievable?

    Energy Technology Data Exchange (ETDEWEB)

    Chen-Mayer, H [National Institute of Standards & Technology, Gaithersburg, MD (United States); Judy, P [Brigham & Women’s Hospital, Boston, MA (United States); Fain, S [University of Wisconsin, Madison, WI (United States); Hoppel, B [Toshiba Medical Research Institute USA, Inc, Vernon Hills, IL (United States); Lynch, D [Nation Jewish Health, Denver, CO (United States); Fuld, M [Siemens Medical Solutions USA, Inc., Baltimore, MD (United States)

    2016-06-15

    Purpose: To standardize the calibration procedures of CT lung density measurements using low-density reference foams in a phantom, and to demonstrate a reproducibility of less than 1 HU for lung equivalent foam densities measured across CT vendor platforms and protocols. Methods: A phantom study was conducted on CT scanner models from 4 vendors at 100, 120, and 135/140 kVp and 1.5, 3, and 6 mGy dose settings, using a lung density phantom containing air, water, and 3 reference foams (indirectly calibrated) with discrete densities simulating a 5-cm slice of the human chest. Customized segmentation software was used to analyze the images and generate a mean HU and variance for each of the density for the 22 vendor/protocols. A 3-step calibration process was devised to remove a scanner-dependent parameter using linear regression of the HU value vs the relative electron density. The results were mapped to a single energy (80 keV) for final comparison. Results: The heterogeneity across vendor platforms for each density assessed by a random effects model was reduced by 50% after re-calibration, while the standard deviation of the mean HU values also improved by about the same amount. The 95% CI of the final HU value was within +/−1 HU for all 3 reference foam densities. For the backing lung foam in the phantom (served as an “unknown”), this CI is +/− 1.6 HU. The kVp and dose settings did not appear to have significant contributions to the variability. Conclusion: With the proposed calibration procedures, the inter-scanner reproducibility of better than 1 HU is demonstrated in the current phantom study for the reference foam densities, but not yet achieved for a test density. The sources of error are being investigated in the next round of scanning with a certified Standard Reference Material for direct calibration. Fain: research funding from GE Healthcare to develop pulmonary MRI techniques. Hoppel: employee of Toshiba Medical Research Institute USA

  1. Nivel de pobreza y estado nutricional asociados a parasitosis intestinal en estudiantes, Huánuco, Perú, 2010

    Directory of Open Access Journals (Sweden)

    César Gabriel Berto Moreano

    2013-10-01

    Full Text Available Introducción: Se ha encontrado una prevalencia alta de parasitosis en escolares de la amazonía; pese a ello, no hay estudios realizados que revisen su asociación con el nivel socioeconómico y estado nutricional. Objetivos: Determinar la relación entre nivel de pobreza y estado nutricional con la presencia de parásitos intestinales en estudiantes escolares del caserío Venenillo, Huánuco. Diseño: Estudio transversal-analítico. Lugar: Caserío de Venenillo, Huánuco. Participantes: Estudiantes escolares de la única institución educativa del centro poblado. Intervenciones: A 42 estudiantes se les realizó examen coproparasitológico mediante observación directa con lugol y técnica de sedimentación rápida de Lumbreras. El nivel de pobreza fue determinado mediante el índice de necesidades básicas insatisfechas (NBI; y el grado de desnutrición, por medio del índice de Waterlow. El análisis estadístico fue realizado mediante el coeficiente gamma de Goodman y Kruskal. Principales medidas de resultados: Relación de parasitosis intestinal con pobreza y estado nutricional. Resultados: Los parásitos intestinales estuvieron presentes en 97,6%. Se encontró asociación significativa entre el nivel de parasitismo y el nivel de pobreza (p=0,02; gamma=0,82. No se encontró asociación significativa entre nivel de desnutrición y parasitismo (p=0,77. Conclusiones: La parasitosis intestinal se asoció al nivel de pobreza, no así con el nivel de desnutrición en la población de estudio.

  2. Dieta de roedores sigmodontinos (Cricetidae en los bosques montanos tropicales de Huánuco, Perú

    Directory of Open Access Journals (Sweden)

    Maggie C. Noblecilla

    2013-06-01

    Full Text Available Se analizó el contenido estomacal de cinco especies de roedores sigmodontinos: Akodon orophilus, Microry-zomys altissimus, M. minutus, Thomasomys notatus yT. kalinowskii, procedentes de los bosques montanos de Huánuco, Perú (2564 - 3850 m de altitud. Concluimos que A. orophiluses insectívora por haber presentado un alto volumen de artrópodos (adultos y larvas en el contenido estomacal (90,1%; mientras que T. notatusy T. kalinowskiison principalmente herbívoras por el alto volumen de materia vegetal, 89% y 67,75% respectiva-mente; y que M. altissimusy M. minutusson omnívoras por presentar volúmenes similares tanto para vegetales como para artrópodos. Thomasomys kalinowskiies considerada generalista por la mayor amplitud de nicho (4,61, mientras A. orophiluses considerada especialista por el menor valor (1,70. Akodon orophilusmostró una preferencia por el consumo de artrópodos adultos al tener un bajo coeficiente de variación (CV= 20% y también un significativo aumento en el consumo de larvas de artrópodos en la época húmeda, siendo la única especie con variación estacional en la dieta. Por otro lado, la sobreposición de nicho fue menor a 0,75 en el 80% de los pares de especies comparados, indicando una baja similitud en la dieta. La mayor similitud en la dieta se observó entre M. altissimus- T. notatus(0,822 y M. minutus - T. kalinowskii(0,816. Se concluye que estos roedores sigmodontinos, simpátricos en los bosques montanos de Huánuco, exhiben dietas disímiles, probablemente como una estrategia para evitar o aminorar la competencia interespecífica.

  3. Short communication. Employment of molecular markers to develop tetraploid “supermale” asparagus from andromonoecious plants of the landrace ‘Morado de Huétor’

    Directory of Open Access Journals (Sweden)

    Jose J. Regalado

    2014-10-01

    Full Text Available The aim of this work was the development of new “supermale” genotypes retaining the highest genetic diversity possible of the tetraploid asparagus landrace ‘Morado de Huétor’. The elite andromonoecious male HT664 of the ‘Morado de Huétor’ asparagus landrace and the andromonoecious hybrid male HC027, obtained by crossing between this landrace and a commercial cultivar of Asparagus officinalis, were selected for self-pollination to produce possible “supermales” with genes of ‘Morado de Huétor’ (SMHT. To confirm the hybrid nature of HC027, we characterized this genotype with EST-SSR (Expressed Sequence Tag-derived Simple Sequence Repeats markers. We also adopted the sex-linked marker Asp1-T7 for sex determination in ‘Morado de Huétor’ and the resulting hybrids between this landrace and other commercial cultivars. Asp1-T7 marker was used for the selection and genotyping of SMHT. “All-male” cultivars with a different genetic background can be generated by crossing females with these new “supermale” genotypes, and the agronomical traits of these new cultivars would be very different from the “all-male” cultivars currently available in the market, making them extremely interesting for asparagus breeding programs.

  4. Proteínas del huésped incorporadas en el Virus de la Inmunodeficiencia Humana tipo 1 (VIH-1

    Directory of Open Access Journals (Sweden)

    Dayane Canedo de León

    2008-01-01

    Full Text Available El Virus de la Inmunodeficiencia Humana (VIH, como la mayoría de los virus envueltos, toma esta estructura cuando abandona la célula infectada. El virus adquiere durante este proceso, junto con fragmentos de la membrana de la célula huésped, proteínas derivadas de la membrana celular como parte integral de la envoltura madura. Estos componentes de la envoltura viral derivados del huésped pueden ejercer algunos efectos en el ciclo de vida del virus, en la interacción virus-célula, especialmente en la respuesta del huésped a sus propias proteínas incorporadas por el virus y, finalmente, en la patogénesis de la enfermedad inducida por el virus. El rol de estas proteínas ha recibido cada día más atención, específicamente en la importancia que puedan tener en el proceso infeccioso viral y en le desarrollo del Síndrome de la Inmunodeficiencia Adquirida (SIDA. El objetivo de este artículo es hacer una revisión de las proteínas del huésped que son incorporadas por el VIH, haciendo énfasis en el rol potencial de estas proteínas en la patogénesis del SIDA.

  5. Proposed Methodology for Application of Human-like gradual Multi-Agent Q-Learning (HuMAQ) for Multi-robot Exploration

    International Nuclear Information System (INIS)

    Ray, Dip Narayan; Majumder, Somajyoti

    2014-01-01

    Several attempts have been made by the researchers around the world to develop a number of autonomous exploration techniques for robots. But it has been always an important issue for developing the algorithm for unstructured and unknown environments. Human-like gradual Multi-agent Q-leaming (HuMAQ) is a technique developed for autonomous robotic exploration in unknown (and even unimaginable) environments. It has been successfully implemented in multi-agent single robotic system. HuMAQ uses the concept of Subsumption architecture, a well-known Behaviour-based architecture for prioritizing the agents of the multi-agent system and executes only the most common action out of all the different actions recommended by different agents. Instead of using new state-action table (Q-table) each time, HuMAQ uses the immediate past table for efficient and faster exploration. The proof of learning has also been established both theoretically and practically. HuMAQ has the potential to be used in different and difficult situations as well as applications. The same architecture has been modified to use for multi-robot exploration in an environment. Apart from all other existing agents used in the single robotic system, agents for inter-robot communication and coordination/ co-operation with the other similar robots have been introduced in the present research. Current work uses a series of indigenously developed identical autonomous robotic systems, communicating with each other through ZigBee protocol

  6. The monomeric form of Neisseria DNA mimic protein DMP19 prevents DNA from binding to the histone-like HU protein

    Science.gov (United States)

    Ko, Tzu-Ping; Liao, Yi-Ting; Hsu, Kai-Cheng

    2017-01-01

    DNA mimicry is a direct and effective strategy by which the mimic competes with DNA for the DNA binding sites on other proteins. Until now, only about a dozen proteins have been shown to function via this strategy, including the DNA mimic protein DMP19 from Neisseria meningitides. We have shown previously that DMP19 dimer prevents the operator DNA from binding to the transcription factor NHTF. Here, we provide new evidence that DMP19 monomer can also interact with the Neisseria nucleoid-associated protein HU. Using BS3 crosslinking, gel filtration and isothermal titration calorimetry assays, we found that DMP19 uses its monomeric form to interact with the Neisseria HU dimer. Crosslinking conjugated mass spectrometry was used to investigate the binding mode of DMP19 monomer and HU dimer. Finally, an electrophoretic mobility shift assay (EMSA) confirmed that the DNA binding affinity of HU is affected by DMP19. These results showed that DMP19 is bifunctional in the gene regulation of Neisseria through its variable oligomeric forms. PMID:29220372

  7. Investigation of the HU-density conversion method and comparison of dose distribution for dose calculation on MV cone beam CT images

    Energy Technology Data Exchange (ETDEWEB)

    Kim, Min Joo; Lee, Seu Ran; Suh, Tae Suk [Dept. of Biomedical Engineering, The Catholic University of Korea, Bucheon (Korea, Republic of)

    2011-11-15

    Modern radiation therapy techniques, such as Image-guided radiation therapy (IGRT), Adaptive radiation therapy (ART) has become a routine clinical practice on linear accelerators for the increase the tumor dose conformity and improvement of normal tissue sparing at the same time. For these highly developed techniques, megavoltage cone beam computed tomography (MVCBCT) system produce volumetric images at just one rotation of the x-ray beam source and detector on the bottom of conventional linear accelerator for real-time application of patient condition into treatment planning. MV CBCT image scan be directly registered to a reference CT data set which is usually kilo-voltage fan-beam computed tomography (kVFBCT) on treatment planning system and the registered image scan be used to adjust patient set-up error. However, to use MV CBCT images in radiotherapy, reliable electron density (ED) distribution are required. Patients scattering, beam hardening and softening effect caused by different energy application between kVCT, MV CBCT can cause cupping artifacts in MV CBCT images and distortion of Houns field Unit (HU) to ED conversion. The goal of this study, for reliable application of MV CBCT images into dose calculation, MV CBCT images was modified to correct distortion of HU to ED using the relationship of HU and ED from kV FBCT and MV CBCT images. The HU-density conversion was performed on MV CBCT image set using Dose difference map was showing in Figure 1. Finally, percentage differences above 3% were reduced depending on applying density calibration method. As a result, total error co uld be reduced to under 3%. The present study demonstrates that dose calculation accuracy using MV CBCT image set can be improved my applying HU-density conversion method. The dose calculation and comparison of dose distribution from MV CBCT image set with/without HU-density conversion method was performed. An advantage of this study compared to other approaches is that HU

  8. Proteomics reveal energy metabolism and mitogen-activated protein kinase signal transduction perturbation in human Borna disease virus Hu-H1-infected oligodendroglial cells.

    Science.gov (United States)

    Liu, X; Yang, Y; Zhao, M; Bode, L; Zhang, L; Pan, J; Lv, L; Zhan, Y; Liu, S; Zhang, L; Wang, X; Huang, R; Zhou, J; Xie, P

    2014-05-30

    Borna disease virus (BDV) is a neurotropic, non-cytolytic RNA virus which replicates in the cell nucleus targeting mainly hippocampal neurons, but also astroglial and oligodendroglial cells in the brain. BDV is associated with a large spectrum of neuropsychiatric pathologies in animals. Its relationship to human neuropsychiatric illness still remains controversial. We could recently demonstrate that human BDV strain Hu-H1 promoted apoptosis and inhibited cell proliferation in a human oligodendroglial cell line (OL cells) whereas laboratory BDV strain V acted contrariwise. Here, differential protein expression between BDV Hu-H1-infected OL cells and non-infected OL cells was assessed through a proteomics approach, using two-dimensional electrophoresis followed by matrix-assisted laser desorption ionization-time of flight tandem mass spectrometry. A total of 63 differential host proteins were identified in BDV Hu-H1-infected OL cells compared to non-infected OL cells. We found that most changes referred to alterations related to the pentose phosphate pathway, glyoxylate and dicarboxylate metabolism, the tricarboxylic acid (TCA) cycle, and glycolysis /gluconeogenesis. By manual querying, two differential proteins were found to be associated with mitogen-activated protein kinase (MAPK) signal transduction. Five key signaling proteins of this pathway (i.e., p-Raf, p-MEK, p-ERK1/2, p-RSK, and p-MSK) were selected for Western blotting validation. p-ERK1/2 and p-RSK were found to be significantly up-regulated, and p-MSK was found to be significantly down-regulated in BDV Hu-H1-infected OL cells compared to non-infected OL cell. Although BDV Hu-H1 constitutively activated the ERK-RSK pathway, host cell proliferation and nuclear translocation of activated pERK in BDV Hu-H1-infected OL cells were impaired. These findings indicate that BDV Hu-H1 infection of human oligodendroglial cells significantly perturbs host energy metabolism, activates the downstream ERK-RSK complex of

  9. Infección por Gnathostoma (Spirurida: Gnathostomatidae en Hoplias microlepis: prevalencia, correlación con la talla del pez, huéspedes e implicaciones para salud pública en Ecuador

    Directory of Open Access Journals (Sweden)

    Juan José Alava

    2009-12-01

    Conclusiones. La gnathostomiasis sigue siendo prevalente en la zona costera de Ecuador y el agente patógeno es aún encontrado en el huésped intermediario. Diversos mamíferos neotropicales estarían actuando como huésped reservorio definitivo en el ciclo biológico de Gnathostoma en Ecuador.

  10. Shi Diao and the Social Enlightenment Movement in the Late Qing Dynasty%时调唱歌与清末之社会启蒙运动

    Institute of Scientific and Technical Information of China (English)

    李秋菊

    2017-01-01

    流传于市井的时调艺术以其俚俗时行的特质,与清末启蒙思潮正相契合,因而被一些感时忧世的爱国文人所关注、重视并加以利用,成为开启民智、再造人心、救亡图存、改良社会的利器。启蒙者根据清末流行的时调曲调新填的曲词,已经完全跳出儿女情思、古人古事、市井俗态的窠臼,不但在题材内容、创作动机等方面呈现出新的质素,不论是感慨时政、劝戒恶俗,还是破除迷信、介绍新知,无不体现出“启蒙救亡”的特色,而且承载着救亡图存的爱国精神及强身—强种—强国、男女平等平权与维新图强的思想,因而老树发新芽,在清末社会启蒙运动中扮演着重要角色。发掘时调艺术在清末启蒙思潮中所起的积极作用,对于清末社会启蒙运动研究的推进及重新评估时调之类的民间文艺的价值不无裨益。%Because of its popularity,Shi diao 时调 (popular tune) was in line with the social enlightenment movement in the late Qing Dynasty and thus attracted attention of the patriotic intellectuals,who employed this type of popular musical and literary genre to awaken Chinese people to their patriotic mission of saving their nation from outside bullying and invasion through mental and social reforms. Different from the old themes (e.g. love stories and legends) associated with this genre,Shi diao thus created acquired a distinctive feature of pursuing social enlightenment and reforms,which were intended to eliminate superstitions and backward customs and traditions,introduce new knowledge,enhance the mental and physical quality of Chinese people, and even achieve the equality between men and women. These patriotic themes made Shi

  11. Detrimental ELAVL-1/HuR-dependent GSK3β mRNA stabilization impairs resolution in acute respiratory distress syndrome.

    Directory of Open Access Journals (Sweden)

    Olivia Hoffman

    Full Text Available A hallmark of acute respiratory distress syndrome (ARDS is accumulation of protein-rich edema in the distal airspaces and its removal is critical for patient survival. Previous studies have shown a detrimental role of Glycogen Synthase Kinase (GSK 3β during ARDS via inhibition of alveolar epithelial protein transport. We hypothesized that post-transcriptional regulation of GSK3β could play a functional role in ARDS resolution. To address this hypothesis, we performed an in silico analysis to identify regulatory genes whose expression correlation to GSK3β messenger RNA utilizing two lung cancer cell line array datasets. Among potential regulatory partners of GSK3β, these studies identified the RNA-binding protein ELAVL-1/HuR (Embryonic Lethal, Abnormal Vision, Drosophila-Like as a central component in a likely GSK3β signaling network. ELAVL-1/HuR is a RNA-binding protein that selectively binds to AU-rich elements of mRNA and enhances its stability thereby increasing target gene expression. Subsequent studies with siRNA suppression of ELAVL-1/HuR demonstrated deceased GSK3β mRNA and protein expression and improved clearance of FITC-albumin in A549 cells. Conversely, stabilization of ELAVL-1/HuR with the proteasome inhibitor MG-132 resulted in induction of GSK3β at mRNA and protein level and attenuated FITC-albumin clearance. Utilizing ventilator-induced lung injury or intra-tracheal installation of hydrochloric acid to induce ARDS in mice, we observed increased mRNA and protein expression of ELAVL-1/HuR and GSK3β. Together, our findings indicate a previously unknown interaction between GSK3β and ELAV-1 during ARDS, and suggest the inhibition of the ELAV-1- GSK3β pathways as a novel ARDS treatment approach.

  12. A single nucleotide polymorphism in the zona pellucida 3 gene is associated with the first parity litter size in Hu sheep.

    Science.gov (United States)

    Chong, Yuqing; Huang, Huarong; Liu, Guiqiong; Jiang, Xunping; Rong, Weiheng

    2018-03-31

    Zona pellucida 3 (ZP3) is a primary sperm receptor and acrosome reaction inducer. As a candidate gene, the ZP3 gene has been widely studied since it has great influence on reproductive traits in farm animals. However, little is known about the association between polymorphisms of the coding region of the ZP3 gene and the first parity litter size in Hu sheep. Therefore, the objective of this study was to identify single nucleotide polymorphisms (SNPs) of the ZP3 gene associated with the first parity litter size in Hu sheep. A total of 462 female Hu sheep were sampled to detect SNPs in the coding region of the ZP3 gene. Six SNPs were identified and the reliability of all estimated allele frequencies reached 0.9545 except for one locus (g.2293C > T). SNP (rs401271989) was identified as that involved in amino acid change (Ile → Leu). This amino acid was located at the beginning of a β-strand and outside of the ZP3 protein membrane, and it was most likely to be a ligand-binding site (the possibility was 0.917). At this locus, individuals with AC genotype had a larger litter size than those with CC genotype in the first parity (2.050 vs 1.727, p size in Hu sheep, and it may affect the function of ZP3 protein by impacting the secondary and tertiary protein structures. The present study demonstrates that SNP (rs401271989) could be used in marker-assisted selection of the first parity litter size in Hu sheep. Copyright © 2018 Elsevier B.V. All rights reserved.

  13. Modelo de gestión cultural: Una experiencia con el Qhapaq Ñan en Huánuco

    Directory of Open Access Journals (Sweden)

    Denesy Palacios Jiménez

    2014-06-01

    Full Text Available Objetivos: Plantear el aprovechamiento del patrimonio cultural arqueológico del Qhapaq Ñan en Huánuco en condición de parque cultural, mediante un modelo eficiente de gestión cultural basada en la investigación, protección, conservación y uso social, para convertir a este lugar en un destino turístico y así contribuir con un proyecto no solo para salvaguardarlo sino también para incrementar los ingresos económicos y reducir los niveles de pobreza en la zona. Métodos: Se trata de un estudio que describe y recoge experiencias de gestión cultural respecto a cómo se aprovecha en otros sitios el legado o patrimonio cultural arqueológico, tanto en el ámbito mundial como nacional. La investigación fue cuantitativa y cualitativa, con un alcance correlacional. Se usó el diseño descriptivo, comparativo, analítico, histórico, deductivo. Resultados: El estudio plantea la necesidad de optimizar los recursos para el aprovechamiento del Qhapaq Ñan como parque cultural a través de una adecuada gestión cultural, y que dicho parque comprenderá 68,34 km, desde el tambo de Tambococha o Tunsucancha hasta el tambo de Taparako, por ser uno de los tramos mejor conservados e involucra importantes zonas de patrimonio cultural material e inmaterial. Conclusiones: El Camino Inca en Huánuco es uno de los patrimonios más importantes del país, y es posible ser impulsado como un parque cultural mediante un modelo de gestión cultural, si tenemos en cuenta las diversas experiencias de gestión en el país y en mundo, cuyos aportes deben servir de apoyo para un modelo de gestión en este campo.

  14. Comments on the paper 'Sorption of radionickel to goethite: effect of water quality parameters and temperature' by Hu et al

    International Nuclear Information System (INIS)

    Yuh-Shan Ho

    2011-01-01

    Recently, Hu et al. [1]. published a paper with the above title. In section 'Effect of contact time', the authors stated, 'In order to study the sorption rate constant of Ni(II) to goethite, the pseudo-second-order rate equation was used to fit the kinetic sorption of Ni(II) to goethite' and referred to two self-citations published in 2008 and 2010 respectively [2, 3]. In fact, this kinetic model has already been published first in 1996 [4], and a modified model was presented in the following years to correct a mistake in the 1996 paper [5-7]. However the mistake in the model was duplicated by other researchers [8, 9]. In order to stop the proliferation of the mistake a comment has been made [10]. This type of error could be avoided if authors have had paid more attentions to details about the model from the original paper [11]. Accuracy in citing references is very important for the transmission of scientific knowledge. Citation errors reflect poorly on authors who republish original ideas that were already published. Hopefully, the identification of this type of problems will lead to improved accuracy in referencing [12]. Authors should make serious efforts to check the accuracy of references cited in their manuscripts as well as to read the original article before quoting it rather than citing from abstracts or cross-references [13]. It is recommended that more attention should be paid in preparing bibliographies and in checking quoted references [14]. (author)

  15. Karyotypes of Akodon orophilus Osgood 1913 and Thomasomys sp. (Rodentia: Sigmodontinae from Huánuco, Peru

    Directory of Open Access Journals (Sweden)

    Víctor Pacheco

    2012-10-01

    Full Text Available Conventional chromosomal preparations were made of three native mice from Huánuco, Peru: a male and a female of Thomasomys sp., and a male of Akodon orophilus. Thomasomys sp. had a karyotype of 2n = 42, XY (n = 21, meanwhile A. orophilus presented 2n = 22, XY (n = 11. Comparisons between chromosomal pairs from the existent literature indicate that both are new karyotypes. Thomasomys sp. has a distinct sexual Y chromosome, the only metacentric (m reported for the genus. The chromosomes X and Y of A. orophilus are acrocentrics (a; and the length of chromosome Y (2/3 of the length of X distinguishes A. orophilus from other congeneric. Because the structural differences between the sexual chromosomes usually generates mechanism of reproductive isolation at intraspecific level and are bigger still in interspecific crosses, we concluded that the karyotypes reported here support the validity of the species A. orophilus and suggest that Thomasomys sp. represents a new species to science.

  16. Renal Protective Effect of Xiao-Chai-Hu-Tang on Diabetic Nephropathy of Type 1-Diabetic Mice

    Directory of Open Access Journals (Sweden)

    Chun-Ching Lin

    2012-01-01

    Full Text Available Xiao-Chai-Hu-Tang (XCHT, a traditional Chinese medicine formula consisting of seven medicinal plants, is used in the treatment of various diseases. We show here that XCHT could protect type-1 diabetic mice against diabetic nephropathy, using streptozotocin (STZ-induced diabetic mice and high-glucose (HG-exposed rat mesangial cell (RMC as models. Following 4 weeks of oral administration with XCHT, renal functions and renal hypertrophy significantly improved in the STZ-diabetic mice, while serum glucose was only moderately reduced compared to vehicle treatment. Treatment with XCHT in the STZ-diabetic mice and HG-exposed RMC resulted in a decrease in expression levels of TGF-β1, fibronectin, and collagen IV, with concomitant increase in BMP-7 expression. Data from DPPH assay, DHE stain, and CM-H2DCFDA analysis indicated that XCHT could scavenge free radicals and inhibit high-glucose-induced ROS in RMCs. Taken together, these results suggest that treatment with XCHT can improve renal functions in STZ-diabetic mice, an effect that is potentially mediated through decreasing oxidative stress and production of TGF-β1, fibronectin, and collagen IV in the kidney during development of diabetic nephropathy. XCHT, therefore merits further investigation for application to improve renal functions in diabetic disorders.

  17. Synergistic Anticancer Effects of Vorinostat and Epigallocatechin-3-Gallate against HuCC-T1 Human Cholangiocarcinoma Cells

    Directory of Open Access Journals (Sweden)

    Tae Won Kwak

    2013-01-01

    Full Text Available The aim of this study was to investigate the effect of the combination of vorinostat and epigallocatechin-3-gallate against HuCC-T1 human cholangiocarcinoma cells. A novel chemotherapy strategy is required as cholangiocarcinomas rarely respond to conventional chemotherapeutic agents. Both vorinostat and EGCG induce apoptosis and suppress invasion, migration, and angiogenesis of tumor cells. The combination of vorinostat and EGCG showed synergistic growth inhibitory effects and induced apoptosis in tumor cells. The Bax/Bcl-2 expression ratio and caspase-3 and -7 activity increased, but poly (ADP-ribose polymerase expression decreased when compared to treatment with each agent alone. Furthermore, invasion, matrix metalloproteinase (MMP expression, and migration of tumor cells decreased following treatment with the vorinostat and EGCG combination compared to those of vorinostat or EGCG alone. Tube length and junction number of human umbilical vein endothelial cells (HUVECs decreased as well as vascular endothelial growth factor expression following vorinostat and EGCG combined treatment. These results indicate that the combination of vorinostat and EGCG had a synergistic effect on inhibiting tumor cell angiogenesis potential. We suggest that the combination of vorinostat and EGCG is a novel option for cholangiocarcinoma chemotherapy.

  18. [Textual research on Guang dong xin yu (New Sayings of Guangdong) quoted in Ben cao gang mu shi yi (Supplements to Compendium of Materia Medica].

    Science.gov (United States)

    Zhang, Ruixian; Zhang, Wei; Li, Jian; Liang, Fei

    2014-05-01

    Altogether 15 terms for Guang dong xin yu (New Sayings of Guangdong) were used in Ben cao gang mu shi yi (Supplements to Compendium of Materia Medica), including Yue yu (Cantonese sayings), Chong yu (Sayings from Insect Drug), Jie yu (Sayings from Crustacean Drug), Xin yu (New Sayings), Yue hai xiang yu (Fragrant Sayings from Cantonese Region), Yue zhi mu yu (Sayings from Plants in Cantonese Annals), Guang dong suo yu (Trivial Sayings from Guangdong), Yue shan lu (Records of Cantonese Mountains), Yue lu (Cantonese Records), Jiao guang lu (Joint Guangdong Records), Yue cao zhi (Records of Cantonese Grasses), Guang guo lu (Records of Guangdong Fruits), Nan yue suo ji (Trivial Records of Southern Canton), Guang zhi (Guangdong Records), Yue zhi (Cantonese Records) etc. dealing with 57 sorts of drugs (with individual overlapping ones), the author of Xin yu was Qu Dajun, a surviving fogy of the Ming Dynasty actively involved in the activities to restore the old dynasty and resist the Qing Dynasty, and was persecuted in the literary inquisition in which his works were burnt so that Zhao Xuemin, when quoting his texts, had to go in a roundabout way.

  19. Avaliação dos óbitos ocorridos no Hospital Universitário da Universidade Federal de Santa Catarina (HU/UFSC Evaluation of deaths occurred at the University Hospital (HU/UFSC

    Directory of Open Access Journals (Sweden)

    Rachel Duarte Moritz

    2008-10-01

    Full Text Available OBJETIVO: Avaliar os óbitos ocorridos no HU/UFSC. Comparar o perfil dos pacientes que morreram nas enfermarias com o daqueles que morreram na UTI. Verificar se os óbitos foram considerados esperados (E e não evitáveis (NE. Constatar se houve recusa/suspensão de terapêutica (RST precedendo a morte. MÉTODOS: Obtivemos dados por meio de ficha elaborada pela Comissão de Óbito Hospitalar (COH, na qual constavam os aspectos demográficos, clínicos e terapêuticos dos pacientes e a avaliação da COH sobre a expectativa/evitabilidade dos óbitos. RESULTADOS: Analisamos os dados dos 326 pacientes com mais de 14 anos, que morreram entre julho/2004 e dezembro/2005. Desses, 128 morreram na UTI (G1 e 198 nas enfermarias (G2. A RST precedeu 38,2% dos óbitos no G1 e 2% no G2 (pOBJECTIVE: To evaluate the deaths which occurred at the HU/UFSC. To compare the profile of patients who died in the wards with that of patients who died in the ICU. To classify deaths which were expected or not, and avoidable or not. To verify how often withholding or withdrawing (WW therapy preceded death. METHODS: Archives of the Hospital Death Commission (HDC were analyzed. The clinical and demographic records were retrieved from the HDC data bank. Deaths were classified by the HDC as expected or not and avoidable or not. RESULTS: Data from 326 dead persons over 14 years of age were analyzed. One hundred and twenty eight deaths occurred in the ICU (G1 and 198 in the wards (G2. WW therapy preceded 38.2% of deaths in G1 and 2% in G2 (p<0.001. The main WW therapies were vasoactive drugs and antibiotics. Almost 20% of deaths were unexpected/avoidable in G1. In G2 6.5% were considered unexpected and 5% avoidable (p<0.005. Patients in G1 were younger and mostly male (p<0.005. Do-not-resuscitate orders were registered in 48.4% of patients' medical charts in G2 and 6.3% in G1 (p<0.001. Cardiopulmonary resuscitation was performed in 23.4% of patients in G1 and in 5.5% in G2 (p<0

  20. Aryl hydrocarbon receptor-dependent retention of nuclear HuR suppresses cigarette smoke-induced cyclooxygenase-2 expression independent of DNA-binding.

    Science.gov (United States)

    Zago, Michela; Sheridan, Jared A; Nair, Parameswaran; Rico de Souza, Angela; Gallouzi, Imed-Eddine; Rousseau, Simon; Di Marco, Sergio; Hamid, Qutayba; Eidelman, David H; Baglole, Carolyn J

    2013-01-01

    The aryl hydrocarbon receptor (AhR), a ligand-activated transcription factor that responds to man-made environmental toxicants, has emerged as an endogenous regulator of cyclooxygenase-2 (Cox-2) by a mechanism that is poorly understood. In this study, we first used AhR-deficient (AhR(-/-) ) primary pulmonary cells, together with pharmacological tools to inhibit new RNA synthesis, to show that the AhR is a prominent factor in the destabilization of Cox-2 mRNA. The destabilization of Cox-2 mRNA and subsequent suppression of cigarette smoke-induced COX-2 protein expression by the AhR was independent of its ability to bind the dioxin response element (DRE), thereby differentiating the DRE-driven toxicological AhR pathway from its anti-inflammatory abilities. We further describe that the AhR destabilizes Cox-2 mRNA by sequestering HuR within the nucleus. The role of HuR in AhR stabilization of Cox-2 mRNA was confirmed by knockdown of HuR, which resulted in rapid Cox-2 mRNA degradation. Finally, in the lungs of AhR(-/-) mice exposed to cigarette smoke, there was little Cox-2 mRNA despite robust COX-2 protein expression, a finding that correlates with almost exclusive cytoplasmic HuR within the lungs of AhR(-/-) mice. Therefore, we propose that the AhR plays an important role in suppressing the expression of inflammatory proteins, a function that extends beyond the ability of the AhR to respond to man-made toxicants. These findings open the possibility that a DRE-independent AhR pathway may be exploited therapeutically as an anti-inflammatory target.

  1. A comparative study of oral health attitudes and behavior using the Hiroshima University-Dental Behavioral Inventory (HU-DBI) between dental and civil engineering students in Colombia.

    Science.gov (United States)

    Jaramillo, Jorge A; Jaramillo, Fredy; Kador, Itzjak; Masuoka, David; Tong, Liyue; Ahn, Chul; Komabayashi, Takashi

    2013-03-01

    The aim of this study was to use the Hiroshima University - Dental Behavioral Inventory (HU-DBI) to compare oral health attitudes and behavior of dental and civil engineering students in Colombia. The HU-DBI's survey consisting of twenty dichotomous responses (agree-disagree) regarding tooth brushing, was completed at University Antonio Narino for the dental students and the University of Cauca for the civil engineering students. The Spanish version of the HU-DBI questionnaire was taken by 182 of 247 dental students and 411 of 762 engineering students. The data was-statistically analyzed by the chi-square test and backward logistic regression. Compared to the engineering students, the dental students were more likely to agree with questions such as "I am bothered by the color of my gums"(OR = 2.2, 95% CI: 1.3-3.7),"I think I can clean my teeth well without using toothpaste" (OR = 3.0, 95% CI: 1.5-5.9), "I have used a dye to see how clean my teeth are" (OR = 2.9, 95% CI: 1.9-4.3), and "I have had my dentist tell me that I brush very well" (OR = 2.0, 95% CI: 1.3-3.1). The dental education curriculum in a dental school compared to a civil engineering school in Colombia indicated that a three-phase curriculum in didactics and clinics increased oral health attitudes and behavior from entry to graduation.

  2. HU participates in expression of a specific set of genes required for growth and survival at acidic pH in Escherichia coli.

    Science.gov (United States)

    Bi, Hongkai; Sun, Lianle; Fukamachi, Toshihiko; Saito, Hiromi; Kobayashi, Hiroshi

    2009-05-01

    The major histone-like Escherichia coli protein, HU, is composed of alpha and beta subunits respectively encoded by hupA and hupB in Escherichia coli. A mutant deficient in both hupA and hupB grew at a slightly slower rate than the wild type at pH 7.5. Growth of the mutant diminished with a decrease in pH, and no growth was observed at pH 4.6. Mutants of either hupA or hupB grew at all pH levels tested. The arginine-dependent survival at pH 2.5 was diminished approximately 60-fold by the deletion of both hupA and hupB, whereas the survival was slightly affected by the deletion of either hupA or hupB. The mRNA levels of adiA and adiC, which respectively encode arginine decarboxylase and arginine/agmatine antiporter, were low in the mutant deficient in both hupA and hupB. The deletion of both hupA and hupB had little effect on survival at pH 2.5 in the presence of glutamate or lysine, and expression of the genes for glutamate and lysine decarboxylases was not impaired by the deletion of the HU genes. These results suggest that HU regulates expression of the specific set of genes required for growth and survival in acidic environments.

  3. Autoregulation of transcription of the hupA gene in Escherichia coli: evidence for steric hindrance of the functional promoter domains induced by HU.

    Science.gov (United States)

    Kohno, K; Yasuzawa, K; Hirose, M; Kano, Y; Goshima, N; Tanaka, H; Imamoto, F

    1994-06-01

    The molecular mechanism of autoregulation of expression of the hupA gene in Escherichia coli was examined. The promoter of the gene contains a palindromic sequence with the potential to form a cruciform DNA structure in which the -35 sequence lies at the base of the stem and the -10 sequence forms a single-stranded loop. An artificial promoter lacking the palindrome, which was constructed by replacing a 10 nucleotide repeat for the predicted cruciform arm by a sequence in the opposite orientation, was not subject to HU-repression. DNA relaxation induced by deleting HU proteins and/or inhibiting DNA gyrase in cells results in increased expression from the hupA promoter. We propose that initiation of transcription of the hupA gene is negatively regulated by steric hindrance of the functional promoter domains for formation of the cruciform configuration, which is facilitated at least in part by negative supercoiling of the hupA promoter DNA region. The promoter region of the hupB gene also contains a palindromic sequence that can assume a cruciform configuration. Negative regulation of this gene by HU proteins may occur by a mechanism similar to that operating for the hupA gene.

  4. Adrenaline promotes epithelial-to-mesenchymal transition via HuR-TGFβ regulatory axis in pancreatic cancer cells and the implication in cancer prognosis.

    Science.gov (United States)

    Pu, Jun; Zhang, Xiaorui; Luo, Huiwen; Xu, Lijuan; Lu, Xiaozhao; Lu, Jianguo

    2017-11-25

    Psychological stress has recently been described as a risk factor in the development of pancreatic cancer. Here, we reported that increased neurotransmitter adrenaline was associated with the poor survival in pancreatic cancer patients. Moreover, in the cell model study, we found adrenaline promoted pancreatic cell PANC-1 migration in a dose dependent manner. Block of the β2-adrenoreceptor with ICI118,551, significantly reduced cell migration. Further study found that adrenaline induced a cytoplasmic translocation of RNA binding protein HuR, which in turn activated TGFβ, as shown by the SBE luciferase assay and phosphorylation of Smad2/3. Either HuR knockdown or TGFβ inhibition reduced cell migration induced by adrenaline. Taken together, our study here revealed that adrenaline-HuR-TGFβ regulatory axis at least partially contributes to the psychological stress induced metastasis in PANC-1 cells, shedding light on therapeutic targeting psychological stress in improving the prognosis of pancreatic cancer. Copyright © 2017 Elsevier Inc. All rights reserved.

  5. HuR and Ago2 Bind the Internal Ribosome Entry Site of Enterovirus 71 and Promote Virus Translation and Replication.

    Directory of Open Access Journals (Sweden)

    Jing-Yi Lin

    Full Text Available EV71 (enterovirus 71 RNA contains an internal ribosomal entry site (IRES that directs cap-independent initiation of translation. IRES-dependent translation requires the host's translation initiation factors and IRES-associated trans-acting factors (ITAFs. We reported recently that mRNA decay factor AUF1 is a negative-acting ITAF that binds IRES stem-loop II. We also reported that the small RNA-processing enzyme Dicer produces at least four small RNAs (vsRNAs from the EV71 IRES. One of these, vsRNA1, derived from IRES stem-loop II, reduces IRES activity and virus replication. Since its mechanism of action is unknown, we hypothesized that it might control association of ITAFs with the IRES. Here, we identified the mRNA stability factor HuR and the RISC subunit Argonaute 2 (Ago2 as two ITAFs that bind stem-loop II. In contrast to AUF1, HuR and Ago2 promote EV71 IRES activity and virus replication. In vitro RNA-binding assays revealed that vsRNA1 can alter association of Ago2, HuR, and AUF1 with stem-loop II. This presents a possible mechanism by which vsRNA1 could control viral translation and replication.

  6. Combined influence of CT random noise and HU-RSP calibration curve nonlinearities on proton range systematic errors

    Science.gov (United States)

    Brousmiche, S.; Souris, K.; Orban de Xivry, J.; Lee, J. A.; Macq, B.; Seco, J.

    2017-11-01

    Proton range random and systematic uncertainties are the major factors undermining the advantages of proton therapy, namely, a sharp dose falloff and a better dose conformality for lower doses in normal tissues. The influence of CT artifacts such as beam hardening or scatter can easily be understood and estimated due to their large-scale effects on the CT image, like cupping and streaks. In comparison, the effects of weakly-correlated stochastic noise are more insidious and less attention is drawn on them partly due to the common belief that they only contribute to proton range uncertainties and not to systematic errors thanks to some averaging effects. A new source of systematic errors on the range and relative stopping powers (RSP) has been highlighted and proved not to be negligible compared to the 3.5% uncertainty reference value used for safety margin design. Hence, we demonstrate that the angular points in the HU-to-RSP calibration curve are an intrinsic source of proton range systematic error for typical levels of zero-mean stochastic CT noise. Systematic errors on RSP of up to 1% have been computed for these levels. We also show that the range uncertainty does not generally vary linearly with the noise standard deviation. We define a noise-dependent effective calibration curve that better describes, for a given material, the RSP value that is actually used. The statistics of the RSP and the range continuous slowing down approximation (CSDA) have been analytically derived for the general case of a calibration curve obtained by the stoichiometric calibration procedure. These models have been validated against actual CSDA simulations for homogeneous and heterogeneous synthetical objects as well as on actual patient CTs for prostate and head-and-neck treatment planning situations.

  7. Benchmark critical experiments on low-enriched uranium oxide systems with H/U = 0.77

    International Nuclear Information System (INIS)

    Tuck, G.; Oh, I.

    1979-08-01

    Ten benchmark experiments were performed at the Critical Mass Laboratory at Rockwell International's Rocky Flats Plant, Golden, Colorado, for the US Nuclear Regulatory Commission. They provide accurate criticality data for low-enriched damp uranium oxide (U 3 O 8 ) systems. The core studied consisted of 152 mm cubical aluminum cans containing an average of 15,129 g of low-enriched (4.46% 235 U) uranium oxide compacted to a density of 4.68 g/cm 3 and with an H/U atomic ratio of 0.77. One hundred twenty five (125) of these cans were arranged in an approx. 770 mm cubical array. Since the oxide alone cannot be made critical in an array of this size, an enriched (approx. 93% 235 U) metal or solution driver was used to achieve criticality. Measurements are reported for systems having the least practical reflection and for systems reflected by approx. 254-mm-thick concrete or plastic. Under the three reflection conditions, the mass of the uranium metal driver ranged from 29.87 kg to 33.54 kg for an oxide core of 1864.6 kg. For an oxide core of 1824.9 kg, the weight of the high concentration (351.2 kg U/m 3 ) solution driver varied from 14.07 kg to 16.14 kg, and the weight of the low concentration (86.4 kg U/m 3 ) solution driver from 12.4 kg to 14.0 kg

  8. ESR1 Gene Polymorphisms and Prostate Cancer Risk: A HuGE Review and Meta-Analysis.

    Directory of Open Access Journals (Sweden)

    Yu-Mei Wang

    Full Text Available Many published data on the association between single nucleotide polymorphisms (SNPs in the ESR1 gene and prostate cancer susceptibility are inconclusive. The aim of this Human Genome Epidemiology (HuGE review and meta-analysis is to derive a more precise estimation of this relationship.A literature search of PubMed, Embase, Web of Science and Chinese Biomedical (CBM databases was conducted from their inception through July 1st, 2012. Crude odds ratios (ORs with 95% confidence intervals (CIs were calculated to assess the strength of association.Twelve case-control studies were included with a total 2,165 prostate cancer cases and 3,361 healthy controls. When all the eligible studies were pooled into the meta-analysis, ESR1 PvuII (C>T and XbaI (A>G polymorphisms showed no association with the risk of prostate cancer. However, in the stratified analyses based on ethnicity and country, the results indicated that ESR1 PvuII (C>T polymorphism was significantly associated with increased risk of prostate cancer among Asian populations, especially among Indian population; while ESR1 XbaI (A>G polymorphism may significantly increase the risk of prostate cancer among American population. Furthermore, we also performed a pooled analysis for all eligible case-control studies to explore the role of codon 10 (T>C, codon 325 (C>G, codon 594 (G>A and +261G>C polymorphisms in prostate cancer risk. Nevertheless, no significant associations between these polymorphisms and the risk of prostate cancer were observed.Results from the current meta-analysis indicate that ESR1 PvuII (C>T polymorphism may be a risk factor for prostate cancer among Asian populations, especially among Indian population; while ESR1 XbaI (A>G polymorphism may increase the risk of prostate cancer among American population.

  9. A.~()HU

    African Journals Online (AJOL)

    officer training college to improve the professional standards of ..... secret, rifts have arisen over internment policy and the Ulster ... racks life in Germany offers little compensation for this. .... Clausewitzian principle of civil-military balance, has.

  10. Applying dam height-storage curve to geomorphic features analysis within virtual geographic environment: a case study of the Hong-Shi-Mao watershed

    Science.gov (United States)

    Wang, Daojun; Gong, Jianhua; Ma, Ainai; Li, Wenhang; Wang, Xijun

    2005-10-01

    There are generally two kinds of approaches to studying geomorphic features in terms of the quantification level and difference of major considerations. One is the earlier qualitative characterization, and the other is the 2-dimension measurement that includes section pattern and projection pattern. With the development of geo-information technology, especially the 3-D geo-visualization and virtual geographic environments (VGE), 3-dimension measurement and dynamic interactive between users and geo-data/geo-graphics can be developed to understand geomorphic features deeply, and to benefit to the effective applications of such features for geographic projects like dam construction. Storage-elevation curve is very useful for site selection of projects and flood dispatching in water conservancy region, but it is just a tool querying one value from the other one. In fact, storage-elevation curve can represent comprehensively the geomorphic features including vertical section, cross section of the stream and the landform nearby. In this paper, we use quadratic regression equation shaped like y = ax2 + bx + c and the DEM data of Hong-Shi-Mao watershed, Zi Chang County, ShaanXi Province, China to find out the relationship between the coefficients of the equation and the geomorphic features based on VGE platform. It's exciting that the coefficient "a" appear to be correlative strongly with the stream scale, and the coefficient "b" may give an index to the valley shape. In the end, we use a sub-basin named Hao-Jia-Gou of the watershed as an application. The result of correlative research about quadratic regression equation and geomorphic features can save computing and improve the efficiency in silt dam systems planning.

  11. Genetic inactivation of the Fanconi anemia gene FANCC identified in the hepatocellular carcinoma cell line HuH-7 confers sensitivity towards DNA-interstrand crosslinking agents

    Directory of Open Access Journals (Sweden)

    Bassermann Florian

    2010-05-01

    Full Text Available Abstract Background Inactivation of the Fanconi anemia (FA pathway through defects in one of 13 FA genes occurs at low frequency in various solid cancer entities among the general population. As FA pathway inactivation confers a distinct hypersensitivity towards DNA interstrand-crosslinking (ICL-agents, FA defects represent rational targets for individualized therapeutic strategies. Except for pancreatic cancer, however, the prevalence of FA defects in gastrointestinal (GI tumors has not yet been systematically explored. Results A panel of GI cancer cell lines was screened for FA pathway inactivation applying FANCD2 monoubiquitination and FANCD2/RAD51 nuclear focus formation and a newly identified FA pathway-deficient cell line was functionally characterized. The hepatocellular carcinoma (HCC line HuH-7 was defective in FANCD2 monoubiquitination and FANCD2 nuclear focus formation but proficient in RAD51 focus formation. Gene complementation studies revealed that this proximal FA pathway inactivation was attributable to defective FANCC function in HuH-7 cells. Accordingly, a homozygous inactivating FANCC nonsense mutation (c.553C > T, p.R185X was identified in HuH-7, resulting in partial transcriptional skipping of exon 6 and leading to the classic cellular FA hypersensitivity phenotype; HuH-7 cells exhibited a strongly reduced proliferation rate and a pronounced G2 cell cycle arrest at distinctly lower concentrations of ICL-agents than a panel of non-isogenic, FA pathway-proficient HCC cell lines. Upon retroviral transduction of HuH-7 cells with FANCC cDNA, FA pathway functions were restored and ICL-hypersensitivity abrogated. Analyses of 18 surgical HCC specimens yielded no further examples for genetic or epigenetic inactivation of FANCC, FANCF, or FANCG in HCC, suggesting a low prevalence of proximal FA pathway inactivation in this tumor type. Conclusions As the majority of HCC are chemoresistant, assessment of FA pathway function in HCC could

  12. Effectiveness of the HuCare Quality Improvement Strategy on health-related quality of life in patients with cancer: study protocol of a stepped-wedge cluster randomised controlled trial (HuCare2 study).

    Science.gov (United States)

    Caminiti, Caterina; Iezzi, Elisa; Passalacqua, Rodolfo

    2017-10-06

    Our group previously demonstrated the feasibility of the HuCare Quality Improvement Strategy (HQIS), aimed at integrating into practice six psychosocial interventions recommended by international guidelines. This trial will assess whether the introduction of the strategy in oncology wards improves patient's health-related quality of life (HRQoL). Multicentre, incomplete stepped-wedge cluster randomised controlled trial, conducted in three clusters of five centres each, in three equally spaced time epochs. The study also includes an initial epoch when none of the centres are exposed to the intervention, and a final epoch when all centres will have implemented the strategy. The intervention is applied at a cluster level, and assessed at an individual level with cross-sectional model. A total of 720 patients who received a cancer diagnosis in the previous 2 months and about to start medical treatment will be enrolled. The primary aim is to evaluate the effectiveness of the HQIS versus standard care in terms of improvement of at least one of two domains (emotional and social functions) of HRQoL using the EORTC QLQ-C30 (European Organisation for Research and Treatment of Cancer Quality of Life Questionnaire-Core 30 items) questionnaire, at baseline and at 3 months. This outcome was chosen because patients with cancer generally exhibit low HRQoL, particularly at certain stages of care, and because it allows to assess the strategy's impact as perceived by patients themselves. The HQIS comprises three phases: (1) clinician training-to improve communication-relational skills and instruct on the project; (2) centre support-four on-site visits by experts of the project team, aimed to boost motivation, help with context analysis and identification of solutions; (3) implementation of Evidence-Based Medicine (EBM) recommendations at the centre. Ethics committee review approval has been obtained from the Ethics Committee of Parma. Results will be disseminated at conferences, and

  13. Response to Commentary on Cheng, Broome, Feng, and Hu (2017) Leadership behaviours play a significant role in implementing evidence-based practice. Journal of Clinical Nursing, 2018;27:e1684-e1685.

    Science.gov (United States)

    Cheng, Lei; Feng, Sheng; Hu, Yan; Broome, Marion E

    2018-06-12

    Thank you for the opportunity to respond to Hu and Gifford's comments(Hu & Gifford, 2018). We appreciated their acknowledgement of our findings about the factors influencing the successful implementation of evidence-based practice (EBP). The authors described leadership behaviors as having a significant role in implementing evidence-based practice. This article is protected by copyright. All rights reserved. This article is protected by copyright. All rights reserved.

  14. Phase I trial of anti-GD2 monoclonal antibody hu3F8 plus GM-CSF: Impact of body weight, immunogenicity and anti-GD2 response on pharmacokinetics and survival.

    Science.gov (United States)

    Cheung, Irene Y; Kushner, Brian H; Modak, Shakeel; Basu, Ellen M; Roberts, Stephen S; Cheung, Nai-Kong V

    2017-01-01

    Fifty-seven stage 4 patients with refractory/relapsed neuroblastoma were enrolled in a phase I trial (Clinicaltrials.gov NCT01757626) using humanized anti-GD2 monoclonal antibody hu3F8 in combination with granulocyte-macrophage colony-stimulating factor. The influence of body weight and human anti-human antibody (HAHA) on the pharmacokinetics (PK) of hu3F8, and the effect of de novo anti-GD2 response on patient outcome were explored. Serum samples before hu3F8 infusion, and serially up to day 12 during treatment cycle #1, and at 5 min after each hu3F8 infusion for all subsequent cycles were collected. PK was analyzed using non-compartmental modeling. Immunogenicity was assayed by HAHA response, and vaccination effect by induced host anti-GD2 response measured periodically until disease progression or last followup. Progression-free and overall survival was estimated by the Kaplan-Meier method. Despite dosing being based on body weight, smaller patients had consistently lower area-under-the-curve and faster clearance over the 15 dose levels (0.9 to 9.6 mg/kg per treatment cycle) in this trial. Positive HAHA, defined by the upper limit of normal, when measured within 10 days from the last hu3F8 dose received, was associated with significantly lower serum hu3F8. Despite prior sensitization to other anti-GD2 antibody, e.g. mouse 3F8 or ch14.18, 75% of the patients never developed HAHA response even after getting more treatment cycles. Hu3F8 induced a de novo anti-GD2 response in patients, which was prognostic of progression-free survival. We conclude that hu3F8 had low immunogenicity. During treatment, positive HAHA and low body weight affected PK adversely, whereas induced anti-GD2 response was an outcome predictor.

  15. Pituitary-dependent hyperadrenocorticism in a shi tzu dog treated with twice-daily oral trilostane: a case reportHyperadrenocorticismo hipófise dependente em um cão shi tzu tratado com trilostane oral a cada 12 horas: relato de caso

    Directory of Open Access Journals (Sweden)

    Lucas Alécio Gomes

    2012-10-01

    Full Text Available Hyperadrenocorticism can be defined as a chronic high circulating cortisol, and is a relatively common disease in dogs when compared to cats. Of dogs with naturally occurring HAC, 80 to 85% have pituitary-dependent hyperadrenocorticism (PDH, which is an excessive secretion of ACTH by the pituitary, causing bilateral adrenal hyperplasia and excessive secretion of glucocorticoids. More than 90% of dogs with PDH have a pituitary tumor. The aim of this article is to report a case of a dog, seven years old, female, Shi Tzu, that presented with panting, polyuria/polydipsia, polyphagia, pendulous abdomen and bilateral abdominal alopecia, and intermittent weakness in the pelvic limbs. Based on laboratorial and screening tests a pituitary-dependent hyperadrenocorticism was diagnosed and treated with twice-daily trilostane, orally. In the early monitoring period, ACTH test was performed with an unusual interval (to 30 days. In this case, the starting dose didn’t show improvement in the cutaneous alterations, requiring an increase on the dosage. Hiperadrenocorticismo (HAC é uma doença relativamente comum em cães quando comparado aos gatos e pode ser definido como aumento persistente do cortisol na circulação sanguínea. Quanto ao tipo de manifestação o HAC hipófise-dependente ocorre em 80 a 85% dos casos, causando secreção excessiva de ACTH pela hipófise levando ao aumento bilateral das glândulas adrenais. Mais de 90% dos casos de HAC hipófise-dependente (em cães ocorrem devido a tumores na glândula. O objetivo deste trabalho é relatar o caso de uma cadela da raça Shi Tzu, com sete anos de idade, que apresentou respiração ofegante, poliúria/polidipsia, polifagia, abdome pendular, alopecia bilateral simétrica e fraqueza intermitente em membros pélvicos. Os exames laboratoriais de rotina associados aos testes de triagem confirmaram a suspeita de hiperadrenocorticismo hipófise dependente. O tratamento desde o início tem sido com

  16. Visualization of Moderator Circulation with 1/8 scaled HU-KINS for Calandria Tank of CANDU6

    International Nuclear Information System (INIS)

    Cho, Dae Kun; Kim, Nam Seok; Lee, Jae Young; Kim, Man Woong

    2005-01-01

    The moderator cooling capability of Calandria tank is important during the hypothetical incident of CANDU reactor. Even though the loss of ECCS cooling, the heat of the nuclear fuel can be cooled by the heat transfer path through the contacting location between the pressure tube and Calandria tube. The moderator cooling system removes the heat from the fuel so it pays an ultimate heat sink for the nuclear safety. Therefore, the understanding and estimating the thermal hydraulic conditions of the circulating moderator in the Calandria is of importance. However, the three dimensional nature and complexity of the Calandria tubes make it difficult to analyze. Recent progress in the the three dimensional computational fluid dynamics including the model of turbulent flow stimulate the studies on this subject. For the design or safety analysis purpose, the mesh generation and furnishing proper physical models are imperative and the experimental validation should be performed. However, the experimental facilities have been constructed in the scaled way by the Canadian research groups, AECL and COG. Two facilities: SPEL (1/10 scale by Koroyannaski, 1983) and STERN (1/4 scale by Hadaller, 1990) have been producing experimental data such as the local temperatures and velocities. Several papers has been published to report their CFD codes can be available for the CANDU analysis by comparing the calculations with the experimental results of those facilities. However, as noted by Lee et al. the previous experimental facilities were not scaled properly both in the sense of the force balance between buoyancy force and the jet inertia force. Also, the power density of the moderator was not scaled properly. Therefore, it cannot be said that the observations through SPEL and STERN may have a certain discrepancy from the real CANDU-6 plant. Lee et al (2003) developed the scaling laws for the CANDU-6 and design a 1/8 scale experimental facility named as HU-KINS. In the present paper

  17. Studies on the structures of the Tm, Sj, M1, Can, Sext and Hu blood group antigens.

    Science.gov (United States)

    Dahr, W; Knuppertz, G; Beyreuther, K; Moulds, J J; Moulds, M; Wilkinson, S; Capon, C; Fournet, B; Issitt, P D

    1991-08-01

    The Glycophorins (GPs = sialoglycoproteins) in erythrocyte membranes from various Black individuals, some of which exhibit the M1, Can, Sj, Tm, Sext and/or Hu antigens, and several Caucasian donors, including pooled fetal red cells, were studied. Using agglutination inhibition assays with GP fractions, GP fragments and chemically modified GPs as well as trypsin treatment of intact red cells, the antigens defined by anti-M1, anti-M+M1, anti-Can and anti-Tm sera were found to be located on the N-terminal tryptic peptide (T2, residues 1-31) of the major GP (GP A = MN sialoglycoprotein). Evidence was obtained that the N-terminal amino-acid residue, NeuNAc and/or (a) different sugar residue(s) are involved in the antigens. Amino-acid sequence and composition analyses excluded an amino-acid exchange within the N-terminal region (residues 1-31) of GP A. Carbohydrate analyses revealed the attachment of GlcNAc residues (up to about five, dependent on the strength of the above-mentioned antigens) to O-glycosidically linked oligosaccharides within the N-terminal portion (residues 1-31) of GP A. As judged from the carbohydrate compositions of peptides, the alteration of the O-glycosidic oligosaccharides is associated with a slight increase of the Gal and Fuc contents and a slight decrease of the NeuNAc level. Analyses of small, secondary cyanogen bromide and V8 proteinase peptides from the N-terminal region of GP A from Blacks, Caucasians and Caucasian fetal cells suggest that the variable attachment of small quantities of GlcNAc (about 0.03 to about 0.2 residues per peptide molecule) accounts, at least in part, for the polymorphisms detected by anti-Can and the original anti-Tm (serum Sheerin). Remarkably, the GlcNAc-containing O-glycosidic oligosaccharides occur only in small quantities, or not all at, within the positions 32-61 of GP A and the glycosylated domains of GP B and GP C.(ABSTRACT TRUNCATED AT 400 WORDS)

  18. Prevalence of swallowing and speech problems in daily life after chemoradiation for head and neck cancer based on cut-off scores of the patient-reported outcome measures SWAL-QOL and SHI.

    Science.gov (United States)

    Rinkel, Rico N; Verdonck-de Leeuw, Irma M; Doornaert, Patricia; Buter, Jan; de Bree, Remco; Langendijk, Johannes A; Aaronson, Neil K; Leemans, C René

    2016-07-01

    The objective of this study is to assess swallowing and speech outcome after chemoradiation therapy for head and neck cancer, based on the patient-reported outcome measures Swallowing Quality of Life Questionnaire (SWAL-QOL) and Speech Handicap Index (SHI), both provided with cut-off scores. This is a cross-sectional study. Department of Otolaryngology/Head and Neck Surgery of a University Medical Center. Sixty patients, 6 months to 5 years after chemoradiation for head and neck squamous cell carcinoma. Swallowing Quality of Life Questionnaire (SWAL-QOL) and SHI, both validated in Dutch and provided with cut-off scores. Associations were tested between the outcome measures and independent variables (age, gender, tumor stage and site, and radiotherapy technique, time since treatment, comorbidity and food intake). Fifty-two patients returned the SWAL-QOL and 47 the SHI (response rate 87 and 78 %, respectively). Swallowing and speech problems were present in 79 and 55 %, respectively. Normal food intake was noticed in 45, 35 % had a soft diet and 20 % tube feeding. Patients with soft diet and tube feeding reported more swallowing problems compared to patients with normal oral intake. Tumor subsite was significantly associated with swallowing outcome (less problems in larynx/hypopharynx compared to oral/oropharynx). Radiation technique was significantly associated with psychosocial speech problems (less problems in patients treated with IMRT). Swallowing and (to a lesser extent) speech problems in daily life are frequently present after chemoradiation therapy for head and neck cancer. Future prospective studies will give more insight into the course of speech and swallowing problems after chemoradiation and into efficacy of new radiation techniques and swallowing and speech rehabilitation programs.

  19. A biblioterapia na humanização da assistência hospitalar do Hospital Universitário da Universidade Federal de Santa Catarina – HU/UFSC/Bibliotherapy for the hospital care humanization in the university hospital of Santa Catarina Federal University – HU/UFSC

    Directory of Open Access Journals (Sweden)

    Eva Seitz

    2008-01-01

    Full Text Available Este artigo tem por finalidade apresentar resultados do estudo realizado com pacientes, acompanhantes e funcionários das Unidades de Internação Cirúrgica do Hospital Universitário da Universidade Federal de Santa Catarina (UIC/HU/UFSC. O foco central foi o de verificar até que ponto a prática biblioterapêutica e as atividades de lazer contribuem no processo de Humanização da Assistência Hospitalar dos pacientes internados nas (UIC/HU/UFSC, na percepção dos pacientes, acompanhantes, funcionários da enfermagem e assistentes sociais da referida unidade de internação. Foram entrevistados 16 pacientes, 11 acompanhantes e 13 funcionários da enfermagem e assistentes sociais. As atividades de lazer analisadas neste estudo foram a prática biblioterapêutica, as atividades do grupo Reaja e a dança. Trata-se de uma pesquisa quantitativa e qualitativa. Quanto ao procedimento técnico, a presente pesquisa é classificada como estudo de caso, no qual, utilizou-se, para a coleta dos dados a entrevista estruturada e, cujos resultados demonstram que as atividades contribuem muito na Humanização da Assistência Hospitalar dos pacientes internados na UIC/HU/UFSC. This article has for purpose to present resulted of the study carried through with patients, companions and employees of the Units of Surgical Internment of the University Hospital of the Federal University of Santa Catarina (UIC/HU/UFSC. The central focus was to verify until point the practical library-therapy and the activities of leisure contribute in the process of Humanization of the Hospital Assistance of the patients interned in (UIC/HU/UFSC, in the perception of the patients, companions, employees of the nursing and social assistants of the related unit of internment. 16 patients, 11 companions and 13 social employees of the nursing and assistants had been interviewed. The analyzed activities of leisure in this study had been the practical library-therapy, the activities of

  20. Biodegradation of Chlorpyrifos and Its Hydrolysis Product 3,5,6-Trichloro-2-Pyridinol by a New Fungal Strain Cladosporium cladosporioides Hu-01

    Science.gov (United States)

    Peng, Chuyan; Liu, Hongmei; Hu, Meiying; Zhong, Guohua

    2012-01-01

    Intensive use of chlorpyrifos has resulted in its ubiquitous presence as a contaminant in surface streams and soils. It is thus critically essential to develop bioremediation methods to degrade and eliminate this pollutant from environments. We present here that a new fungal strain Hu-01 with high chlorpyrifos-degradation activity was isolated and identified as Cladosporium cladosporioides based on the morphology and 5.8S rDNA gene analysis. Strain Hu-01 utilized 50 mg·L−1 of chlorpyrifos as the sole carbon of source, and tolerated high concentration of chlorpyrifos up to 500 mg·L−1. The optimum degradation conditions were determined to be 26.8°C and pH 6.5 based on the response surface methodology (RSM). Under these conditions, strain Hu-01 completely metabolized the supplemented chlorpyrifos (50 mg·L−1) within 5 d. During the biodegradation process, transient accumulation of 3,5,6-trichloro-2-pyridinol (TCP) was observed. However, this intermediate product did not accumulate in the medium and disappeared quickly. No persistent accumulative metabolite was detected by gas chromatopraphy-mass spectrometry (GC-MS) analysis at the end of experiment. Furthermore, degradation kinetics of chlorpyrifos and TCP followed the first-order model. Compared to the non-inoculated controls, the half-lives (t 1/2) of chlorpyrifos and TCP significantly reduced by 688.0 and 986.9 h with the inoculum, respectively. The isolate harbors the metabolic pathway for the complete detoxification of chlorpyrifos and its hydrolysis product TCP, thus suggesting the fungus may be a promising candidate for bioremediation of chlorpyrifos-contaminated water, soil or crop. PMID:23056611

  1. Biodegradation of chlorpyrifos and its hydrolysis product 3,5,6-trichloro-2-pyridinol by a new fungal strain Cladosporium cladosporioides Hu-01.

    Directory of Open Access Journals (Sweden)

    Shaohua Chen

    Full Text Available Intensive use of chlorpyrifos has resulted in its ubiquitous presence as a contaminant in surface streams and soils. It is thus critically essential to develop bioremediation methods to degrade and eliminate this pollutant from environments. We present here that a new fungal strain Hu-01 with high chlorpyrifos-degradation activity was isolated and identified as Cladosporium cladosporioides based on the morphology and 5.8S rDNA gene analysis. Strain Hu-01 utilized 50 mg·L(-1 of chlorpyrifos as the sole carbon of source, and tolerated high concentration of chlorpyrifos up to 500 mg·L(-1. The optimum degradation conditions were determined to be 26.8°C and pH 6.5 based on the response surface methodology (RSM. Under these conditions, strain Hu-01 completely metabolized the supplemented chlorpyrifos (50 mg·L(-1 within 5 d. During the biodegradation process, transient accumulation of 3,5,6-trichloro-2-pyridinol (TCP was observed. However, this intermediate product did not accumulate in the medium and disappeared quickly. No persistent accumulative metabolite was detected by gas chromatopraphy-mass spectrometry (GC-MS analysis at the end of experiment. Furthermore, degradation kinetics of chlorpyrifos and TCP followed the first-order model. Compared to the non-inoculated controls, the half-lives (t(1/2 of chlorpyrifos and TCP significantly reduced by 688.0 and 986.9 h with the inoculum, respectively. The isolate harbors the metabolic pathway for the complete detoxification of chlorpyrifos and its hydrolysis product TCP, thus suggesting the fungus may be a promising candidate for bioremediation of chlorpyrifos-contaminated water, soil or crop.

  2. Estrategia de desarrollo de capacidades y el empoderamiento de mujeres en riesgo de violencia familiar grave. Distrito de Ambo; Huánuco-2017.

    OpenAIRE

    Fernández Picón, Clara

    2017-01-01

    El objetivo del estudio fue demostrar que la estrategia de desarrollo de capacidades tiene efecto en el empoderamiento de las mujeres con riesgo de violencia familiar grave, del distrito de Ambo; Huánuco, en el 2017. El estudio fue de enfoque cuantitativo, de tipo cuasi experimental, longitudinal (pre y pos-test), analítico, prospectivo y con grupo experimental y control; con 48 mujeres seleccionadas aleatoriamente. Al grupo experimental se le aplicó la estrategia de desarrollo de capacidades...

  3. Tafonomia del yacimiento de vertebrados pleistoceno de Huéscar-1 (Granada, españa

    Directory of Open Access Journals (Sweden)

    Alberdi, M. T.

    2003-08-01

    Full Text Available This work analyses the sedimentary and taphonomic processes that induced the selective preservation and spatial distribution of Húescar-1 bone assemblage (early Galerian. The bone fossil remains are associated with an alluvial fan system that flowed into a lacustrine area with calcareous sedimentation. The fossils show numerous scratch and abrasion marks produced during their transportation as channel lag. The remains appear in three sedimentological settings: in paleochannel filling-up sequences, in pockets built at the outlet of the channels in the lacustrine area, and scattered within calcareous silts. Nevertheless, most of them are found in the second instante. The cumulative process was attritional as pointed out by the mortality profiles of Equus altidens and could be explained by selective predation and/or seasonal bone accumulation. The notably small number of artiodactyl species, particularly in the typical foms of bush or forest habitats and the presence of amphibious forms (Hippopotamus are indicative of an open grassland habitat. The aquatic birds represent the autochthonous component of the association. For each bone recovered severa1 variables were measured, the data obtained underwent graphic and statistical treatment that provided useful information for the site taphonomic interpretation.Se estudia el conjunto de procesos sedimentarios y rasgos tafonómicos que condicionaron la preservación selectiva y disposición espacial de los restos de vertebrados que forman el yacimiento de edad Galeriense inferior de Huéscar-l. Los restos óseos están asociados a un sistema de abanicos aluviales que desembocaba en una zona lacustre carbonatada amplia. Es un conjunto transportado donde los restos muestran numerosas señales de abrasión y arrastre. Los restos óseos aparecen en tres situaciones sedimentológicas: carga de fondo en el relleno de los paleocanales, bolsadas formadas en el punto de la desembocadura y dispersos espor

  4. Autophagy Stimulus Promotes Early HuR Protein Activation and p62/SQSTM1 Protein Synthesis in ARPE-19 Cells by Triggering Erk1/2, p38MAPK, and JNK Kinase Pathways

    Directory of Open Access Journals (Sweden)

    Nicoletta Marchesi

    2018-01-01

    Full Text Available RNA-binding protein dysregulation and altered expression of proteins involved in the autophagy/proteasome pathway play a role in many neurodegenerative disease onset/progression, including age-related macular degeneration (AMD. HuR/ELAVL1 is a master regulator of gene expression in human physiopathology. In ARPE-19 cells exposed to the proteasomal inhibitor MG132, HuR positively affects at posttranscriptional level p62 expression, a stress response gene involved in protein aggregate clearance with a role in AMD. Here, we studied the early effects of the proautophagy AICAR + MG132 cotreatment on the HuR-p62 pathway. We treated ARPE-19 cells with Erk1/2, AMPK, p38MAPK, PKC, and JNK kinase inhibitors in the presence of AICAR + MG132 and evaluated HuR localization/phosphorylation and p62 expression. Two-hour AICAR + MG132 induces both HuR cytoplasmic translocation and threonine phosphorylation via the Erk1/2 pathway. In these conditions, p62 mRNA is loaded on polysomes and its translation in de novo protein is favored. Additionally, for the first time, we report that JNK can phosphorylate HuR, however, without modulating its localization. Our study supports HuR’s role as an upstream regulator of p62 expression in ARPE-19 cells, helps to understand better the early events in response to a proautophagy stimulus, and suggests that modulation of the autophagy-regulating kinases as potential therapeutic targets for AMD may be relevant.

  5. A phase 1b study of humanized KS-interleukin-2 (huKS-IL2) immunocytokine with cyclophosphamide in patients with EpCAM-positive advanced solid tumors

    International Nuclear Information System (INIS)

    Connor, Joseph P; Henslee-Downey, Jean; Kramer, Daniel; Neugebauer, Roland; Stupp, Roger; Cristea, Mihaela C; Lewis, Nancy L; Lewis, Lionel D; Komarnitsky, Philip B; Mattiacci, Maria R; Felder, Mildred; Stewart, Sarah; Harter, Josephine

    2013-01-01

    Humanized KS-interleukin-2 (huKS-IL2), an immunocytokine with specificity for epithelial cell adhesion molecule (EpCAM), has demonstrated favorable tolerability and immunologic activity as a single agent. Phase 1b study in patients with EpCAM-positive advanced solid tumors to determine the maximum tolerated dose (MTD) and safety profile of huKS-IL2 in combination with low-dose cyclophosphamide. Treatment consisted of cyclophosphamide (300 mg/m 2 on day 1), and escalating doses of huKS-IL2 (0.5–4.0 mg/m 2 IV continuous infusion over 4 hours) on days 2, 3, and 4 of each 21-day cycle. Safety, pharmacokinetic profile, immunogenicity, anti-tumor and biologic activity were evaluated. Twenty-seven patients were treated for up to 6 cycles; 26 were evaluable for response. The MTD of huKS-IL2 in combination with 300 mg/m 2 cyclophosphamide was 3.0 mg/m 2 . At higher doses, myelosuppression was dose-limiting. Transient lymphopenia was the most common grade 3/4 adverse event (AE). Other significant AEs included hypotension, hypophosphatemia, and increase in serum creatinine. All patients recovered from these AEs. The huKS-IL2 exposure was dose-dependent, but not dose-proportional, accumulation was negligible, and elimination half-life and systemic clearance were independent of dose and time. Most patients had a transient immune response to huKS-IL2. Immunologic activity was observed at all doses. Ten patients (38%) had stable disease as best response, lasting for ≥ 4 cycles in 3 patients. The combination of huKS-IL2 with low-dose cyclophosphamide was well tolerated. Although no objective responses were observed, the combination showed evidence of immunologic activity and 3 patients showed stable disease for ≥ 4 cycles.

  6. 石氏针药结合治疗急性踝关节扭伤早期疗效研究%Clinical Observation on the Treatment of Acute Ankle Sprain by Shi's Acupuncture Therapy Combined with Compound Zijing Plaster

    Institute of Scientific and Technical Information of China (English)

    李涛; 郭海玲; 杨光月; 商海滨; 赵咏芳

    2017-01-01

    目的:研究石氏针刺结合复方紫荆消伤膏外用治疗急性踝关节扭伤早期症状改善特点,评价石氏针刺结合外用膏药治疗急性踝关节扭伤、弹力绷带固定治疗和功能锻炼治疗的优效性.方法:对上海市浦东新区6家医院2014年1月至2016年10月收治的300例急性踝关节扭伤患者随机分为针药结合治疗组、弹力绷带固定组和功能锻炼组,三组受试者分别予石氏针刺结合膏药外用治疗,弹力绷带固定结合膏药治疗和功能锻炼处方结合膏药治疗.在入组时(入组)、第7天(第1周、访视一)、第28天(第4周、访视二)和第42天(第6周、访视三)采用美国足踝外科学会AOFAS踝后足评分量表、VAS疼痛评分进行优效性评价.结果:三种治疗方法对急性踝关节扭伤均有疗效(P<0.05).在第7天,针药结合组AOFAS评分与绷带固定组和功能锻炼组差异有统计学意义(P<0.05),针药结合组AOFAS评分高于绷带固定组和功能锻炼组评分.在第7天、第28天针药结合组VAS疼痛评分变化与绷带固定组和功能锻炼组差异有统计学意义(P<0.05),针药结合组VAS疼痛评分改善大于弹力绷带固定组和功能锻炼组.针药结合组AOFAS疗效评定痊愈率和VAS疼痛疗效评定痊愈率高于绷带固定组和功能锻炼组(P<0.05).结论:石氏针药结合治疗急性踝关节扭伤临床疗效明确,对损伤早期的疼痛改善和功能恢复疗效优于弹力绷带固定治疗和功能锻炼治疗.%Objective:To study the improvement characteristics of early symptoms of acute ankle sprain treated with the Shi's acupuncture therapy combined with compound Zijing plaster,and to evaluate the superiority of the Shi's therapy combined with topical plaster,elastic bandage fixation and functional exercise therapy in the treatment of acute ankle sprain.Methods:All 300 cases of acute ankle sprain patients were randomly assigned to groups of Shi's therapy

  7. Protective effects of fermented honeybush (Cyclopia intermedia) extract (HU-018) against skin aging: a randomized, double-blinded, placebo-controlled study.

    Science.gov (United States)

    Choi, Sun Young; Hong, Ji Yeon; Ko, Eun Jung; Kim, Beom Joon; Hong, Sung-Woon; Lim, Mi Hyoung; Yeon, Sung Hum; Son, Rak Ho

    2018-02-01

    Oxidative stress and photodamage resulting from ultraviolet radiation exposure play key roles in skin aging. Fermented Cyclopia intermedia, which is used to brew honeybush tea, exerts antioxidant and anti-wrinkle effects by inhibiting reactive oxygen species production and downregulating matrix metalloproteinase activity. This randomized, double-blinded, placebo-controlled study aimed to evaluate the efficacy and safety of fermented honeybush (Cyclopia intermedia) extract (HU-018) for skin rejuvenation. 120 Korean subjects with crow's feet wrinkles were randomized to receive either low-dose extract (400 mg/day), high-dose extract (800 mg/day), or placebo (negative control, only dextran) for 12 weeks. Wrinkles were evaluated using JANUS ® and PRIMO pico ® . Skin elasticity, hydration and transepidermal water loss were measured. Global skin wrinkle grade was significantly improved in both low-dose and high-dose groups compared to placebo group, as well as for skin hydration and elasticity. Both the low- and high-dose groups showed significantly decreased TEWL compared to the placebo group. There were no adverse effects during the entire study period. Our data indicate that HU-018 is effective for improving skin wrinkles, elasticity, and hydration. Therefore, daily supplementation with fermented honeybush could be helpful for protecting against skin aging.

  8. From the Ethnic History of Asia – the Dōnghú, Wūhuán and Xiānbēi Proto-Mongolian Tribes

    Directory of Open Access Journals (Sweden)

    Nenad Vidaković

    2012-04-01

    Full Text Available The aim of this paper is to present the history of the Dōnghú, Wūhuán and Xiānbēi Proto-Mongolian tribes in the period from the 4th century B.C. to the end of the 3rd century A.D. The history of the ancient nomadic peoples who lived north of China is written in Chinese dynasty chronicles. Proto-Mongolian tribes from the 1st century B.C. are called Dōnghú in Chinese sources. The earliest news on them originates from the Warring States Period (4th – 3rd century B.C., and tells of a conflict with the northern Chinese states. Other types of sources on the history of the Proto-Mongolian tribes are archaeological findings, which associate Mongolian ethnogenesis with slab grave cultures and the Lower Xiàjiādiàn. Linguists find the materials for the research on Mongolian ethnogenesis in the Altaic linguistic family, which the Mongolian language belongs to as well. Based on the mentioned sources, the change in the political situation in the steppes at the end of the 3rd century B.C., when the people of Xiōngnú created a powerful state and conquered the Dōnghúes, is described in the paper. The remains of the shattered Dōnghúes, who had mostly migrated to the north, have been recorded in Chinese chronicles under new topoethnonyms: Xiānbēi and Wūhuán. The weakening and fall of the Xiōngnúes’ state enabled the Proto-Mongolian tribes to re-enter the historical scene. At the end of the 1st century B.C. the Chinese Hàn Empire firstly established relations with the Wūhuán tribes and in the middle of the 1st century A.D. with the Xiānbēi tribes, too. In the beginning both tribal alliances acknowledged the supreme authority of China and carried out frontier service. Under the guidance of tribal chiefs the tribes started to run an independent policy and attack China’s border areas during the 2nd century A.D. In the conclusion, the author describes the period when the Wūhuán and Xiānbēi tribes were at the peak of their power

  9. Nivel de aceptabilidad del vino de tumbo serrano (passiflora mollisima), elaborado con los parámetros tecnológicos óptimos, en la ciudad de Huánuco 2015

    OpenAIRE

    Ríos García, Geaninne

    2017-01-01

    La investigación se desarrolló en la ciudad de Huánuco que por su ubicación geográfica, produce una gran variedad de frutas, entre ellas el tumbo serrano, esta fruta no es aprovechada por los pobladores. El objetivo del presente estudio es determinar el nivel de aceptabilidad en la ciudad de Huánuco, Amarilis y Pillco Marca del vino de tumbo serrano (Passiflora mollissima L.), elaborado con los parámetros tecnológicos óptimos. La investigación se desarrolló en tres etapas la primera con...

  10. Priming with r-metHuSCF and filgrastim or chemotherapy and filgrastim in patients with malignant lymphomas: a randomized phase II pilot study of mobilization and engraftment

    DEFF Research Database (Denmark)

    Johnsen, Hanne; Geisler, C; Juvonen, E

    2011-01-01

    methionyl human G-CSF (filgrastim, r-metHuG-CSF) (experimental arm A) or routine chemotherapy plus filgrastim (conventional arm B). The primary objective was to evaluate the side effects and toxicity during priming and mobilization. The secondary objectives were efficacy by the level of blood......-circulating PBPCs, the number of harvest days and the time to three-lineage engraftment after autografting. First, during priming 5 patients had 8 serious events, 4 in each arm. A summary of all adverse events revealed 30 (94%) patients suffering from 132 events of all grading. Second, neutropenia...... and thrombocytopenia was documented in arm B. Third, 9/14 (64%) patients in arm A reached the target of 5 million CD34(+) cells/kg body weight (bw) compared with 13/15 (87%) in arm B. The results represent the first randomized trial of growth factor plus chemotherapy priming and indicate that a formal phase III trial...

  11. A dual model HU conversion from MRI intensity values within and outside of bone segment for MRI-based radiotherapy treatment planning of prostate cancer

    Energy Technology Data Exchange (ETDEWEB)

    Korhonen, Juha, E-mail: juha.p.korhonen@hus.fi [Clinical Research Institute Helsinki University Central Hospital Ltd., POB-700, 00029 HUS, Finland and Department of Oncology, Helsinki University Central Hospital, POB-180, 00029 HUS (Finland); Kapanen, Mika [Clinical Research Institute Helsinki University Central Hospital Ltd., POB-700, 00029 HUS (Finland); Department of Oncology, Helsinki University Central Hospital, POB-180, 00029 HUS (Finland); Department of Medical Physics, Tampere University Hospital, POB-2000, 33521 Tampere (Finland); Keyriläinen, Jani; Seppälä, Tiina; Tenhunen, Mikko [Department of Oncology, Helsinki University Central Hospital, POB-180, 00029 HUS (Finland)

    2014-01-15

    Purpose: The lack of electron density information in magnetic resonance images (MRI) poses a major challenge for MRI-based radiotherapy treatment planning (RTP). In this study the authors convert MRI intensity values into Hounsfield units (HUs) in the male pelvis and thus enable accurate MRI-based RTP for prostate cancer patients with varying tissue anatomy and body fat contents. Methods: T{sub 1}/T{sub 2}*-weighted MRI intensity values and standard computed tomography (CT) image HUs in the male pelvis were analyzed using image data of 10 prostate cancer patients. The collected data were utilized to generate a dual model HU conversion technique from MRI intensity values of the single image set separately within and outside of contoured pelvic bones. Within the bone segment local MRI intensity values were converted to HUs by applying a second-order polynomial model. This model was tuned for each patient by two patient-specific adjustments: MR signal normalization to correct shifts in absolute intensity level and application of a cutoff value to accurately represent low density bony tissue HUs. For soft tissues, such as fat and muscle, located outside of the bone contours, a threshold-based segmentation method without requirements for any patient-specific adjustments was introduced to convert MRI intensity values into HUs. The dual model HU conversion technique was implemented by constructing pseudo-CT images for 10 other prostate cancer patients. The feasibility of these images for RTP was evaluated by comparing HUs in the generated pseudo-CT images with those in standard CT images, and by determining deviations in MRI-based dose distributions compared to those in CT images with 7-field intensity modulated radiation therapy (IMRT) with the anisotropic analytical algorithm and 360° volumetric-modulated arc therapy (VMAT) with the Voxel Monte Carlo algorithm. Results: The average HU differences between the constructed pseudo-CT images and standard CT images of each

  12. Effect of Age on Energy Requirement for Maintenance and Growth of Dorper and Hu Crossbred F1 Ewes Weighing 20 to 50 kg

    Science.gov (United States)

    Nie, H. T.; Wan, Y. J.; You, J. H.; Wang, Z. Y.; Lan, S.; Fan, Y. X.; Wang, F.

    2015-01-01

    This research aimed to define the energy requirement of Dorper and Hu Hybrid F1 ewes 20 to 50 kg of body weight, furthermore to study energy requirement changes with age and evaluate the effect of age on energy requirement parameters. In comparative slaughter trial, thirty animals were divided into three dry matter intake treatments (ad libitum, n = 18; low restricted, n = 6; high restricted, n = 6), and were all slaughtered as baseline, intermediate, and final slaughter groups, to calculate body chemical components and energy retained. In digestibility trial, twelve ewes were housed in individual metabolic cages and randomly assigned to three feeding treatments in accordance with the design of a comparative slaughter trial, to evaluate dietary energetic values at different feed intake levels. The combined data indicated that, with increasing age, the net energy requirement for maintenance (NEm) decreased from 260.62±13.21 to 250.61±11.79 kJ/kg0.75 of shrunk body weight (SBW)/d, and metabolizable energy requirement for maintenance (MEm) decreased from 401.99±20.31 to 371.23±17.47 kJ/kg0.75 of SBW/d. Partial efficiency of ME utilization for maintenance (km, 0.65 vs 0.68) and growth (kg, 0.42 vs 0.41) did not differ (p>0.05) due to age; At the similar condition of average daily gain, net energy requirements for growth (NEg) and metabolizable energy requirements for growth (MEg) for ewes during late fattening period were 23% and 25% greater than corresponding values of ewes during early fattening period. In conclusion, the effect of age upon energy requirement parameters in the present study were similar in tendency with previous recommendations, values of energy requirement for growth (NEg and MEg) for Dorper and Hu crossbred female lambs ranged between the NRC (2007) recommendation for early and later maturating growing sheep. PMID:26104522

  13. Analysis of the kinetic of expression of tristetraprolin and HuR by rheumatoid arthritis patients pheripheral blood mononuclear cells stimulated with lipopolysaccharide

    Directory of Open Access Journals (Sweden)

    G. Ferraccioli

    2011-09-01

    Full Text Available Objective. Given the role of TNF-α in Rheumatoid Arthritis (RA we decided to define the characteristics of the TNF- α synthesis by peripheral blood mononuclear cells (PBMNCs obtained from active-aggressive RA patients giving a particular attention to the modulation of the expression of two fundamental proteins in TNF-α mRNA stability regulation, Tristetraprolin (TTP and HuR. Methods. 11 RA patients with active disease were enrolled in the study before their entry in 2 double blind protocols: Infliximab versus MTX and Etanercept versus MTX. 9 healthy blood donors were taken as controls. PBMNCs obtained by Ficoll centrifugation and plastic adherence were stimulated with lipopolysaccharide (LPS and TNF-α was measured in the supernatant during 8 hours by ELISA. At each time point the cells were harvested and analysed for TNF- α, TTP and HuR mRNA expression by semi-quantitative PCR. Results. MNCs TNF-α secretion after LPS stimulation did not differ significantly between RA and control subjects, even if a tendency towards a more prompt response was observed in the patients. More importantly only the DMARDs responsive patients (DAS <3.7 at the 6th month, with a minimal reduction of 1.2 points disclosed precociously (at the first month a significant change in the profile of TNF-α secretion and maintained it until the 6th month. The “normalization” of the synthetic behaviour was accompanied by the resetting in the regulation of the expression of the TTP, that appeared significantly different in the patients before and after therapy. Conclusions. Independently from the type of therapy, responsive patients demonstrate a rapid change in the cellular biology at the systemic level that might drive the resolution of the phlogistic process at the synovial level.

  14. SU-F-J-193: Efficient Dose Extinction Method for Water Equivalent Path Length (WEPL) of Real Tissue Samples for Validation of CT HU to Stopping Power Conversion

    International Nuclear Information System (INIS)

    Zhang, R; Baer, E; Jee, K; Sharp, G; Flanz, J; Lu, H

    2016-01-01

    Purpose: For proton therapy, an accurate model of CT HU to relative stopping power (RSP) conversion is essential. In current practice, validation of these models relies solely on measurements of tissue substitutes with standard compositions. Validation based on real tissue samples would be much more direct and can address variations between patients. This study intends to develop an efficient and accurate system based on the concept of dose extinction to measure WEPL and retrieve RSP in biological tissue in large number of types. Methods: A broad AP proton beam delivering a spread out Bragg peak (SOBP) is used to irradiate the samples with a Matrixx detector positioned immediately below. A water tank was placed on top of the samples, with the water level controllable in sub-millimeter by a remotely controlled dosing pump. While gradually lowering the water level with beam on, the transmission dose was recorded at 1 frame/sec. The WEPL were determined as the difference between the known beam range of the delivered SOBP (80%) and the water level corresponding to 80% of measured dose profiles in time. A Gammex 467 phantom was used to test the system and various types of biological tissue was measured. Results: RSP for all Gammex inserts, expect the one made with lung-450 material (<2% error), were determined within ±0.5% error. Depends on the WEPL of investigated phantom, a measurement takes around 10 min, which can be accelerated by a faster pump. Conclusion: Based on the concept of dose extinction, a system was explored to measure WEPL efficiently and accurately for a large number of samples. This allows the validation of CT HU to stopping power conversions based on large number of samples and real tissues. It also allows the assessment of beam uncertainties due to variations over patients, which issue has never been sufficiently studied before.

  15. SU-F-J-193: Efficient Dose Extinction Method for Water Equivalent Path Length (WEPL) of Real Tissue Samples for Validation of CT HU to Stopping Power Conversion

    Energy Technology Data Exchange (ETDEWEB)

    Zhang, R; Baer, E; Jee, K; Sharp, G; Flanz, J; Lu, H [Massachusetts General Hospital and Harvard Medical School, Boston, MA (United States)

    2016-06-15

    Purpose: For proton therapy, an accurate model of CT HU to relative stopping power (RSP) conversion is essential. In current practice, validation of these models relies solely on measurements of tissue substitutes with standard compositions. Validation based on real tissue samples would be much more direct and can address variations between patients. This study intends to develop an efficient and accurate system based on the concept of dose extinction to measure WEPL and retrieve RSP in biological tissue in large number of types. Methods: A broad AP proton beam delivering a spread out Bragg peak (SOBP) is used to irradiate the samples with a Matrixx detector positioned immediately below. A water tank was placed on top of the samples, with the water level controllable in sub-millimeter by a remotely controlled dosing pump. While gradually lowering the water level with beam on, the transmission dose was recorded at 1 frame/sec. The WEPL were determined as the difference between the known beam range of the delivered SOBP (80%) and the water level corresponding to 80% of measured dose profiles in time. A Gammex 467 phantom was used to test the system and various types of biological tissue was measured. Results: RSP for all Gammex inserts, expect the one made with lung-450 material (<2% error), were determined within ±0.5% error. Depends on the WEPL of investigated phantom, a measurement takes around 10 min, which can be accelerated by a faster pump. Conclusion: Based on the concept of dose extinction, a system was explored to measure WEPL efficiently and accurately for a large number of samples. This allows the validation of CT HU to stopping power conversions based on large number of samples and real tissues. It also allows the assessment of beam uncertainties due to variations over patients, which issue has never been sufficiently studied before.

  16. The stress-induced heat shock protein 70.3 expression is regulated by a dual-component mechanism involving alternative polyadenylation and HuR.

    Science.gov (United States)

    Kraynik, Stephen M; Gabanic, Andrew; Anthony, Sarah R; Kelley, Melissa; Paulding, Waltke R; Roessler, Anne; McGuinness, Michael; Tranter, Michael

    2015-06-01

    Heat shock protein 70.3 (Hsp70.3) expression increases in response to cellular stress and plays a cytoprotective role. We have previously shown that Hsp70.3 expression is controlled through coordinated post-transcriptional regulation by miRNAs and alternative polyadenylation (APA), and APA-mediated shortening of the Hsp70.3 3'-UTR facilitates increased protein expression. A stress-induced increase in Hsp70.3 mRNA and protein expression is accompanied by alternative polyadenylation (APA)-mediated truncation of the 3'UTR of the Hsp70.3 mRNA transcript. However, the role that APA plays in stress-induced expression of Hsp70.3 remains unclear. Our results show that APA-mediated truncation of the Hsp70.3 3'UTR increases protein expression through enhanced polyribosome loading. Additionally, we demonstrate that the RNA binding protein HuR, which has been previously shown to play a role in mediating APA, is necessary for heat shock mediated increase in Hsp70.3 mRNA and protein. However, it is somewhat surprising to note that HuR does not play a role in APA of the Hsp70.3 mRNA, and these two regulatory events appear to be mutually exclusive regulators of Hsp70.3 expression. These results not only provide important insight to the regulation of stress response genes following heat shock, but also contribute an enhanced understanding of how alternative polyadenylation contributes to gene regulation. Copyright © 2015 Elsevier B.V. All rights reserved.

  17. MiR-146b-5p overexpression attenuates stemness and radioresistance of glioma stem cells by targeting HuR/lincRNA-p21/β-catenin pathway

    Science.gov (United States)

    Yang, Wei; Yu, Hongquan; Shen, Yueming; Liu, Yingying; Yang, Zhanshan; Sun, Ting

    2016-01-01

    A stem-like subpopulation existed in GBM cells, called glioma stem cells (GSCs), might contribute to cancer invasion, angiogenesis, immune evasion, and therapeutic resistance, providing a rationale to eliminate GSCs population and their supporting niche for successful GBM treatment. LincRNA-p21, a novel regulator of cell proliferation, apoptosis and DNA damage response, is found to be downregulated in several types of tumor. However, little is known about the role of lincRNA-p21 in stemness and radioresistance of GSCs and its regulating mechanisms. In this study, we found that lincRNA-p21 negatively regulated the expression and activity of β-catenin in GSCs. Downregulation of lincRNA-p21 in GSCs was resulted from upregulation of Hu antigen R (HuR) expression caused by miR-146b-5p downregulation. MiR-146b-5p overexpression increased apoptosis and radiosensitivity, decreased cell viability, neurosphere formation capacity and stem cell marker expression, and induced differentiation in GSCs. Moreover, knock-down lincRNA-p21 or HuR and β-catenin overexpression could rescue the phenotypic changes resulted from miR-146b-5p overexpression in GSCs. These findings suggest that targeting the miR-146b-5p/HuR/lincRNA-p21/β-catenin signaling pathway may be valuable therapeutic strategies against glioma. PMID:27166258

  18. Changes in the sense of agency during hypnosis: The Hungarian version of the Sense of Agency Rating Scale (SOARS-HU) and its relationship with phenomenological aspects of consciousness.

    Science.gov (United States)

    Költő, András; Polito, Vince

    2017-03-01

    Changes in the sense of agency are defining feature of hypnosis. The Sense of Agency Rating Scale (SOARS) is a 10-item questionnaire, administered after a hypnosis session to assess alteration in the sense of agency. In the present study, a Hungarian version of the measure (SOARS-HU) is presented. The SOARS-HU and the Phenomenology of Consciousness Inventory (PCI) were administered to 197 subjects following hypnotizability screening with the Harvard Group Scale of Hypnotic Susceptibility Scale, Form A (HGSHS:A). Confirmatory factor analysis and correlations with hypnotizability demonstrate the reliability and validity of the SOARS-HU. Changes in the Involuntariness and Effortlessness subscales of the SOARS-HU were associated with alterations in subjective conscious experience, as measured by the PCI. These changes in subjective experience remained significant after controlling for HGSHS:A scores. These results indicate that changes in the sense of agency during hypnosis are associated with alterations of consciousness that are independent of hypnotizability. Copyright © 2017 Elsevier Inc. All rights reserved.

  19. Phase I/II clinical and pharmacokinetic study evaluating a fully human monoclonal antibody against EGFr (HuMax-EGFr) in patients with advanced squamous cell carcinoma of the head and neck

    DEFF Research Database (Denmark)

    Bastholt, Lars; Specht, Lena; Jensen, Kenneth

    2007-01-01

    PURPOSE: To assess safety, tolerability, pharmacokinetics and clinical activity of HuMax-EGFr in patients with SCCHN. PATIENTS AND METHODS: Twenty-eight patients with SCCHN were enrolled. The study comprised a single-dose escalation part for assessment of safety issues followed by a repeat dose e...

  20. Research Upregulation of CD23 (FcεRII Expression in Human Airway Smooth Muscle Cells (huASMC in Response to IL-4, GM-CSF, and IL-4/GM-CSF

    Directory of Open Access Journals (Sweden)

    Lew D Betty

    2005-05-01

    Full Text Available Abstract Background Airway smooth muscle cells play a key role in remodeling that contributes to airway hyperreactivity. Airway smooth muscle remodeling includes hypertrophy and hyperplasia. It has been previously shown that the expression of CD23 on ASMC in rabbits can be induced by the IgE component of the atopic serum. We examined if other components of atopic serum are capable of inducing CD23 expression independent of IgE. Methods Serum starved huASMC were stimulated with either IL-4, GM-CSF, IL-13, IL-5, PGD2, LTD4, tryptase or a combination of IL-4, IL-5, IL-13 each with GM-CSF for a period of 24 h. CD23 expression was analyzed by flow cytometry, western blot, and indirect immunofluorescence. Results The CD23 protein expression was upregulated in huASMC in response to IL-4, GM-CSF, and IL-4/GM-CSF. The percentage of cells with increased fluorescence intensity above the control was 25.1 ± 4.2% (IL-4, 15.6 ± 2.7% (GM-CSF and 32.9 ± 13.9% (IL-4/GMCSF combination(n = 3. The protein content of IL-4/GMCSF stimulated cells was significantly elevated. Expression of CD23 in response to IL-4, GM-CSF, IL-4/GM-CSF was accompanied by changes in cell morphology including depolymerization of isoactin fibers, cell spreading, and membrane ruffling. Western blot revealed abundant expression of the IL-4Rα and a low level expression of IL-2Rγc in huASMC. Stimulation with IL-4 resulted in the phosphorylation of STAT-6 and an increase in the expression of the IL-2Rγc. Conclusion CD23 on huASMC is upregulated by IL-4, GM-CSF, and IL-4/GM-CSF. The expression of CD23 is accompanied by an increase in cell volume and an increase in protein content per cell, suggesting hypertrophy. Upregulation of CD23 by IL-4/GM-CSF results in phenotypic changes in huASMC that could play a role in cell migration or a change in the synthetic function of the cells. Upregulation of CD23 in huASMC by IL-4 and GM-CSF can contribute to changes in huASMC and may provide an avenue

  1. The influence of royal jelly and human interferon-alpha (HuIFN-αN3) on proliferation, glutathione level and lipid peroxidation in human colorectal adenocarcinoma cells in vitro.

    Science.gov (United States)

    Filipič, Bratko; Gradišnik, Lidija; Rihar, Klemen; Šooš, Eugen; Pereyra, Adriana; Potokar, Jana

    2015-12-01

    Among royal jelly's (RJ) various biological activities, its possible antitumour activity deserves particular attention. The purpose of this study was to investigate the influence of RJ, its bioactive component 10-hydroxy-2-decenoic acid (10- HDA), and human interferon-alpha (HuIFN-αN3) on the proliferation of human colorectal adenocarcinoma cells (CaCo- 2), and ascertain their effect on intracellular glutathione (GSH) level and lipid peroxidation. We studied the antiproliferative (AP) activity of RJ [(0.1 g/10 mL phosphate buffer saline (PBS)], HuIFN-αN3 (1000 I.U. mL⁻¹), 10-HDA at 100.0 μmol L⁻¹, and their different combinations, in the ratio 1:1, 1:2, and 2:1 on CaCo-2 cells. The GSH level was measured by glutathione assay. The lipid peroxidation was measured by malondialdehyde (MDA) assay. Single RJ had a low AP activity: 2.0 (0.5 mg mL⁻¹). HuIFN-αN3 had an AP activity of 2.5 (208.33 I.U. mL⁻¹), while 10-HDA had an AP activity of 1.5 (37.5 μmol mL⁻¹). The highest AP activity of 3.8 was obtained when RJ and HuIFN-αN3 were applied at the ratio 2:1. In that combination the level of GSH was 24.9±2.4 nmol g⁻³ of proteins (vs. 70.2±3.2 nmol g⁻³ in the control) and the level of MDA was 72.3±3.1 nmol g⁻³ (vs. 23.6±9.1 nmol g⁻³ in the control). It is generally assumed that 10-HDA, an important constituent of RJ, together with HuIFN-αN3, is responsible for the inhibition of CaCo-2 cells proliferation in vitro. In our study, however, RJ and HuIFN-αN3 applied at 2:1 decreased the level of GSH the most and significantly increased lipid peroxidation via MDA in CaCo-2 cells. Future studies should show whether these GSH- and MDA-related activities of RJ, HuIFN-αN3, 10-HDA, and their combinations may decrease the tumorigenicity index and tumorigenic potential of various tumour cells in vitro.

  2. Glycosylphosphatidylinositol-Anchored Anti-HIV scFv Efficiently Protects CD4 T Cells from HIV-1 Infection and Deletion in hu-PBL Mice

    Science.gov (United States)

    Ye, Chaobaihui; Wang, Weiming; Cheng, Liang; Li, Guangming; Wen, Michael; Wang, Qi; Zhang, Qing; Li, Dan

    2016-01-01

    ABSTRACT Despite success in viral inhibition and CD4 T cell recovery by highly active antiretroviral treatment (HAART), HIV-1 is still not curable due to the persistence of the HIV-1 reservoir during treatment. One patient with acute myeloid leukemia who received allogeneic hematopoietic stem cell transplantation from a homozygous CCR5 Δ32 donor has had no detectable viremia for 9 years after HAART cessation. This case has inspired a field of HIV-1 cure research focusing on engineering HIV-1 resistance in permissive cells. Here, we employed a glycosylphosphatidylinositol (GPI)-scFv X5 approach to confer resistance of human primary CD4 T cells to HIV-1. We showed that primary CD4 T cells expressing GPI-scFv X5 were resistant to CCR5 (R5)-, CXCR4 (X4)-, and dual-tropic HIV-1 and had a survival advantage compared to control cells ex vivo. In a hu-PBL mouse study, GPI-scFv X5-transduced CD4 T cells were selected in peripheral blood and lymphoid tissues upon HIV-1 infection. Finally, GPI-scFv X5-transduced CD4 T cells, after being cotransfused with HIV-infected cells, showed significantly reduced viral loads and viral RNA copy numbers relative to CD4 cells in hu-PBL mice compared to mice with GPI-scFv AB65-transduced CD4 T cells. We conclude that GPI-scFv X5-modified CD4 T cells could potentially be used as a genetic intervention against both R5- and X4-tropic HIV-1 infections. IMPORTANCE Blocking of HIV-1 entry is one of most promising approaches for therapy. Genetic disruption of the HIV-1 coreceptor CCR5 by nucleases in T cells is under 2 clinical trials and leads to reduced viremia in patients. However, the emergence of viruses using the CXCR4 coreceptor is a concern for therapies applying single-coreceptor disruption. Here, we report that HIV-1-permissive CD4 T cells engineered with GPI-scFv X5 are resistant to R5-, X4-, or dual-tropic virus infection ex vivo. In a preclinical study using hu-PBL mice, we show that CD4 T cells were protected and that GPI-scFv X5

  3. Los orígenes del Colegio Menor de la Concepción de Huérfanos de Salamanca

    Directory of Open Access Journals (Sweden)

    Miguel A. MARTÍN SÁNCHEZ

    2009-12-01

    Full Text Available RESUMEN: El Colegio Menor de la Concepción de Huérfanos de la Universidad de Salamanca es uno más de la gran cantidad de colegios que se fundaron al amparo del estudio salmantino en el siglo XVI. Fundado por Francisco de Solís, obispo de Bagnorea y secretario de Paulo III, durante tres siglos facilitó y proporcionó amparo y educación a multitud de estudiantes pobres que no tenían recursos para ello. Fundado en la primera mitad del siglo XVI, durante esta centuria se asentó y comenzó su andadura, que terminaría en el siglo XIX. Este trabajo realiza un análisis sobre los primeros años de vida del Colegio, analizando cuestiones tan importantes como su fundación, las bulas fundacionales, el fundador, las primeras constituciones o la matrícula durante el siglo XVI, entre otras. Fue el siglo XVI el siglo de su nacimiento y consolidación, realizando durante esta centuria un gran esfuerzo institucional, como demuestra el hecho de la elaboración de las primeras constituciones, la construcción del edificio, o la incorporación a la Universidad de Salamanca, por ejemplo. A lo largo de estas páginas realizaremos un recorrido por los orígenes del primer colegio universitario que se crea para el amparo de niños pobres y huérfanos, permitiéndoles estudiar desde la gramática hasta graduarse en la ciencia que mejor les pareciere. La obra social y educativa del Colegio permitió la progresión y ascenso social de multitud de estudiantes pobres y huérfanos con talento, que de otra forma nunca hubieran podido realizar estudios en la Universidad, puesto que carecían de recursos para ello.ABSTRACT: The Conception of Orphans Minor College of the University of Salamanca is one more of the great quantity of colleges that were founded under protection of Salamancan Study in the 16th century. It was founded by Francisco de Solís, bishop of Bagnorea and secretary of Paulo III, provided protection and education to many poor students without

  4. Internação domiciliar: o perfil dos pacientes assistidos pelo Programa HU em Casa Home care: profile of patients attended by a home care program

    Directory of Open Access Journals (Sweden)

    Daniella Reis Barbosa Martelli

    2011-01-01

    Full Text Available Internação domiciliar é uma modalidade de atendimento à saúde que está se transformando em uma alternativa importante para minimizar alguns dos principais problemas inerentes aos sistemas de saúde vigentes, especialmente os da rede pública. O objetivo do estudo foi descrever o perfil sociodemográfico e clínico da população assistida pelo Programa de Internação Domiciliar (PID HU em Casa do Hospital Universitário Clemente de Faria da Universidade Estadual de Montes Claros. O estudo foi descritivo e retrospectivo por meio da análise de prontuários, realizada de maio de 2005 a maio de 2008. Foram analisados 137 pacientes, sendo 75 do gênero feminino (54,7% e 62 do masculino (45,3%. O grupo de 61 a 80 anos foi mais prevalente (37,2% e 73% dos pacientes residiam em bairros periféricos do município de Montes Claros-MG. Dos agravos mais comuns na primeira internação, a pneumonia foi prevalente, 22 casos (16,1%. A maioria dos pacientes foi encaminhada ao PID pela clinica médica (84,7%, com intervalo de maior prevalência de duas a três internações (42,4%. Do total de pacientes, 120 (87,6% permaneceram internados por 16 a 30 dias e 51,8% não necessitaram passar novamente pelo PID para uma segunda internação. Com relação à resolutividade clínica, 130 (94,9% tiveram alta clínica, no PID, na primeira internação. O PID mostrou-se ser um programa de alta resolutividade, atendendo mais ao público idoso feminino, de baixa renda e com períodos de internação relativamente curtos.The home care is a modality of health care which is becoming an important alternative to minimize some of mainly relevant problems of world health, especially the public health network. This paper aimed to describe the socio-demographic and clinical population assisted by the Home Care Program HU em Casa, of the University Hospital Clemente de Faria, Universidade Estadual de Montes Claros. It is a descriptive and retrospective study analyzing

  5. La masacre de Ambo: Histoire d'une revolte paysanne, département de Huánuco, Pérou, 1962-1963

    Directory of Open Access Journals (Sweden)

    2004-01-01

    Full Text Available À travers l’histoire de la révolte de la communauté de Huaylla y Aclacancha (vallée d’Ambo, département de Huánuco il est possible de comprendre comment s’organisent les paysans comuneros pour défendre leurs terres communautaires. L’analyse des requêtes paysannes envoyées aux autorités gouvernementales dévoile l’importance pour la communauté de faire valoir la légitimité de ses droits de propriété, en s’appuyant à la fois sur des actions légales et sur des occupations de terre. Cependant l’utilisation simultanée de ces moyens de revendication n’explique pas en soi le dérapage vers la violence, connu dans la presse comme la masacre de Ambo (la tuerie d’Ambo. Seule une étude des contextes dans lesquels interagissent tous les acteurs concernés (comuneros, syndicalistes, autorités politiques, policiers et hacendados peut permettre de saisir pourquoi les réclamations de cette communauté ont débouché sur la mort de comuneros. A través la historia de la lucha de la comunidad de Huaylla y Aclacancha (provincia de Ambo, departamento de Huánuco se puede comprender cómo se organizan los comuneros para defender sus tierras comunales. El análisis de las solicitudes enviadas por los comuneros a las autoridades gubernamentales nos muestra la importancia, para la comunidad, de hacer valer tanto la legitimidad de sus derechos de propiedad como, al mismo tiempo, apoyarse sobre acciones legales y ocupaciones de tierras. La utilización simultánea de esos medios de reivindicación no explica en sí el deslizamiento violento, conocido en la prensa como la masacre de Ambo. Pero sí, el análisis de los contextos en los cuales interactuan todos los actores de ese drama (comuneros, sindicalistas, autoridades políticas, gardias civiles y hacendados nos permite comprender por qué las reclamaciones de esta comunidad desembocan en la muerte de comuneros. Through a history of the community’s rebellion (Huaylla y Aclacancha, in

  6. La estrategia diplomática-militar de España reflejada en la correspondencia extraoficial del Duque de Huéscar entre 1747 y 1748

    Directory of Open Access Journals (Sweden)

    Naiara Pavía Dopazo

    2014-02-01

    Full Text Available En este artículo se pretende contribuir al conocimiento de los sucesos bélicos acaecidos en Génovadurante la primavera de 1747, a través del intercambio de correspondencia inédita entre algunos delos principales aliados españoles de esta república, capitaneados por Carvajal y Ensenada que encontraronen don Fernando de Silva, duque de Huéscar (luego de Alba, el mejor enlace para la conformaciónde una red social que permitiera un conocimiento extraoficial que mejorara la capacidad deactuación a favor de los intereses de España en dicha república. Un análisis interpersonal de un hechohistórico que pone de manifiesto la «tensa relación» diplomática entre Francia y España, unidas porel Pacto de Familia de 1743 y que determinó las estrategias diplomáticas llevadas por ambos durantelas negociaciones de la paz de Aquisgrán, que puso fin a la Guerra de Sucesión Austriaca.With this article we’re trying to contribute to the knowledge of the warlike events occurred in Genoaduring the spring of 1747, through the exchange of unknown correspondence among some of theprincipal Spanish allies of this republic, led by Carvajal and Ensenada who found in don Fernando ofSilva, Duke of Huéscar (later Duke of Alba, the best link for the conformation of a social network thatallowed an unofficial knowledge in order to improve the capacity of action in favour of the interestsof Spain in the above mentioned republic. An interpersonal analysis of a historical fact that revealsthe diplomatic «tense relationship” between France and Spain, joined by the Family agreement of 1743and that was decisive for the diplomatic strategies accomplished by both of them during thenegotiations of the Peace of Aachen (Aix-la-Chapelle, which came to an end with the War of theAustrian Succession.

  7. Factores asociados a la infección por Ehrlichia canis en perros infestados con garrapatas en la ciudad de Huánuco, Perú

    Directory of Open Access Journals (Sweden)

    Edward Huerto-Medina

    Full Text Available El objetivo del estudio fue determinar la frecuencia y factores asociados a la infección por Ehrlichia canis en perros. Se recolectaron muestras de sangre de 150 perros infestados con garrapatas en 10 consultorios veterinarios de la ciudad de Huánuco en Perú, los perros fueron seleccionados al azar sin distinción de raza, edad ni sexo. Se detectó anticuerpos contra Ehrlichia canis mediante inmunoensayo cromatográfico. El 51,3% de perros estuvieron infectados por Ehrlichia canis. En el análisis multivariado se encontraron asociados a la presencia Ehrlichia canis, el mal estado de salud del perro (p=0,049, un promedio mayor de infestación por garrapatas (p=0,018, perros de edad adulta (p=0,038. La frecuencia de Ehrlichia canis en perros de esta ciudad es alta. Se recomienda el control de la garrapata marrón del perro (Rhipicephalus sanguineus vector de la Ehrlichia canis

  8. Serum metabonomics study of anti-depressive effect of Xiao-Chai-Hu-Tang on rat model of chronic unpredictable mild stress.

    Science.gov (United States)

    Xiong, Zhili; Yang, Jie; Huang, Yue; Zhang, Kuo; Bo, Yunhai; Lu, Xiumei; Su, Guangyue; Ma, Jie; Yang, Jingyu; Zhao, Longshan; Wu, Chunfu

    2016-09-01

    Xiao-Chai-Hu-Tang (XCHT) has been proven to be effective for the clinical treatment of depression. However, the mechanisms of definite antidepressant-like effects and detailed metabolic biomarkers were still unclear in this prior study. Here, we have investigated the metabolic profiles and potential biomarkers in a chronic unpredictable mild stress model after treatment with XCHT. Metabonomics based on ultra-high performance liquid chromatography coupled with mass spectrometry was used to profile the metabolic fingerprints of serum obtained from a rat model with chronic unpredictable mild stress with and without XCHT treatment. The model rats showed a significant decrease in sucrose preference and food consumption, and these depression-like symptoms were significantly improved by XCHT. Through principal component analysis (PCA), nine potential biomarkers of tryptophan, uric acid, phenylalanine, cholic acid and lysophosphatidylcholine (C18:0 LPC, C16:0 LPC, C16:1 LPC, C18:1 LPC, C20:4 LPC) were characterized as potential biomarkers involved the pathogenesis of depression. The therapeutic effect of XCHT on depression may involve in amino acid metabolism, lipid metabolism, oxidative stress and inflammation response. The present investigation highlights that metabonomics is a valuable tool for studying the essence of depression as well as evaluating the efficacy of the corresponding drug treatment. Copyright © 2016 Elsevier B.V. All rights reserved.

  9. Contents of the heavy metals nickel and lead in leaves of Paulownia elongata S.Y. Hu and Paulownia fortunei Hems. in Serbia

    Directory of Open Access Journals (Sweden)

    Stanković Dragica

    2009-01-01

    Full Text Available A comparative study was carried out on the capabilities of the two species Paulownia elongata S. Y. Hu and Paulownia fortunei Hems. as biomonitors of atmospheric (and soil heavy-metal pollution. Research on content of the heavy metals nickel (Ni and lead (Pb in leaves of the species Paulownia elongata growing under urban and suburban conditions with the comparison to the concentration of these elements in leaves of the species Paulownia elongata and Paulownia fortunei on an experimental plot in Bela Crkva showed average nickel concentrations of 2.7 μg/g on the experimental plot in Bela Crkva, Serbia, twice as low as the concentrations measured under extreme urban conditions (6.62 μg/g, or 4.54 μg/g in the immediate vicinity of suburban traffic lines. Inasmuch as Paulownia elongata endures urban conditions well, it can be recommended for cultivation in parks, tree alleys, and wind-protection zones along urban and regional traffic lines.

  10. Assessment of in vitro cyto/genotoxicity of sequentially treated electroplating effluent on the human hepatocarcinoma HuH-7 cell line.

    Science.gov (United States)

    Naik, Umesh Chandra; Das, Mihir Tanay; Sauran, Swati; Thakur, Indu Shekhar

    2014-03-01

    The present study compares in vitro toxicity of electroplating effluent after the batch treatment process with that obtained after the sequential treatment process. Activated charcoal prepared from sugarcane bagasse through chemical carbonization, and tolerant indigenous bacteria, Bacillus sp. strain IST105, were used individually and sequentially for the treatment of electroplating effluent. The sequential treatment involving activated charcoal followed by bacterial treatment removed 99% of Cr(VI) compared with the batch processes, which removed 40% (charcoal) and 75% (bacteria), respectively. Post-treatment in vitro cyto/genotoxicity was evaluated by the MTT test and the comet assay in human HuH-7 hepatocarcinoma cells. The sequentially treated sample showed an increase in LC50 value with a 6-fold decrease in comet-assay DNA migration compared with that of untreated samples. A significant decrease in DNA migration and an increase in LC50 value of treated effluent proved the higher effectiveness of the sequential treatment process over the individual batch processes. Copyright © 2014 Elsevier B.V. All rights reserved.

  11. SupT1 Cell Infusion as a Possible Cell-Based Therapy for HIV: Results from a Pilot Study in Hu-PBMC BRGS Mice

    Directory of Open Access Journals (Sweden)

    Jonathan Fior

    2016-04-01

    Full Text Available In a previous in vitro study, the SupT1 cell line was explored as a decoy target for HIV-1, proposing SupT1 cell infusion as a possible cell-based therapy for HIV. In the present work, the previous in vitro model was translated into an in vivo setting. Specifically, Hu-PBMC BRGS mice were infected with a high input of HIV-1 LAI (100,000 TCID50, and 40 million 30 Gy-irradiated SupT1 cells were infused weekly for 4 weeks as a therapy. Blood samples were taken to monitor CD4+ T cell count and viral load, and mice were monitored daily for signs of illness. At the earliest time point analyzed (Week 1, there was a significantly lower plasma viral load (~10-fold in all animals treated with SupT1 cell infusion, associated with a higher CD4+ T cell count. At later time points, infection proceeded with robust viral replication and evident CD4+ T cell depletion, except in one mouse that showed complete suppression of viral replication and preservation of CD4+ T cell count. No morbidity or mortality was associated with SupT1 cell infusion. The interesting tendencies observed in the generated data suggest that this approach should be further investigated as a possible cell-based HIV therapy.

  12. Hu-Lu-Ba-Wan Attenuates Diabetic Nephropathy in Type 2 Diabetic Rats through PKC-α/NADPH Oxidase Signaling Pathway

    Directory of Open Access Journals (Sweden)

    Lishan Zhou

    2013-01-01

    Full Text Available Hu-Lu-Ba-Wan (HLBW is a Chinese herbal prescription used to treat kidney deficiency. The aim of this study was to explore the effect and mechanism of HLBW on diabetic nephropathy (DN in type 2 diabetic rats. The rat model of DN was established by being fed a high-fat diet and intravenous injection of streptozotocin. Then, HLBW decoction was administered for 16 weeks. Blood glucose level, lipid profile, renal function, 24-hour total urinary protein, and albumin content were examined. Renal morphology and superoxide anion levels were evaluated. The activity of nicotinamide-adenine dinucleotide phosphate (NADPH and protein kinase C-alpha (PKC-α related genes expression in renal tissue were also determined. Our data demonstrated that HLBW significantly improved hyperglycemia, hyperlipidemia, and proteinuria in diabetic rats compared with those of control group. HLBW also alleviated glomerular expansion and fibrosis, extracellular matrix accumulation and effacement of the foot processes. Additionally, HLBW reduced superoxide anion level, NADPH oxidase activity, the protein and mRNA expressions of p47phox, and the protein expression of phosphorylated PKC-α in renal tissue. These results suggest that HLBW is effective in the treatment of DN in rats. The underlying mechanism may be related to the attenuation of renal oxidative stress via PKC-α/NADPH oxidase signaling pathway.

  13. NOTES AND CORRESPONDENCE Evaluation of Tidal Removal Method Using Phase Average Technique from ADCP Surveys along the Peng-Hu Channel in the Taiwan Strait

    Directory of Open Access Journals (Sweden)

    Yu-Chia Chang

    2008-01-01

    Full Text Available Three cruises with shipboard Acoustic Doppler Current Profiler (ADCP were performed along a transect across the Peng-hu Channel (PHC in the Taiwan Strait during 2003 - 2004 in order to investigate the feasibility and accuracy of the phase-averaging method to eliminate tidal components from shipboard ADCP measurement of currents. In each cruise measurement was repeated a number of times along the transect with a specified time lag of either 5, 6.21, or 8 hr, and the repeated data at the same location were averaged to eliminate the tidal currents; this is the so-called ¡§phase-averaging method¡¨. We employed 5-phase-averaging, 4-phase-averaging, 3-phase-averaging, and 2-phase-averaging methods in this study. The residual currents and volume transport of the PHC derived from various phase-averaging methods were intercompared and were also compared with results of the least-square harmonic reduction method proposed by Simpson et al. (1990 and the least-square interpolation method using Gaussian function (Wang et al. 2004. The estimated uncertainty of the residual flow through the PHC derived from the 5-phase-averaging, 4-phase-averaging, 3-phase-averaging, and 2-phase-averaging methods is 0.3, 0.3, 1.3, and 4.6 cm s-1, respectively. Procedures for choosing a best phase average method to remove tidal currents in any particular region are also suggested.

  14. A Pilot Trial of Humanized Anti-GD2 Monoclonal Antibody (hu14.18K322A) with Chemotherapy and Natural Killer Cells in Children with Recurrent/Refractory Neuroblastoma.

    Science.gov (United States)

    Federico, Sara M; McCarville, M Beth; Shulkin, Barry L; Sondel, Paul M; Hank, Jacquelyn A; Hutson, Paul; Meagher, Michael; Shafer, Aaron; Ng, Catherine Y; Leung, Wing; Janssen, William E; Wu, Jianrong; Mao, Shenghua; Brennan, Rachel C; Santana, Victor M; Pappo, Alberto S; Furman, Wayne L

    2017-11-01

    Purpose: Anti-GD2 mAbs, acting via antibody-dependent cell-mediated cytotoxicity, may enhance the effects of chemotherapy. This pilot trial investigated a fixed dose of a unique anti-GD2 mAb, hu14.18K322A, combined with chemotherapy, cytokines, and haploidentical natural killer (NK) cells. Experimental Design: Children with recurrent/refractory neuroblastoma received up to six courses of hu14.18K322A (40 mg/m 2 /dose, days 2-5), GM-CSF, and IL2 with chemotherapy: cyclophosphamide/topotecan (courses 1,2), irinotecan/temozolomide (courses 3,4), and ifosfamide/carboplatin/etoposide (courses 5,6). Parentally derived NK cells were administered with courses 2, 4, and 6. Serum for pharmacokinetic studies of hu14.18K322A, soluble IL2 receptor alpha (sIL2Rα) levels, and human antihuman antibodies (HAHA) were obtained. Results: Thirteen heavily pretreated patients (9 with prior anti-GD2 therapy) completed 65 courses. One patient developed an unacceptable toxicity (grade 4 thrombocytopenia >35 days). Four patients discontinued treatment for adverse events (hu14.18K322A allergic reaction, viral infection, surgical death, second malignancy). Common toxicities included grade 3/4 myelosuppression (13/13 patients) and grade 1/2 pain (13/13 patients). Eleven patients received 29 NK-cell infusions. The response rate was 61.5% (4 complete responses, 1 very good partial response, 3 partial responses) and five had stable disease. The median time to progression was 274 days (range, 239-568 days); 10 of 13 patients (77%) survived 1 year. Hu14.18K322A pharmacokinetics was not affected by chemotherapy or HAHA. All patients had increased sIL2Rα levels, indicating immune activation. Conclusions: Chemotherapy plus hu14.18K322A, cytokines, and NK cells is feasible and resulted in clinically meaningful responses in patients with refractory/recurrent neuroblastoma. Further studies of this approach are warranted in patients with relapsed and newly diagnosed neuroblastoma. Clin Cancer Res; 23

  15. Towards the identification of alkaline phosphatase binding ligands in Li-Dan-Hua-Shi pills: A Box-Behnken design optimized affinity selection approach tandem with UHPLC-Q-TOF/MS analysis.

    Science.gov (United States)

    Tao, Yi; Huang, Surun; Gu, Xianghui; Li, Weidong; Cai, Baochang

    2018-05-30

    Alkaline phosphatase conjugated magnetic microspheres were synthesized via amide reaction, and employed as an effective adsorbent in affinity selection of binding ligands followed by UHPLC-Q-TOF/MS analysis. The analytical validity of the developed approach was evaluated under optimized conditions and the following figures of merit were obtained: linearity, 0.01-0.5 g L -1 with good determination coefficients (R 2  = 0.9992); limits of detection (LODs), 0.003 g L -1 ; and limits of quantitation (LOQ), 0.01 g L -1 . The precision (RSD%) of the proposed affinity selection approach was studied based on intra-day (0.8%) and inter-day (1.3%) precisions. Finally, the adsorbent was successfully applied to identification of binding ligands in Li-Dan-Hua-Shi pills and good recoveries were obtained in the range from 96.9 to 99.4% (RSDs 1.6-3.0%). Copyright © 2018 Elsevier B.V. All rights reserved.

  16. Mitilanotherium inexpectatum (Giraffidae, Mammalia from Huélago (Lower Pleistocene; Guadix-Baza basin, Granada, Spain - observations on a peculiar biogegraphic pattern

    Directory of Open Access Journals (Sweden)

    Morales, J.

    2011-12-01

    Full Text Available Giraffid fossils from the lowermost Pleistocene (MN17 locality Huélago (Guadix-Baza Basin, Granada, Spain are described and assigned to Mitilanotherium inexpectatum Samson & Radulesco (1966. The remains are compared to giraffid material from the Pliocene and younger. The known geographic distribution of this giraffid is disjunct; it is found in Spain and in an area stretching from Rumania and Greece to Tadzhikistan, but not in central Europe. The oldest record is from the Upper Pliocene (MN16 of Turkey and the youngest is from the Lower Pleistocene of Greece (with an estimated age of about 1.2 Ma. Shortly after 2.6 Ma it may have dispersed to Spain, where it may have lived as much as half a million years. The dispersal did not leave a fossil record in the area between SE Europe and Spain. The same occured with dispersals of other mammals in the Early, Middle and Late Miocene, Pliocene and Pleistocene. These species that show this pattern are interpreted to be adapted to open or arid environments. Their dispersals across Europe to Spain may have occurred during short periods of atypical environmental conditions and thus did not leave an easily detectable fossil record.Los fósiles de jirafas del Pleistoceno basal (MN 17 de la localidad de Huélago (Cuenca de Guadix- Baza, Granada, Spain son descritos y asignados a Mitilanotherium inexpectatum Samson & Radulesco (1966. Los restos fósiles son comparados con jiráfidos del Plioceno, y formas más recientes. La distribución geográfica conocida muestra que es disyunta; encontrándose en España y en un área que se extiende de Rumania y Grecia a Tadzhikistan, pero no en Europa central. El registro más antiguo procede del Plioceno Superior (MN 16 de Turquía y el más reciente del Pleistoceno inferior de Grecia (con una edad estimada de ca. 1, 2 Ma. Poco después de los 2,6 Ma la especie pudo haberse dispersado a España, donde como mucho pudo haber durado medio millón de años. Esta dispersion

  17. Efecto de una intervención educativa sobre los conocimientos de teniasis/cisticercosis en una comunidad rural de Huánuco, Perú 2005

    Directory of Open Access Journals (Sweden)

    Elsa Palacios-Flores

    2008-07-01

    Full Text Available Objetivo. Evaluar el efecto de una intervención educativa sobre los conocimientos de teniasis/cisticercosis en los pobladores de la localidad de Queropalca, Huánuco. Materiales y métodos. Se realizó un ensayo comunitario, en el cual se aplicó una estrategia educativo comunicacional sobre los factores de riesgo de teniasis/cisticercosis, consistente en metodologías participativas de visitas casa en casa y campañas de promoción en toda la jurisdicción durante seis meses (junio a diciembre del 2005. Se midió el nivel de conocimientos sobre teniasis/cisticercosis en los pobladores de 10 años a más de edad. Resultados. Se evaluaron 142 pobladores, la intervención educativa mejoró el nivel de conocimiento global sobre la teniasis/cisticercosis (p < 0,001 y sobre los factores de riesgo como la eliminación de basura al campo libre (p = 0,027, consumo de alimentos sin lavarse las manos (p = 0,043, crianza de cerdos sin corral (p < 0,001, no uso de letrinas o baños (p < 0,001, consumo de carne de cerdo sin inspección sanitaria (p < 0,001, no se modificó el nivel de conocimiento relacionado al consumo de agua no tratada (p = 0,148. Conclusiones. La aplicación de la metodología educativo comunicacional incrementó los conocimientos relacionados con las medidas higiénicas sanitarias para la prevención y control de la teniasis/cisticercosis en una población altoandina.

  18. The Diversity of REcent and Ancient huMan (DREAM): A New Microarray for Genetic Anthropology and Genealogy, Forensics, and Personalized Medicine.

    Science.gov (United States)

    Elhaik, Eran; Yusuf, Leeban; Anderson, Ainan I J; Pirooznia, Mehdi; Arnellos, Dimitrios; Vilshansky, Gregory; Ercal, Gunes; Lu, Yontao; Webster, Teresa; Baird, Michael L; Esposito, Umberto

    2017-12-01

    The human population displays wide variety in demographic history, ancestry, content of DNA derived from hominins or ancient populations, adaptation, traits, copy number variation, drug response, and more. These polymorphisms are of broad interest to population geneticists, forensics investigators, and medical professionals. Historically, much of that knowledge was gained from population survey projects. Although many commercial arrays exist for genome-wide single-nucleotide polymorphism genotyping, their design specifications are limited and they do not allow a full exploration of biodiversity. We thereby aimed to design the Diversity of REcent and Ancient huMan (DREAM)-an all-inclusive microarray that would allow both identification of known associations and exploration of standing questions in genetic anthropology, forensics, and personalized medicine. DREAM includes probes to interrogate ancestry informative markers obtained from over 450 human populations, over 200 ancient genomes, and 10 archaic hominins. DREAM can identify 94% and 61% of all known Y and mitochondrial haplogroups, respectively, and was vetted to avoid interrogation of clinically relevant markers. To demonstrate its capabilities, we compared its FST distributions with those of the 1000 Genomes Project and commercial arrays. Although all arrays yielded similarly shaped (inverse J) FST distributions, DREAM's autosomal and X-chromosomal distributions had the highest mean FST, attesting to its ability to discern subpopulations. DREAM performances are further illustrated in biogeographical, identical by descent, and copy number variation analyses. In summary, with approximately 800,000 markers spanning nearly 2,000 genes, DREAM is a useful tool for genetic anthropology, forensic, and personalized medicine studies. © The Author(s) 2017. Published by Oxford University Press on behalf of the Society for Molecular Biology and Evolution.

  19. Humanización de la Sanidad y Salud Laboral: Implicaciones, estado de la cuestión y propuesta del Proyecto HU-CI

    Directory of Open Access Journals (Sweden)

    Macarena Gálvez Herrer

    Full Text Available Resumen La evolución científica y técnica de la atención sanitaria mantienen un desarrollo exponencial que permite cada vez una mejor asistencia a los pacientes, nuevas formas de tratamiento y crecientes índices de supervivencia. Sin embargo, estos importantes avances que enriquecen la atención a la salud, en muchas ocasiones, han ido invadiendo espacio al propio acto humano de la atención a la persona. Potenciar organizaciones más humanizadas implicará establecer acciones dirigidas al ambiente y lugar de trabajo, así como a todos los agentes implicados (pacientes, familiares y profesionales. Con dicha finalidad, las políticas de Humanización y su aplicación al contexto sanitario son una realidad en nuestros días y están concretándose en algunas propuestas específicas en determinadas organizaciones, con el apoyo de algunos organismos oficiales. En el presente trabajo, señalamos la interacción entre los objetivos de dichas políticas de humanización y las metas de la salud laboral en contextos asistenciales. Se exploran áreas comunes de trabajo dirigidas al bienestar del profesional sanitario, posibilidades de gestión integral de ambos conceptos, y se expone un ejemplo concreto como es el Proyecto de Humanización de las Unidades de Cuidados Intensivos (HU-CI.

  20. Estudio clínico epidemiológico de bartonelosis humana en el valle del Monzón, Huamalíes, Huánuco

    Directory of Open Access Journals (Sweden)

    Abelardo Tejada

    2003-12-01

    Full Text Available OBJETIVO: Estudiar los casos de bartonelosis humana en valle del Monzón y determinar las especies de Lutzomyia que podrían jugar papel en la transmisión de la enfermedad en la zona. MATERIAL Y MÉTODOS: Se estudió casos de la enfermedad de Carrión en la selva alta del valle del Monzón, provincia de Huamalíes, Huánuco, donde entre 1997 y 1998 se presentó un brote epidémico. Para el diagnóstico de los casos se realizó frotis y gota gruesa, hemocultivo y serología. Para la captura de flebotominos, se utilizó trampas de luz CDC y trampa Shannon, en ambientes intra y peridomiciliarios. RESULTADOS: A lo largo de 21 localidades, la enfermedad afectó 140 personas, 25 de ellos entre 1 y 4 años de edad, 81 mujeres y 59 hombres; 121 presentaron la fase aguda de la enfermedad, 16 la fase intercalar y 3 la fase eruptiva. La población de la zona se dedica principalmente al cultivo de la coca, café y cacao. CONCLUSIÓN: Se estableció que el valle del Monzón es nueva zona endémica de bartonelosis humana, donde la transmisión ocurre principalmente en ambientes intra y peridomiciliarios, siendo Lutzomyia serrana el vector más probable.

  1. Characterization and determination of antioxidant components in the leaves of Camellia chrysantha (Hu Tuyama based on composition–activity relationship approach

    Directory of Open Access Journals (Sweden)

    Jin-Bin Wei

    2015-03-01

    Full Text Available Camellia chrysantha (Hu Tuyama (CCT, an ornamental plant possessing antioxidant activity, has been infused as tea and drank for its health benefits. The antioxidant components in CCT, however, had not been clearly characterized. To quickly identify the antioxidant constituents of CCT, a composition–activity relationship strategy based on ultra high-pressure liquid chromatography coupled with linear ion trap hybrid orbitrap mass spectrometry and orthogonal partial least-squares method has been applied. As a result, 16 variables were found to make significant contributions to the 1,1-diphenyl-2-picrylhydrazyl radical scavenging activity. Six of them were identified as catechin (1, epicatechin (5, vitexin (8, isovitexin (10, quercetin-7-O-β-D-glucopyranoside (12 and kaempferol (16. The strength of 1,1-diphenyl-2-picrylhydrazyl radical scavenging activity was found to be 12 > 1 > 5 > 16 > 8 > 10 by validation test. Meanwhile, a liquid chromatography-electrospray ionization-mass spectrometry method was established for quantitative determination of six marker compounds in CCT samples from different preparations. The validation of the method, including linearity, sensitivity (limitation of detection and limitation of quantification, repeatability, precision, stability, and recoveries, was carried out and demonstrated to meet the requirements of quantitative analysis. This is the first report on the comprehensive characterization and determination of chemical constituents in CCT by ultra high-pressure liquid chromatography coupled with linear ion trap hybrid orbitrap mass spectrometry. The results indicate that the composition–activity relationship approach may be a useful method for the discovery of active constituents in natural plants and the quality control of medicinal herbs.

  2. Synthesis of (R)-5-(Di[2,3-3H2]propylamino)-5,6-dihydro-4H-imidazo[4,5,1-ij]quinolin-2(1H)-one-([3H]U-86170) and (R)-5-([2,3-3H2]propylamino)-5,6-dihydro-4H-imidazo(4,5,1-ij) quinolin-2(1H)-one ([3H]U-91356)

    International Nuclear Information System (INIS)

    Moon, M.W.; Hsi, R.S.P.

    1992-01-01

    (R)-5-(diallylamino)-5,6-dihydro-4H-imidazo[4,5,1-ij]quinolin-2(1H)-one (12b) was prepared in 9% overall yield from 3-aminoquinoline. Reaction of 12b in ethyl acetate with tritium gas in presence of a 5% platinum on carbon catalyst afforded a mixture of (R)-5-(di[2,3- 3 H 2 ]propylamino)-5,6-dihydro-4H-imidazo[4,5,1-ij]-quinolin-2(1H)-one ([ 3 H]U-86170, 69 Ci/mmol) and (R)-5-([2,3- 3 H 2 ]-propylamino)5,6-dihydro-4H-imidazo-[4,5,1-ij]quinolin-2(1H)-one ( [ 3 H]U-91356, 34 Ci/mmol) which was separated by preparative reverse-phase chromatography. U-86170 and U-91356 are potent dopamine D2 agonists. The labelled compounds are useful for drug disposition studies. [ 3 H]U-86170 is also useful as a dopamine D2 agonist radioligand for receptor binding studies. (author)

  3. Mortalidad neonatal, análisis de registros de vigilancia e historias clínicas del año 2011 neonatales en Huánuco y Ucayali, Perú

    Directory of Open Access Journals (Sweden)

    José Enrique Velásquez Hurtado

    Full Text Available Objetivos. Estimar la tasa de mortalidad neonatal y describir las defunciones neonatales ocurridas en el 2011 en hospitales del Ministerio de Salud de las regiones Huánuco y Ucayali, Perú. Materiales y Métodos .Estudio transversal realizado de septiembre a noviembre de 2012 en Huánuco y Ucayali. Se revisaron los registros de las defunciones neonatales ocurridas en el 2011 en municipalidades provinciales, direcciones regionales de salud y cuatro hospitales de referencia. Para el cálculo de las tasas de mortalidad se utilizaron las fuentes de información más confiables por región. La revisión de 185 historias clínicas en los hospitales permitió describir las causas básicas de las muertes neonatales. Resultados. En el 2011 se reportaron en Huánuco 10 886 recién nacidos vivos y 158 muertes neonatales, con una tasa de 14,5 muertes por 1000 nacidos vivos. En Ucayali, se reportaron 11 441 recién nacidos vivos y 138 muertes neonatales, con una tasa de 12,1 muertes por 1000 nacidos vivos. La mayoría de muertes neonatales hospitalarias ocurrieron en los primeros 7 días de vida (87%, en neonatos prematuros (73,9% y con bajo peso al nacimiento (67%. Las causas básicas más frecuentes en las muertes neonatales fueron: infección (31,4%, malformación congénita (22,2% y prematuridad (18,9%. . Conclusiones La tasa de mortalidad neonatal en las regiones estudiadas fue superior a la media nacional. Los resultados sugieren la necesidad de intervenciones efectivas e integrales durante el embarazo, parto y periodo posnatal temprano; siendo este último periodo el de mayor vulnerabilidad en el neonato

  4. Mortalidad neonatal, análisis de registros de vigilancia e historias clínicas del año 2011 en Huánuco y Ucayali, Perú

    Directory of Open Access Journals (Sweden)

    José Enrique Velásquez Hurtado

    Full Text Available Objetivos. Estimar la tasa de mortalidad neonatal y describir las defunciones neonatales ocurridas en el 2011 en hospitales del Ministerio de Salud de las regiones Huánuco y Ucayali, Perú. Materiales y Métodos .Estudio transversal realizado de septiembre a noviembre de 2012 en Huánuco y Ucayali. Se revisaron los registros de las defunciones neonatales ocurridas en el 2011 en municipalidades provinciales, direcciones regionales de salud y cuatro hospitales de referencia. Para el cálculo de las tasas de mortalidad se utilizaron las fuentes de información más confiables por región. La revisión de 185 historias clínicas en los hospitales permitió describir las causas básicas de las muertes neonatales. Resultados. En el 2011 se reportaron en Huánuco 10 886 recién nacidos vivos y 158 muertes neonatales, con una tasa de 14,5 muertes por 1000 nacidos vivos. En Ucayali, se reportaron 11 441 recién nacidos vivos y 138 muertes neonatales, con una tasa de 12,1 muertes por 1000 nacidos vivos. La mayoría de muertes neonatales hospitalarias ocurrieron en los primeros 7 días de vida (87%, en neonatos prematuros (73,9% y con bajo peso al nacimiento (67%. Las causas básicas más frecuentes en las muertes neonatales fueron: infección (31,4%, malformación congénita (22,2% y prematuridad (18,9%. . Conclusiones La tasa de mortalidad neonatal en las regiones estudiadas fue superior a la media nacional. Los resultados sugieren la necesidad de intervenciones efectivas e integrales durante el embarazo, parto y periodo posnatal temprano; siendo este último periodo el de mayor vulnerabilidad en el neonato

  5. Role of transcription factor Sp1 and RNA binding protein HuR in the downregulation of Dr+ Escherichia coli receptor protein decay accelerating factor (DAF or CD55) by nitric oxide.

    Science.gov (United States)

    Banadakoppa, Manu; Liebenthal, Daniel; Nowak, David E; Urvil, Petri; Yallampalli, Uma; Wilson, Gerald M; Kishor, Aparna; Yallampalli, Chandra

    2013-02-01

    We previously reported that nitric oxide (NO) reduces the rate of bacteremia and maternal mortality in pregnant rats with uterine infection by Escherichia coli expressing the Dr Fimbria (Dr(+) ). The epithelial invasion of Dr(+) E. coli is dependent on the expression level of its cellular receptor decay accelerating factor (DAF). NO reduces the rate of bacteremia by downregulating the expression of DAF. In this study, we elucidated the role of transcription factor Sp1 and RNA binding protein HuR in the downregulation of human DAF by NO. We generated a series of deletion mutant constructs of DAF gene 5'-untranslated region and mapped the NO-response region upstream to the core promoter region of the DAF gene. One of the several Sp1 binding sites in the DAF 5'-untranslated region was located within the NO-response region. The binding of Sp1 to this site was inhibited by NO. Furthermore, NO also promoted the degradation of DAF mRNA. The 3'-untranslated region of DAF harbors an AU-rich element and this element destabilized the mRNA transcript. NO promoted the rapid degradation of DAF mRNA by inhibiting the binding of mRNA stabilizing protein HuR to this AU-rich region. The inhibition of binding of HuR to the AU-rich region was due to the S-nitrosylation of one or more cysteine residues by NO. Thus, these data reveal the molecular mediators of transcriptional and post-transcriptional regulation of DAF by NO with implications in pathophysiology related to DAF. © 2012 The Authors Journal compilation © 2012 FEBS.

  6. A 970 Hounsfield units (HU) threshold of kidney stone density on non-contrast computed tomography (NCCT) improves patients' selection for extracorporeal shockwave lithotripsy (ESWL): evidence from a prospective study.

    Science.gov (United States)

    Ouzaid, Idir; Al-qahtani, Said; Dominique, Sébastien; Hupertan, Vincent; Fernandez, Pédro; Hermieu, Jean-François; Delmas, Vincent; Ravery, Vincent

    2012-12-01

    What's known on the subject? and What does the study add? Stone density on non-contrast computed tomography (NCCT) is reported to be a prognosis factor for extracorporeal shockwave lithotripsy (ESWL). In this prospective study, we determined that a 970 HU threshold of stone density is a very specific and sensitive threshold beyond which the likelihood to be rendered stone free is poor. Thus, NCCT evaluation of stone density before ESWL may useful to identify which patients should be offered alternative treatment to optimise their outcome. • To evaluate the usefulness of measuring urinary calculi attenuation values by non-contrast computed tomography (NCCT) for predicting the outcome of treatment by extracorporeal shockwave lithotripsy (ESWL). • We prospectively evaluated 50 patients with urinary calculi of 5-22 mm undergoing ESWL. • All patients had NCCT at 120 kV and 100 mA on a spiral CT scanner. Patient age, sex, body mass index, stone laterality, stone size, stone attenuation values (Hounsfield units [HU]), stone location, and presence of JJ stent were studied as potential predictors. • The outcome was evaluated 4 weeks after the ESWL session by NCCT. • ESWL success was defined as patients being stone-free (SF) or with remaining stone fragments of ESWL treatment. • Stones of patients who became SF or had CIRF had a lower density compared with stones in patients with residual fragments [mean (sd) 715 (260) vs 1196 (171) HU, P ESWL was identified. • The use of NCCT to determine the attenuation values of urinary calculi before ESWL helps to predict treatment outcome, and, consequently, could be helpful in planning alternative treatment for patients with a likelihood of a poor outcome from ESWL. © 2012 THE AUTHORS. BJU INTERNATIONAL © 2012 BJU INTERNATIONAL.

  7. Estrategia de intervención en el empoderamiento de la mujer víctima de violencia de pareja de una zona periurbana de Huánuco; 2017

    OpenAIRE

    Quiñones Flores, Mitzi Marleni

    2017-01-01

    El objetivo del estudio fue demostrar el efecto de la estrategia de intervención en el empoderamiento de la mujer víctima de violencia de pareja de una zona periurbana de Huánuco. El estudio fue de tipo longitudinal, analítico, prospectivo y experimental; con 44 mujeres para el grupo experimental y control, quienes respondieron los instrumentos de valoración previamente fiabilizados y según consideraciones éticas. La comprobación de hipótesis fue mediante la prueba U de Mann-Whitney para un p...

  8. Excepciones a la prueba prohibida para garantizar el derecho al debido proceso penal, en la Corte Superior de Justicia del Distrito Judicial de Huánuco, 2014 - 2015

    OpenAIRE

    Flores León, Vilma Felicitas

    2016-01-01

    La presente investigación ha tenido el objetivo de identificar las excepciones a la prueba prohibida que deben ser admitidas y valoradas para garantizar el derecho al debido proceso penal en la Corte Superior de Justicia del Distrito Judicial de Huánuco, 2014 - 2015, planteándose como una hipótesis que, la investigación de la verdad en el proceso penal, la defensa de los derechos fundamentales de la persona humana y el interés público, son las excepciones a la prueba prohibida que deben ser a...

  9. Prevalencia de hepatitis viral A y B y factores de riesgo asociados a su infección en la población escolar de un distrito de Huánuco - Perú

    Directory of Open Access Journals (Sweden)

    C Heriberto Hidalgo

    2002-01-01

    Full Text Available Objetivo: Determinar la prevalencia de marcadores serológicos para la infección por el virus de la hepatitis A y B en la población escolar del distrito de Huánuco e identificar los factores asociados a dichas infecciones. Materiales y métodos: en este estudio transversal analítico se seleccionó una muestra aleatoria y estratificada de 270 del total de escolares registrados en los diferentes centros educativos del distrito de Huánuco, Departamento de Huánuco-Perú, de abril a diciembre del 2000, en quienes se evaluó la presencia de HBsAg y anticuerpos anti-HAV, anticuerpos totales, anticuerpos IgM anti-HBcAg, anti-HDV y antígeno "e" en sangre (Estos últimos tres sólo a los HBsAg reactivos. La presencia de factores de riesgo para la infección por estos dos virus fue evaluada por una encuesta epidemiológica. Resultados: 257 (95,2% escolares tuvieron Anticuerpos anti-HAV, 8 (3,0% resultaron ser portadores de HBsAg, 62 (23,0% tuvieron anticuerpos anti- HBcAg y ninguno de los 8 portadores de HBsAg tuvieron anticuerpos anti-HDV, anticuerpos IgM anti-HBcAg, ni antígeno "e" (HBeAg. La edad mayor a 11 años estuvo asociada a la presencia de anti-HAV (OR=14,3, p<0,001. El tener vivienda de adobe estuvo asociado a la reactividad al HBsAg (OR=5,1, p=0,045 y el tener relaciones sexuales estuvo asociado a la presencia de anticuerpos anti-HBcAg (OR=6,49, p=0,003. Conclusiones: el distrito de Huánuco tiene una alta endemicidad para HAV y endemicidad intermedia para el HBV. La edad mayor de 11 años estuvo asociada a una mayor infección por HAV y el tener vivienda precaria y relaciones sexuales a una mayor infección por HBV.

  10. Factores de depresión y de autoestima en mujeres víctimas de violencia familiar asistidas en un Centro de Emergencia Mujer de la provincia de Huánuco

    OpenAIRE

    Sobrado Chávez, Félix Dulio

    2017-01-01

    Investigación de tipo descriptiva comparativa correlacional tuvo como objetivo Establecer la relación y/o comparación entre los niveles de depresión y de autoestima que presentan las mujeres víctimas de violencia, asistidas en un centro emergencia mujer de la provincia de Huánuco según el tipo de familia, estado civil, ocupación y la edad. Se aplicaron las escalas de depresión de Beck y la escala de Coopersmith a una muestra de 140 mujeres entre 18 a 47 años de edad. Los datos fueron procesad...

  11. In vitro and in vivo bactericidal activity of Tinospora sagittata (Oliv.) Gagnep. var. craveniana (S.Y.Hu) Lo and its main effective component, palmatine, against porcine Helicobacter pylori

    OpenAIRE

    Rong, Qian; Xu, Min; Dong, Qi; Zhang, Yuli; Li, Yinglun; Ye, Gang; Zhao, Ling

    2016-01-01

    Background Tinospora sagittata (Oliv.) Gagnep. var. craveniana (S.Y.Hu) Lo (TSG) is a traditional Chinese herb that has been used for the treatment of upper respiratory tract infection and has anti-bacterial and anti-ulcer activity. Our study investigated the bactericidal effects of TSG and its major component, palmatine, against a Helicobacter pylori (H. pylori) strain isolated from pig and the standard strain H. pylori SS1 in vitro and in vivo. Methods H. pylori was isolated from pig and na...

  12. Las actividades extracurriculares y su influencia en la comprensión lectora del idioma inglés en los estudiantes del Instituto Superior Pedagógico Público “Marcos Duran Martel” - Huánuco 2013

    OpenAIRE

    Montero Albornoz, Rocio del Pilar

    2016-01-01

    El objetivo principal del trabajo de investigación es de determinar la mejor estrategia para desarrollar las actividades extracurriculares en la comprensión lectora del idioma Inglés en los estudiantes del Institutos Superior Pedagógico Públicos “Marcos Duran Martel” Huánuco. Esta investigación se enmarca en un enfoque investigativo integral y se clasifica como descriptivo explicativa. Todo el trabajo investigativo se realiza bajo el enfoque como método general de la ciencia, al utilizar un s...

  13. T'ai Chi

    Science.gov (United States)

    ... are different styles of t'ai chi, including: Chen style Hao (or Wu Shi) style Hu Lei ... medical advice, diagnoses, and treatment, consult your doctor. © 1995- The Nemours Foundation. All rights reserved. Images provided ...

  14. Implementación de un equipo de laboratorio para la planta piloto de lácteos campus Juan Lunardi, para el análisis de la leche en tres razas de vacas (Holstein, Jersey y Criollas) de la comuna indígena de Shiña-Nabón

    OpenAIRE

    Ascaribay Andrade, Saúl Geovani

    2013-01-01

    El presente trabajo de grado trata sobre la implementación de un equipo de laboratorio para el análisis comparativo de la leche entre tres razas de vacas, (Holstein, Jersey y Criollas), este análisis se lo realizo en la Asociación de Productores Agropecuarios de la comuna indígena de Shiña perteneciente al cantón Nabón provincia del Azuay, los parámetros a ser analizados están basados dentro de las normas técnicas que dicta el INEN, las normas que fueron analizadas fueron: Leche Cruda Requisi...

  15. The SHiP facility at CERN

    CERN Document Server

    AUTHOR|(SzGeCERN)452451

    2016-01-01

    Searches for new physics with accelerators are being performed at the LHC, looking for high massive particles coupled to matter with ordinary strength. A new experimental facility meant to search for very weakly coupled particles in the few GeV mass domain has been recently proposed. The existence of such particles, foreseen in dierent theoretical models beyond the Standard Model, is largely unexplored from the experimental point of view. A beam dump facility, built at CERN in the north area, using 400 GeV protons is a copious factory of charmed hadrons and could be used to probe the existence of such particles. The beam dump is also an ideal source of tau neutrinos, the less known particle in the Standard Model. In particular, tau anti-neutrinos have not been directly observed so far. We report the physics potential of such an experiment and outline the performances of a detector operating at the same facility for the search for the tau --> mu mu mu decay

  16. Coaxing shy particles into an atomic jar

    CERN Multimedia

    Hellemans, A

    2000-01-01

    A Dutch-American team claim they can produce anti-hydrogen atoms in far greater quantities than any other current method. They use rubidium ions to trap electrons by applying a pulsed electric field in a series of steps (1 page).

  17. Do talented women shy away from competition?

    NARCIS (Netherlands)

    Hoyer, Britta; van Huizen, T.M.; Keijzer, L.M.; Rezaei Khavas, T.; Rosenkranz, S.; Westbrock, B.

    2016-01-01

    We study the willingness to compete in a cognitive task among an entire cohort of fresh man business and economics students. Combining data from a lab-in-thefield experiment with university admissions data, we trace the gender gap in competitiveness at different levels of high school performance.

  18. Biased Facial Expression Interpretation in Shy Children

    Science.gov (United States)

    Kokin, Jessica; Younger, Alastair; Gosselin, Pierre; Vaillancourt, Tracy

    2016-01-01

    The relationship between shyness and the interpretations of the facial expressions of others was examined in a sample of 123 children aged 12 to 14?years. Participants viewed faces displaying happiness, fear, anger, disgust, sadness, surprise, as well as a neutral expression, presented on a computer screen. The children identified each expression…

  19. 从对电视剧《施琅大将军》的争论看 中国文化民族主义复兴的困境 (The Dilemma of Chinese Cultural Nationalism: the Case of the TV Program 'General Shi Lang'

    Directory of Open Access Journals (Sweden)

    Mobo Gao

    2007-01-01

    Full Text Available With the rise of China's status on international stage as a result of its economic development there is an increasingly audible voice of Chinese cultural nationalism. More and more educators and intellectuals are calling for the revival of Chinese traditional culture values. However, the very issues of who are the Chinese and what are traditional Chinese cultural values present a huge dilemma. The debates on a recent a TV program "General Shi Lang" consist a good case to illustrate this dilemma. Shi Lang was a general of the last days of the Ming Dynasty, but had surrendered to the Manchu Qing dynasty invaders and fought for the Machus take over Taiwan from a Chinese ruler. The debates show that the dilemma has its cause in at least three issues. First, it is not at all obvious who should be categorized as Chinese. Secondly, it is not at all obvious what Chinese cultural values are. And finally it is the issue of evaluation of traditional values against the universal claim of the values of liberal democracy.

  20. Chemical profiling approach to evaluate the influence of traditional and simplified decoction methods on the holistic quality of Da-Huang-Xiao-Shi decoction using high-performance liquid chromatography coupled with diode-array detection and time-of-flight mass spectrometry.

    Science.gov (United States)

    Yan, Xuemei; Zhang, Qianying; Feng, Fang

    2016-04-01

    Da-Huang-Xiao-Shi decoction, consisting of Rheum officinale Baill, Mirabilitum, Phellodendron amurense Rupr. and Gardenia jasminoides Ellis, is a traditional Chinese medicine used for the treatment of jaundice. As described in "Jin Kui Yao Lue", a traditional multistep decoction of Da-Huang-Xiao-Shi decoction was required while simplified one-step decoction was used in recent repsorts. To investigate the chemical difference between the decoctions obtained by the traditional and simplified preparations, a sensitive and reliable approach of high-performance liquid chromatography coupled with diode-array detection and electrospray ionization time-of-flight mass spectrometry was established. As a result, a total of 105 compounds were detected and identified. Analysis of the chromatogram profiles of the two decoctions showed that many compounds in the decoction of simplified preparation had changed obviously compared with those in traditional preparation. The changes of constituents would be bound to cause the differences in the therapeutic effects of the two decoctions. The present study demonstrated that certain preparation methods significantly affect the holistic quality of traditional Chinese medicines and the use of a suitable preparation method is crucial for these medicines to produce special clinical curative effect. This research results elucidated the scientific basis of traditional preparation methods in Chinese medicines. © 2016 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

  1. Factores diagnósticos endoscópicos y pronósticos relacionados con el Helicobacter Pylori en la enfermedad injerto contra huésped tras el trasplante alogénico de células hematopoyéticas

    OpenAIRE

    Velasco Guardado, Antonio

    2016-01-01

    [ES] INTRODUCCIÓN: El trabajo consta de tres artículos originales relacionados por un lado con el diagnóstico endoscópico e histológico en la Enfermedad de Injerto contra Huésped (EICH) tras el trasplante alogénico de células hematopoyéticas (TACH) y por otro sobre el papel que juega la infección por Helicobacter pylori (HP) en dicha enfermedad. El tracto gastrointestinal es la principal diana de la Enfermedad de Injerto contra Huésped. Su diagnóstico se basa en los hallazgos endoscópicos e ...

  2. Adaptación y propiedades psicométricas del inventario de depresión de Beck II en estudiantes de la Universidad Pública de Huánuco

    OpenAIRE

    Rivera Mansilla, Yessica María

    2014-01-01

    El presente estudio tuvo como objetivo adaptar y evaluar las propiedades psicométricas del Inventario de Depresión de Beck II (Beck, Steer y Brown, 1996) en una muestra probabilística estratificada de 869 estudiantes de pregrado de la Universidad Nacional Hermilio Valdizán de Huánuco, matriculados en el semestre 2013-I. Se realizó la adaptación lingüística a partir del análisis de contenido con criterio de jueces; el nuevo Inventario de Depresión de Beck II Adaptación Huanuqueña alcanzó una a...

  3. La variabilité génétique chez l'huître plate Ostrea edulis (L. 1758) : inférence du nombre de géniteurs instantané d'une population

    OpenAIRE

    Da Silva, Sara Maria Mira

    2001-01-01

    Les études de génétique des populations des bivalves marins ont fréquemment mit en évidence une relation hétérozygotie / valeur sélective, et un fort déficit en hétérozygotes. Parmi les hypothèses explicatives de ces deux phénomènes, la création d'individus consanguins dans les populations est particulièrement intéressante à tester. Le but de ce travail était de vérifier s'il pouvait y avoir un nombre faible de géniteurs à la base d'un événement de reproduction donné chez l'huître plate Ostre...

  4. The Shi’a Crescent: A Misconception of Shi’a Alliance

    Science.gov (United States)

    2014-12-01

    Iranian origin to Iran.33 After the Iraq-Iran War started, Saddam’s regime encouraged Iraqi men who were married to Iranian women to divorce their...region, indicating that “The Shi’a point to a pattern of negligence and poverty resulting from discriminatory practices of governments from Ottoman...decreased the authority of the sayyids, who were tribal counselors on marriages, divorces , and inheritances,26 and marked the success of the Sunni

  5. Qualitative and quantitative characterization of secondary metabolites and carbohydrates in Bai-Hu-Tang using ultraperformance liquid chromatography coupled with quadrupole time-of-flight mass spectrometry and ultraperformance liquid chromatography coupled with photodiode array detector.

    Science.gov (United States)

    Zhong, Wei-Fang; Tong, Wing-Sum; Zhou, Shan-Shan; Yip, Ka-Man; Li, Song-Lin; Zhao, Zhong-Zhen; Xu, Jun; Chen, Hu-Biao

    2017-10-01

    Bai-Hu-Tang (BHT), a classic traditional Chinese medicine (TCM) formula used for clearing heat and promoting body fluid, consists of four traditional Chinese medicines, i.e., Gypsum Fibrosum (Shigao), Anemarrhenae Rhizoma (Zhimu), Glycyrrhizae Radix et Rhizoma Praeparata cum Melle (Zhigancao), and nonglutinous rice (Jingmi). The chemical composition of BHT still remains largely elusive thus far. To qualitatively and quantitatively characterize secondary metabolites and carbohydrates in BHT, here a combination of analytical approaches using ultraperformance liquid chromatography coupled with quadrupole time-of-flight mass spectrometry and ultraperformance liquid chromatography coupled with photodiode array detector was developed and validated. A total of 42 secondary metabolites in BHT were tentatively or definitely identified, of which 10 major chemicals were quantified by the extracting ion mode of quadrupole time-of-flight mass spectrometry. Meanwhile, polysaccharides, oligosaccharides, and monosaccharides in BHT were also characterized via sample pretreatment followed by sugar composition analysis. The quantitative results indicated that the determined chemicals accounted for 35.76% of the total extract of BHT, which demonstrated that the study could be instrumental in chemical dissection and quality control of BHT. The research deliverables not only laid the root for further chemical and biological evaluation of BHT, but also provided a comprehensive analytical strategy for chemical characterization of secondary metabolites and carbohydrates in traditional Chinese medicine formulas. Copyright © 2017. Published by Elsevier B.V.

  6. Biscuits with No Added Sugar Containing Stevia, Coffee Fibre and Fructooligosaccharides Modifies α-Glucosidase Activity and the Release of GLP-1 from HuTu-80 Cells and Serotonin from Caco-2 Cells after In Vitro Digestion.

    Science.gov (United States)

    Martinez-Saez, Nuria; Hochkogler, Christina Maria; Somoza, Veronika; Del Castillo, Maria Dolores

    2017-07-04

    This study assessed the in vitro effects of the bioaccessible food components released during the simulated human digestion of a coffee fibre-containing biscuit (CFB) on α-glucosidase activity, antioxidant capacity and satiety hormones. Digest of CFB presented a significantly ( p < 0.05) lower amount of sugar (68.6 mg/g) and a higher antioxidant capacity (15.1 mg chlorogenic acid eq./g) than that of a sucrose-containing biscuit (SCB). The CFB significantly reduced ( p < 0.05) α-glucosidase activity (IC50 = 3.3 mg/mL) compared to the SCB (IC50 = 6.2 mg/mL). Serotonin and glucagon-like peptide-1 (GLP-1) release by differentiated Caco-2 and HuTu-80 cells, respectively, was stimulated by the CFB (355% at a concentration of 0.5 mg/mL and 278% at a concentration of 0.05 mg/mL) to the same order of magnitude as those of the SCB. To summarize, the CFB was demonstrated to reduce monosaccharide bioaccessibility, to inhibit a diabetes-related digestive enzyme, and to improve the release of satiety hormones.

  7. Qualitative and quantitative characterization of secondary metabolites and carbohydrates in Bai-Hu-Tang using ultraperformance liquid chromatography coupled with quadrupole time-of-flight mass spectrometry and ultraperformance liquid chromatography coupled with photodiode array detector

    Directory of Open Access Journals (Sweden)

    Wei-Fang Zhong

    2017-10-01

    Full Text Available Bai-Hu-Tang (BHT, a classic traditional Chinese medicine (TCM formula used for clearing heat and promoting body fluid, consists of four traditional Chinese medicines, i.e., Gypsum Fibrosum (Shigao, Anemarrhenae Rhizoma (Zhimu, Glycyrrhizae Radix et Rhizoma Praeparata cum Melle (Zhigancao, and nonglutinous rice (Jingmi. The chemical composition of BHT still remains largely elusive thus far. To qualitatively and quantitatively characterize secondary metabolites and carbohydrates in BHT, here a combination of analytical approaches using ultraperformance liquid chromatography coupled with quadrupole time-of-flight mass spectrometry and ultraperformance liquid chromatography coupled with photodiode array detector was developed and validated. A total of 42 secondary metabolites in BHT were tentatively or definitely identified, of which 10 major chemicals were quantified by the extracting ion mode of quadrupole time-of-flight mass spectrometry. Meanwhile, polysaccharides, oligosaccharides, and monosaccharides in BHT were also characterized via sample pretreatment followed by sugar composition analysis. The quantitative results indicated that the determined chemicals accounted for 35.76% of the total extract of BHT, which demonstrated that the study could be instrumental in chemical dissection and quality control of BHT. The research deliverables not only laid the root for further chemical and biological evaluation of BHT, but also provided a comprehensive analytical strategy for chemical characterization of secondary metabolites and carbohydrates in traditional Chinese medicine formulas.

  8. Semiconductor laser with fresh aloe shi fu and nursing therapy curative effect observation of indwelling needle phlebitis in patients with cerebral apoplexy%半导体激光联合鲜芦荟湿敷及护理治疗脑卒中患者留置针静脉炎的疗效观察

    Institute of Scientific and Technical Information of China (English)

    王爱丽; 卢琦; 梅现红; 官莉

    2015-01-01

    Objective:To investigate the semiconductor laser combined fresh aloe shi fu and nursing treatment the curative effect of needle phlebitis in patients with cerebral apoplexy. Methods: 66 cases of patients with cerebral stroke with phlebitis, randomly divided into experimental group and the control group, 33 cases each. The control group was treated with fresh aloe shi fu; On the basis of the experimental group in the control group treatment using semiconduc﹣tor laser irradiation in vitro and nursing intervention in the treatment of phlebitis. On two groups before and after the treatment of phlebitis treatment efficient and subjective pain level. Results: The patients with phlebitis treatment effec﹣tive rate of 93. 94% , compared with control group effective rate was 81. 82% (P < 0. 05), the difference was statisti﹣cally significant. The experimental group patients with venous pain level compared with control group (P < 0. 05), the difference was statistically significant. Conclusion: The application of semiconductor laser with fresh aloe shi fu and nursing therapy in patients with cerebral apoplexy phlebitis, can alleviate the pain of the patients with cerebral apo﹣plexy.%探讨半导体激光照射联合鲜芦荟湿敷及护理治疗脑卒中患者留置针静脉炎的疗效。方法:将脑卒中并发静脉炎患者66例,随机分为实验组和对照组,各33例。对照组采用鲜芦荟湿敷方法治疗;实验组在对照组治疗的基础上采用半导体激光体外照射及护理干预治疗静脉炎。对两组治疗前后静脉炎治疗有效率及主观疼痛级别进行比较。结果:实验组患者静脉炎治疗有效率为93.94%,和对照组有效率81.82%相比(P<0.05),差别有统计学意义;实验组患者静脉疼痛级别和对照组相比(P<0.05),差别有统计学意义。结论:应用半导体激光照射联合鲜芦荟湿敷及护理治疗脑卒中患者静脉炎,能减轻脑卒中患者的痛苦。

  9. L'amélioration de la qualité des huîtres à échelle professionnelle: intégration de l'eau salée souterraine traitée comme milieu d'élevage

    OpenAIRE

    Haure, Joel; Durin, Olivier; Palvadeau, Hubert; Papin, Mathias; Nourry, Max; Penisson, Christian; Martin, Jean-louis

    2003-01-01

    Les travaux menés au LCPL depuis plusieurs année sur l'engraissement contrôlé de l'huître creuse Crassostrea gigas ont permis, à l'échelle expérimentale de définir les différents paramètres d 'élevage: température : 14°C ration alimentaire : 2.10(9) cell/ind/j de la diatomée Skeletonema costatum - indice AFNOR initial sans incidence - débit d 'eau : 3 l/ind/h - eau de mer ou eau salée souterraine. Dans ces conditions et après 30 jours d 'engraissement, le poids total des huîtres a progressé d...

  10. Propuesta de un modelo de diagnóstico y control para la elaboración de perfiles de proyectos de inversión pública del sector educación del Gobierno Regional de Huánuco, bajo la metodología de la dinámica de sistemas – 2015

    OpenAIRE

    Flores Pinan, Julio Humberto

    2016-01-01

    El presente trabajo de investigación; se realizó con el objetivo de Proponer un Modelo de Diagnóstico y Control para la Elaboración de Perfiles de Proyectos de Inversión Pública del Sector Educación del Gobierno Regional de Huánuco, bajo la Metodología de la Dinámica de Sistemas. Por tal motivo; se investigó acerca de todos los factores intervinientes en la Problemática del Sector de Educación en el Departamento de Huánuco, mediante la Selección y Muestreo de todos los PIPs de Educación el...

  11. Introduction of digital soil mapping techniques for the nationwide regionalization of soil condition in Hungary; the first results of the DOSoReMI.hu (Digital, Optimized, Soil Related Maps and Information in Hungary) project

    Science.gov (United States)

    Pásztor, László; Laborczi, Annamária; Szatmári, Gábor; Takács, Katalin; Bakacsi, Zsófia; Szabó, József; Dobos, Endre

    2014-05-01

    Due to the former soil surveys and mapping activities significant amount of soil information has accumulated in Hungary. Present soil data requirements are mainly fulfilled with these available datasets either by their direct usage or after certain specific and generally fortuitous, thematic and/or spatial inference. Due to the more and more frequently emerging discrepancies between the available and the expected data, there might be notable imperfection as for the accuracy and reliability of the delivered products. With a recently started project (DOSoReMI.hu; Digital, Optimized, Soil Related Maps and Information in Hungary) we would like to significantly extend the potential, how countrywide soil information requirements could be satisfied in Hungary. We started to compile digital soil related maps which fulfil optimally the national and international demands from points of view of thematic, spatial and temporal accuracy. The spatial resolution of the targeted countrywide, digital, thematic maps is at least 1:50.000 (approx. 50-100 meter raster resolution). DOSoReMI.hu results are also planned to contribute to the European part of GSM.net products. In addition to the auxiliary, spatial data themes related to soil forming factors and/or to indicative environmental elements we heavily lean on the various national soil databases. The set of the applied digital soil mapping techniques is gradually broadened incorporating and eventually integrating geostatistical, data mining and GIS tools. In our paper we will present the first results. - Regression kriging (RK) has been used for the spatial inference of certain quantitative data, like particle size distribution components, rootable depth and organic matter content. In the course of RK-based mapping spatially segmented categorical information provided by the SMUs of Digital Kreybig Soil Information System (DKSIS) has been also used in the form of indicator variables. - Classification and regression trees (CART) were

  12. Inventario y evaluación de primates y amenazas para sus poblaciones en bosque montano de la Región Huánuco, Perú

    Directory of Open Access Journals (Sweden)

    Rolando Aquino

    2015-06-01

    Full Text Available El estudio estuvo orientado al inventario y evaluación de primates e identificar las amenazas para sus poblaciones en bosque montano de la Región Huánuco,  un área poco explorado con respecto a la  fauna silvestre. De Junio a Julio y de Setiembre a Octubre del 2014, fueron conducidos censos por transecto en puntos de muestreo correspondientes a las microcuencas de los ríos Chontayacu y Chinchao y cuenca alta del río Huallaga. En 618 km de longitud recorrida fueron registrados 47 grupos pertenecientes a cinco especies, siendo las más comunes Alouatta seniculus (15 grupos y Lagothrix flavicauda  (13 grupos. L. flavicauda fue observada únicamente en la Microcuenca del río Chontayacu,  y Ateles chamek  en la Cuenca alta del río Huallaga. En el área de estudio, los primates viven en parches de bosques primario y residual, excepto en el Chontayacu, donde el bosque primario es todavía denso y extenso. La densidad poblacional fue más alta para L. flavicauda (20,8 indiv./km2 y más baja para Sapajus macrocephalus (2,7 indiv./km2. Entre las actividades observadas, la deforestación para la agricultura y ganadería constituye la principal  amenaza para la supervivencia de primates, en particular en la Microcuenca del río Chinchao y Cuenca alta del río Huallaga.

  13. Eficiencia de polinización de colonias huérfanas del abejorro nativo Bombus atratus (Hymenoptera: Apidae en dos cultivares de fresa (Fragaria x ananassa sembrados bajo cubierta en la sabana de Bogotá

    Directory of Open Access Journals (Sweden)

    Carlos Alberto Poveda Coronel

    2018-01-01

    Full Text Available En Colombia la fresa se ha convertido en un cultivo de interés económico debido a la creciente demanda en el mercado extranjero en la última década. La mayoría de plantaciones son a campo abierto y no usan esquemas de polinización para mejorar la calidad de producción. La polinización con abejorros mejora la calidad de los frutos, aunque estos se producen mediante polinización espontánea. La especie nativa Bombus atratus ha sido reconocida como un polinizador eficiente de cultivos hortofrutícolas colombianos bajo invernadero. El presente estudio evaluó la eficiencia de polinización de dos colonias huérfanas en la calidad de los frutos de las variedades camino real y ventana sembrados bajo invernadero en Cajicá-Colombia. Se embolsaron los botones para obtener los frutos producidos espontáneamente y ser comparados con los frutos provenientes de la visita de obreras de B. atratus. Se encontró que la visita de las obreras mejoró la calidad de los frutos en las variables, calibre (35 % y 31 %, longitud (28 % y 19 %, peso fresco (103 % y 90 %, peso seco (126 % y 145 % y número de semillas (55 % y 81 % para las variedades Camino Real y Ventana respectivamente. A partir de las observaciones realizadas, se determinó que el recurso floral utilizado por las obreras de B. atratus fue el néctar y se hacen recomendaciones sobre su uso en este cultivo.

  14. Heterogeneous catalytic degradation of polyacrylamide solution | Hu ...

    African Journals Online (AJOL)

    Modified with trace metal elements, the catalytic activity of Fe2O3/Al2O3 could be changed greatly. Among various trace metal elements, Fe2O3/Al2O3 catalysts modified with Co and Cu showed great increase on catalytic activity. International Journal of Engineering, Science and Technology, Vol. 2, No. 7, 2010, pp. 110- ...

  15. Main: 1HU9 [RPSD[Archive

    Lifescience Database Archive (English)

    Full Text Available Lox3; Glycine Max Molecule: Lipoxygenase-3; Chain: A; Synonym: L-3; Other_details: Complex With 4-Hydroperox...RSKLDSQVYGDHTSQITKEHLEPNLEGLTVDEAIQNKRLFLLGHHDPIMPYLRRINATSTKAYATRTILFLKNDGTLRPLAIELSLPHPQGDQSGAFSQVFLPADEGV...TFLWGRYSVEMSAVVYKDWVFTDQALPADLIKRGMAIEDPSCPHGIRLVIEDYPYAVDGLEIWDAIKTWVHEYVFLYYKSDDTLREDPELQACWKELVEVGHGDKKNEPWWPKMQTREELVEACAI

  16. EnviroAtlas - HU12_polygon

    Data.gov (United States)

    U.S. Environmental Protection Agency — This data set is a complete digital hydrologic unit boundary layer to the Subwatershed (12-digit) 6th level for the entire United States. This data set consists of...

  17. Identificación de una nueva área de infección por Rickettsias del grupo typhi: estudio de un brote de tifus en Huánuco

    Directory of Open Access Journals (Sweden)

    Rosa Mostorino E

    2003-03-01

    Full Text Available Objetivos: Investigar un brote de síndrome febril en el distrito de Punchao mediante una evaluación clínica, laboratorial y entomológica para conocer los factores asociados a la aparición de dicho brote. Materiales y métodos: Debido al reporte de tres pacientes con cuadro clínico febril asociado a cefalea, mialgias y postración en la semana epidemiológica Nº41 del año 2000, procedentes del distrito de Punchao, Humalíes, Huánuco y ante la información de presentación inusual de pacientes febriles en la última semana en dicho lugar, se decidió investigar la naturaleza y características del brote. Se definió como caso a todo paciente con cuadro febril agudo y uno de estos síntomas: cefalea, mialgias o postración; procediéndose a la búsqueda activa de éstos y a la evaluación de presencia de anticuerpos para rickettsias en suero mediante inmunofluorescencia indirecta (IFI. Se capturaron roedores y se colectaron ectoparásitos en las viviendas (roedores, animales domésticos y humanos, a fin de identificar la presencia de Rickettsias en ellos mediante IFI, aislamiento o PCR. Resultados: No se logró el aislamiento del agente causal. Se evidenció circulación de la Rickettsia sp. (serología positiva tanto en humanos (en casos y en no casos como en roedores. Se evidenció mayor presencia de malos hábitos de aseo y condiciones inadecuadas de saneamiento básico en los casos (respecto a los no casos y una disminución de los casos luego del inicio de las medidas de control. Conclusiones: Las evidencias encontradas permitieron identificar un brote de tifus en Punchao, no pudiéndose determinar la especie involucrada debido a que no se aisló el agente causal.

  18. Intervención comunicacional en la promoción del perfil ambiental del profesorado del Colegio Nacional Integrado Jorge Basadre en Santa María del Valle, Huánuco. Perú-2011

    Directory of Open Access Journals (Sweden)

    Angélica SOTOMAYOR BACA

    2015-05-01

    Full Text Available En la búsqueda de medidas de mitigación y remediación de la crisis ambiental, la preparación de profesores para la Educación Ambiental es, en la actualidad, reconocida como una prioridad. Ello determina la necesidad de una transformación continua del rol docente, constituyéndose en agentes activos en la formación integral de nuevas generaciones, abordando los problemas ambientales con enfoques emergentes.El objetivo de esta investigación es comprobar si a lo largo de la intervención comunicacional se logra mejorar el perfil ambiental del profesorado del Colegio Nacional Integrado Jorge Basadre en Santa María del Valle, del distrito y provincia de Huánuco-Perú. Y, por tanto, optimizar sus capacidades hacia la enseñanzaaprendizaje del cuidado del ambiente, incorporando en el alumno el compromiso con el cuidado del ambiente. El estudio es experimental, prospectivo, longitudinal y analítico, con diseño de un solo grupo antes y después; de treinta y seis participantes voluntarios de la intervención comunicacional, desarrollada en sesiones mensuales, en un periodo de cinco meses. Se aplicaron satisfactoriamente una encuesta y dos escalas validadas y fiabilizadas. Se comprueban las hipótesis mediante el análisis de varianza de un factor de contrastes multivariados y la prueba t para medias de una muestra relacionada; apoyados en el SPWS V19. La influencia de la intervención comunicacional es demostrada mediante las diferencias significativas obtenidas en los momentos posteriores a la intervención respecto al momento basal. Según los hallazgos, se confirman las hipótesis que establecen diferencias en el comportamiento habitual, en la práctica pedagógica y en las percepciones hacia la educación ambiental de los participantes. Sin embargo, la intervención no mejora la práctica de valores y principios ambientales del profesorado, lo que supone la incidencia de futuros estudios que favorezcan tales cambios. De manera general, la

  19. In vitro and in vivo bactericidal activity of Tinospora sagittata (Oliv.) Gagnep. var. craveniana (S.Y.Hu) Lo and its main effective component, palmatine, against porcine Helicobacter pylori.

    Science.gov (United States)

    Rong, Qian; Xu, Min; Dong, Qi; Zhang, Yuli; Li, Yinglun; Ye, Gang; Zhao, Ling

    2016-08-30

    Tinospora sagittata (Oliv.) Gagnep. var. craveniana (S.Y.Hu) Lo (TSG) is a traditional Chinese herb that has been used for the treatment of upper respiratory tract infection and has anti-bacterial and anti-ulcer activity. Our study investigated the bactericidal effects of TSG and its major component, palmatine, against a Helicobacter pylori (H. pylori) strain isolated from pig and the standard strain H. pylori SS1 in vitro and in vivo. H. pylori was isolated from pig and named H. pylori SCYA201401. For in vitro experiments, the inhibitory activity of TSG and palmatine against H. pylori SCYA201401 and H. pylori SS1 were tested by use of the agar cup diffusion technique. The minimal inhibitory concentration (MIC) and minimal bactericidal concentration (MBC) were determined from the absence of H. pylori colonies on agar plates. Time-kill curves were used to evaluate bactericidal activity; the average number of colonies was calculated at 0 to 48 h after liquid incubation, with concentrations of drugs at 0.5, 1, and 2 × MIC. For in vivo experiments, H. pylori SCYA201401-infected mice were randomly divided into TSG, palmatine, triple therapy (omeprazole, clarithromycin, and amoxicillin), blank control, and model groups. The eradication ratios were determined by use of rapid urease tests and bacterial culture. In vitro, the MIC and MBC of TSG against H. pylori SCYA201401 and SS1 were both 6250 μg/mL, whereas palmatine against H. pylori SCYA201401 was 6.25 μg/mL and against H. pylori SS1 was 3.12 μg/mL. The time-kill curves showed a dose-dependent, progressive decline in the numbers of viable bacteria up to 40 h. In vivo, the eradication ratios in the TSG and palmatine groups of mice were 80 and 50 % compared with 70 % in the triple-therapy group. TSG and its major component, palmatine, have bactericidal activity against H. pylori in vitro and in vivo. The possibility that TSG or palmatine can be effective in the treatment of human and animals H. pylori

  20. Anne Le Huérou, Aude Merlin, Amandine Regamey and Silvia Serrano, Tchétchénie: une affaire intérieure? Russes et Tchétchènes dans l’étau de la guerre, Paris: Editions Autrement, 2005

    Directory of Open Access Journals (Sweden)

    Bruno Coppieters

    2005-10-01

    Full Text Available This book on Chechnya has been co-authored by Anne Le Huérou, Aude Merlin, Amandine Regamey and Silvia Serrano. These scholars are associated with either the Ecole des hautes études en sciences sociales - CNRS or with the Institut d'études politiques de Paris. Their book offers an excellent introduction to the two most recent wars with Russia. Its aim is to explain to a wider public their historical and social background, the claims put forward by the various actors, the different currents in...

  1. Efectos musculares y hematológicos del uso de rHuEpo en combinación con el entrenamiento físico. Implicaciones de la demospresina y la hipoxia en el dopaje sanguineo. Estudios in vivo e in vitro.

    OpenAIRE

    Martínez Bello, Vladimir Essau

    2011-01-01

    En la presente Tesis Doctoral hemos querido estudiar, en primer lugar, el efecto que tendría el incremento artificial de la capacidad de transporte de oxígeno, a través del tratamiento con rHuEpo, sobre distintos parámetros musculares así como su implicación en la mejora del rendimiento físico. Son muchos los autores que, tanto en el ámbito clínico (Winearls, Oliver y cols. 1986; Bommer, Muller-Buhl y cols. 1987) como en el ámbito deportivo (Berglund y Ekblom 1991; Lundby, Robach y cols. 2008...

  2. Hu Jintao's Speech on Climate Change (abridged)%Hu Jintao' s Speech on Climate Change (abridged)

    Institute of Scientific and Technical Information of China (English)

    2009-01-01

    @@ Mr.Secretary-General, dear colleagues, Global climate change has a profound impact on the survival and development of mankind. It is a major challenge facing all countries.I wish to highlight a few principles that we need to follow in our common endeavor to tackle this issue of climate change.

  3. Vliv běhu naboso na kinetiku běhu

    OpenAIRE

    Bezemek, Denis

    2017-01-01

    Title: The influence of barefoot running on running kinetics. Objectives: The aim of this work is to assess the influence of different footwear (regular running shoes, barefoot footwear and barefoot running) on footstrike (rear-foot strike, mid-foot strike and fore-foot strike) during running and evaluate the action of reaction forces in different types of footstrike. Methods: In this study participated 11 runners (only men), who were divided in three groups based on their preferred footwear....

  4. Mala imagen y estrategias de selección y adaptación para ladiversificación turística: el caso de las casas de huéspedes oGasthof del Altmühlsee (Alemania

    Directory of Open Access Journals (Sweden)

    Maria del Pilar Leal Londoño

    2016-01-01

    Full Text Available El artículo analiza las estrategias de selección y adaptación que conllevan a una diversificación turística por parte de las casas de huéspedes o Gasthof en la región del lago del Altmühlsee (Alemania, una región con una importante actividad turística que se ha visto amenazada resultado de la mala imagen generada por la prensa como consecuencia de la abundante presencia de algas tóxicas en sus lagos. Para lograrlo, se retoman elementos teóricos de la Geografía Económica Evolutiva (GEE en un enfoque Darwinista, con el fin de entender los mecanismos que han permitido la emergencia de diversas estrategias de diversificación turística por parte de las casas de huéspedes (Gasthof de la región que les permiten adaptar su oferta a pesar de las circunstancias.

  5. Regional Implications of Shi’a Revival in Iraq

    Science.gov (United States)

    2004-01-01

    From the marshes of southern Iraq to the ghettoes of Karachi, the Shi‘a have been the underdogs —oppressed and marginalized by Sunni ruling regimes and...former with “true” Is- lam—and their governments as its defenders—and branding the latter as obscurantist extremism. They dismissed Khomeini as Shi‘a... branding his vitriol against the House of Saud in the 1980s as fitna (illegitimate rebellion and sowing of disunity) against the Muslim community.7

  6. Search for heavy sterile neutrinos with SHiP

    CERN Document Server

    Jacobsson, Richard

    Invited contribution to the White Paper on keV sterile neutrino Dark Matter as proceedings of the v-Dark 2015 international workshop which was held at the Institute for Advanced Study of the Technical University of Munich, Garching, Germany, 7 - 9 December 2015. White Paper will be submitted to JCAP.

  7. Iranian Influence in Iraqi Shi’a Groups

    Science.gov (United States)

    2012-06-01

    Movement in Iraq, 254. 60 Jabar, The Shīʻite Movement in Iraq, 254. 61 Robert Fisk, The Great War For Civilisation : the Conquest of the Middle East...by Iran in 62 Fisk, The Great War For Civilisation : the Conquest of the Middle East, 647. 63 John...U.S. soldier missing in Iraq. AAH sources indicated that the group was not behind the killing but rather just mediators in the process of returning

  8. Sunni and Shi’a Terrorism: Differences that Matter

    Science.gov (United States)

    2008-12-29

    Upon the United States (Washington, DC: St. Martin’s Press, 2004), 88‐89.  The  report’s  language  was curiously qualified when discussing the Iranian...such a tactic cannot be ruled out in the future.  84 Poland, the Czech Republic, the  Slovak  Republic...Democratic Front for the Liberation of Palestine (DFLP)*    Hamas*    Iranian Extremists/Militants – Kuwait ( label  applied by Sunni Kuwait  government

  9. Dicty_cDB: SHI783 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 34, mRNA sequence. 42 5.0 1 DV288069 |DV288069.1 NAAHW80TF Aedes aegypti - Fat Bodie...583TR Aedes aegypti - Fat Bodies Normalized (NAFFB2) Aedes aegypti cDNA clone NAAG583, mRNA sequence. 42 5.0... 1 DV284076 |DV284076.1 NAAG583TF Aedes aegypti - Fat Bodies Normalized (NAFFB2) ...Aedes aegypti cDNA clone NAAG583, mRNA sequence. 42 5.0 1 DV276964 |DV276964.1 NAAFQ66TR Aedes aegypti - Fat Bodie...AAFQ66TF Aedes aegypti - Fat Bodies Normalized (NAFFB2) Aedes aegypti cDNA clone NAAFQ66, mRNA sequence. 42

  10. Dicty_cDB: SHI292 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available nt alignments: (bits) Value (Q9NZJ4) RecName: Full=Sacsin; &AL157766_4( AL157766 |pid:none) 106 4e-22 BC1384...82_1( BC138482 |pid:none) Mus musculus sacsin, mRNA (cDNA cl... 104 2e-21 (Q9JLC8) RecName: Full=Sacsi

  11. Multiple System Atrophy with Orthostatic Hypotension (Shy-Drager Syndrome)

    Science.gov (United States)

    ... the onset of symptoms. A problem with the respiratory system is the most common cause of death. x ... the onset of symptoms. A problem with the respiratory system is the most common cause of death. View ...

  12. Dicty_cDB: SHI734 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ESIWYDYWLDNGYFSPEKQMEIQPHVVKDKKFVIVIPPPNVTGSLHLGHALTNSIQDAVV RYHRMKG*slfmgtryrscrycnts...KQEAEEKIVREHIEKILKTPKGEKKDVSSLLSSYHPTAV ESIWYDYWLDNGYFSPEKQMEIQPHVVKDKKFVIVIPPPNVTGSLHLGHALTNSIQDAVV RYHRMKG*slfmgtryrscrycnts

  13. Once hurt, twice shy: Social pain contributes to social anxiety.

    Science.gov (United States)

    Fung, Klint; Alden, Lynn E

    2017-03-01

    Social rejection has been consistently linked to the development of social anxiety. However, mechanisms underlying the relation have been largely unexplored, which presents an obstacle to fully understanding the origins of social anxiety and to the development of effective prevention and treatment strategies. Two studies were conducted to test the hypothesis that the emotion of social pain following rejection promotes the development of social anxiety in subsequent situations. In Study 1, undergraduate participants were exposed to 2 social situations (Cyberball) 2 days apart. Participants who were rejected in the first situation reported higher social anxiety before and during the second situation relative to those who were included. This effect was fully mediated by initial social pain intensity. In Study 2, all participants were initially rejected. Using double-blinded drug administration, participants were randomly assigned to ingest acetaminophen to alleviate the social pain from rejection, or a sugar placebo. As predicted, the acetaminophen group reported lower social anxiety before and during the second situation. Approximately half of the effect was mediated by reduction in social pain. Notably, the immediate effect of acetaminophen was specific to social pain rather than social anxiety. Results were discussed in the context of literature on the etiology of social anxiety and social pain. Future directions were suggested. (PsycINFO Database Record (c) 2017 APA, all rights reserved).

  14. Dicty_cDB: SHI133 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 044130 |CR044130.1 Forward strand read from insert in 3'HPRT insertion targeting and chromosome engineering ...Forward strand read from insert in 3'HPRT insertion targeting and chromosome engineering clone MHPP47e19. 50... 0.068 1 CR034434 |CR034434.1 Forward strand read from insert in 3'HPRT insertion targeting and chromosome engineering...ion targeting and chromosome engineering clone MHPP142o16. 50 0.068 1 BX990136 |B...X990136.1 Forward strand read from insert in 3'HPRT insertion targeting and chromosome engineering clone MHP

  15. Dicty_cDB: SHI542 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available . 42 8.2 1 CR129751 |CR129751.1 Reverse strand read from insert in 5'HPRT insertion targeting and chromosome engineering...ion targeting and chromosome engineering clone MHPN147m24. 42 8.2 1 CR010531 |CR010531.1 Reverse strand read... from insert in 5'HPRT insertion targeting and chromosome engineering clone MHPN2...17j13. 42 8.2 1 CR103480 |CR103480.1 Reverse strand read from insert in 5'HPRT insertion targeting and chromosome engineering

  16. SHI induced damage in electrical properties of silicon NPN BJTs

    Energy Technology Data Exchange (ETDEWEB)

    Kumar, M. Vinay, E-mail: vkm288@gmail.com; Krishnaveni, S. [Department of studies in Physics, University of Mysore, Mysore (India); Kumar, Santhosh [Department of Physics, Regional Institute of Education, Mysore (India); Yashoda, T. [Department of Physics, AVK College for Women, Hassan (India)

    2016-05-23

    The investigation of radiation damage in Si microelectronic circuitry and devices are being carried out by various research groups globally. In particular the Si Bipolar junction transistors are very sensitive to high energetic radiation. In the present study, radiation response of NPN Bipolar junction transistor (2N3773) has been examined for 60 MeV B{sup 4+} ion. Key electrical properties like Gummel, dc current gain and capacitance – voltage (C-V) characteristics of 60 MeV B{sup 4+} ion irradiated transistor were studied before and after irradiation. Ion irradiation and subsequent electrical characterizations were performed at room temperature. Current voltage (I-V) measurements showed the increase in collector current for V{sub BE} ≤ 0.4 V as a function of fluence, which is due to B{sup 4+} ion induced surface leakage currents. Base current is observed to be more sensitive than collector current and gain appears to be degraded with ion fluence. Also, C-V measurements shows that both built in potential and doping concentration increased significantly after irradiation.

  17. Stone heterogeneity index as the standard deviation of Hounsfield units: A novel predictor for shock-wave lithotripsy outcomes in ureter calculi.

    Science.gov (United States)

    Lee, Joo Yong; Kim, Jae Heon; Kang, Dong Hyuk; Chung, Doo Yong; Lee, Dae Hun; Do Jung, Hae; Kwon, Jong Kyou; Cho, Kang Su

    2016-04-01

    We investigated whether stone heterogeneity index (SHI), which a proxy of such variations, was defined as the standard deviation of a Hounsfield unit (HU) on non-contrast computed tomography (NCCT), can be a novel predictor for shock-wave lithotripsy (SWL) outcomes in patients with ureteral stones. Medical records were obtained from the consecutive database of 1,519 patients who underwent the first session of SWL for urinary stones between 2005 and 2013. Ultimately, 604 patients with radiopaque ureteral stones were eligible for this study. Stone related variables including stone size, mean stone density (MSD), skin-to-stone distance, and SHI were obtained on NCCT. Patients were classified into the low and high SHI groups using mean SHI and compared. One-session success rate in the high SHI group was better than in the low SHI group (74.3% vs. 63.9%, P = 0.008). Multivariate logistic regression analyses revealed that smaller stone size (OR 0.889, 95% CI: 0.841-0.937, P < 0.001), lower MSD (OR 0.995, 95% CI: 0.994-0.996, P < 0.001), and higher SHI (OR 1.011, 95% CI: 1.008-1.014, P < 0.001) were independent predictors of one-session success. The radiologic heterogeneity of urinary stones or SHI was an independent predictor for SWL success in patients with ureteral calculi and a useful clinical parameter for stone fragility.

  18. Casein kinase 1-Like 3 is required for abscisic acid regulation of ...

    African Journals Online (AJOL)

    Casein kinase 1-Like 3 is required for abscisic acid regulation of seed germination, root growth, and gene expression in Arabidopsis. M Wang, D Yu, X Guo, X Li, J Zhang, L Zhao, H Chang, S Hu, C Zhang, J Shi, X Liu ...

  19. Discrimination of Dendrobium officinale and Its Common Adulterants by Combination of Normal Light and Fluorescence Microscopy

    Directory of Open Access Journals (Sweden)

    Chu Chu

    2014-03-01

    Full Text Available The stems of Dendrobium officinale Kimura et Migo, named Tie-pi-shi-hu, is one of the most endangered and precious species in China. Because of its various pharmacodynamic effects, D. officinale is widely recognized as a high-quality health food in China and other countries in south and south-east Asia. With the rising interest of D. officinale, its products have a high price due to a limited supply. This high price has led to the proliferation of adulterants in the market. To ensure the safe use of D. officinale, a fast and convenient method combining normal and fluorescence microscopy was applied in the present study to distinguish D. officinale from three commonly used adulterants including Zi-pi-shi-hu (D. devonianum, Shui-cao-shi-hu (D. aphyllum, Guang-jie-shi-hu (D. gratiosissimum. The result demonstrated that D. officinale could be identified by the characteristic “two hat-shaped” vascular bundle sheath observed under the fluorescence microscopy and the distribution of raphides under normal light microscopy. The other three adulterants could be discriminated by the vascular bundle differences and the distribution of raphides under normal light microscopy. This work indicated that combination of normal light and fluorescence microscopy is a fast and efficient technique to scientifically distinguish D. officinale from the commonly confused species.

  20. Determination of Heavy Metal Ions in Tobacco and Tobacco Additives

    African Journals Online (AJOL)

    NJD

    This paper describes a new method for the simultaneous determination of heavy metal ions in tobacco and tobacco additives by ... The HPLC system consisted of a Waters 2690 Alliance separation ..... 1 Z.H. Shi and C.G. Fu, Talanta, 1997, 44, 593. ... 5 Q.F. Hu, G.Y. Yang, J.Y. Yin and Y. Yao, Talanta, 2002, 57, 751.

  1. Reacción de ingerto versus huésped: de la comprensión a la utilización de un fenómeno biológico Graft versus host reation: from comprehension to utilization of a biological phenomenon

    Directory of Open Access Journals (Sweden)

    Jorge Eliécer Ossa Londoño

    1999-01-01

    Full Text Available La enfermedad de injerto versus huésped es una de las complicaciones con mayor mortalidad que se presentan después de un trasplante, usualmente de médula ósea, o después de una transfusión sanguínea.- Los principales órganos blanco son la piel. el hígado, el tracto gastrointestinal y el sistema inmune. Sin embargo. la apreciación de esta enfermedad ha venido cambiando a medida que avanza la comprensión de la inmunología de trasplantes. pues se ha visto que puede tener resultados benéficos como son un efecto antireucémico y un aumento de la tolerancia a los trasplantes. Graft versus host disease is one of the complications with greater lethality after transplantation, usually of bone marrow, or after blood transfusion. Organs involved include skin, liver, gastrointestinal tract and the immune system. However, the conception of graft versus host disease has been changing as comprehension of transplant immunology has advanced, since it has been demonstrated that it can have beneficial results as an antileucemic response and because of an increased tolerance to grafts.

  2. Stage en entreprise des étudiants de la filière du Tourisme : défis et perspective. Le cas du Département de Français de l’École Supérieure de Langues Étrangères (ESLE de Hué

    Directory of Open Access Journals (Sweden)

    CONG HUYEN TON NU Y Nhiem

    2016-12-01

    Full Text Available Le stage en entreprise des étudiants dans le domaine du tourisme constituant une préoccupation du Département de Français de l’École Supérieure de Langues Étrangères de Hué, une enquête réalisée auprès de nos étudiants en 4e année permet d’éclaircir la problématique liée à leur stage qui mériterait plus d’attention afin de procéder aux améliorations. Des limites, difficultés vécues de nos étudiants de français durant leur stage en entreprise alimentent une multitude de réflexions au service de ce sujet. Dans ce sens, la collaboration école-entreprise est mise en valeur au profit de la qualité du stage.

  3. Viral and host factors related with histopathologyc activity in patients with chronic hepatitis B and moderate or intermittently elevated alanine aminotransferase levels Influencia de factores virales y del huésped en la actividad histológica en pacientes con hepatitis crónica por virus de la hepatitis B y elevación moderada o intermitente de alanina aminotransferasa

    Directory of Open Access Journals (Sweden)

    E. Molina Pérez

    2010-09-01

    Full Text Available Objective: viral and host factors are related with progression of pathological lesion in chronic hepatitis B. We analyzed these factors in patients with moderate or intermittently elevated ALT levels, and its threshold that determinate significant histological activity. Patients and methods: retrospective analyses of viral and host parameters in 89 consecutive chronic hepatitis B patients biopsied because of moderate or intermittently elevated ALT levels [1-2 x ULN (ULN = 39 IU/mL] and/or DNA-HBV > 2 x 10³ IU/mL in AntiHBe+ patients. It was analyzed age, gender, ALT levels, HBeAg, viral load and genotype. It was considered advanced histological lesion a Knodell Score (KS > 7 and histological lesion indicating treatment, lobular inflammation ≥ 2 or fibrosis ≥ 2 according to Scheuer Classification. Results: KS > 7 and histological lesion indicating treatment was found in 47.8 and 60.7% respectively. It was observed relationship between age, male gender, ALT levels and viral load with histological damage (p ULN (69.1 vs. 47.1%, p = 0.04. There were not significant upper frequencies of advanced lesion when a cut-off of 40 years or DNA-HBV > 2 x 10³ IU/mL viral load or serological status HBeAg was considerate. Histological activity was lesser in genotype D patients than those infected with others genotypes (p Objetivo: analizar factores virales y del huésped relacionados con actividad histológica en un subgrupo de pacientes con hepatitis crónica B y elevación intermitente o moderada de alanina aminotransferasa (ALT, y el umbral que determine daño histológico indicativo de tratamiento. Pacientes y métodos: análisis retrospectivo de parámetros virales y del huésped en 89 pacientes con hepatitis crónica B biopsiados consecutivamente por elevación intermitente o moderada de ALT [1-2 x USN (USN = 39 UI/mL]. Fueron analizados edad, sexo, ALT, HBeAg, carga viral y genotipo. Se consideró como lesion histologica avanzada un Índice de

  4. Effects of Dietary Neutral Detergent Fiber to Non-Fiber Carbohydrates Ratio on Ruminal Nitrate Reduction of Hu Sheep%饲粮中性洗涤纤维与非纤维性碳水化合物比例对湖羊瘤胃还原硝态氮的影响

    Institute of Scientific and Technical Information of China (English)

    林淼; 张建刚; 陈志远; 赵国琦

    2014-01-01

    本试验采用4×4拉丁方试验设计,研究4种中性洗涤纤维与非纤维性碳水化合物比例(NDF/NFC)的饲粮(0.58、0.71、1.20、1.57)对湖羊瘤胃硝态氮含量动态变化和发酵特性的影响。各组饲粮中均含有1.0%硝酸钾,在喂后0、0.5、1.0、1.5、2.0、4.0、6.0、8.0 h通过瘤胃瘘管采集瘤胃液,测定硝酸盐和亚硝酸盐含量以及瘤胃发酵参数;晨饲后2.0 h通过颈静脉采血,测定高铁血红蛋白含量。结果表明,6.0~8.0 h饲粮NDF/NFC=0.71时瘤胃亚硝酸盐含量最低;且0~1.5 h随着NDF/NFC的增大,氨态氮( NH3-N)含量有逐渐降低的趋势;0、8.0 h总微生物蛋白质含量以NDF/NFC=0.58时最高,且与NDF/NFC=0.71时差异不显著(P>0.05),整个试验期未出现亚硝酸盐中毒。因此,在本试验条件下,湖羊饲粮NDF/NFC=0.71时,最有利于瘤胃硝态氮还原及瘤胃发酵。%A 4 × 4 Latin square design in this study was used to investigate the effects of different dietary neu-tral detergent fiber to non-fiber carbohydrates ratios (NDF/NFC) (0.58, 0.71, 1.20 and 1.57) on dynamic changes of ruminal nitrate nitrogen content and fermentation characteristics of Hu sheep. The diet of each group contained 1.0% potassium nitrate, and rumen fluid was obtained at 0, 0.5, 1.0, 1.5, 2.0, 4.0, 6.0 and 8.0 h after feeding to determine the contents of nitrate and nitrite and ruminal fermentation parameters. Blood sample was collected at 2.0 h after feeding to determine the blood methemoglobin content. The results showed that the nitrite content of sheep fed diet with NDF/NFC=0.71 was lowest at 6.0 to 8.0 h after feeding. With the rising of NDF/NFC, NH3-N content had a trend of decrease at 0 to 1.5 h after feeding. Total microbial protein con-tent of sheep fed diet with NDF/NFC=0.58 was highest at 0 and 8.0 h after feeding, and had no significant difference with sheep fed diet with NDF/NFC=0.71 ( P>0.05) . In addition, the nitrite toxicity was not detec-ted during

  5. Antihepatoma and Liver Protective Potentials of Ganoderma Lucidum (靈芝 Ling Zhi Fermented in a Medium Containing Black Soybean (黑豆 Hēi Dòu and Astragalus Membranaceus (生黃耆 Shēng Huáng Qí

    Directory of Open Access Journals (Sweden)

    Zheng-Yuan Su

    2013-04-01

    Full Text Available The antihepatoma activity and liver protective function of the fermentation products (5 L fermenator of Ganoderma lucidum (GL; 靈芝 Ling Zhi cultivated in a medium containing black soybean (BS; 黑豆 Hēi Dòu and Astragalus membranaceus (AM; 生黃耆 Shēng Huáng Qí at different fermentation temperatures were investigated in this study. Hep 3B cells pretreated with lovastatin were used to study the antihepatoma activity, and possible active components were analyzed by reverse-phase high-performance liquid chromatography. Carbon tetrachloride (CCl4-induced primary rat hepatocyte injury was further used to evaluate the liver protective activity of the fermentation products. While all the GL broth filtrates do not inhibit the growth of Hep 3B cells, the ethanolic extract from GL-2 mycelia (GL-2-mE, cultivated in the medium containing BS (50 g/L and AM (20 g/L at 24 °C for 11 days showed the best antihepatoma activity (IC50 26.6 μg/mL than the other ethanolic extracts from GL mycelia, GL fruiting body, BS, and AM did. The antihepatoma activities were correlated with some unknown active components in these samples. Furthermore, GL-2-mE (100 μg/mL without harmful effect on the growth of normal primary rat hepatocytes significantly maintained cell viability, reduced lactate dehydrogenase leakage, lowered lipid peroxidation, and increased glutathione peroxidase and glutathione S-transferase activities in the CCl4-induced damaged primary rat hepatocytes.

  6. Changes in speed and strength in female volleyball players during and after a plyometric training program Změny rychlostně-silových předpokladů volejbalistek v průběhu a po absolvování plyometrického tréninkového programu

    Directory of Open Access Journals (Sweden)

    Milan Elfmark

    2009-03-01

    Full Text Available The goal of this article was the validation of a plyometric training program and the evaluation of the changes in monitored speed and explosive power predispositions during and after the end of the training program. The program was applied to a group of female youth volleyball players (n = 11 twice a week during an eight week period. Their actual level of explosive power and locomotor speed was evaluated before, during and after the intervention was completed. The levels were determined with the following tests: the standing vertical jump, the vertical jump with an approach and the shuttle run for 6 x 6 m. There were positive changes in the average values of test scores during the period of testing, but the dynamics of the changes in the explosive power and the speed were different. Other increases in all the characteristics were noticeable when the final measurements were made six weeks after the completion of the training program. Examination of the differences in the test scores by the follow up group, before the beginning and six weeks after finishing the intervention, was centred on objectively and statistically important changes in the volleyball players' motor predispositions (p < .05. The results of the program support the opinion that plyometric exercises are effective tools in the development of explosive power and speed in young athletes. Cílem studie bylo ověřit v tréninkové praxi program sestávající z vybraných plyometrických cvičení a zhodnotit změny sledovaných rychlostně-silových předpokladů v průběhu a po jeho absolvování. Program byl aplikován u volejbalistek kadetské kategorie (n = 11 2x týdně po dobu 8 týdnů. Aktuální úroveň výbušné síly a lokomoční rychlosti byla hodnocena před, v průběhu a po skončení intervence testy dosah jednoruč po výskoku z místa, dosah jednoruč výskokem po smečařském rozběhu a rychlostní člunkový běh na 6 x 6 m. V období realizace programu doch

  7. Effects of Different Dietary Sources of Roughage on Performance, Ruminal Fermentation and Serum Biochemical Parameters of Hu Sheep%不同粗饲料来源饲粮对湖羊生长性能、瘤胃发酵及血清生化指标的影响

    Institute of Scientific and Technical Information of China (English)

    吴天佑; 赵睿; 罗阳; 王洪荣

    2016-01-01

    This study was conducted to study the effects of different dietary sources of roughage on performance,ruminal fermentation and serum biochemical parameters of Hu sheep under the same energy and protein conditions.Eighteen healthy Hu sheep with similar body weight were randomly divided into three groups with six sheep per group,and sheep in different groups were fed three diets with peanut vine (PV group),beanstalk (BS group) and sugarcan molasses (SM group) as the only dietary roughage source,respectively,under the same energy and protein levels.The test had a 15-day pre-experiment and a 45-day experiment.The results showed as follows:1) average daily gain of Hu sheep in PV group was significant higher than that of BS and SM groups (P<0.05).2) Acetate,butyrate,total volatile fatty acid contents and the ratio of acetate to propionate in rumen fluid of SM group were significantly lower than those of the other groups (P<0.05 or P<0.01);propionate content of SM group was significantly higher than that of PV group at 9 h (P<0.05 or P<0.01),but there was no significant difference among groups at 24 h (P>0.05).3) Serum urea nitrogen content of SM group was significantly higher than that of PV group (P<0.05),and serum creatinine content was significantly higher than that of BS group (P<0.05).In conclusion,under the same dietary energy and protein levels condition,compared to BS and SM,PV as the only dietary roughage source can improve performance,ruminal fermentation and nitrogen utilization rate,and save the supplementation of concentrate.%本试验在相同能量和蛋白质水平下,研究了不同粗饲料来源的饲粮对湖羊生长性能、瘤胃发酵功能及血清生化指标的影响.选用体况良好、体重相近的湖羊18只,随机分为3组,每组6只.在相同能量和蛋白质水平饲粮条件下,分别饲喂以花生藤(PV组)、豆秸(BS组)和甘蔗渣(SM组)作为单一粗饲料配制3种不同粗饲料来源的饲粮.试验期60 d

  8. ÕhuLoss - ehtides maailma / Pekka Erelt

    Index Scriptorium Estoniae

    Erelt, Pekka, 1965-

    2011-01-01

    Ehtekunstnike rühmitusest õhuLoss (Kadri Mälk, Piret Hirv, Eve Margus-Villems, Tanel Veenre, Kristiina Laurits, Villu Plink, Katrin Sipelgas). Esimest korda astus rühmitus üles 10 aastat tagasi Hollandis Marzee galeriis toimunud näitusel. 2011. aasta augustis-septembris toimus näitus Tallinna Põhjatuletornis

  9. Determination of diferences in runs between boys and girls aged 5.5 Určení rozdílu v běhu mezi chlapci a dívkami ve věku 5,5 roku

    Directory of Open Access Journals (Sweden)

    Damir Karpljuk

    2005-02-01

    Full Text Available The aim of this research is to determine whether there are distinctions in runs among five and a half year old boys and girls. The research is based on studying 80 girls and 64 boys from seven kindergartens in Slovenia. The following five measurement methods have been used in our research: a 10-meter run, a 150-meter run, a 10-meter run with a flying start, 4-times 5-meter run, and a 300-meter run. The results of the t-test indicate a statistically characteristic difference among boys and girls in 300 m run test results only, that is, a method used for measuring aerobic endurance. Other motor skills results have shown that there are no statistically characteristic differences among boys and girls. It is important that sport activities for boys and girls are organized for both groups of children equally. Especially girls must take part in a variety of running exercises in order to increase their aerobic endurance. They should be encouraged to take part in a variety of games which require activating the energy component of movement. Based on the results of this research we can say that physical education (PE of preschool children should be planned regardless of sex and the PE program should be the same for both boys and girls. Cílem tohoto výzkumu je určit, zda existují odlišnosti v běhu chlapců a dívek ve věku 5,5 roku. Výzkum je založen na studii 80 dívek a 64 chlapců v sedmi mateřských školách ve Slovinsku. Bylo použito těchto pěti měřicích metod: běh na 10 metrů, běh na 150 metrů, běh na 10 metrů s letmým startem, běh 4 × 5 metrů, běh na 300 metrů. Výsledky t-testu vykázaly statisticky významný rozdíl mezi chlapci a dívkami jen v běhu na 300 metrů, což je metoda používaná pro měření aerobní vytrvalosti. Výsledky ostatních pohybových aktivit vykazují, že mezi chlapci a dívkami není žádný statisticky významný rozdíl. Je důležité, aby sportovní aktivity byly organizovány rovnom

  10. Autonomic nervous system activity assessment in recreational half marathon runners [Hodnocení aktivity autonomního nervového systému u rekreačních účastníků půlmaratonského běhu

    Directory of Open Access Journals (Sweden)

    David Smékal

    2011-03-01

    competition. It is evident that the causes of soreness or fatigue do not markedly affect ANS activity during a later phase of recovery.[VÝCHODISKA: Spektrální analýza (SA variability srdeční frekvence (VSF je považována za neinvazivní metodu kvantifikace autonomní kardiální regulace sinoatriálního uzlu. Je známo, že autonomní regulace je ovlivňována různými stresory jako například nervozitou nebo tělesnou prací. CÍLE: Cílem předložené studie bylo zhodnotit vliv předstartovního stavu na aktivitu autonomního nervového systému (ANS a dále pak monitorovat časový průběh zotavení ANS paralelně se subjektivně vnímanou únavou v průběhu 24 hodin od ukončení půlmaratonu u amatérských běžců. METODIKA: Autonomní kardiální regulace byla posuzována pomocí metody SA VSF. Aktivita ANS byla hodnocena jeden týden před závodem a v den závodu. Po ukončení závodu proběhla měření aktivity ANS v 1., 12. a 24. hodině. Aktivita ANS byla reprezentována standardními spektrálními parametry a také komplexními indexy SA HRV. K hodnocení velikosti předstartovní nervozity byla využita modifikovaná Likertova 10bodová škála. Subjektivně vnímaná únava byla hodnocena na 6bodové škále. VÝSLEDKY: Vnímání nervozity bylo signifikantně vyšší v den závodu než týden před závody. Signifikantní pokles komplexního indexu sympatovagové balance v den závodu nepřímo svědčil o vzestupu aktivity sympatiku. Ve 12. ani 24. hodině zotavení se již žádný ze sledovaných parametrů VSF signifikantně nelišil od obou vstupních vyšetření. Subjektivně vnímaná únava zůstala zvýšená ještě 24 hodin od ukončení závodu. ZÁVĚRY: Naše práce ukázala, že zvýšená předzávodní nervozita vede k převaze sympatiku v autonomní regulaci zejména během orthostatické stimulace. Dále bylo zjištěno, že aktivita ANS se navrátila na předzátěžovou úroveň během 12. hodiny od ukončení z

  11. Effect of Dendrobium officinale Extraction on Gastric Carcinogenesis in Rats

    OpenAIRE

    Zhao, Yi; Liu, Yan; Lan, Xi-Ming; Xu, Guo-Liang; Sun, You-Zhi; Li, Fei; Liu, Hong-Ning

    2016-01-01

    Dendrobium officinale (Tie Pi Shi Hu in Chinese) has been widely used to treat different diseases in China. Anticancer effect is one of the important effects of Dendrobium officinale. However, the molecular mechanism of its anticancer effect remains unclear. In the present study, gastric carcinogenesis in rats was used to evaluate the effect of Dendrobium officinale on cancer, and its pharmacological mechanism was explored. Dendrobium officinale extracts (4.8 and 2.4 g/kg) were orally adminis...

  12. Regional new energy vision formulated for Murakami City; 2001 nendo Murakami shi chiiki shin energy vision sakutei tou jigyo. Murakami shi shin energy puran

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2002-03-01

    For promoting the introduction of new energy and for enhancing people's consciousness of such at Murakami City, Niigata Prefecture, surveys and studies were conducted involving energy consumption in the town, the amount of new energy resources in existence, and new energy introduction projects, and a vision was formulated. The annual energy consumption of the city is estimated at 78,000 kL in terms of oil. The residential/commercial sector consumes 24,000 kL, the industrial sector 28,000 kL, and the transportation sector 26,000 kL, with the three sectors demanding similar amounts. The carbon dioxide emitted by the sectors is estimated at 223,000 t-CO2/year. New energy introduction projects were discussed, which included hot water supply, heating, road heating, and power generation, all these utilizing heat from the Senami hot spa; biogas fueled power generation and BDF (bio-diesel) bus operation in the Senami hot spa district; the introduction of a hybrid wind power/photovoltaic power generation system into Ogata Seaside Park; the introduction of a mini-scale hydroelectric power generation system into the Kamikaifu district; a large-scale wind power generation business at the Iwafune district; the introduction of wind power and photovoltaic power generation facilities into primary and junior high schools; the use of clean energy vehicles for official use; and so forth. (NEDO)

  13. First records of three species of Oxycraspedus Kuschel (Coleóptera: Belidae in Argentina and use of a predictive model to compare their potential distribution with the range of their host-plant, Araucaria araucana Primera cita de las tres especies de Oxycraspedus Kuschel (Coleóptera: Belidae en Argentina y uso de un modelo predictivo para comparar su distribución potencial con el rango de su planta huésped, la Araucaria araucana

    Directory of Open Access Journals (Sweden)

    M.S. FERRER

    2007-09-01

    Full Text Available The first records of the three known species of Oxycraspedus Kuschel (Belidae: Oxycoryninae in Argentina are reported, and added to their known distribution in Chile. These weevils are of interest because of their association with the pehuén or monkey puzzle tree, Araucaria araucana, a species of conservation concern. Their distribution data are of value for the protection of biodiversity in natural areas of Patagonia. The potential distribution of Oxycraspedus, as predicted by a model using bioclimatic variables, is coincident as expected, with the geographic range of the araucaria host-plantSe reportan por primera vez en Argentina las tres especies de Oxycraspedus Kuschel (Belidae: Oxycoryninae y se añaden a su distribución en Chile. Estos gorgojos son de interés debido a su asociación con el pehuén Araucaria araucana, una especie de gran interés en temas de conservación. Los datos sobre su distribución son valiosos para proteger la biodiversidad en áreas de la Patagonia. La distribución potencial de Oxycraspedus predicha por un modelo a partir de variables bioclimáticas, es coincidente, como se esperaba, con el rango geográfico de su planta huésped, la araucaria

  14. Status and physics of the SHiP experiment at CERN

    CERN Document Server

    Buonaura, Annarita

    2017-01-01

    SHIP is a new general purpose fixed target facility, whose Technical Proposal has been recently reviewed by the CERN SPS Committee and by the CERN Research Board. The two boards recommended that the experiment proceeds further to a Comprehensive Design phase in the context of the new CERN Working group "Physics Beyond Colliders", aiming at presenting a CERN strategy for the European Strategy meeting of 2019. In its initial phase, the 400GeV proton beam extracted from the SPS will be dumped on a heavy target with the aim of integrating $2 \\times 10^{20}$ pot in 5 years. A dedicated detector, based on a long vacuum tank followed by a spectrometer and particle identification detectors, will allow probing a variety of models with light long-lived exotic particles and masses below O(10) GeV /c$^{2}$. The main focus will be the physics of the so-called Hidden Portals, i.e. search for Dark Photons, Light scalars and pseudo-scalars, and Heavy Neutrinos. The sensitivity to Heavy Neutrinos will allow for the first time...

  15. New energy vision of the Gotsu city area; 2001 nendo Gotsu shi chiiki shin energy vision

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2002-02-01

    For the purpose of promoting the introduction of new energy and enhancing the awareness of it in Gotsu City, Shimane Prefecture, an investigational study was conducted of the energy consumption amount of the city, existence amount of new energy, project for new energy introduction, etc., and a new energy vision was worked out. The energy consumption amount of the city was estimated at 1,558,022 Gcal. By sector, the energy consumption amount consisted of 80.0% in the industrial sector, 11.2% of in the transportation sector, 5.8% in the residential sector and 3.0% in the business sector. In the industrial sector, the main energy consumption industries were the paper manufacturing industry and tile industry. As the project for new energy introduction, the following were studied: project for the wind farm where a lot of wind power generators are installed; park as a symbol having 1 or 2 wind power generators; introduction of solar energy use water warmer/photovoltaic power generation to public facilities; system for promotion of the introduction of solar energy use water warmer/photovoltaic power generation to households; project on CO2 reduction by installation of LNG station; refuse/waste power generation project; project on utilization of the waste heat from tile makers. (NEDO)

  16. Do Women Shy Away From Competition? Do Men Compete Too Much?

    OpenAIRE

    Muriel Niederle; Lise Vesterlund

    2005-01-01

    Competitive high ranking positions are largely occupied by men, and women remain scarce in engineering and sciences. Explanations for these occupational differences focus on discrimination and preferences for work hours and field of study. We examine if absent these factors gender differences in occupations may still occur. Specifically we explore whether women and men, on a leveled playing field, differ in their selection into competitive environments. Men and women in a laboratory experimen...

  17. Learning from the Stones: A Go Approach to Mastering China's Strategic Concept, Shi

    National Research Council Canada - National Science Library

    Lai, David

    2004-01-01

    .... It is through learning the Chinese board game called go. This game is a living reflection of Chinese philosophy, culture, strategic thinking, warfare, military tactics, and diplomatic bargaining...

  18. The beam test of muon detector parameters for the SHiP experiment at CERN

    Science.gov (United States)

    Likhacheva, V. L.; Kudenko, Yu. G.; Mefodiev, A. V.; Mineev, O. V.; Khotyantsev, A. N.

    2018-01-01

    Scintillation detectors based on extruded plastics have been tested in a 10 GeV/c beam at CERN. The scintillation signal readout was provided using optical wavelength shifting fibers Y11 Kuraray and Hamamatsu MPPC micropixel avalanche photodiodes. The light yield was scanned along and across the detectors. Time resolution was found by fitting the MPPC digitized pulse rise and other methods.

  19. A Facility to Search for Hidden Particles (SHiP) at the CERN SPS

    CERN Document Server

    Anelli, M.; Arduini, G.; Back, J.J.; Bagulya, A.; Baldini, W.; Baranov, A.; Barker, G.J.; Barsuk, S.; Battistin, M.; Bauche, J.; Bay, A.; Bayliss, V.; Bellagamba, L.; Bencivenni, G.; Bertani, M.; Bezshyyko, O.; Bick, D.; Bingefors, N.; Blondel, A.; Bogomilov, M.; Boyarsky, A.; Bonacorsi, D.; Bondarenko, D.; Bonivento, W.; Borburgh, J.; Bradshaw, T.; Brenner, R.; Breton, D.; Brook, N.; Bruschi, M.; Buonaura, A.; Buontempo, S.; Cadeddu, S.; Calcaterra, A.; Calviani, M.; Campanelli, M.; Capoccia, C.; Cecchetti, A.; Chatterjee, A.; Chauveau, J.; Chepurnov, A.; Chernyavskiy, M.; Ciambrone, P.; Cicalo, C.; Conti, G.; Cornelis, K.; Courthold, M.; Dallavalle, M.G.; D'Ambrosio, N.; De Lellis, G.; De Serio, M.; Dedenko, L.; Di Crescenzo, A.; Di Marco, N.; Dib, C.; Dietrich, J.; Dijkstra, H.; Domenici, D.; Donskov, S.; Druzhkin, D.; Ebert, J.; Egede, U.; Egorov, A.; Egorychev, V.; Alaoui, M. A. El; Enik, T.; Etenko, A.; Fabbri, F.; Fabbri, L.; Fedorova, G.; Felici, G.; Ferro-Luzzi, M.; Fini, R.A.; Franke, M.; Fraser, M.; Galati, G.; Giacobbe, B.; Goddard, B.; Golinka-Bezshyyko, L.; Golubkov, D.; Golutvin, A.; Gorbunov, D.; Graverini, E.; Grenard, J-L; Guler, A.M.; Hagner, C.; Hakobyan, H.; Helo, J.C.; van Herwijnen, E.; Horvath, D.; Iacovacci, M.; Iaselli, G.; Jacobsson, R.; Kadenko, I.; Kamiscioglu, M.; Kamiscioglu, C.; Khaustov, G.; Khotjansev, A.; Kilminster, B.; Kim, V.; Kitagawa, N.; Kodama, K.; Kolesnikov, A.; Kolev, D.; Komatsu, M.; Konovalova, N.; Koretskiy, S.; Korolko, I.; Korzenev, A.; Kovalenko, S.; Kudenko, Y.; Kuznetsova, E.; Lacker, H.; Lai, A.; Lanfranchi, G.; Lauria, A.; Lebbolo, H.; Levy, J. -M.; Lista, L.; Loverre, P.; Lukiashin, A.; Lyubovitskij, V.E.; Malinin, A.; Manfredi, M.; Perillo-Marcone, A.; Marrone, A.; Matev, R.; Messomo, E.N.; Mermod, P.; Mikado, S.; Mikhaylov, Yu.; Miller, J.; Milstead, D.; Mineev, O.; Mingazheva, R.; Mitselmakher, G.; Miyanishi, M.; Monacelli, P.; Montanari, A.; Montesi, M.C.; Morello, G.; Morishima, K.; Movtchan, S.; Murzin, V.; Naganawa, N.; Naka, T.; Nakamura, M.; Nakano, T.; Nurakhov, N.; Obinyakov, B.; Ocalan, K.; Ogawa, S.; Oreshkin, V.; Orlov, A.; Osborne, J.; Pacholek, P.; Panman, J.; Paoloni, A.; Paparella, L.; Pastore, A.; Patel, M.; Petridis, K.; Petrushin, M.; Poli-Lener, M.; Polukhina, N.; Polyakov, V.; Prokudin, M.; Puddu, G.; Pupilli, F.; Rademakers, F.; Rakai, A.; Rawlings, T.; Redi, F.; Ricciardi, S.; Rinaldesi, R.; Roganova, T.; Rogozhnikov, A.; Rokujo, H.; Romaniouk, A.; Rosa, G.; Rostovtseva, I.; Rovelli, T.; Ruchayskiy, O.; Ruf, T.; Saitta, G.; Samoylenko, V.; Samsonov, V.; Ull, A. Sanz; Saputi, A.; Sato, O.; Schmidt-Parzefall, W.; Serra, N.; Sgobba, S.; Shaposhnikov, M.; Shatalov, P.; Shaykhiev, A.; Shchutska, L.; Shevchenko, V.; Shibuya, H.; Shitov, Y.; Silverstein, S.; Simone, S.; Skorokhvatov, M.; Smirnov, S.; Solodko, E.; Sosnovtsev, V.; Spighi, R.; Spinetti, M.; Starkov, N.; Storaci, B.; Strabel, C.; Strolin, P.; Takahashi, S.; Teterin, P.; Tioukov, V.; Tommasini, D.; Treille, D.; Tsenov, R.; Tshchedrina, T.; Ustyuzhanin, A.; Vannucci, F.; Venturi, V.; Villa, M.; Vincke, Heinz; Vincke, Helmut; Vladymyrov, M.; Xella, S.; Yalvac, M.; Yershov, N.; Yilmaz, D.; Yilmazer, A.U.; Vankova-Kirilova, G.; Zaitsev, Y.; Zoccoli, A.; CERN. Geneva. SPS and PS Experiments Committee; SPSC

    2015-01-01

    A new general purpose fixed target facility is proposed at the CERN SPS accelerator which is aimed at exploring the domain of hidden particles and make measurements with tau neutrinos. Hidden particles are predicted by a large number of models beyond the Standard Model. The high intensity of the SPS 400~GeV beam allows probing a wide variety of models containing light long-lived exotic particles with masses below ${\\cal O}$(10)~GeV/c$^2$, including very weakly interacting low-energy SUSY states. The experimental programme of the proposed facility is capable of being extended in the future, e.g. to include direct searches for Dark Matter and Lepton Flavour Violation. The facility will be serviced by a new dedicated beam line branched off the splitter section on the North Area. It is followed by a new target station and a magnetic shield to suppress beam induced background. The proposed orientation of the beam line and the underground complex allows reserving more than 100~m of space beyond the experiment...

  20. Development of a Summarized Health Index (SHI) for Use in Predicting Survival in Sea Turtles

    Science.gov (United States)

    Li, Tsung-Hsien; Chang, Chao-Chin; Cheng, I-Jiunn; Lin, Suen-Chuain

    2015-01-01

    Veterinary care plays an influential role in sea turtle rehabilitation, especially in endangered species. Physiological characteristics, hematological and plasma biochemistry profiles, are useful references for clinical management in animals, especially when animals are during the convalescence period. In this study, these factors associated with sea turtle surviving were analyzed. The blood samples were collected when sea turtles remained alive, and then animals were followed up for surviving status. The results indicated that significantly negative correlation was found between buoyancy disorders (BD) and sea turtle surviving (p turtles had significantly higher levels of aspartate aminotranspherase (AST), creatinine kinase (CK), creatinine and uric acid (UA) than surviving sea turtles (all p turtles and to improve veterinary care at rehabilitation facilities. PMID:25803431

  1. Shy Children Are Less Sensitive to Some Cues to Facial Recognition

    Science.gov (United States)

    Brunet, Paul M.; Mondloch, Catherine J.; Schmidt, Louis A.

    2010-01-01

    Temperamental shyness in children is characterized by avoidance of faces and eye contact, beginning in infancy. We conducted two studies to determine whether temperamental shyness was associated with deficits in sensitivity to some cues to facial identity. In Study 1, 40 typically developing 10-year-old children made same/different judgments about…

  2. SI-SHY: Dysregulated Fear in Toddlerhood Predicts Kindergarten Social Withdrawal through Protective Parenting.

    Science.gov (United States)

    Kiel, Elizabeth J; Buss, Kristin A

    2014-05-01

    Two recent advances in the study of fearful temperament (behavioral inhibition) include the validation of dysregulated fear as a temperamental construct that more specifically predicts later social withdrawal and anxiety, and the use of conceptual and statistical models that place parenting as a mechanism of development from temperament to these outcomes. The current study further advances these areas by examining whether protective parenting mediated the relation between dysregulated fear in toddlerhood and social withdrawal in kindergarten. Participants included 93 toddlers and their mothers, who engaged in laboratory tasks assessing traditional fearful temperament, dysregulated fear, and protective parenting. When children reached kindergarten, they returned to the laboratory for a multimethod assessment of social withdrawal. Results confirmed the hypothesis that dysregulated fear predicted social withdrawal through protective parenting, and this occurred above and beyond the effect of traditional fearful temperament. These findings bolster support for the use of dysregulated fear as a temperamental construct related to, but perhaps more discerning of risk than traditionally measured fearful temperament/behavioral inhibition and highlight the importance of transactional influences between the individual and the caregiving environment in the development of social withdrawal.

  3. Internet communication: an activity that appeals to shy and socially phobic people?

    Science.gov (United States)

    Madell, Dominic; Muncer, Steven

    2006-10-01

    Shyness (or social anxiety) and social phobia can be viewed as two distinct conditions, and this study investigates whether they are related to use of the Internet generally, and for communication purposes. 362 participants from two schools, a college and a university in the Teesside area in England were asked to complete Mattick and Clarke's (1998) Social Phobia (SPS) and Social Interaction Anxiety (SIAS) scales and also answer a questionnaire which asked them about their use of the Internet generally and for communication purposes. The findings from these suggested that social anxiety and social phobia are not highly associated with use of the Internet either in general, or for communication purposes, although minor associations with certain aspects of Internet use are discussed.

  4. Institucional'naja podgotovka Pol'shi k vstupleniju v Evropejskij sojuz

    Directory of Open Access Journals (Sweden)

    Tomaszewski W.

    2015-05-01

    Full Text Available In May 2014 it was aready ten years since Poland’s accession to the European Union. The accession was preceded by a long period of political action and negotiations between the Polish and the EU institutions. The process of integration was extremely complex. It covered almost all areas of economic, legal and civil aspects of the aspiring country’s economy, in which all necessary requirements had to be met. The aim of the article was to present the institutional framework created for efficient implementation of the process of accession. The considerations involved especially an institutional method. The research resulted in poining out both the actually efficient and less efficient bodies participating in the process of integration.

  5. Status and physics of the SHiP experiment at CERN

    CERN Document Server

    Buonaura, Annarita

    2018-01-01

    SHIP is a new general purpose fixed target facility, whose Technical Proposal has been recently reviewed by the CERN SPS Committee and by the CERN Research Board. The two boards recommended that the experiment proceeds further to a Comprehensive Design phase in the context of the new CERN Working group "Physics Beyond Colliders", aiming at presenting a CERN strategy for the European Strategy meeting of 2019. In its initial phase, the 400GeV proton beam extracted from the SPS will be dumped on a heavy target with the aim of integrating $2 \\times 10^{20}$ pot in 5 years. A dedicated detector, based on a long vacuum tank followed by a spectrometer and particle identification detectors, will allow probing a variety of models with light long-lived exotic particles and masses below O(10) GeV /c$^{2}$. The main focus will be the physics of the so-called Hidden Portals, i.e. search for Dark Photons, Light scalars and pseudo-scalars, and Heavy Neutrinos. The sensitivity to Heavy Neutrinos will allow for the first time...

  6. Shi et al., Afr J Tradit Complement Altern Med. (2015) 12(6):169-179 ...

    African Journals Online (AJOL)

    Proff.Adewunmi

    ... indicating that ethyl acetate extracts of TA leaves are efficacious in attenuating oxidative stress in the liver of ... Antioxidant and antibacterial activities of polyphenolic compounds from bitter cumin (Cuminum .... functions and human disease.

  7. On dendrocincla tyrannina: Morphology, behavior and conservation of a shy lek-type insectivore

    Directory of Open Access Journals (Sweden)

    Willis Edwin O.

    1995-11-01

    Full Text Available El trepatroncos tiranino o "churulo" (Dendrocincla tyrannina, Dendrocolaptidae de los bosques de neblina del norte de los Andes es solitario, como las otras especies del género. Se desplaza en el sotobosque lleno de epífitas, dependiendo parcialmente de los insectos que huyen de los escasos ejércitos de hormigas. Es un ave silenciosa y arisca, que se esconde después de volar cortas distancias en busca de presas, o procurándolas en musgos o troncos. La pérdida de los bosques húmedos andinos de laderas abruptas para dar lugar a la ganadería de baja productividad amenaza a la especie y aumenta el peligro de derrumbes en áreas sujetos a temblores; el uso más apropiado para tales áreas es para estudios científicos y actividades turísticas, y no para asentamientos permanentesThe Tyrannine Woodcreeper (Dendrocincla tyrannina, Dendrocolaptidae of northern Andean cloud forests is solitary, like the rest of the genus, and wanders in the epiphyte-laden forest understory, depending partly on hard-to-find swarms of army ants and on understory flocks to flush insects. It is wary and silent, hiding after flying short distan ces for prey or gleaning it from moss or trunks. As los s of sleep Andean wet forests where the woodcreepers live resulls in gretaer danger from earthquakes, study and tourism are preferable to settlements.

  8. The SHiP experiment and its detector for neutrino physics

    CERN Document Server

    Buonaura, Annarita

    2016-01-01

    SHIP is a new general purpose fixed target facility, proposed at the CERN SPS accelerator. In its initial phase the 400GeV proton beam will be dumped on a heavy target with the aim of integrating $2 \\times 10^{20}$ pot in 5 years. A detector downstream of the target will allow to search long-lived exotic particles with masses below O(10) GeV/c2 forseen in extension of the Standard Model. Another dedicated detector, that will be the focus of this talk, will allow to study active neutrino cross- sections and angular distributions. The neutrino detector consists of an emulsion target, based on the Emulsion Cloud Chamber technology fruitfully employed in the OPERA experiment. The Emulsion Cloud Chamber will be placed in a magnetic field, with the so-called Compact Emulsion spectrometer, a few cm thick chamber for the charge and momentum measurement of hadrons. This will provide the leptonic number measurement also in the hadronic tau decay channels. The detector will be hybrid, using nuclear emulsions and electr...

  9. SHI induced defects in chemically synthesized graphene oxide for hydrogen storage applications

    Energy Technology Data Exchange (ETDEWEB)

    Sharma, Preetam K., E-mail: preetam.nano@gmail.com; Sharma, Vinay; Rajaura, Rajveer Singh; Singh, M. [Department of Physics, University of Rajasthan, Jaipur-302004, India. (India); Srivastava, Subodh; Vijay, Y. K. [Department of Physics, University of Rajasthan, Jaipur-302004, India. (India); Department of Physics, Vivekananda Global University, Jaipur-303012, India. (India); Sharma, S. S. [Department of Physics, Govt. Women Engineering College, Ajmer-305002, India. (India)

    2016-05-06

    Graphene, due to its unique properties arising from the single carbon layer, is a potential candidate for applications in a variety of fields including sensors, photovoltaics and energy storage. The atomic structure and morphology of the carbon nanomaterials especially graphene can be tailored by energetic ionic irradiation. As graphene sheet is very stable, the surface have less reactivity as compared to the edges of the sheets. By surface modification with energetic ion-beams additional dangling bonds can be formed to enhance the surface activity of the graphene film which could be exploited in a variety of applications. In the present work, graphene oxide was synthesized by improved Hummers’ Method. The irradiation was done with Ag{sup +} ions carrying energy 100 MeV with the fluence of 3×10{sup 13}. Raman spectrum of graphene irradiated by Ag{sup +} beam shows additional disordered peaks of D´ and D+G bands. There is also a decrease in the intensity of D band. AFM images depict the increase in the surface roughness of the films. This can be attributed to the increase in the defects in the flakes and intermixing of adjacent layers by irradiation.

  10. Women do not play their aces: the consequences of shying away

    NARCIS (Netherlands)

    Claussen, J.; Czibor, E.; van Praag, M.

    2015-01-01

    The underrepresentation of women at the top of hierarchies is often explained by gender differences in preferences. We find support for this claim by analyzing a large dataset from an online card game community, a stylized yet natural setting characterized by self-selection into an uncertain,

  11. New energy vision of the Noogata city area; 2001 nendo Noogata shi chiiki shin energy vision

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2002-02-01

    For the purpose of promoting the introduction of new energy and enhancing the awareness of it in Noogata City, Fukuoka Prefecture, an investigational study was conducted of the energy demand amount of the city, existence amount of new energy, project for new energy introduction, etc., and a vision was worked out. The energy consumption amount of the city was estimated at 4,825.4 x 10{sup 6} MJ/y. It consisted of 47.1% in the industrial sector, 26.1% in the commercial/residential sector and 24.9% in the transportation sector. The rate of energy source was 65.7% of petroleum-base energy and 25.1% of electric power. As the project for new energy introduction, the following were studied: introduction of wind power generation/photovoltaic power generation to the flower park at the foot of Mt. Fukuchi and Nakanoshima park on the sandbank of the Onga river; introduction of photovoltaic power generation to library. Moreover, as future models of the introduction, the potential study was made on the following: installation of the stockbreeding waste biogas plant at the compost center; installation of fuel cell system using digestion gas from night soil treatment facilities; installation of the natural gas cogeneration system in the project on redevelopment of the urban area, etc. (NEDO)

  12. Regional new energy vision for Hita City; 2001 nendo Hita shi chiiki shin energy vision

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2002-02-01

    For promoting the introduction of new energy and for elevating people's consciousness of such in Hita City, Oita Prefecture, surveys and studies were conducted concerning the energy supply/demand trend in the city, the amount of new energy resources in existence, and new energy introduction plans, and a vision was formulated. The city's energy consumption is estimated at 16,216,376 GJ, with the industrial sector responsible for 78.23%, the transportation sector for 11.35%, and the residential and commercial sector for 9.73%. It is in the public sector, general households, forestry, and hog raising that new energy will be utilized. Key projects for new energy introduction were discussed, which covered a residence incorporating a combination of new energies such as solar heat for water heating and photovoltaic power; lumber drying facilities utilizing forestry generated biomass; cogeneration fueled by methane gas from livestock excrements and garbage; photovoltaic power for schools, the city office, etc.; use of photovoltaic power, temperature difference energy, and methane gas at purification centers, etc.; use of clean energy vehicles for official use; etc. (NEDO)

  13. SHI induced enhancement in green emission from nanocrystalline CdS thin films for photonic applications

    International Nuclear Information System (INIS)

    Kumar, Pragati; Saxena, Nupur; Chandra, Ramesh; Gao, Kun; Zhou, Shengqiang; Agarwal, Avinash; Singh, Fouran; Gupta, Vinay; Kanjilal, D.

    2014-01-01

    Intense green emission is reported from nanocrystalline CdS thin films grown by pulsed laser deposition. The effect of ion beam induced dense electronic excitation on luminescence property of CdS films is explored under irradiation using 70 MeV 58 Ni 6+ ions. It is found that swift heavy ion beam irradiation enhances the emission intensity by an order of 1 and broadens the emission range. This feature is extremely useful to enhance the performance of different photonic devices like light emitting diodes and lasers, as well as luminescence based sensors. To examine the role of energy relaxation process of swift heavy ions in creation/annihilation of different defect levels, multi-peaks are fitted in photoluminescence spectra using a Gaussian function. The variation of contribution of different emissions in green emission with ion fluence is studied. Origin of enhancement in green emission is supported by various characterization techniques like UV–visible absorption spectroscopy, glancing angle X-ray diffraction, micro-Raman spectroscopy and transmission electron microscopy. A possible mechanism of enhanced GE due to ion beam irradiation is proposed on the basis of existing models. -- Highlights: • Room temperature green luminescence nanocrystalline CdS thin films grown by pulsed laser deposition. • Enhanced green emission by means of swift heavy ion irradiation. • Multipeak fitting of photoluminescence spectra using a Gaussian function. • Variation of area contributed by different emissions in green emission is studied with respect to ion fluence. • Mechanism of enhanced green emission is discussed based on creation/annihilation of defects due to ion beam irradiation

  14. SHI induced enhancement in green emission from nanocrystalline CdS thin films for photonic applications

    Energy Technology Data Exchange (ETDEWEB)

    Kumar, Pragati, E-mail: pkumar.phy@gmail.com [Department of Physics, Bareilly College, Shahmat Ganj Road, Bareilly 243005, Uttar Pradesh (India); Saxena, Nupur [Inter University Accelerator Centre, Aruna Asaf Ali Marg, P.O. Box 10502, New Delhi 110067 (India); Chandra, Ramesh [Institute Instrumentation Centre, Indian Institute of Technology, Roorkee 247667 (India); Gao, Kun; Zhou, Shengqiang [Institute of Ion Beam Physics and Materials Research, Helmholtz-Zentrum Dresden-Rossendorf (HZDR), P.O. Box 510119, 01314 Dresden (Germany); Agarwal, Avinash [Department of Physics, Bareilly College, Shahmat Ganj Road, Bareilly 243005, Uttar Pradesh (India); Singh, Fouran [Inter University Accelerator Centre, Aruna Asaf Ali Marg, P.O. Box 10502, New Delhi 110067 (India); Gupta, Vinay [Department of Physics and Astrophysics, Delhi University, Delhi 110007 (India); Kanjilal, D. [Inter University Accelerator Centre, Aruna Asaf Ali Marg, P.O. Box 10502, New Delhi 110067 (India)

    2014-03-15

    Intense green emission is reported from nanocrystalline CdS thin films grown by pulsed laser deposition. The effect of ion beam induced dense electronic excitation on luminescence property of CdS films is explored under irradiation using 70 MeV {sup 58}Ni{sup 6+} ions. It is found that swift heavy ion beam irradiation enhances the emission intensity by an order of 1 and broadens the emission range. This feature is extremely useful to enhance the performance of different photonic devices like light emitting diodes and lasers, as well as luminescence based sensors. To examine the role of energy relaxation process of swift heavy ions in creation/annihilation of different defect levels, multi-peaks are fitted in photoluminescence spectra using a Gaussian function. The variation of contribution of different emissions in green emission with ion fluence is studied. Origin of enhancement in green emission is supported by various characterization techniques like UV–visible absorption spectroscopy, glancing angle X-ray diffraction, micro-Raman spectroscopy and transmission electron microscopy. A possible mechanism of enhanced GE due to ion beam irradiation is proposed on the basis of existing models. -- Highlights: • Room temperature green luminescence nanocrystalline CdS thin films grown by pulsed laser deposition. • Enhanced green emission by means of swift heavy ion irradiation. • Multipeak fitting of photoluminescence spectra using a Gaussian function. • Variation of area contributed by different emissions in green emission is studied with respect to ion fluence. • Mechanism of enhanced green emission is discussed based on creation/annihilation of defects due to ion beam irradiation.

  15. Do gays shy away from competition? Do lesbians compete too much?

    NARCIS (Netherlands)

    Buser, T.; Geijtenbeek, L.; Plug, E.

    It is an established fact that gay men earn less than other men and lesbian women earn more than other women. In this paper we study whether differences in competitive preferences, which have emerged as a likely determinant of labour market differences between men and women, can provide a plausible

  16. Do Gays Shy Away from Competition? Do Lesbians Compete Too Much?

    OpenAIRE

    Buser, Thomas; Geijtenbeek, Lydia; Plug, Erik

    2015-01-01

    It is an established fact that gay men earn less than other men and lesbian women earn more than other women. In this paper we study whether differences in competitive preferences, which have emerged as a likely determinant of labour market differences between men and women, can provide a plausible explanation. We conduct an experiment on a Dutch online survey panel to measure the competitiveness of gay, lesbian and straight panel members. For differences in competitiveness to partially expla...

  17. New energy vision of Kanazawa City; 2001 nendo Kanazawa shi shin energy vision

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2002-02-01

    For the purpose of promoting the introduction of new energy and enhancing the awareness of it in Kanazawa City, Ishikawa Prefecture, an investigational study was conducted of the energy demand amount of the city, existence amount of new energy and project for new energy introduction, and a vision was worked out. The energy demand amount of the city was approximately 42 million GJ. The amount of CO2 emitted from this was estimated at approximately 880,000 t-C. The rate of energy source was 65.3% of petroleum-base energy, 24.7% of electric power and 10.0% of gas. As viewed by sector, the energy demand amount consisted of 38.1% in the commercial/residential sector, 32.2% in the transportation sector and 29.7% in the industrial sector. As the project for new energy introduction, the following were studied: introduction of wind power generation to the sport recreation zone of the mountain area; introduction of natural gas cogeneration to the city hospital; introduction of hydroelectric power generation using the idle head of filtration plant; utilization of the sewage heat and sewage digestion gas at the water quality control center, introduction of clean energy vehicle to official vehicle; introduction of photovoltaic power generation to park light/school, etc. (NEDO)

  18. Shy and Ticklish Truths as Species of Scientific and Artistic Perception

    African Journals Online (AJOL)

    ... recognize a 'gay science' (Nietzsche) not as an eccentric construction of merely poetic insights and expressions, but as a necessary part of the fundamentals of knowledge. It is a truth of the human condition that its truths are grounded in a personal embodiment of individuality, ontogeny, momentariness and situationality.

  19. New energy vision of the Akita city area; 2001 nendo Akita shi chiiki shin energy vision

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2002-03-01

    For the purpose of promoting the introduction of new energy and enhancing the awareness of it in Akita City, an investigational study was conducted of the energy demand of the town, existence amount of new energy, project on new energy introduction, etc., and a new energy vision was worked out. The population of Akita City was 317,868 as of December 31, 2000, which is continuously on the increase. The amount of energy demand of the whole city was 990,000 kL/y. The energy demand consists of fossil fuels such as petroleum, coal and propane gas (77.7%) and electric power (22.3%). The CO2 emissions from these are 2,908,000 t-CO2. As the project on the new energy introduction, study was made on the installation of the photovoltaic power system and wind power system at base centers and introduction of the waste power system at the Goshono Works. As the model project, study was made on the introduction of the photovoltaic power generation and wind power generation to street light and public facilities, road snow melting/space heating and cooling using soil heat, introduction of clean energy vehicles, BDF introduction using waste cooking oil and rate blossoms, etc. (NEDO)

  20. Search for Hidden Particles (SHiP): a new experiment proposal

    Science.gov (United States)

    De Lellis, G.

    2015-06-01

    Searches for new physics with accelerators are being performed at the LHC, looking for high massive particles coupled to matter with ordinary strength. We propose a new experimental facility meant to search for very weakly coupled particles in the few GeV mass domain. The existence of such particles, foreseen in different theoretical models beyond the Standard Model, is largely unexplored from the experimental point of view. A beam dump facility, built at CERN in the north area, using 400 GeV protons is a copious factory of charmed hadrons and could be used to probe the existence of such particles. The beam dump is also an ideal source of tau neutrinos, the less known particle in the Standard Model. In particular, tau anti-neutrinos have not been observed so far. We therefore propose an experiment to search for hidden particles and study tau neutrino physics at the same time.

  1. Current status of X-ray system at SHI Tsukuba facility

    International Nuclear Information System (INIS)

    Washio, Masakazu; Kato, Hiroo; Yamase, Yutaka; Odera, Masatoshi; Thompson, C.C.; Cleland, M.R.

    1992-01-01

    Many studies have been carried out on X-ray converter system, characteristics of the X-rays and its applications. In this paper, following items will be described. 1. Characteristics of electron beam obtained from 5 MeV Dynamitron, 2. Design and status of the X-ray converter, 3. Characteristics of converted X-ray, 4. Preliminary results of sterilization of certain microbiological reference standard. (J.P.N.)

  2. SI-SHY: Dysregulated Fear in Toddlerhood Predicts Kindergarten Social Withdrawal through Protective Parenting

    Science.gov (United States)

    Kiel, Elizabeth J.; Buss, Kristin A.

    2014-01-01

    Two recent advances in the study of fearful temperament (behavioral inhibition) include the validation of dysregulated fear as a temperamental construct that more specifically predicts later social withdrawal and anxiety, and the use of conceptual and statistical models that place parenting as a mechanism of development from temperament to these outcomes. The current study further advances these areas by examining whether protective parenting mediated the relation between dysregulated fear in toddlerhood and social withdrawal in kindergarten. Participants included 93 toddlers and their mothers, who engaged in laboratory tasks assessing traditional fearful temperament, dysregulated fear, and protective parenting. When children reached kindergarten, they returned to the laboratory for a multimethod assessment of social withdrawal. Results confirmed the hypothesis that dysregulated fear predicted social withdrawal through protective parenting, and this occurred above and beyond the effect of traditional fearful temperament. These findings bolster support for the use of dysregulated fear as a temperamental construct related to, but perhaps more discerning of risk than traditionally measured fearful temperament/behavioral inhibition and highlight the importance of transactional influences between the individual and the caregiving environment in the development of social withdrawal. PMID:25242893

  3. Effect of Language Context on Ratings of Shy and Unsociable Behaviors in English Language Learner Children

    Science.gov (United States)

    Ash, Andrea C.; Rice, Mabel L.; Redmond, Sean M.

    2014-01-01

    Purpose: The primary goal of this study was to explore the effect of language context on the socially withdrawn behaviors of school-age-children who are English language learners (ELLs) from middle- to high-socioeconomic status (SES) backgrounds. This is one of the 1st studies to address the frequently confused concepts of shyness and…

  4. SHiP: a new facility with a dedicated detector for studying $\

    CERN Document Server

    Buonaura, Annarita

    2016-01-01

    SHIP is a new general purpose fixed target facility, proposed at the CERN SPS accelerator. In five years, $2\\times 10^{20}$ protons of 400 GeV/c momentum will be dumped on a Molybdenum target. A detector downstream of the target will allow a search to made for long-lived particles with masses below O(10) GeV/c$^2$ foreseen in several extensions of the Standard Model. Another dedicated detector will allow the study of active neutrino cross-sections and angular distributions. The neutrino detector consists of an emulsion target, based on the Emulsion Cloud Chamber technology fruitfully employed in the OPERA experiment. The Emulsion Cloud Chamber will be placed in a magnetic field, with the so-called Compact Emulsion Spectrometer, a few cm thick chamber for the charge and momentum measurement of hadrons. This will provide the leptonic number measurement also in the hadronic tau decay channels. The detector will be hybrid, using nuclear emulsions and electronic detectors for the time stamp of the events and the m...

  5. Regional new energy vision for Joetsu City; 2001 nendo Joetsu shi chiiki shin energy vision

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2002-02-01

    For promoting the introduction of new energy and for enhancing people's consciousness of such at Joetsu City, Niigata Prefecture, surveys and studies were conducted involving energy consumption of the city, the amount of new energy resources in existence, and new energy introduction projects, and a vision was formulated. The city consumes 3,593 times 10{sup 9} kcal in energy, with the industrial sector responsible for 47.5%, the transportation sector 28.1%, and the residential/commercial sector 24.3%. As for the energy type, oil based fuel accounts for 58.3%, electric power 26.8%, and town gas 8.6%. The amount of carbon dioxide emissions due to energy consumption is estimated at 1,160 kt-CO2. Studies conducted for new energy introduction covered the supply of photovoltaic power to a project on municipal housing construction and a project on promoting the buildup of environment preservation facilities; the installation of a photovoltaic power generation system for a Citizens' Forest buildup project; the installation of a wind power generation system at the Minowadai Square of Recreation and Relaxation for the citizens; the installation of eco-stations to deal with gasoline, propane gas, and natural gas; the extension of financial support for the purchase of low-pollution vehicles; and so forth. (NEDO)

  6. Névtani kérdések a nyest.hu-n. [Onomastic questions on nyest.hu website

    Directory of Open Access Journals (Sweden)

    Haindrich, Helga Anna

    2013-12-01

    Full Text Available Since the 1st of June 2009, members of the general public have been able to visit a Hungarian website focusing on national and international news and events concerning Linguistic Studies. The portal classifies the current news according to their topics; thus, writings on onomastic questions can be found under the heading Proper Names. Most relevant articles deal with place names; other writings – in order of decreasing frequency – discuss personal names, names for institutions, names for animals, names for artefacts, and trade names. The portal not only shares news and knowledge, but also offers services such as a help desk for problems in translation, text ergonomics and Linguistics. The opportunity to comment on articles and launch forums or blogs to initiate a discourse on topical issues is also provided by the webmaster. The website, by presenting interesting news and topics in connection with proper names, plays a vital role in disseminating factual knowledge relating to Onomastics.

  7. Diagnosis of angiomyolipoma using computed tomography-region of interest ≤-10 HU or 4 adjacent pixels ≤-10 HU are recommended as the diagnostic thresholds

    International Nuclear Information System (INIS)

    Simpson, E.; Patel, U.

    2006-01-01

    AIM: To study and compare the diagnostic accuracy of region of interest (ROI) density measurement and pixel mapping [computed tomography (CT) density of individual pixels] for the diagnosis of renal angiomyolipoma (AML) using CT. MATERIALS AND METHODS: A study group of histologically proven AMLs was compared with a control group of histologically proven renal cell cancers, normal renal parenchyma, and simple renal cysts. The mean tissue density (ROI circle) and a pixel density map were recorded. The diagnostic accuracy of various thresholds of ROI and pixel mapping values were compared using receiver operating characteristic curves. RESULTS: Twenty-two AMLs, 16 renal cell carcinomas (RCCs), 30 simple cysts, and 30 sites of renal parenchyma were evaluated. The mean (±1 SD) density of the AMLs was significantly lower [-15.2(20.8) units] than the three control groups [+36.0(8.1) units, +5.4(3.4) units and +22.2(46.5) units for RCC, renal cyst and parenchyma respectively; p<0.001 (analysis of variance)]. The sensitivities and specificities of the ROI diagnostic thresholds of ≤0 units, ≤-10 units and ≤-20 units were 77 and 97%, 73 and 100% and 50 and 100%, respectively. Using pixel mapping [diagnostic thresholds of either a line of 4 pixels ≤-10 units or a square of 4 pixels ≤-10 units] the sensitivity improves to 86% with a specificity of 97%. CONCLUSION: Although a ROI threshold value of ≤-10 units has a very high specificity (100% in the present study) the sensitivity is modest at only 73%. Pixel mapping is more sensitive for recognizing small clusters of fat. In practice, both methods can be recommended for the analysis of suspected AMLs. ROI density measurement is convenient when analysing large areas of suspected fat and ≤-10 units should be used as the diagnostic threshold. When faced with small lucent areas or indeterminate values after ROI analysis, pixel mapping is recommended using a line of 4 pixels ≤-10 units or a square of 4 pixels ≤-10 units as the discriminating thresholds

  8. Impact Analysis of Peng-Hu Power System Connected with a Photovoltaic System

    DEFF Research Database (Denmark)

    Wang, Li; Nguyen, Ha Thi; Yan, Chih-Hao

    2014-01-01

    With the rapid increase of photovoltaic (PV) systems installed in power systems in the recent years, the negative impacts on power quality of distribution networks due to highpenetration PV systems can be increased. This paper presents the system-impact analyzed results of a 0.6-MW PV system conn...

  9. The Comparison Study of gas source between two hydrate expeditions in ShenHu area, SCS

    Science.gov (United States)

    Cong, X. R.

    2016-12-01

    Two gas hydrate expeditions (GMGS 01&03) were conducted in the Pearl River Mouth Basin, SCS, which were organized by Guangzhou Marine Geological Survey in 2007 and 2015, respectively. Compared with the drilling results of "mixed bio-thermogenic gas and generally dominated by biogenic gas" in 2007, hydrocarbon component measurements revealed a higher content of ethane and propane in 2015 drilling, providing direct evidence that deep thermogenic gas was the source for shallow hydrate formation. According to the geochemical analyses of the results obtained from the industrial boreholes in Baiyun sag, the deep hydrocarbon gas obviously leaked from the reservoir as escape caused by Dongsha movement in the late Miocene, as a result thermogenic gas from Wenchang, Enping and Zhuhai hydrocarbon source rocks migrated to late Miocene shallow strata through faults, diapirs and gas chimney vertically migration. In this paper we report the differences in fluid migration channel types and discuss their effect in fluid vertical migration efficiency in the two Shenhu hydrate drilling areas. For the drilling area in 2007,when the limited deep thermogenic gas experienced long distance migration process from bottom to up along inefficient energy channel, the gas composition might have changed and the carbon isotope fractionation might have happened, which were reflected in the results of higher C1/C2 ratios and lighter carbon isotope in gas hydrate bearing sediments. As a result the gas is with more "biogenic gas" features. It means thermogenic gases in the deep to contributed the formation of shallow gas hydrate indirectly in 2007 Shenhu drill area. On another hand, the gases were transported to the shallow sediment layers efficiently, where gas hydrate formed, through faults and fractures from deep hydrocarbon reservoirs, and as the result they experienced less changes in both components and isotopes in 2015 drilling site.

  10. The SCID-hu mouse and its application to human radiation biology

    International Nuclear Information System (INIS)

    Kyoizumi, Seishi; Akiyama, Mitoshi; McCune, J.M.; Namikawa, Reiko.

    1993-01-01

    The radiobiological study of humans has been hampered by a lack of suitable in vivo experimental models. Of course, acute and chronic radiation effects in humans have been documented in the studies of atomic bomb (A-bomb) survivors and patients irradiated either by therapeutic intent or by accident. However, the information gained from these studies has been limited by the difficulties in estimating precise radiation doses and in obtaining biological samples for directly analyzing the processes of radiation-induced pathogenesis. With these issues in mind, we propose that the severe combined immunodeficient mouse-human chimera can be used as an in vivo experimental model for human radiation biology. We have developed techniques by which normal human bone marrow can be implanted into immunodeficient C.B-17 scid/scid (SCID) mice (S. Kyoizumi et al, Blood 79, 1704, 1992). We have report that this in vivo model can be used for the analysis of radiation damage to human bone marrow. After whole-body irradiation of the engrafted animals, human progenitor cells within the human marrow were destroyed in a dose-dependent manner (D 0 = 0.7-1.0Gy, n = 1.0). Acute hematotoxicity was reduced when the radioprotective agent (WR-2721) was administered prior to irradiation. After low dose irradiation, the recovery of human progenitor activity was accelerated by treatment with human granulocyte-colony stimulating factor (G-CSF). This small animal model may prove amenable for the risk analysis of human radiation exposure as well as for the development of new modalities for the prevention and treatment of radiotoxic damage to the human hematopoietic system. (author)

  11. [Sex pheromone secondary components of Indian meal moth Plodia interpunctella in China. HU wenlil 2, DU].

    Science.gov (United States)

    Hu, Wenli; Du, Jiawei

    2005-09-01

    Indian meal moth Plodia interpunctella Hübner (Lepidoptera: Pyralidae) is considered as an important insect pest infesting stored grains and other products in China. The major sex pheromone component of P. interpunctella, Z9, E12-14: OAc (TDA), has already been identified. Though the efficiency of male capture by using the bait with this component alone is quite good, the pheromone system is far from fully understood. The identification with capillary chromatographic analysis and GC-MS methods showed that there were four main components, i. e., Z9, E12-14: OAc(A), Z9, E12-14: OH (B), Z9, E12-14: Ald(C), and Z9-14: OAc(D), in the sex pheromone gland of female P. interpunctella, and the ratio of these four components was A: B: C:D= 100:22: 12:9. Wind tunnel experimental results suggested that the response of male P. interpunctella to a blend (A: B: C: D = 8:2:1:0.8) was not significantly different from that to female sex pheromone gland extracts.

  12. Page 1 Hu TropJ ObstetGynaecol, 18 (2), October 2001. A Review of ...

    African Journals Online (AJOL)

    This may be partly due to the low antibody screening (and titration) at 4-weekly prevalence of Rhesus (Rh) negative blood ... The women's biodata, parity, previous history of administration of anti-D globulin, the partner's blood ... were nulliparae"with previous history of abortion and. 47 (61.0%) were parous. Of the 44 women ...

  13. Anodic Oxidation of 18 Halogenated and/or Methylated Derivatives of CB(11)Hu(12)(-)

    Czech Academy of Sciences Publication Activity Database

    Wahab, Abdul; Douvris, C.; Klíma, Jiří; Šembera, F.; Ugolotti, J.; Kaleta, J.; Ludvík, Jiří; Michl, J.

    2017-01-01

    Roč. 56, č. 1 (2017), s. 269-276 ISSN 0020-1669 R&D Projects: GA ČR GAP206/11/0727 Institutional support: RVO:61388955 Keywords : WEAKLY COORDINATING ANIONS * DODECAMETHYLCARBA-CLOSO-DODECABORANYL * ICOSAHEDRAL CARBORANE ANIONS Subject RIV: CG - Electrochemistry OBOR OECD: Electrochemistry (dry cells, batteries, fuel cells, corrosion metals, electrolysis) Impact factor: 4.857, year: 2016

  14. Anodic Oxidation of 18 Halogenated and/or Methylated Derivatives of CB(11)Hu(12)(-)

    Czech Academy of Sciences Publication Activity Database

    Wahab, Abdul; Douvris, C.; Klíma, J.; Šembera, Filip; Ugolotti, Juri; Kaleta, Jiří; Ludvík, J.; Michl, Josef

    2017-01-01

    Roč. 56, č. 1 (2017), s. 269-276 ISSN 0020-1669 Institutional support: RVO:61388963 Keywords : weakly coordinating anions * dodecamethylcarba-closo-dodecaboranyl * icosahedral carborane anions Subject RIV: CA - Inorganic Chemistry OBOR OECD: Inorganic and nuclear chemistry Impact factor: 4.857, year: 2016

  15. World Energy Data System (WENDS). Volume VIII. Nuclear facility profiles, CO--HU. [Brief tabulated information

    Energy Technology Data Exchange (ETDEWEB)

    1979-06-01

    In this compendium each profile of a nuclear facility is a capsule summary of pertinent facts regarding that particular installation. The facilities described include the entire fuel cycle in the broadest sense, encompassing resource recovery through waste management. Power plants and all US facilities have been excluded. To facilitate comparison the profiles have been recorded in a standard format. Because of the breadth of the undertaking some data fields do not apply to the establishment under discussion and accordingly are blank. The set of nuclear facility profiles occupies four volumes; the profiles are ordered by country name, and then by facility code. Each nuclear facility profile volume contains two complete indexes to the information. The first index aggregates the facilities alphabetically by country. It is further organized by category of facility, and then by the four-character facility code. It provides a quick summary of the nuclear energy capability or interest in each country and also an identifier, the facility code, which can be used to access the information contained in the profile.

  16. Sledování průběhu malolaktické fermentace

    OpenAIRE

    Štětkářová, Lucie

    2014-01-01

    Malolactic fermentation (MLF), or malolactic fermentation is a process which converts Malic acid to lactic acid. Made with lactic fermentation bacteria. There are different kinds of lactic acid bacteria -- positive (Oenococcus oeni) and negative (Lactobacillus, Pediococcus). Malolactic fermentation on wine by reducing acidity, improves the stability of microbial and sensory properties of wine. Malolactic fermentation we can perform before the alcoholic fermentation, during alcoholic fermentat...

  17. World Energy Data System (WENDS). Volume VIII. Nuclear facility profiles, CO--HU

    International Nuclear Information System (INIS)

    1979-06-01

    In this compendium each profile of a nuclear facility is a capsule summary of pertinent facts regarding that particular installation. The facilities described include the entire fuel cycle in the broadest sense, encompassing resource recovery through waste management. Power plants and all US facilities have been excluded. To facilitate comparison the profiles have been recorded in a standard format. Because of the breadth of the undertaking some data fields do not apply to the establishment under discussion and accordingly are blank. The set of nuclear facility profiles occupies four volumes; the profiles are ordered by country name, and then by facility code. Each nuclear facility profile volume contains two complete indexes to the information. The first index aggregates the facilities alphabetically by country. It is further organized by category of facility, and then by the four-character facility code. It provides a quick summary of the nuclear energy capability or interest in each country and also an identifier, the facility code, which can be used to access the information contained in the profile

  18. Vliv stimulace silových schopností na rovnováhu

    OpenAIRE

    Škoda, Jan

    2013-01-01

    3 ABSTRACT Title of thesis: Impact of stimulation of power abilities on balance Aim of thesis: Verification of effectiveness of power workouts for stable and unstable supporting surfaces and the impact thereof on balance. Methods: An experimental method was used, with two groups of probands completing a three-month power training programme. The programme included power workouts with balance equipment for the first group and similar power workouts on a stable mat for the second group. The whol...

  19. The role of bioactive substances in controlling foodborne pathogens derived from Metasequoia glyptostroboides Miki ex Hu.

    Science.gov (United States)

    Bajpai, Vivek K; Na, Minkyun; Kang, Sun Chul

    2010-07-01

    In an attempt to isolate bioactive substances, ethyl acetate cone extract of Metasequoia glyptostroboides was subjected to a column chromatographic analysis that resulted in isolation of an abietane type diterpenoid, taxoquinone. Its structure was elucidated by spectroscopic means. In further, taxoquinone showed potential antibacterial effect as diameters of zones of inhibition against foodborne pathogenic bacteria such as Listeria monocytogenes ATCC 19166, Salmonella typhimurium KCTC 2515, Salmonella enteritidis KCTC 2021, Escherichia coli ATCC 8739, E. coli O157:H7 ATCC 43888, Enterobacter aerogenes KCTC2190, Staphylococcus aureus ATCC 6538 and S. aureus KCTC 1916, which were found in the range of 10.6-15.8mm. The minimum inhibitory concentration (MIC) and minimum bactericidal concentration (MBC) values of taxoquinone against the employed bacterial pathogens were found in the range of 62.5-250 and 125-500 microg/ml. Also the compound had strong antibacterial effect on the viable counts of the tested bacteria. Further, scanning electron microscopic study demonstrated potential detrimental effect of taxoquinone on the morphology of E. coli ATCC 8739. These findings indicate that bioactive compound taxoquinone present in M. glyptostroboides could be used as a promising antibacterial agent in food industry to inhibit the growth of certain important foodborne pathogens. 2010 Elsevier Ltd. All rights reserved.

  20. Antibacterial abietane-type diterpenoid, taxodone from Metasequoia glyptostroboides Miki ex Hu.

    Science.gov (United States)

    Bajpai, Vivek K; Kang, Sun Chul

    2010-12-01

    In an attempt to isolate bioactive constituents, ethyl acetate cone extract of Metasequoia glyptostroboides was subjected to a column chromatographic analysis that resulted in isolation of an abietane-type diterpenoid, taxodone. Its structure was elucidated by spectroscopic means. Further, taxodone showed potential antibacterial effect as diameters of zones of inhibition against foodborne pathogenic bacteria, such as Listeria monocytogenes ATCC 19166, Salmonella typhimurium KCTC 2515, S. enteritidis KCTC 2021, Escherichia coli ATCC 8739, E. coli O157:H7 ATCC 43888, Enterobacter aerogenes KCTC 2190, Staphylococcus aureus ATCC 6538 and S. aureus KCTC 1916, were found in the range of 9.4 to 14.2 mm. The minimum inhibitory concentration (MIC) and minimum bactericidal concentration (MBC) values of taxodone against the employed bacterial pathogens were found in the range of 250 to 1000 and 250 to less than 2000 microg/ml, respectively. Also the compound had a strong antibacterial effect on the viable counts of the tested bacteria. These findings indicate that the bioactive compound taxodone present in M. glyptostroboides could be used as an antibacterial agent in food industry to inhibit the growth of certain important foodborne pathogens.

  1. Impacts of elevated ozone on growth and photosynthesis of Metasequoia glyptostroboides Hu et Cheng.

    Science.gov (United States)

    Zhang, Weiwei; Feng, Zhaozhong; Wang, Xiaoke; Niu, Junfeng

    2014-09-01

    One-year-old Metasequoia glyptostroboides seedlings were exposed to non-filtered ambient air (NF) and elevated ozone (E-O3, NF+60 ppb) in open-top chambers for two years. E-O3 accelerated leaf senescence, as indicated by significant decreases in photosynthetic pigment contents with the elongation of O3 exposure. E-O3 significantly affected gas exchange and carboxylation, inducing reductions in light-saturated photosynthesis (Asat), the maximum activity of Rubisco (Vc,max) and the maximum electron transport rate (Jmax). Chl a/b, Vc,max/Jmax and stomatal limitation (l) were not affected. Stomatal conductance (gs) was significantly decreased by E-O3 in the first year, but remained unchanged in the second year. It can be inferred that the decrease in Asat by E-O3 was mainly attributed to the changes in non-stomatal factors. After two years' exposure, E-O3 caused significant decreases in canopy photosynthesis and leaf mass per area, and a significant increase in the number of branches, but induced slight, not significant decreases in growth and biomass. Therefore, it can be concluded that the carbon accumulation of the species M. glyptostroboides could be negatively affected after long-term exposure to high O3 concentration. Copyright © 2014 Elsevier Ireland Ltd. All rights reserved.

  2. Anatomical studies on the development of Metasequoia glyptostroboides Hu et Cheng wood

    Directory of Open Access Journals (Sweden)

    Alina Hejnowicz

    2015-01-01

    Full Text Available Variability of anatomical characters within a 15 year old stem is presented by the method of contour lines, where against a schematic longitudinal section of a stem points corresponding to the same values for a character are joined by lines, similarly as altitudes in cartography. The method permits prediction of future trends in character changes. It was thus established that tracheid dimensions and diameter of bordered pits in early wood tracheids increase with age of tree and do not reach maximal values before the 15th year. The annual ring width and the height of the rays attain maximal values before the 15th year while the dimensions of ray cells and the percentage of late wood reach almost constant values during the first year or two.

  3. Temporal and spatial characteristics of male cone development in Metasequoia glyptostroboides Hu et Cheng.

    Science.gov (United States)

    Jin, Biao; Tang, Liang; Lu, Yan; Wang, Di; Zhang, Min; Ma, Jiuxia

    2012-12-01

    Metasequoia glyptostroboides, a famous relic species of conifer that survived in China, has been successfully planted in large numbers across the world. However, limited information on male cone development in the species is available. In this study, we observed the morphological and anatomical changes that occur during male cone development in M. glyptostroboides using semi-thin sections and scanning electron microscopy. The male cones were borne oppositely on one-year-old twigs that were mainly located around the outer and sunlit parts of crown. Male cones were initiated from early September and shed pollen in the following February. Each cone consisted of spirally arranged microsporophylls subtended by decussate sterile scales, and each microsporophyll commonly consisted of three microsporangia and a phylloclade. The microsporangial wall was composed of an epidermis, endothecium, and tapetum. In mid-February, the endothecium and tapetum layers disintegrated, and in the epidermal layer the cell walls were thickened with inner protrusions. Subsequently, dehiscence of the microsporangia occurred through rupturing of the microsporangial wall along the dehiscence line. These results suggest that the structure, morphology, architecture and arrangement of male cones of M. glyptostroboides are mainly associated with the production, protection and dispersal of pollen for optimization of wind pollination.

  4. Reporting of Human Genome Epidemiology (HuGE association studies: An empirical assessment

    Directory of Open Access Journals (Sweden)

    Gwinn Marta

    2008-05-01

    Full Text Available Abstract Background Several thousand human genome epidemiology association studies are published every year investigating the relationship between common genetic variants and diverse phenotypes. Transparent reporting of study methods and results allows readers to better assess the validity of study findings. Here, we document reporting practices of human genome epidemiology studies. Methods Articles were randomly selected from a continuously updated database of human genome epidemiology association studies to be representative of genetic epidemiology literature. The main analysis evaluated 315 articles published in 2001–2003. For a comparative update, we evaluated 28 more recent articles published in 2006, focusing on issues that were poorly reported in 2001–2003. Results During both time periods, most studies comprised relatively small study populations and examined one or more genetic variants within a single gene. Articles were inconsistent in reporting the data needed to assess selection bias and the methods used to minimize misclassification (of the genotype, outcome, and environmental exposure or to identify population stratification. Statistical power, the use of unrelated study participants, and the use of replicate samples were reported more often in articles published during 2006 when compared with the earlier sample. Conclusion We conclude that many items needed to assess error and bias in human genome epidemiology association studies are not consistently reported. Although some improvements were seen over time, reporting guidelines and online supplemental material may help enhance the transparency of this literature.

  5. Genetic factors affecting statin concentrations and subsequent myopathy: a HuGENet systematic review

    Science.gov (United States)

    Canestaro, William J.; Austin, Melissa A.; Thummel, Kenneth E.

    2015-01-01

    Statins, 3-hydroxy-3-methyl-glutaryl-coenzyme A reductase inhibitors, have proven efficacy in both lowering low-density-lipoprotein levels and preventing major coronary events, making them one of the most commonly prescribed drugs in the United States. Statins exhibit a class-wide side effect of muscle toxicity and weakness, which has led regulators to impose both dosage limitations and a recall. This review focuses on the best-characterized genetic factors associated with increased statin muscle concentrations, including the genes encoding cytochrome P450 enzymes (CYP2D6, CYP3A4, and CYP3A5), a mitochondrial enzyme (GATM), an influx transporter (SLCO1B1), and efflux transporters (ABCB1 and ABCG2). A systematic literature review was conducted to identify relevant research evaluating the significance of genetic variants predictive of altered statin concentrations and subsequent statin-related myopathy. Studies eligible for inclusion must have incorporated genotype information and must have associated it with some measure of myopathy, either creatine kinase levels or self-reported muscle aches and pains. After an initial review, focus was placed on seven genes that were adequately characterized to provide a substantive review: CYP2D6, CYP3A4, CYP3A5, GATM, SLCO1B1, ABCB1, and ABCG2. All statins were included in this review. Among the genetic factors evaluated, statin-related myopathy appears to be most strongly associated with variants in SLCO1B1. PMID:24810685

  6. Paraneoplastic neurological syndromes with anti-hu antibodies : Pathogenesis and treatment

    NARCIS (Netherlands)

    A.H.C. de Jongste (Arjen)

    2015-01-01

    markdownabstract__Abstract__ Paraneoplastic neurological syndromes (PNS) are remote effects of cancer that are neither caused by invasion of the tumor or its metastasis, nor by infection, ischemia, metabolic and nutritional deficits, surgery or other forms of tumor treatment.1 PNS cause severe

  7. HuRECA: Human Reliability Evaluator for Computer-based Control Room Actions

    International Nuclear Information System (INIS)

    Kim, Jae Whan; Lee, Seung Jun; Jang, Seung Cheol

    2011-01-01

    As computer-based design features such as computer-based procedures (CBP), soft controls (SCs), and integrated information systems are being adopted in main control rooms (MCR) of nuclear power plants, a human reliability analysis (HRA) method capable of dealing with the effects of these design features on human reliability is needed. From the observations of human factors engineering verification and validation experiments, we have drawn some major important characteristics on operator behaviors and design-related influencing factors (DIFs) from the perspective of human reliability. Firstly, there are new DIFs that should be considered in developing an HRA method for computer-based control rooms including especially CBP and SCs. In the case of the computer-based procedure rather than the paper-based procedure, the structural and managerial elements should be considered as important PSFs in addition to the procedural contents. In the case of the soft controllers, the so-called interface management tasks (or secondary tasks) should be reflected in the assessment of human error probability. Secondly, computer-based control rooms can provide more effective error recovery features than conventional control rooms. Major error recovery features for computer-based control rooms include the automatic logic checking function of the computer-based procedure and the information sharing feature of the general computer-based designs

  8. Assessing the People’s Liberation Army in the Hu Jintao Era

    Science.gov (United States)

    2014-04-01

    before China’s transportation and communications infrastructure was modernized. However, with cell phones, computers, the Internet, and...physical stamina , and political indoctrination.80 But there is a limit to the military effectiveness of political mobiliza- tion. Political...air missiles (SAM) imbedded in eight re- volver-type six- cell vertical launching systems (VLS) as with 052C, the Type 052D has two canister-type 32

  9. Hu Hong’ (bad thing): parental perceptions of teenagers’ sexuality in urban Vietnam

    OpenAIRE

    Lan Anh Thi Do; Pimpawun Boonmongkon; Seung Chun Paek; Thomas E. Guadamuz

    2017-01-01

    Abstract Background Teenagers under 18 years old in Vietnam are considered as minors who usually lack the autonomy to make decisions. They are also sometimes viewed as contributors to social evils including crime, violence and substance use. Moreover, most Vietnamese teenagers have unsafe sex before marriage. The objective of this study is to explore the parental perceptions relating to their teenagers’ sexuality, particularly the social and cultural forces, that may hinder access to sexualit...

  10. vénérolo ogie du CH HU Ibn

    African Journals Online (AJOL)

    raoul

    Le service de Dermatologie de l'Hôpital Ibn Sina a été créé en 1969. ... infections virales (n: 13) avec 8 nouveaux cas de SIDA, infections fongiques (n: 10) y compris 8 cas ... L'histoire et la renommée de l'hôpital Ibn Sina font de cet établissement, à côté des ... Les maladies de système sont dominées par le lupus qui est.

  11. Final technical report. 1998 HU CFRT summer fusion high school workshop

    International Nuclear Information System (INIS)

    Ali, Halima; Punjabi, Alkesh

    1999-01-01

    The center conducted its third High School Summer Fusion Science Workshop in Summer 1998. The center had only three faculty mentors available only for a part of Summer 1998, The center accepted four scholars in this workshop, Prof. Halima Ali coordinated this workshop. Each student was assigned to a research mentor according to the student's interest in a specific research area and problem. In the workshop in the center, the students received instructions and training in the basics of energy, plasma and fusion sciences. They also received one-on-one instructions and training by their mentors to further their understanding of the subject and to introduce to relevant concepts such as magnetic confinement fusion, tokamaks, diverters and area-preserving maps

  12. HuMiChip: Development of a Functional Gene Array for the Study of Human Microbiomes

    Energy Technology Data Exchange (ETDEWEB)

    Tu, Q.; Deng, Ye; Lin, Lu; Hemme, Chris L.; He, Zhili; Zhou, Jizhong

    2010-05-17

    Microbiomes play very important roles in terms of nutrition, health and disease by interacting with their hosts. Based on sequence data currently available in public domains, we have developed a functional gene array to monitor both organismal and functional gene profiles of normal microbiota in human and mouse hosts, and such an array is called human and mouse microbiota array, HMM-Chip. First, seed sequences were identified from KEGG databases, and used to construct a seed database (seedDB) containing 136 gene families in 19 metabolic pathways closely related to human and mouse microbiomes. Second, a mother database (motherDB) was constructed with 81 genomes of bacterial strains with 54 from gut and 27 from oral environments, and 16 metagenomes, and used for selection of genes and probe design. Gene prediction was performed by Glimmer3 for bacterial genomes, and by the Metagene program for metagenomes. In total, 228,240 and 801,599 genes were identified for bacterial genomes and metagenomes, respectively. Then the motherDB was searched against the seedDB using the HMMer program, and gene sequences in the motherDB that were highly homologous with seed sequences in the seedDB were used for probe design by the CommOligo software. Different degrees of specific probes, including gene-specific, inclusive and exclusive group-specific probes were selected. All candidate probes were checked against the motherDB and NCBI databases for specificity. Finally, 7,763 probes covering 91.2percent (12,601 out of 13,814) HMMer confirmed sequences from 75 bacterial genomes and 16 metagenomes were selected. This developed HMM-Chip is able to detect the diversity and abundance of functional genes, the gene expression of microbial communities, and potentially, the interactions of microorganisms and their hosts.

  13. HuRoME: entorno de modelado para el software de un robot humanoide

    OpenAIRE

    Inglés Romero, Juan Francisco

    2010-01-01

    Actualmente, el Desarrollo de Software Dirigido por Modelos (DSDM) representa uno de los paradigmas de desarrollo software más en boga en el ámbito de la Ingeniería del Software. Las tecnologías en torno a este nuevo enfoque ofrecen una aproximación prometedora para superar las limitaciones expresivas de los lenguajes de programación de tercera generación, permitiendo a los diseñadores describir sistemas cada vez más complejos de manera más simple, gracias a la utilización de conceptos propi...

  14. Hüseyin Nail Kubali and Durkheim’s Professional ethics and civic morals

    Directory of Open Access Journals (Sweden)

    Ivan Strenski

    2006-01-01

    Full Text Available A swirl of puzzles surrounds a work of Émile Durkheim’s that Jonathan Z. Smith claims is the ‘single most provocative treatment of’ the idea of the sacred in the Durkheimian corpus – Professional Ethics and Civic Morals. Why, one asks, was Durkheim’s work first published in Turkey, especially when the lectures that gave rise to this volume had been delivered in France in the early years of the twentieth century? Of what particular importance was Durkheim for modern Turkish thinkers, and what kinds of thinkers might they be? And, what of this particular work of Durkheim’s? What special purpose, moreover, might have been served by publishing it in Turkey when it was – in 1950? Why was the volume edited by (and who was? Hüseyin Nail Kubali? What were his motives – both of a scientific kind or of a wider social or political sort? These are the questions that are addressed in this article. As readers will discover, in answering them, a nest of hidden themes is uncovered – a nest that few readers – even those who know the Durkheim corpus – will have anticipated. Not only are Durkheimian interpretations of religion at issue, but also the particular bearing of Durkheimianism on modern Turkey. This link with modern Turkey, in turn, brings to the surface many of the controversial questions now vexing the European Union as it ponders the possibility of Turkish membership of the EU – questions of human rights, civil society, the rule of law, the relation of religion and state, to name just the most relevant to the content of this article.

  15. Further considerations on the phonetics and morphologizations of Hi and Hu̯ in Indoeuropean

    Directory of Open Access Journals (Sweden)

    Francisco R. Adrados

    1981-12-01

    Full Text Available The author puts up to date his ideas on Indo-European Laryngeals, which have been published from 1956 onwards. He takes into account new materials as well as new proposals about the most difficult points. He starts exposing some General Phonetics facts which favor his theory and then he offers some new evidence from Anatolian languages which enlarge our knowledge of Indo-European Laryngeals. Then he explains minutely the different treatments of Laryngeals in Post-Anatolian Indo-European, arriving frequently to more economical and simple solutions. The paper ends with a synopsis of the treatments of the six Laryngeals (three with a palatal appendix and three with a labial one in Indo-European.

  16. AIR PRESSURE and Other Data from SHI YAN 3 From Antarctic and Others from 19921109 to 19930224 (NODC Accession 9600025)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The accession contains Surface Wave data and Sea Surface Temperature (SST) data collected as part of Tropical Ocean Global Atmosphere (TOGA) and Coupled...

  17. "But at school … I became a bit shy": Korean immigrant adolescents' discursive participation in science classrooms

    Science.gov (United States)

    Ryu, Minjung

    2013-09-01

    In reform-based science curricula, students' discursive participation is highly encouraged as a means of science learning as well as a goal of science education. However, Asian immigrant students are perceived to be quiet and passive in classroom discursive situations, and this reticence implies that they may face challenges in discourse-rich science classroom learning environments. Given this potentially conflicting situation, the present study aims to understand how and why Asian immigrant students participate in science classroom discourse. Findings from interviews with seven Korean immigrant adolescents illustrate that they are indeed hesitant to speak up in classrooms. Drawing upon cultural historical perspectives on identity and agency, this study shows how immigrant experiences shaped the participants' othered identity and influenced their science classroom participation, as well as how they negotiated their identities and situations to participate in science classroom and peer communities. I will discuss implications of this study for science education research and science teacher education to support classroom participation of immigrant students.

  18. The Shi'ites, the West and the Future of Democracy: Reframing Political Change in a Religio-secular World

    Directory of Open Access Journals (Sweden)

    John A Rees

    2006-02-01

    Full Text Available The present article critically reviews Paul McGeough’s important analysis of the most recent Iraq war within a broader consideration of secular-religious relations in international affairs. The thesis of Mission Impossible: The Sheikhs, the US and the Future of Iraq (2004 can be summarised around two ideas: that the US strategy in Iraq was flawed because it wilfully bypassed the traditional power structures of Iraqi society; and that these structures, formed around the tribe and the mosque, are anti-democratic thus rendering attempts at democratisation impossible. The article affirms McGeough’s argument concerning the inadequacy of the US strategy, but critically examines the author’s fatalism toward the democratic capacity of Iraqi structures, notably the structure of the mosque. By broadening the notion of democracy to include religious actors and agendas, and by an introductory interpretation of the Shi’ite community as vital players in an emerging Iraqi democracy, the article attempts to deconstruct the author’s secularist view that the world of the mosque exists in a ‘parallel universe’ to the liberal democratic West. Reframing the Shi’ites as essential actors in the democratic project thus situates political discourse in a ‘religio-secular world’ and brings the ‘other worlds’ of religion and secularism together in a sphere of interdependence. Such an approach emphasises the importance of post-secular structures in the discourses on democratic change.

  19. SHiP: a new facility with a dedicated detector to search for new long-lived neutral particles

    CERN Document Server

    AUTHOR|(SzGeCERN)711794

    2015-01-01

    SHIP is a new fixed target experiment whose Technical Proposal has been recently submitted to the CERN SPS Committee. In its initial phase, the 400 GeV proton beam extracted from the SPS will be dumped on a heavy target with the aim of integrating 2 × 1020 pot in 5 years. A dedicated detector, based on a long empty decay volume followed by a spectrometer and particle identi- fication detectors, will allow probing a variety of models with light long-lived exotic particles and masses below O(10) GeV/c2. The main focus will be the physics of the so-called Hidden Portals, i.e. search for Dark Photons, light scalars and pseudo-scalars, and Heavy Neutrinos. The sensitivity to Heavy Neutrinos will allow for the first time to probe, in the mass range between the kaon and the D meson mass, a coupling range for which Baryogenesis and active neutrino masses could also be explained. Direct detection of light and long-lived SUSY particles, such as RPV neutralinos and pseudo-Dirac gauginos could also be performed in an un...

  20. Once bitten, twice shy? Medically-attended injuries can sensitise parents to children's risk of injuries on playgrounds.

    Science.gov (United States)

    Morrongiello, B A; Howard, A W; Rothman, L; Sandomierski, M

    2009-02-01

    To compare risk perceptions of parents whose child sustained a medically attended playground injury (cases) with those of parents whose child had not (controls) to address two questions. Does having a child experience a medically attended injury: (1) sensitise parents to children's injury vulnerability and severity; (2) influence parents' appraisal of the injury mechanism (child's behaviour), attributions for injuries or beliefs about strategies for prevention? Each case-control parent dyad was assigned to one of two conditions: (1) being presented with 10 common injury-risk playground behaviours specific to the equipment on which their child had been hurt, and asked to appraise injury vulnerability and severity; or (2) being presented with scenarios about playground injuries that varied in severity but were all based on the same child behaviour, and asked questions about this behaviour, attributions for injury and strategies for prevention. The results support the occurrence of a sensitisation process. Compared with control parents, case parents showed higher ratings of injury severity and children's vulnerability to injury, made fewer attributions for injuries to bad luck, and endorsed a greater diversity of prevention strategies, including parent (closer supervision), child (teaching rules about safe play on playgrounds) and environmental (modifications to playgrounds). A child's medically attended injury can create a "teachable moment" for the parent. Linking injury-prevention programming to this teachable moment may increase the likelihood of evoking changes in parental supervisory behaviour and their setting of rules limiting their child's risk behaviours to reduce the occurrence of childhood injury.

  1. Shy and bold great tits (Parus major): body temperature and breath rate in response to handling stress

    NARCIS (Netherlands)

    Carere, C.; Van Oers, K.

    2004-01-01

    A standard handling protocol was used to test the hypothesis that boldness predicts stress responsiveness in body temperature and breath rate. Great tit (Parus major) nestlings were taken from the field, hand reared until independence, and their response to a novel object was assessed. At the age of

  2. Shy and bold great tits (Parus major) : body temperature and breath rate in response to handling stress

    NARCIS (Netherlands)

    Carere, C; van Oers, K

    2004-01-01

    A standard handling protocol was used to test the hypothesis that boldness predicts stress responsiveness in body temperature and breath rate. Great tit (Parus major) nestlings were taken from the field, hand reared until independence, and their response to a novel object was assessed. At the age of

  3. Turning shy on a winter's day : Effects of season on personality and stress response in Microtus arvalis

    NARCIS (Netherlands)

    Gracceva, Giulia; Herde, Antje; Groothuis, Ton G. G.; Koolhaas, Jaap M.; Palme, Rupert; Eccard, Jana A.

    Animal personalities are by definition stable over time, but to what extent they may change during development and in adulthood to adjust to environmental change is unclear. Animals of temperate environments have evolved physiological and behavioural adaptations to cope with the cyclic seasonal

  4. Direct determination of absolute configuration: a vibrational circular dichroism study on dimethyl-substituted phenyloxiranes synthesized by Shi epoxidation

    DEFF Research Database (Denmark)

    Fristrup, Peter; Lassen, Peter Rygaard; Tanner, David Ackland

    2008-01-01

    obtained using DFT/B3LYP calculations, and the differences between experiment and theory are discussed. The absolute configuration at the benzylic position was established as being (R), (S) and (R) for the cis, trans and geminal dimethylsubstituted phenyloxiranes, respectively. In all three cases...

  5. Regional new energy vision formulation for Nichinan City. Fiscal 2001 report; 2001 nendo Nichinan shi chiiki shin energy vision sakuteisho

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2002-03-01

    For promoting the introduction of new energy and for elevating people's consciousness of such in Nichinan City, Miyazaki Prefecture, surveys and studies were conducted concerning the energy demand of the city, the amount of new energy resources in existence, and new energy introduction plans, and then a vision was formulated. The city's energy demand is estimated to be approximately 4,028-million MJ/year, which includes 46% for the transportation sector, 30% for the people's livelihood-related business sector, 17% for the residential sector, and 7% for the industrial sector. The energy demand is covered 62% by oil-based fuels and 30% by electric power. Projects discussed for new energy introduction included the introduction of photovoltaic power into a lifelong learning center, a comprehensive center for health and welfare, and primary schools; introduction of solar hot water supply systems into school meal providing facilities; introduction of medium-size wind power systems (five systems); medium- or small-scale hydroelectric power generation on the Sakatani river; use of street light lighted by photovoltaic/wind hybrid power systems; introduction of clean energy vehicles; power generation utilizing livestock excrement; introduction of photovoltaic, hydroelectric, and methane gas power generation into a sewage treatment plant; and the use of RPF (refuse paper and plastic fuel) at the Nichinan plant of Oji Paper Co., Ltd. (NEDO)

  6. Temperament, disordered attachment and parental sensitivity in foster care: Differential findings on attachment security for shy children

    NARCIS (Netherlands)

    de Schipper, J.C.; Oosterman, M.; Schuengel, C.

    2012-01-01

    In a foster care sample, the moderating effect of temperamental shyness on the association between parental sensitivity and attachment quality was tested. The foster parents of 59 foster children (age M=57 months, SD=16.4) filled out the Child Behavior Questionnaire. To control for confounds,

  7. Quality control for the equipment of Nuclear medicine: experience of the H.U. de la Princesa; Control de calidad del equipamiento en Medicina Nuclear. Experiencia enel H.U. de la Princesa

    Energy Technology Data Exchange (ETDEWEB)

    Espana, M.L.; Gracia, A.; Prieto, C.; Lopez F, P. [Servicio de ProteccionRadiologica. Hospital Universitario de la Princesa C/ Diego de Leon 62, 28006Madrid (Spain)

    1998-12-31

    The quality control of the equipment used in a nuclear medicine service is a fundamental aspect in the Quality Assurance Program that in the present time is starting in our hospital. the objective of this work is to present the internal protocol used, its problematic associated with its starting, and the results obtained in the quality control as of the gamma camera as of the activimeter. In addition to the equipment own to the nuclear medicine service it has been used a Cs-137 source and puppets for several purposes. The results obtained demonstrated the stability of the controlled parameters which has led us to a restating of the established periodicities in our internal protocol, over all for some constancy tests. (Author)

  8. Oxidation of M252 but not M428 in hu-IgG1 is responsible for decreased binding to and activation of hu-FcγRIIa (His131).

    Science.gov (United States)

    Cymer, Florian; Thomann, Marco; Wegele, Harald; Avenal, Cecile; Schlothauer, Tilman; Gygax, Daniel; Beck, Hermann

    2017-11-01

    Oxidation of monoclonal therapeutic antibodies (mAbs) can affect binding to Fc-receptors and potentially influence pharmacokinetics or effector functions like e.g. antibody dependent cellular phagocytosis (ADCP). Recently, it has been demonstrated that binding to FcγRIIa (H131) is affected by methionine oxidation of the Fc-portion but it is currently unknown which methionine is responsible for decreased binding. We separated an oxidized IgG1 monoclonal antibody based on the oxidation state of methionine 252 and analyzed fractionated material in receptor binding experiments as well as in functional (cell-based) assays. Although the unfractionated mixture demonstrated weaker interaction/activation of the receptor, differently oxidized isolated subspecies can lead both to stronger as well as weaker binding and activation of the histidine variant of FcγRIIa. Copyright © 2017 The Authors. Published by Elsevier Ltd.. All rights reserved.

  9. Los nuevos centros comerciales y su impacto económico y social en Huánuco - 2015

    OpenAIRE

    Meza Segura, Dieter Anibal

    2015-01-01

    El recurso natural más valioso y más escaso es el tiempo, porque no es renovable, es irreparable e irrecuperable: una vez que usted desperdicia desde un segundo hasta un año, un lustro o una década, jamás podrá recuperarlos, sólo lamentarse sobre lo que usted pudo haber hecho con ellos, sin que consiga alivio a su sentido de pérdida, error y desperdicio. Eso es lo principal que proporciona un centro comercial: maximiza el uso productivo del tiempo: le proporciona a las personas—desde un ni...

  10. Quality control for the equipment of Nuclear medicine: experience of the H.U. de la Princesa

    International Nuclear Information System (INIS)

    Espana, M.L.; Gracia, A.; Prieto, C.; Lopez F, P.

    1998-01-01

    The quality control of the equipment used in a nuclear medicine service is a fundamental aspect in the Quality Assurance Program that in the present time is starting in our hospital. the objective of this work is to present the internal protocol used, its problematic associated with its starting, and the results obtained in the quality control as of the gamma camera as of the activimeter. In addition to the equipment own to the nuclear medicine service it has been used a Cs-137 source and puppets for several purposes. The results obtained demonstrated the stability of the controlled parameters which has led us to a restating of the established periodicities in our internal protocol, over all for some constancy tests. (Author)

  11. Study of effect of different CT scanning protocols on HU variation and their impact on TPS calculations

    International Nuclear Information System (INIS)

    Mahur, Mamta; Sharma, Richa; Sasindaran, M.; Singh, Anshu; Gedam, Varsha; Negi, P.S.; Grover, R.K.

    2016-01-01

    Computer tomographic (CT) scans are used to correct for tissue inhomogeneties in radiotherapy treatment planning. In order to guarantee a precise treatment, it is important to obtain the relationship between CT Hounsfield units and relative electron densities, which is the basic input for radiotherapy planning systems which consider tissue heterogeneities. The purpose of this study is to investigate the influence of different CT scan parameters (kVp, mAs) on uniformity of CT numbers versus relative electron density (HURED) curves and their different dosimetric impact

  12. Convergent syntheses of HuPrP106-126 (difficult sequence) using native chemical ligation and desulfurization/deselenization

    Czech Academy of Sciences Publication Activity Database

    Šebestík, Jaroslav; Šafařík, Martin; Zawada, Zbigniew; Hlaváček, Jan

    2010-01-01

    Roč. 16, S1 (2010), s. 86-86 ISSN 1075-2617. [European Peptide Symposium /31./. 05.09.2010-09.09.2010, Copenhagen] R&D Projects: GA ČR GA203/07/1517 Institutional research plan: CEZ:AV0Z40550506 Keywords : prion * ligation * convergent synthesis Subject RIV: CC - Organic Chemistry

  13. Laudatio for E. C. G. SUDARSHAN On his 75th Birth Day. Jaca (HU), Spain, September 18, 2006

    International Nuclear Information System (INIS)

    Boya, L J

    2007-01-01

    The scientific career of E. C. G. Sudarshan is reported, with some biographical notes to frame the results. His research and teaching achievements span more than fifty years, and he has been Professor of Physics at the University of Texas at Austin since 1969, where he is still quite active and taking up students. Symmetry, in its multiple aspects, is perhaps the feature more persistent in his whole work; also the complex relations between classical and quantum realities permeates most of his mature-period papers

  14. Mammal Hunting in the Special Use Zone and Buffer Tingo Maria National Park, Huánuco, Peru

    Directory of Open Access Journals (Sweden)

    Fiorella Nasha Gonzales Guillén

    2014-12-01

    Full Text Available Between the months of August to November 2011 were conducted 42 semi-structured interviews to assess the hunting of mammals in areas of special purpose (ZUE and buffer (ZA National Park Tingo María surveys. The results indicate that 43% of the population practiced hunting as a secondary activity, the main smallholder agriculture. The methodology used for hunting are the "tramperas" while the hunting is often 2-3 times a month. Hunting is more common after the wet season, it is selective and responds to the taste of meat that an economic need. Among the most hunted mammals include agouti Dasyprocta sp. and picuro Cuniculus paca, while animals higher biomass as the peccary Pecari tajacu are rare in the area, so it is recommended to increase the control of hunting of vulnerable species in the villages which are inside and in the vicinity of the Park.

  15. Phase II study of Gleevec® plus hydroxyurea (HU) in adults with progressive or recurrent meningioma

    OpenAIRE

    Reardon, David A.; Norden, Andrew D.; Desjardins, Annick; Vredenburgh, James J.; Herndon, James E.; Coan, April; Sampson, John H.; Gururangan, Sridharan; Peters, Katherine B.; McLendon, Roger E.; Norfleet, Julie A.; Lipp, Eric S.; Drappatz, Jan; Wen, Patrick Y.; Friedman, Henry S.

    2011-01-01

    We prospectively evaluated the efficacy and safety of imatinib plus hydroxyurea in patients with progressive/recurrent meningioma. A total of 21 patients with progressive/recurrent meningioma were enrolled in this dual center, single-arm, phase II trial. All patients received 500 mg of hydroxyurea twice a day. Imatinib was administered at 400 mg/day for patients not on CYP3A enzyme inducing anti-epileptic drugs (EIAEDs) and at 500 mg twice a day for patients on EIAEDs. The primary endpoint wa...

  16. Phase II study of Gleevec® plus hydroxyurea (HU) in adults with progressive or recurrent meningioma.

    Science.gov (United States)

    Reardon, David A; Norden, Andrew D; Desjardins, Annick; Vredenburgh, James J; Herndon, James E; Coan, April; Sampson, John H; Gururangan, Sridharan; Peters, Katherine B; McLendon, Roger E; Norfleet, Julie A; Lipp, Eric S; Drappatz, Jan; Wen, Patrick Y; Friedman, Henry S

    2012-01-01

    We prospectively evaluated the efficacy and safety of imatinib plus hydroxyurea in patients with progressive/recurrent meningioma. A total of 21 patients with progressive/recurrent meningioma were enrolled in this dual center, single-arm, phase II trial. All patients received 500 mg of hydroxyurea twice a day. Imatinib was administered at 400 mg/day for patients not on CYP3A enzyme inducing anti-epileptic drugs (EIAEDs) and at 500 mg twice a day for patients on EIAEDs. The primary endpoint was progression-free survival at 6 months (PFS-6) and secondary endpoints were safety, radiographic response rate, and overall survival (OS). Best radiographic response was stable disease and was observed in 14 patients (67%). PFS-6 for all patients, those with grade I tumors (n = 8) and those with grade II or III tumors (n = 13) was 61.9, 87.5 and 46.2%, respectively. Patients with grade II or III tumors had poorer PFS and OS than those with grade I tumors, (P = 0.025 and P = 0.018) respectively. The only grade 3 or greater adverse event occurring in ≥ 10% of patients was anemia (10%). Imatinib plus hydroxyurea is well tolerated among patients with meningioma but has modest anti-tumor activity for this indication.

  17. Introduction to Computational Chemistry: Teaching Hu¨ckel Molecular Orbital Theory Using an Excel Workbook for Matrix Diagonalization

    Science.gov (United States)

    Litofsky, Joshua; Viswanathan, Rama

    2015-01-01

    Matrix diagonalization, the key technique at the heart of modern computational chemistry for the numerical solution of the Schrödinger equation, can be easily introduced in the physical chemistry curriculum in a pedagogical context using simple Hückel molecular orbital theory for p bonding in molecules. We present details and results of…

  18. Konsep Ketuhanan (T’ien dan Relevansinya dengan Pembentukan Etos Kerja dalam Ajaran Kong Hu Cu (Konfusius

    Directory of Open Access Journals (Sweden)

    Nazwar Nazwar

    2016-12-01

    Full Text Available Artikel ini membahas konsep Ketuhanan Konfusius yang berkaitan dengan etika kerja para penganutnya. Konsep ketuhanan yang dianalisa berdasar pada perspektif Filsafat, kemudian ditarik kepada realita tindakan sosial penganut ajaran Konfusius, dengan menggunakan data yang diperoleh berupa semangat kerja dan pemenuhan kebutuhan hidup para penganut pandangan hidup ini. Berdasarkan hasil penelitian, ditemukan bahwa konsep ketuhanan yang terdapat dalam ajaran Konfusius adalah paradigma fungsional. Dalam keyakinan tersebut, relasi antara Tuhan dan manusia didasarkan pada nilai fungsi. Tuhan diyakini berdasar pada peranannya terhadap kehidupan manusia. Begitupun sebaliknya, manusia diyakini berperan dalam pemenuhan keinginan Tuhan. Sehingga dalam ibadahnya yang paling menonjol adalah ritual korban. Semakin banyak korban yang dipersembahkan, maka kehidupanpun akan semakin subur dan makmur. Berdasarkan paradigma demikian, para penganut Konfusius kemudian mempunyai semangat kerja tinggi. Dengan tujuan selain  pemenuhan kebutuhan hidup, juga merupakan usaha pemenuhan kebutuhan spiritual dalam rangka ibadah kepada T’ien (Tuhan. This article discusses the concept of God Confucius relating to the work ethic of its adherents. The concept of God that is analyzed based on the perspective of philosophy, then pulled to the reality of social action adherents of Confucianism, using the data obtained in the form of morale and subsistence adherents of this view of life. Based on this research, it was found that the concept of God contained in the teachings of Confucius is the functional paradigm. In that belief, the relationship between God and man is based on the value of the function. God is believed, based on its role in human life. Vice versa, humans are believed to play a role in the fulfillment of God's will. Thus, in the worship of the most prominent is the ritual sacrifice. The more sacrifices be offered, the more fertile and prosperous life will be. Based on such a paradigm, the Confucians then have a high morale. For purposes other than the needs of life, is also a spiritual business needs in order to the worship to T'ien (God.

  19. Synergistic effect of nisin and cone essential oil of Metasequoia glyptostroboides Miki ex Hu against Listeria monocytogenes in milk samples.

    Science.gov (United States)

    Yoon, Jung In; Bajpai, Vivek K; Kang, Sun Chul

    2011-01-01

    This study was undertaken to evaluate the effect of nisin and cone essential oil of Metasequoia glyptostroboides against Listeria monocytogenes ATCC 19116 inoculated in whole (8%), low (1%) and skim (no fat content) milks. Essential oil at the concentrations of 2% and 5% revealed strong antilisterial effect against L. monocytogenes ATCC 19116 in all categories of milks. Nisin at the concentrations of 250 and 500 IU/ml displayed a remarkable antilisterial effect as compared to the control group. Also, the synergistic combinations of cone essential oil (1% and 2%) and nisin (62.5, 125, 250 and 500 IU/ml) had a remarkable antilisterial activity in all categories of whole, low and skim milks after 14 days. Results of this study indicate that the cone essential oil of M. glyptostroboides might be a useful candidate for using in food industry to control the growth of pathogenic microorganisms. Copyright © 2010 Elsevier Ltd. All rights reserved.

  20. Profile of Patients of the Auditory Health of the State of Santa Catarina Served at HU-UFSC

    Directory of Open Access Journals (Sweden)

    Dimatos, Oscar Cardoso

    2011-01-01

    Full Text Available Introduction: Hearing is one of the essential functions for the development of language and its deficiency may lead to several consequences. Objective: To describe the profile of patients of the Hearing Health Program of the State of Santa Catarina attended at the College Hospital of the Federal University of Santa Catarina. Method:We performed a retrospective study with the patients with hearing aid indication attended in the years 2007 and 2008. They were divided into 2 groups: children ( 18 years. We assessed the following: age, sex, loss type and degree, duration, co-morbidity and probable etiology. Results: 304 reports were reviewed, 10.2% of the children group and 80.8% of the adult group. In the children group, the mean age was of 7.7±5,4 years, with 58.06% boys and 41.94% girls, and in the adult group the mean age was of 61±16 years, with 52.38% women and 47.62% men. The neurosensorial hearing loss was found more frequently in both groups. In the children group, the severe degree loss was more frequent, and in the adult group, the moderate and moderate to severe degrees were more frequent. The main etiologies were genetic/unknown causes in the children group and presbycusis in the adults group. Conclusion:In the children group, most was formed by boys with neurosensorial loss of light and severe degrees, duration > 1 year and without co-morbidities. In the adult group, most was formed by women with neurosensorial loss of moderate and moderate-severe degrees, duration > 5 year and with co-morbidities.

  1. Význam vytrvalostního běhu v evoluci člověka

    OpenAIRE

    Hola, Tomáš

    2016-01-01

    Human evolution and the evolution of our appearance in time is a research subject for a long time. This work summarizes existing studies, opinions and knowledge about possible importance of endurance running in the human evolution. This work analyzes possible benefits of the orientation on the endurance running and adaptations that are pointing on a possibility of the orientation on the endurance running by early Homo. In the first part of my work I will focus on the possible use of endurance...

  2. Vliv intenzivní fyzioterapie na nadváhu a obezitu u osob 40-50 let

    OpenAIRE

    ILLOVÁ, Lenka

    2014-01-01

    The topic of my bachelor thesis is Effect of intensive physiotherapy on overweight and obesity in people from 40 to 50 years. Obesity is severe illness quickly becoming a heavy problem in the society. In spite of this, a little emphasis is put on monitoring and solving the increasing number of overweight and obese people. In my opinion it is a hot issue considering the incidence of obesity is increasing, and occurring in countries which have not been affected so far. The theoretical part deal...

  3. Les phénoloxydases chez l’huître creuse Crassostrea gigas : biomarqueurs potentiels de stress environnemental

    OpenAIRE

    Luna Acosta , Andrea

    2010-01-01

    The Pacific oyster Crassostrea gigas is the leading aquaculture product at the worldwide level. However, massive summer mortalities affect dramatically cultivated and natural oyster populations, especially at young life stages. These events could be linked to an unbalance between the different actors of the triad host – pathogen agent – environment, which could favour a weakening of defence mechanisms in the host, and consequently, the emergence and/or increase of diseases. Among environmenta...

  4. La escritura huérfana: Miguel Romero Esteo o la sublimidad del grotesco en la última vanguardia

    Directory of Open Access Journals (Sweden)

    Cornago Bernal, Óscar

    2002-06-01

    Full Text Available This paper analyzes Romero Esteo's work from a cultural and aesthetic background rarely founded in the peninsular hispanic studies, in spite of being the appropiate one regarding his times. This complex theoretical frame, which has been related afterwards to diverse currents as Posestructuralism, the «New Left» and «Postmodernity», began to be developed in Europe during the sixties. Among the main names of these tendencies, who are the basis for my present approach, Michel Foucault, Roland Barthes, Jacques Derrida, Jean-François Lyotard, Gille Deleuze y Felix Guattari, Jean Baudrillard, Umberto Eco o Eugenio Trías are included. Starting from this wide corpus of aesthetic philosophy, which is going to be given an unitary interpretation through a consideration of the barroque condition of contemporary culture —reconsidering the theory of alegory by Benjamin—, this study intends to understand the specifity of an aesthetic project of great originality as well as the cultural background where it has risen.Este estudio analiza la obra de Miguel Romero Esteo desde un contexto cultural y estético escasamente transitado en el hispanismo peninsular, pero que es, sin embargo, el que le corresponde por generación histórica. Este complejo marco teórico, que ha sido relacionado posteriormente con corrientes diversas como el Posestructuralismo, la «nueva izquierda » o la Posmodernidad, comenzó a desarrollarse en Europa a medida que avanzaban los años sesenta. Entre los nombres que lo han protagonizado, y que son la base de este trabajo, se incluyen Michel Foucault, Roland Barthes, Jacques Derrida, Jean-François Lyotard, Gille Deleuze y Felix Guattari, Jean Baudrillard, Umberto Eco o Eugenio Trías. A partir de este amplio corpus de filosofia estética, al que se le dará una lectura unitaria mediante la condición barroca de la cultura actual —recuperando la teoría de la alegoría de Benjamin—, se trata de entender la especificidad que caracteriza tanto un proyecto estético de gran originalidad como del medio cultural que lo vio nacer.

  5. Vliv obuvi na způsob běhu a zranění

    OpenAIRE

    Kolovecká, Michaela

    2016-01-01

    In recent years running has become a very popular sport. Therefore it is nowadays often discussed whether it is shod running or barefoot running that is better. The aim of this thesis is to provide a summary of scientific pieces of knowledge on the effect of footwear on running style and related injuries. The introduction chapter describes the basics of running techniques and progressive development of running styles in relation to the development of running footwear. The following chapters d...

  6. Strengthening institutions or institutionalising weaknesses? : interactions between aid and institutions in Huíla Province, Angola

    NARCIS (Netherlands)

    Serrano, M.M.

    2012-01-01

    This research analyses the interaction between aid interventions and local institutions through which people address needs during crisis. These include state and non- state institutions involved in social assistance and in the delivery of basic services such as healthcare. The study focuses on the

  7. Trinidad y Pascua en la teología de H-U. von Balthasar y J. Moltmann

    Directory of Open Access Journals (Sweden)

    Eloy Bueno de la Fuente

    2015-06-01

    Full Text Available The rediscovery of the Trinity and the Easter constitutes one of the most important phenomena of the last century theology, especially when it emphasises the intimate connection between both of them. Magnificent examples of this are von Balthasar and Moltmann’s theological projects. However, in these writers, the primacy that is attributed to the cross does not permit to perceive clearly the role and the sense of the resurrection of Jesus.

  8. Bullying y el rendimiento escolar en centros educativos estatales de nivel secundaria del Distrito de Huánuco 2012

    OpenAIRE

    Jerí Guerra, Antonia Esmila

    2016-01-01

    Nuestro problema de investigación se basó en determinar si existe relación entre el fenómeno bullying y el rendimiento escolar de los participantes, considerándose su nivel de participación en dicho fenómeno. El método fue descriptivo correlacional prospectivo (relación entre variables Bullying y Rendimiento Académico), y el diseño fue no experimental correlacional, transaccional de dos grupos independientes, que consiste en observar situaciones ya existentes, como se dan en su contexto na...

  9. Interactive effects of antioxidant genes and air pollution on respiratory function and airway disease: a HuGE review.

    Science.gov (United States)

    Minelli, Cosetta; Wei, Igor; Sagoo, Gurdeep; Jarvis, Debbie; Shaheen, Seif; Burney, Peter

    2011-03-15

    Susceptibility to the respiratory effects of air pollution varies between individuals. Although some evidence suggests higher susceptibility for subjects carrying variants of antioxidant genes, findings from gene-pollution interaction studies conflict in terms of the presence and direction of interactions. The authors conducted a systematic review on antioxidant gene-pollution interactions which included 15 studies, with 12 supporting the presence of interactions. For the glutathione S-transferase M1 gene (GSTM1) (n=10 studies), only 1 study found interaction with the null genotype alone, although 5 observed interactions when GSTM1 was evaluated jointly with other genes (mainly NAD(P)H dehydrogenase [quinone] 1 (NQO1)). All studies on the glutathione S-transferase P1 (GSTP1) Ile105Val polymorphism (n=11) provided some evidence of interaction, but findings conflicted in terms of risk allele. Results were negative for glutathione S-transferase T1 (GSTT1) (n=3) and positive for heme oxygenase 1 (HMOX-1) (n=2). Meta-analysis could not be performed because there were insufficient data available for any specific gene-pollutant-outcome combination. Overall the evidence supports the presence of gene-pollution interactions, although which pollutant interacts with which gene is unclear. However, issues regarding multiple testing, selective reporting, and publication bias raise the possibility of false-positive findings. Larger studies with greater accuracy of pollution assessment and improved quality of conduct and reporting are required. © The Author 2011. Published by Oxford University Press on behalf of the Johns Hopkins Bloomberg School of Public Health. All rights reserved.

  10. Archaeological Discoveries in the People’s Republic of China and Their Contribution to the Understanding of Chinese History

    Directory of Open Access Journals (Sweden)

    Xingcan Chen

    2009-11-01

    Full Text Available More than eight decades ago, the distinguished Chinese scholar Hu Shi (1891–1962 wrote an essay titled ‘My Views on Ancient History’, in which he said: My outlook regarding ancient history is, for the present, we should shorten the study of ancient history by two or three thousand years, and start our researches from the Book of Odes. When archaeology has become well developed, then we can slowly extend [our understanding of ancient history before the Eastern Zhou dynasty, using excavated historical evidence. Today, over eighty years later, Chinese history before the Eastern Zhou dynasty has been steadily reconstructed, step by step, from archaeological discoveries, without which, even the well-recognized deserved brilliance of ancient history, since the Eastern Zhou dynasty, would be dimmed.

  11. Effect of Dendrobium officinale Extraction on Gastric Carcinogenesis in Rats

    Directory of Open Access Journals (Sweden)

    Yi Zhao

    2016-01-01

    Full Text Available Dendrobium officinale (Tie Pi Shi Hu in Chinese has been widely used to treat different diseases in China. Anticancer effect is one of the important effects of Dendrobium officinale. However, the molecular mechanism of its anticancer effect remains unclear. In the present study, gastric carcinogenesis in rats was used to evaluate the effect of Dendrobium officinale on cancer, and its pharmacological mechanism was explored. Dendrobium officinale extracts (4.8 and 2.4 g/kg were orally administered to the rats of the gastric carcinogenesis model. Compared with the cancer model group, the high dose of Dendrobium officinale extracts significantly inhibited the rate of carcinogenesis. Further analysis revealed that Dendrobium officinale extracts could regulate the DNA damage, oxidative stress, and cytokines related with carcinogenesis and induce cell apoptosis in order to prevent gastric cancer.

  12. Fiscal 1995 survey report. Study of new energy vision formulation for Kawasaki City, Kanagawa Prefecture; 1995 nendo Kawasaki shi shin energy vision sakutei kentou chosa hokokusho

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1996-03-01

    A survey was conducted of the current status of energy supply/demand, future problems, goals of the energy policy, basic plan, and so forth, for the formulation of a new energy vision for the city. Concerning energy supply/demand, studies were made of each sector, area, and energy source. In the study of energy demand, it was discovered that, although the industrial sector in the coastal region remained important, the residential/commercial sector was gathering weight and that the city was serving as an energy supply base for the neighboring areas. In the study of new energy, it was found that the available amount of solar energy resources was enormous, that the Tama river fresh water and the Keihin canal seawater constituted a promising source of temperature difference energy, and that sewage energy, transformation station exhaust heat, LNG (liquefied natural gas) cold heat, and so forth, were also available as energy sources. Taken up for discussion as possible new energy introduction models were gas engine cogeneration, photovoltaic power generation, district heat supply utilizing temperature difference energy, and so forth. (NEDO)

  13. Regional new energy vision formulation survey for Makurazaki City. Fiscal 2001 report; 2001 nendo Makurazaki shi chiiki shin energy vision sakutei tou chosa hokokusho

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2002-02-01

    For promoting the introduction of new energy and for elevating people's consciousness of such in Makurazaki City, Kagoshima Prefecture, surveys and studies were conducted concerning the energy demand of the city, the amount of new energy resources in existence, and new energy introduction plans, and then a vision was formulated. The city's energy demand in fiscal 1999 is estimated at approximately 3,206 TJ, with the industrial sector demanding 1,820 TJ, the residential and commercial sector demanding 701 TJ, and the transportation sector demanding 684 TJ. Energy consuming industries in this prefecture are fisheries industry and food industry. Pilot projects for new energy introduction were discussed, which included the introduction of photovoltaic power into the city hall, primary and junior high schools, a school meal providing center, and a city-managed hospital; installation of hybrid power-lighted light at the city hall, along the Kedo river, and in the Hinokami park; introduction of a solar heat utilization system into a nursing home for elderly people; introduction of wind power into education facilities; conversion of waste of cooking oil into diesel fuel; introduction of clean energy vehicles into public service; and new energy projects to be contracted to the private sector. (NEDO)

  14. Report on the project on working out the new energy vision of Hisai City; 2001 nendo Hisai shi chiiki shin energy vision sakutei tou jigyo hokokusho

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2002-03-01

    For the purpose of promoting the introduction of new energy and enhancing the awareness of it in Hisai City, Mie Prefecture, an investigational study was conducted of the energy demand structure, existence amount of new energy and project for new energy introduction, and a vision was worked out. The energy consumption amount of the city was 21,500 lorries in the industrial sector, 11,200 lorries in the transportation sector, 2,700 lorries in the business sector and 2,400 lorries in the residential sector in terms of tank-lorry loaded oil. As features, the following were cited: growth in the transportation sector, mostly in automobiles, was great; growth in the electric power consumption in the residential sector was great. As the project for new energy introduction, the following were supposed and studied in terms of the economical efficiency and environmental acceptability: introduction of cogeneration to hospital; introduction of ligneous biomass power generation to hospital; substitution of wood burning boiler for A heavy oil boiler for hot water supply use; introduction of photovoltaic power generation for home use and business use; introduction of solar heat use hot water supply device. (NEDO)

  15. Vneshnjaja politika Pol'shi i Kaliningradskaja oblast' v 1989—2012 godah [The foreign policy of Poland and the Kaliningrad region in 1989—2012

    Directory of Open Access Journals (Sweden)

    Chełminiak Marcin

    2012-01-01

    Full Text Available This article sets out to analyse the role of the Kaliningrad region in the Polish foreign policy after 1989. The analysis focuses on the political and regional determinants, which had the greatest impact on the Poland-Kaliningrad region relations. The methodology used in the article is not unusual for political science and is based on analysing original (documents and secondary (scholarly publications, press articles sources. The authors also use the system and decision analysis methods. The analysis covers the period after 1989, when the geopolitical changes brought about by the collapse of the Yalta-Potsdam order resulted in Poland redefine the priorities of its foreign policy. One of the most important challenges for the Polish diplomacy after 1989 was the development of economic and political relations with the Russian Federation. Cross-border cooperation between Poland and the Kaliningrad Region is conducted, inter alia, through euroregional structures functioning in the border areas. The analysis of this issue is vital for further cooperation in the Polish-Russian borderland, especially after the conclusion of the local border traffic agreement in 2012. The authors come to a conclusion that the implementation of the local border traffic agreement can improve cross-border relations but it will not significantly change the role of the Kaliningrad region in the Polish foreign policy.

  16. AYAT-AYAT WAH}DAT AL-WUJUd dalam Kitab Tanbi>h al-Ma>shi Karya ‘Abdurrauf al-Sinkili

    Directory of Open Access Journals (Sweden)

    Asep Nahrul Musadad

    2015-08-01

    Full Text Available Abstract: One of the key moments in discussing the history of Indonesian Islam is a polemic related to the negotiation on the doctrine of wahdat al-wujud that occured in Aceh in 17th century between the followers of Hamzah al-Fansuri and Nuruddin al-Raniri. This article focuses on analyzing several Qur’anic verses used by ‘Abdurrauf as the confirmation of his argument. In the polemical context, Abdurrauf al-Sinkili appeared to be an actor of reconciliation between two opposite sides. He tried to respond to the disputed issues through his book called “Tanbi>h al-Mashi”. As an exponent of the so-called moderate sufism (mysticism, he built the argument concerning wah}dat al-wujud based on the Quranic text. After making a thematic classification chronologically, his interpretation on these verses is analyzed by using Hussain al-Dhahaby’s theory of sufistic exegesis. In conclusion, it shows that ‘Abdurrauf’s commentary is “sufi-nazari type”, featured by his exegeses pattern. This, of course, represents his attitude as a reconciler who then needs to seek confirmation to the Qur’anic verses in evaluating wah}dat al-wujud doctrine, through which such a polemical issues occurred at that time. الملخص: إن من المرحلة الأساسية التي مرّ بها تاريخ الإسلام في اندونيسيا الجدل و النزاع حول عقيدة وحدة الوجود فى أتشيه (Aceh حول قرن السابع عشر بين أتباع حمزة الفنسوري و نور الدين الرانيري. ففي ذلك الخطاب النزاعي جاء عبد الرؤوف السنكيلي مصلحا بين الجانبين المعاكسين. وعلى مقتضى الظروف، كتب كتاب " تنبيه الماشي" الذي تطرّق فيه طريق التوسّط، ممثّلا للتصوّف المعتدل. اعتمد عبد الرؤوف على النصوص القرآنية فى تحقيق آراءه حول تناقضات وحدة الوجود. فهذه المقالة تطرح نفسها في تحليل الأيات القرآنية التي استخدمها عبد الرؤوف تأكيدا لحجته. بعد إجراء تصنيف موضوعي لتفسيره، سيتم التحليل باستخدام نظرية حسين الذهبي عن التفسير الصوفي. فيمكن القول بأن مادة تفسيره تدخل تحت لون "الصوفى النظري" التي ظهرت من قبل eisegesis (من النظرية الى النص. فهذا بالطبع يمثل على موقفه في الاعتدالية و باعتباره مصلحا، حتى يحتاج الى القرآن في التأكيد و التقييم للمسائل حول وحدة الوجود التي حدث من خلالها مثل هذا الجدل في ذلك الوقت. Abstrak: Salah satu momen kunci dalam perbincangan sejarah Islam Indonesia adalah polemik terkait negosiasi doktrin wah}dat al-wuju>d yang terjadi di Aceh pada abad ke-17 antara pengikut H{amzah al-Fansu>ri> dan Nu>r al-Di>n al-Ra>ni>ri>. Dalam konteks polemikal tersebut, Abdurrauf al-Sinkili muncul sebagai sosok rekonsiliator. Ia mencoba merespon pertikaian tersebut lewat kitabnya yang berjudul “Tanbi>h al-Ma>shi”. Sebagai eksponen tasawuf moderat, ia mendasarkan argumentasi terkait paham wah}dat al-wuju>d kepada al-Qur’an. Tulisan ini membincang ayat-ayat al-Qur’an yang digunakan sebagai konfirmasi dalam argumentasi Abdurrauf. Setelah dikelompokan secara tematik-kronologis, tafsiran Abdurrauf terhadap beberapa ayat al-Qur’an yang terkait wah}dat al-wuju>d dianalisis menggunakan teori tafsir sufistik Hussein al-Dhahaby. Secara konklusif dapat dikatakan bahwa uraian Abdurrauf tersebut merupakan sebuah tafsir sufistik versi “s}u>fi-naz}ari” yang menggunakan pola “eisegesis” (dari gagasan ke teks. Hal ini tentunya merepresentasikan sikapnya sebagai rekonsiliator yang kemudian merasa perlu untuk mencari konfirmasi terhadap ayat al-Qur’an dalam evaluasinya terhadap doktrin wah}dat al-wuju>d yang kontroversial ketika itu.  Keywords: Abdurrauf al-Sinkili, wah}dat al-wuju>d, rekonsiliasi, tafsir sufi

  17. Misunderstanding the Other and Shy Signs of Openness: Discourse on the 1992-1995 War in the Current Bosniak and Bosnian Serb Media

    Directory of Open Access Journals (Sweden)

    Michal Janíčko

    2015-04-01

    Full Text Available The article deals with how the 1990s civil war in Bosnia and Herzegovina was represented in the media that currently remain influential among Bosniaks and Bosnian Serbs. Critical discourse analysis is used both as a theoretical approach to discourse and as a methodological tool for its study. In the analysis, the civil war discourse in Bosniak and Bosnian Serb media is represented by two daily newspapers on each side. The analysis reveals mutually incompatible representations of the causes and nature of the war, the prevailing absence of dialogue, and the unwillingness of each side to consider the other side’s war victims. Looking at more specific topics, a number of discourses are identified on both sides, among which some present the potential for dialogue with alternative representations. The discourses are interpreted through Bosniak and Bosnian Serb nationalist ideologies. The findings might support further research on the relation between the media and nationalism and on the ongoing Bosnian political dispute concerning the desired nature of the state.

  18. Regional new energy vision for Kakegawa City. Formulation survey report; 2001 nendo Kakegawa shi chiiki shin energy vision sakutei chosa hokokusho

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2002-02-01

    For promoting the introduction of new energy and for enhancing people's consciousness of such at Kakegawa City, Shizuoka Prefecture, surveys and studies were conducted involving the energy demand of the city, the amount of new energy resources in existence, and new energy introduction projects, and a vision was formulated. The city consumes approximately 11,638 GJ/year, with the industrial sector consuming 4,896 GJ, the residential/commercial sector 3,608 GJ, and the transportation sector 3,134 GJ. Energy types are electric power, gas oil, heavy oil, gasoline, kerosene, LPG, and town gas, as listed in the descending order in terms of consumption rate. The amount of carbon dioxide resulting from the consumption is estimated at 673,214 t-CO2. Projects for new energy introduction were studied, which involved photovoltaic power generation for the general-purpose gymnasium, kindergartens, the school meal center, and meeting places; introduction of solar heat utilization systems into public facilities; financial support system for the purchase of solar heat utilization apparatuses; refuse-fueled power generation and heat utilization at a new cleaning center; utilization of biogas from garbage and stock raising waste; utilization of woody resources; clean-energy vehicles; and so on. (NEDO)

  19. Plans for promoting district energy-saving visions for City of Wakkanai; Wakkanai-shi chiiki sho energy vision suishin keikakusho

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2001-02-01

    The district energy-saving visions and promotion plans therefor are drawn for City of Wakkanai, to promote energy saving and abatement of gas emissions which cause global warming. The conception of the energy-saving introduction project includes introduction of co-generation systems in the facilities of pivotal functions in the city center, and energy-saving systems in a municipal heated pool and public hot spring facilities. The facilities of pivotal functions in the city, e.g., the municipal office buildings, municipal hospital and all-around culture center of the city are supplied with heat in a centralized manner from the energy center, and the energy-saving effect is expected when co-generation systems are introduced in the energy center. The study results indicate that introduction of the co-generation systems in the energy center has a potential energy-saving effect of 2,400Gcal/y. The energy-saving effects are also analyzed for each of the municipal office buildings, municipal hospital, all-around culture center, municipal heated pool and public hot spring facilities, including those potentially realized by improving illumination and air supply/discharge facilities. (NEDO)

  20. Technology Education and Technology Teacher Education in Taiwan, R.O.C. = Zhong Hua Min Guo Ke Ji Jiao Yu Ji qi shi zi Jiao Yu.

    Science.gov (United States)

    Lee, Lung-Sheng Steven; Wang, Cheng-Pin Peter; Wang, Yen-chao; Shih, Neng-Mu; Yeh, Chung-ching

    Technology education in Taiwan begins with craft work at the elementary school level, and the most important point is the practical application. All junior high school students are required to take the Living Technology course. Content includes technology and life, information and communication, construction and manufacturing, and energy and…