Chinn, Courtney Hugh
2011-01-01
Head Start and Early Head Start (HS/EHS) programs have partnered with the American Academy of Pediatric Dentistry to promote oral health and increase access to dental homes. Preparing HS/EHS staff for issues related to pediatric oral health promises to improve effectiveness of this collaboration. This paper's purpose was to describe the Columbia Head Start Oral Health Program (C-HSOHP) and changes in HS/EHS staff pediatric oral health knowledge and competencies after participating in C-HSOHP. Four HS/EHS grantees in New York City engaged in the 2008-09 C-HSOHP. A convenience sample of 61 staff completed pre- and postself assessments of knowledge and competencies. Significant paired mean improvements were found for staff-reported level of preparation to explain dental issues during pregnancy, the tooth decay process, and preparing parents for their child's first dental visit. Significant improvements were found in staff confidence in teaching parents about children's oral health issues, referring for pediatric dental services, and talking to a dentist about a concern. The Columbia Head Start Oral Health Program was effective in improving Head Start/Early Head Start staff self-confidence and self-perceived preparedness in teaching parents about oral health, applying oral health knowledge to HS/EHS programs, communicating with dental professionals, and improving access to pediatric dental services.
Altürk, Sümeyye; Avcı, Davut; Başoğlu, Adil; Tamer, Ömer; Atalay, Yusuf; Dege, Necmi
2018-02-05
Crystal structure of the synthesized copper(II) complex with 6-methylpyridine-2-carboxylic acid, [Cu(6-Mepic) 2 ·H 2 O]·H 2 O, was determined by XRD, FT-IR and UV-Vis spectroscopic techniques. Furthermore, the geometry optimization, harmonic vibration frequencies for the Cu(II) complex were carried out by using Density Functional Theory calculations with HSEh1PBE/6-311G(d,p)/LanL2DZ level. Electronic absorption wavelengths were obtained by using TD-DFT/HSEh1PBE/6-311G(d,p)/LanL2DZ level with CPCM model and major contributions were determined via Swizard/Chemissian program. Additionally, the refractive index, linear optical (LO) and non-nonlinear optical (NLO) parameters of the Cu(II) complex were calculated at HSEh1PBE/6-311G(d,p) level. The experimental and computed small energy gap shows the charge transfer in the Cu(II) complex. Finally, the hyperconjugative interactions and intramolecular charge transfer (ICT) were studied by performing of natural bond orbital (NBO) analysis. Copyright © 2017 Elsevier B.V. All rights reserved.
Directory of Open Access Journals (Sweden)
Tamer Ömer
2016-03-01
Full Text Available The molecular modeling of p-nitroanilinium perchlorate molecule was carried out by using B3LYP and HSEH1PBE levels of density functional theory (DFT. The IR and Raman spectra were simulated and the assignments of vibrational modes were performed on the basis of relative contribution of various internal co-ordinates. NBO analysis was performed to demonstrate charge transfer, conjugative interactions and the formation of intramolecular hydrogen bonding interactions within PNAPC. Obtained large dipole moment values showed that PNAPC is a highly polarizable complex, and the charge transfer occurs within PNAPC. Hydrogen bonding and charge transfer interactions were also displayed by small HOMO-LUMO gap and molecular electrostatic potential (MEP surface. The strong evidences that the material can be used as an efficient nonlinear optical (NLO material of PNAPC were demonstrated by considerable polarizability and hyperpolarizability values obtained at DFT levels.
The retention mechanism of technetium-99m-HM-PAO
DEFF Research Database (Denmark)
Neirinckx, R D; Burke, J F; Harrison, R C
1988-01-01
Preparations of d,l- and meso-hexamethylpropyleneamine oxime (HM-PAO) labeled with technetium-99m were added to rat brain homogenates diluted with phosphate buffer (1:10). The conversion of d,l-HM-PAO to hydrophilic forms took place with an initial rate constant of 0.12 min-1. Incubation of the b......Preparations of d,l- and meso-hexamethylpropyleneamine oxime (HM-PAO) labeled with technetium-99m were added to rat brain homogenates diluted with phosphate buffer (1:10). The conversion of d,l-HM-PAO to hydrophilic forms took place with an initial rate constant of 0.12 min-1. Incubation....... This correspondence of values supports the notion that GSH may be important for the in vivo conversion of 99mTc-labeled HM-PAO to hydrophilic forms and may be the mechanism of trapping in brain and other cells. A kinetic model for the trapping of d,l- and meso-HM-PAO in tissue is developed that is based on data...
The development of 99mTc-d, 1-HM-PAO
International Nuclear Information System (INIS)
Bai Lanqin; Huang Jinjie; Fan Li; Bai Suzhen; Li Guoli; Jing Hui; Xiao Lun
1991-12-01
The 99m Tc-d,1-HM-PAO is an ideal radiopharmaceutical for regional cerebral blood perfusion imaging. The improvement of synthesis and separation of diastereoisomers leads to obtain high purity (>99%) of d, 1-HM-PAO and meso-HM-PAO. During separation H NMR spectroscopy was used to monitor the relative composition of these two diastereoisomers that can ensure the purity of pligand of d,1-HM-PAO. The intravenous injection of 99m Tc-d,1-HM-PAO was formed by adding fresh 99m Tc washing liquor into a sterile. Pyrogen-free and freeze-dried vial. The radiochemical purity (RCP) of 99m Tc-d,1-HM-PAO was greater than 80%. From the experiments of 99m Tc-d,1-HM-PAO in mice, after two minutes of intravenously (I>V>) administration about 2.24% of injected dose (I.D.)appeared in the brain, and after 24 hours about 72% of radioactivity of injected dose still left in the brain. But for the 99m Tc-meso-HM-PAO after two minutes of i.v. administration, about 1.93% of I.D. appeared in the brain, and 24 hours later, 25% of radioactivity of I.D. was in the brain. This result shows that in the brain the radioactivity of 99m Tc-meso-HM-PAO declines faster than that of 99m Td-d,1-HM-PAO
Technetium-labeled HM-PAO studies in patients with cerebrovascular disease
International Nuclear Information System (INIS)
Smith, F.W.; Sharp, P.F.; Gemmell, H.; Evans, N.T.; MacDonald, A.F.
1986-01-01
Technetium-labeled hexamethyl-propyleneamineoxime (HM-PAO) is a promising radiopharmaceutical for the demonstration of cerebral blood flow. Twenty-four patients who had experienced either acute stroke (AS) or transient ischemic attack (TIA) were studied by x-ray CT and SPECT using technetium-labeled HM-PAO total of 26 studies. HM-PAO has a cerebral distribution similar to that of iodoamphetamine, but labeling with technetium allows good SPECT imaging on demand in any nuclear medicine department. In ten of the 16 patients who had experienced AS, findings on HM-PAO and CT studies correlated well. In six patients reduced cortical perfusion was detected on HM-PAO imaging, but only small infarcts in the internal capsule were seen on CT. In four of the eight patients who had experienced TIA, neither study revealed any abnormality. In the remaining four, areas of cortical underperfusion were seen on HM-PAO imaging, whereas the CT examination was normal. The findings in this study suggest that HM-PAO imaging is a more sensitive method for demonstrating the extent of cerebral underperfusion in cases of cerebrovascular accident
Enhanced thermophysical properties via PAO superstructure
Pournorouz, Zahra; Mostafavi, Amirhossein; Pinto, Aditya; Bokka, Apparao; Jeon, Junha; Shin, Donghyun
2017-01-01
For the last few years, molten salt nanomaterials have attracted many scientists for their enhanced specific heat by doping a minute concentration of nanoparticles (up to 1% by weight). Likewise, enhancing the specific heat of liquid media is important in many aspects of engineering such as engine oil, coolant, and lubricant. However, such enhancement in specific heat was only observed for molten salts, yet other engineering fluids such as water, ethylene glycol, and oil have shown a decrease of specific heat with doped nanoparticles. Recent studies have shown that the observed specific heat enhancement resulted from unique nanostructures that were formed by molten salt molecules when interacting with nanoparticles. Thus, such enhancement in specific heat is only possible for molten salts because other fluids may not naturally form such nanostructures. In this study, we hypothesized such nanostructures can be mimicked through in situ formation of fabricated nano-additives, which are putative nanoparticles coated with useful organic materials (e.g., polar-group-ended organic molecules) leading to superstructures, and thus can be directly used for other engineering fluids. We first applied this approach to polyalphaolefin (PAO). A differential scanning calorimeter (DSC), a rheometer, and a customized setup were employed to characterize the heat capacity, viscosity, and thermal conductivity of PAO and PAO with fabricated nano-additives. Results showed 44.5% enhanced heat capacity and 19.8 and 22.98% enhancement for thermal conductivity and viscosity, respectively, by an addition of only 2% of fabricated nanostructures in comparison with pure PAO. Moreover, a partial melting of the polar-group-ended organic molecules was observed in the first thermal cycle and the peak disappeared in the following cycles. This indicates that the in situ formation of fabricated nano-additives spontaneously occurs in the thermal cycle to form nanostructures. Figure of merit analyses have
Enhanced thermophysical properties via PAO superstructure.
Pournorouz, Zahra; Mostafavi, Amirhossein; Pinto, Aditya; Bokka, Apparao; Jeon, Junha; Shin, Donghyun
2017-12-01
For the last few years, molten salt nanomaterials have attracted many scientists for their enhanced specific heat by doping a minute concentration of nanoparticles (up to 1% by weight). Likewise, enhancing the specific heat of liquid media is important in many aspects of engineering such as engine oil, coolant, and lubricant. However, such enhancement in specific heat was only observed for molten salts, yet other engineering fluids such as water, ethylene glycol, and oil have shown a decrease of specific heat with doped nanoparticles. Recent studies have shown that the observed specific heat enhancement resulted from unique nanostructures that were formed by molten salt molecules when interacting with nanoparticles. Thus, such enhancement in specific heat is only possible for molten salts because other fluids may not naturally form such nanostructures. In this study, we hypothesized such nanostructures can be mimicked through in situ formation of fabricated nano-additives, which are putative nanoparticles coated with useful organic materials (e.g., polar-group-ended organic molecules) leading to superstructures, and thus can be directly used for other engineering fluids. We first applied this approach to polyalphaolefin (PAO). A differential scanning calorimeter (DSC), a rheometer, and a customized setup were employed to characterize the heat capacity, viscosity, and thermal conductivity of PAO and PAO with fabricated nano-additives. Results showed 44.5% enhanced heat capacity and 19.8 and 22.98% enhancement for thermal conductivity and viscosity, respectively, by an addition of only 2% of fabricated nanostructures in comparison with pure PAO. Moreover, a partial melting of the polar-group-ended organic molecules was observed in the first thermal cycle and the peak disappeared in the following cycles. This indicates that the in situ formation of fabricated nano-additives spontaneously occurs in the thermal cycle to form nanostructures. Figure of merit analyses have
HM-PAO SPECT in the diagnosis of cerebrovascular disease
International Nuclear Information System (INIS)
Cordes, M.; Rummeny, E.; Reissmann, M.; Fox, K.; Panitz, N.; Pfannenstiel, P.
1987-01-01
Single photon emission computed tomography (SPECT) after injection of 99m-Tc-HM-PAO was used to examine 34 patients whose clinical findings could not exclude a cerebrovascular disease. In all patients an X-ray computed tomography examination was inconclusive for the clinical-neurological findings. The regional cerebral bloodflow was pathologically disturbed in 10 of 34 patients in the HM-PAO SPECT examination. The detection of the regional cerebral bloodflow with HM-PAO SPECT is helpful in the diagnosis of cerebrovascular disease. (orig.) [de
DFT calculations on spectroscopic and structural properties of a NLO chromophore
Altürk, Sümeyye; Avci, Davut; Tamer, Ömer; Atalay, Yusuf
2016-03-01
The molecular geometry optimization, vibrational frequencies and gauge including atomic orbital (GIAO) 1H and 13C NMR chemical shift values of 2-(1'-(4'''-Methoxyphenyl)-5'-(thien-2″-yl)pyrrol-2'-yl)-1,3-benzothiazole as potential nonlinear optical (NLO) material were calculated using density functional theory (DFT) HSEh1PBE method with 6-311G(d,p) basis set. The best of our knowledge, this study have not been reported to date. Additionally, a detailed vibrational study was performed on the basis of potential energy distribution (PED) using VEDA program. It is noteworthy that NMR chemical shifts are quite useful for understanding the relationship between the molecular structure and electronic properties of molecules. The computed IR and NMR spectra were used to determine the types of the experimental bands observed. Predicted values of structural and spectroscopic parameters of the chromophore were compared with each other so as to display the effects of the different substituents on the spectroscopic and structural properties. Obtained data showed that there is an agreement between the predicted and experimental data.
Energy Technology Data Exchange (ETDEWEB)
Lezama C, J; Ferro F, G; Alcazar A, P
1991-09-15
Most brain imaging radiopharmaceuticals are conventional hydrophilic compounds that are excluded from entering the normal brain by an intact blood-brain barrier (BBB). Under pathologic conditions, the barrier is disrupted and radiotracer concentrates in the leisure for positive identification. {sup 99m} Tc- hexa methyl propylene amine oxime ({sup 99} {sup m} Tc-HM-PAO) is a newer-type lipophilic agent that enter the normal brain through an intact BBB. Studies with this agent offer the promise of measuring cerebral perfusion in the normal and diseased brain. In this paper we present the synthesis and Tc-99m labelling of d,I-HM-PAO. The synthesis of the ligand was carried out by condensation of two molecular equivalents of butanedione monoxime with one molecular equivalent of 1,3 propanediamine provided a bis imine intermediate, which was reduced with sodium borohydride to get the meso and d,I diastereoisomers of HM-PAO. Separation of these was achieved by fractional crystallization. {sup 99m} Tc-(d,I)HM-PAO was obtained by stannous ion reduction of Mo-99/Tc-99m generator eluate in the presence of the ligand. Complex radiochemical purity was determined by instant thin layer chromatography and paper chromatography. Finally, we obtained {sup 99m} Tc-(d,I)HM-PAO with a high radiochemical yield, in excess of 90%. However, for subsequent clinical studies the preparation has to be done a few minutes before application because our product has a low stability. (Author)
International Nuclear Information System (INIS)
Lezama C, J.; Ferro F, G.; Alcazar A, P.
1991-09-01
Most brain imaging radiopharmaceuticals are conventional hydrophilic compounds that are excluded from entering the normal brain by an intact blood-brain barrier (BBB). Under pathologic conditions, the barrier is disrupted and radiotracer concentrates in the leisure for positive identification. 99m Tc- hexa methyl propylene amine oxime ( 99 m Tc-HM-PAO) is a newer-type lipophilic agent that enter the normal brain through an intact BBB. Studies with this agent offer the promise of measuring cerebral perfusion in the normal and diseased brain. In this paper we present the synthesis and Tc-99m labelling of d,I-HM-PAO. The synthesis of the ligand was carried out by condensation of two molecular equivalents of butanedione monoxime with one molecular equivalent of 1,3 propanediamine provided a bis imine intermediate, which was reduced with sodium borohydride to get the meso and d,I diastereoisomers of HM-PAO. Separation of these was achieved by fractional crystallization. 99m Tc-(d,I)HM-PAO was obtained by stannous ion reduction of Mo-99/Tc-99m generator eluate in the presence of the ligand. Complex radiochemical purity was determined by instant thin layer chromatography and paper chromatography. Finally, we obtained 99m Tc-(d,I)HM-PAO with a high radiochemical yield, in excess of 90%. However, for subsequent clinical studies the preparation has to be done a few minutes before application because our product has a low stability. (Author)
Garthoff, J.A.; Heemskerk, S.; Hempenius, R.A.; Lina, B.A.; Krul, C.A.; Koeman, J.H.; Speijers, G.J.
2010-01-01
Pectin-derived acidic oligosaccharides (pAOS) are non-digestible carbohydrates to be used in infant formulae and medical nutrition. To support its safety, the genotoxic potential of pAOS was evaluated. pAOS was not mutagenic in the Ames test. Positive results were obtained in the chromosome
Garthoff, J.A.; Heemskerk, S.; Hempenius, R.A.; Lina, B.A.R.; Krul, C.A.M.; Koeman, J.H.; Speijers, G.J.A.
2010-01-01
Pectin-derived acidic oligosaccharides (pAOS) are non-digestible carbohydrates to be used in infant formulae and medical nutrition. To support its safety, the genotoxic potential of pAOS was evaluated. pAOS was not mutagenic in the Ames test. Positive results were obtained in the chromosome
PAO mud boosts ROP, minimizes enviro impact
International Nuclear Information System (INIS)
Anon.
1993-01-01
A North Sea well drilled with a drilling fluid based on polyalphaolefin (PAO) chemistry has helped increase penetration rates and reduce torque and drag while minimizing environmental impact, according to a paper presented at the 1993 SPE/IADC Drilling Conference in Amsterdam. The paper, ''Superior Performance with Minimal Environmental Impact: A Novel Non-Aqueous Drilling Fluid'' (SPE/IADC 25753), written by J.E. Friedheim and R. Pantermuehl of M-I Drilling Fluids, says the rate of penetration was some 15% higher than in offset wells drilled with mineral-oil-base mud. Average penetration rates at the beginning of the 8,856-ft (2,700-m) 12 1/4-in. interval drilled exceeded 100 ft/hr (30.5 m/hr) and averaged higher than 90 ft/hr (27.4 m/hr) for the entire section. The authors attributed the performance to better hole cleaning. Hole cleaning, lubricity, inhibition and equivalent bottom-hole density were primary concerns while drilling the well. ''Environmental aspects of the PAO fluid show that it should be essentially non-toxic to aquatic life,'' the authors contended. ''Various toxicity, bioaccumulation and biodegradation work indicate that the PAO mud will have little impact on the environment while slowly biodegrading.''
Experimental study of per-rectal portal scintigraphy using 99mTc-HM-PAO
International Nuclear Information System (INIS)
Kubota, Hayato; Shinotsuka, Akira; Takenaka, Hiroki; Tamaki, Satoshi.
1994-01-01
Usefulness of per-rectal portal scintigraphy by 123 I-IMP has already been admitted. We assessed whether 99m Tc-HM-PAO, another agent used for cerebral blood flow scintigraphy, could be utilized for scintigraphic evaluation of the portal system. Animal experiments were carried out to evaluate the usefulness of the examination. Shunt indices obtained from per-rectal portal scintigraphy by 123 I-IMP and 99m Tc-HM-PAO in shunt models and shunt rate obtained by direct injection of 99m Tc-MAA into the inferior mesenteric vein under laparotomy were compared. Correlation coefficient of each agent with 99m Tc-MAA was 0.90 for 99m Tc-HM-PAO and 0.80 for 123 I-IMP. It was also noted that as larger quantity of the tracer could be administered in 99m Tc-HM-PAO than in 123 I-IMP, absorption from rectum was optimum and liver extraction fraction was 94.4%. Therefore, we concluded that 99m Tc-HM-PAO was useful for per-rectal portal scintigraphy. (author)
Development of 99mTc-labelled the d,1-diasteroisomer of HM-PAO for cerebral blood flow imaging
International Nuclear Information System (INIS)
Lun Xiao.
1989-10-01
The d,1-diastereoisomer of hexamethyl propyleneamine oxime (HM-PAO) was selected as the preferred ligand for Tc-99m as a radiotracer for cerebral perfusion imaging. Further improvement of the synthesis and isolation method of HM-PAO resulted in pure d,1-HM-PAO and pure meso-HM-PAO. The neutral, lipophilic Tc-99m complexes of d,1-HM-PAO and meso-HM-PAO were formed in high yield by stannous reduction of Mo-99/Tc-99m generator eluate, respectively. Two minutes following i.v. administration of Tc-99m-d,1-HM-PAO in mice, 2.24% of the injected dose appears in the brain. Little washout of the tracer is observed up to 24-hour post injection. Two minutes following i.v. administration of Tc-99m-meso-HM-PAO in mice, 1.9% of the injected dose appears in the brain. The radioactivity of Tc-99m-meso-HM-PAO declined faster than that of Tc-99m-d,1-HM-PAO did in the brain up to 24-hour post injection. 12 refs, 5 figs, 5 tabs
99mTc HM-PAO brain perfusion SPECT in brain death
International Nuclear Information System (INIS)
Bonetti, M.G.; Ciritella, P.; Valle, G.; Perrone, E.
1995-01-01
We have easily carried out and interpreted 99m Tc HM-PAO SPECT in a consecutive series of 40 comatose patients with brain damage, without discontinuing therapy. Brain death was diagnosed in 7 patients, by recognising absence of brain perfusion, as shown by no intracranial radionuclide uptake. In patients in whom perfusion was seen on brain scans, HM-PAO SPECT improved assessment of the extent of injury, which in general was larger than suggested by CT. (orig.)
Basic and clinical evaluation of regional cerebral perfusion scintigraphy of 99mTc-HM-PAO
International Nuclear Information System (INIS)
Tsukatani, Yasushi; Nakamura, Kayoko; Fujii, Hiroshi
1988-01-01
Radiochemical purity of 99m Tc-HM-PAO decreased rapidly after preparation. 99m Tc activity of the whole brain increased rapidly after venous injection, and changed very little after 3 minutes later. 99m Tc-HM-PAO scintigram showed the wider abnormal perfusion area than CT scanning did. Hypoperfusion area found by IMP tended to be wider than that by HM-PAO. There were no side effects observed of all cases. (author)
Quorum quenching by an N-acyl-homoserine lactone acylase from Pseudomonas aeruginosa PAO1
Sio, CF; Otten, LG; Cool, RH; Diggle, SP; Braun, PG; Daykin, M; Camara, M; Williams, P; Quax, WJ; Bos, R
The virulence of the opportunistic human pathogen Pseudomonas aeruginosa PAO1 is controlled by an N-acyl-homoserine lactone (AHL)-dependent quorum-sensing system. During functional analysis of putative acylase genes in the P. aeruginosa PAO1 genome, the PA2385 gene was found to encode an acylase
Mineral characterisation of Don Pao rare earth deposit in Vietnam
International Nuclear Information System (INIS)
XuanBen, T.
1998-01-01
Full text: The Don Pao Rare Earth Deposit was discovered in 1959 in Phon Tho district, about 450km North-West of Hanoi capital. Geological work was conducted between 1959-95, resulting in 60 ore bodies of various sizes being identified. The ore bodies are irregularly shaped nests, lenses and veins hosted in the shear zone, at the margin of a Paeleogene aged syenite massif. The mineral composition of Don Pao Deposit is very complex, consisting of more than 50 minerals. Among them, basnaesite, parisite, fluorite and barite are the main constituent minerals of the ore. All the minerals were identified by the modern methods of mineralogical studies. Based on the constituent mineral ratios, four ore types have been distinguished in the deposit: 1. Rare earth ore containing over 5 percent of RE 2 O 3 . 2. Rare Earth-Barite ore containing 0.5 to 30 percent of RE 2 O 3 . 3. Rare Earth-Barite-Fluorite ore containing 1 to 5 percent of RE 2 O 3 . 4. Rare Earth bearing Fluorite ore containing 1 to 5 percent of RE 2 O 3 . According to the benefication test, the ores in Don Pao can be enriched to a concentrate of 60 percent of RE 2 O 3 with a recover of 75 percent
DEFF Research Database (Denmark)
Yonekura, Y; Nishizawa, S; Mukai, Thomas Søgaard
1988-01-01
In order to validate the use of technetium-99m-d,l-hexamethylpropyleneamine oxime (HM-PAO) as a flow tracer, a total of 21 cases were studied with single photon emission computerized tomography (SPECT), and compared to regional cerebral blood flow (rCBF) measured by position emission tomography...... (PET) using the oxygen-15 CO2 inhalation technique. Although HM-PAO SPECT and rCBF PET images showed a similar distribution pattern the HM-PAO SPECT image showed less contrast between high and low activity flow regions than the rCBF image and a nonlinear relationship between HM-PAO activity and r......CBF was shown. Based on the assumption of flow-dependent backdiffusion of HM-PAO from the brain, we applied a "linearization algorithm" to correct the HM-PAO SPECT images. The corrected HM-PAO SPECT images revealed a good linear correlation with rCBF (r = 0.901, p less than 0.001). The results indicated HM-PAO...
The retention of [99mTc]-d,l-HM-PAO in the human brain after intracarotid bolus injection
DEFF Research Database (Denmark)
Lassen, N A; Andersen, A R; Friberg, L
1988-01-01
[99mTc]-d,l-HM-PAO (HM-PAO) was injected rapidly into the internal carotid artery and its retention in the brain was recorded by external scintillation cameras in eight human subjects. A model is described based on three compartments: the lipophilic tracer in the blood pool of the brain, the lipo......[99mTc]-d,l-HM-PAO (HM-PAO) was injected rapidly into the internal carotid artery and its retention in the brain was recorded by external scintillation cameras in eight human subjects. A model is described based on three compartments: the lipophilic tracer in the blood pool of the brain...
Directory of Open Access Journals (Sweden)
Miguel Castro
2014-04-01
Full Text Available The effects that the adsorption of the paracetamol molecule produce on the structural and electronic properties of boron nitride (hBNNs; B27N27H18 and boron nitride oxide (hBNONs; B27N27H17 + O + (OH3 + COOH hexagonal symmetry nanosheets were studied by means of Density Functional Theory. The generalized gradient approximation proposed by Heyd—Scuseria—Ernzerhof ((HSEh1PBE―GGA was used in concert with 6-31G(d basis sets. Several candidate structures, 9 and 13 for the hBNNs―Paracetamol and BNONs―Paracetamol interactions, respectively, were used for the geometry optimization procedure. The results show that in the lowest energy absorption site the paracetamol molecule reaches a parallel orientation to the surface of the nanosheets, producing physisorption for hBNNs―Paracetamol and chemisorption for BNONs―Paracetamol. Besides, the adsorption process yields an increase of the polarity opening the possibility for the solubility and dispersion of these compounds. The paracetamol molecule promotes also a decrease of the reactivity parameter, which is crucial for biological applications of these systems. Referred to pristine hBNNs and BNONs, the work functions of hBNNs-Paracetamol and BNONs―Paracetamol are diminished. That is, these functionalized 2D systems yields appropriate conditions for field emission and they may be used as sensors of such pharmaceutical compound.
Cerebral blood flow imaging by I-123 IMP and Tc-99m HM-PAO
Energy Technology Data Exchange (ETDEWEB)
Uno, Koichi; Yoshikawa, Kyosan; Minoshima, Satoshi; Imaseki, Keiko; Arimizu, Noboru; Yamaura, Akira; Uematsu, Sadao
1988-02-01
SPECT studies with either N-isopropyl-p-(I-123)iodo- amphetamine (I-123 IMP) or Tc-99m hexamethyl propylene amine oxime (Tc-99m HM-PAO) were cuncurrently performed in 12 patients with brain disorders, comprising cerebral infarction (7), cerebral aneurysm (one), intracranial hemorrhage (3), and subdural hematoma (one). Whereas I-123 IMP was taken up gradually into the brain, the uptake of Tc-99m-HM-PAO in the brain reached the peak immediately after the iv injection, with 90% or more remaining constant by 15 min postinjection. On early SPECT images, a high uptake of I-123 IMP was observed in the lung, and the uptake of Tc-99m HM-PAO was observed as well in the soft tissue of cervical region. In all patients except for one, decreased rCBF was observed in the lesions on both I-123 and Tc-99m SPECT scans. Both of the radiopharmaceuticals were analogous in that decreased blood flow corresponded to cerebral lesions. (Namekawa, K).
Diagnosis of infected bone and joint diseases with 99mTc-HM-PAO labeled leukocytes
International Nuclear Information System (INIS)
Kanegae, Kakuko; Itoh, Kazuo; Tsukamoto, Eriko; Nagao, Kazuhiko; Nakada, Kunihiro; Hurudate, Masayori
1992-01-01
The usefulness of 99m Tc-hexamethylpropylene amine oxime (HM-PAO) labeled leukocytes scans was studied in 15 patients with suspected infection of the bone and joints. All spot images of lesions were obtained 4 and 24 hours after injection of 70.3-236.8 MBq (a mean, 149.5 MBq). 99m Tc-HM-PAO leukocytes scans were positive in 5 patients, negative in 8, and equivocal in 2. It had a sensitivity of 83% (5/6), specificity of 100% (6/6), and accuracy of 93% (14/15) for diagnosing infections. Equivocal uptake, seen on the 4-hr image in 2 patients, became negative on the 24-hr image. In view of ready availability and simple labeling procedure, 99m Tc-HM-PAO labeled leukocytes scans can be used as one of the specific diagnostic procedures for infections. (N.K.)
HM-PAO-SPECT of the brain in a new-born child
Energy Technology Data Exchange (ETDEWEB)
Gruenwald, F.; Biersack, H.J.; Bindl, L.
1988-08-01
HM-PAO-SPECT of the brain was performed in a 14 days old new-born child. Diencephalon, brain stem and cerebellum showed a relative high tracer accumulation; there was nearly no accumulation in the neocortex.
Cerebral uptake and retention of 99Tcsup(m)-hexamethylpropyleneamine oxime (99Tcsup(m)-HM-PAO)
International Nuclear Information System (INIS)
Holmes, R.A.; Chaplin, S.B.; Royston, K.G.; Missouri Univ., Columbia
1985-01-01
A new radiopharmaceutical, 99 Tcsup(m)-hexamethylpropyleneamine oxime ( 99 Tcsup(m)-HM-PAO) is described. This agent displays considerable promise for imaging cerebral blood flow. In studies in rats and one human volunteer, 99 Tcsup(m)-HM-PAO demonstrates good brain uptake, prolonged retention of activity in the brain, and slow regional redistribution. These properties suggest that this new radiopharmaceutical is ideal for single photon emission tomographic (SPECT) imaging of cerebral blood flow. (author)
Hernández-Padilla, Laura; Vázquez-Rivera, Dolores; Sánchez-Briones, Luis A; Díaz-Pérez, Alma L; Moreno-Rodríguez, José; Moreno-Eutimio, Mario A; Meza-Carmen, Victor; Cruz, Homero Reyes-De la; Campos-García, Jesús
2017-06-20
Pseudomonas aeruginosa PAO1, a potential pathogen of plants and animals, produces the cyclodipeptides cyclo(l-Pro-l-Tyr), cyclo(l-Pro-l-Phe), and cyclo(l-Pro-l-Val) (PAO1-CDPs), whose effects have been implicated in inhibition of human tumor cell line proliferation. Our purpose was to investigate in depth in the mechanisms of HeLa cell proliferation inhibition by the PAO1-CDPs. The results indicate that PAO1-CDPs, both purified individually and in mixtures, inhibited HeLa cell proliferation by arresting the cell cycle at the G0-G1 transition. The crude PAO1-CDPs mixture promoted cell death in HeLa cells in a dose-dependent manner, showing efficacy similar to that of isolated PAO1-CDPs (LD 50 of 60-250 µM) and inducing apoptosis with EC 50 between 0.6 and 3.0 µM. Moreover, PAO1-CDPs showed a higher proapoptotic activity (~10³-10⁵ fold) than their synthetic analogs did. Subsequently, the PAO1-CDPs affected mitochondrial membrane potential and induced apoptosis by caspase-9-dependent pathway. The mechanism of inhibition of cells proliferation in HeLa cells involves inhibition of phosphorylation of both Akt-S473 and S6k-T389 protein kinases, showing a cyclic behavior of their expression and phosphorylation in a time and concentration-dependent fashion. Taken together our findings indicate that PI3K-Akt-mTOR-S6k signaling pathway blockage is involved in the antiproliferative effect of the PAO1-CDPs.
Comparison of Tc-99m HM-PAO SPECT brain scan and x-ray CT in the detection of brain metastases
International Nuclear Information System (INIS)
Abdel-Dayem, H.M.; Sadek, S.; Sahwell, A.; Kubasek, H.; El-Sayed, M.; Ziada, G.; Mobarak, L.; Al-Huda, F.; Omar, Y.T.
1986-01-01
Tc-99m HM-PAO imaging was compared with x-ray CT in 14 patients with known or suspected brain metastases. Both studies were done within 3 days of each other. Static and single photon emission CT (SPECT) images were acquired after intravenous injection of 13 mCi of Tc-99m HM-PAO. All 14 patients underwent static and SPECT Tc-99m HM-PAO imaging and x-ray CT. Studies were positive in 7, 12, and 10 patients, respectively, by static, SPECT, and x-ray CT imaging, and negative in 7, 2, and 2. The number of lesions identified was 0 (static imaging), 32 (SPECT), and 26(x-ray CT). There were no ''suspicious'' studies by any modality. This study indicates that Tc-99m HM-PAO SPECT cerebral blood flow imaging is more sensitive than x-ray CT for detecting brain metastases, that biplane imaging is not sensitive and SPECT is essential, and that for Tc-99m HM-PAO SPECT brain imaging to regain its importance with respect to x-ray CT, acquisition time must be 10 minutes or less and determination of percentage brain uptake of the injected dose, and of regional distribution, is necessary
Clinical applications of brain perfusion imaging with 99mTc-HM-PAO
International Nuclear Information System (INIS)
Lin Xiangtong
1989-01-01
200 patients with central nervous system diseases were studied with 99m Tc-HM-PAO and SPECT, including Parkinson's disease (PD) 47, Vascular headache 69, CVD 34, Epilepsy 26, Head truma 10, Brain tumor 5 and other 9 cases. Part of them have been compared with the results of MRI, X-CT and EEG. The positivity of SPECT in PD is 61.7% with decrease perfusion in local area of cerebram and basal ganglia and only 4 cases had lower perfusion in cerebellum; in headache is 46.4%, showing variable perfusion patterns; in CVD is 79.4% with decrease perfusion, luxury perfusion and the phenomenon of 'diaschsis'. In epilepsy, the abnormal foci mostly localize in temporal lobe and have close relation to the results of EEG. In brain tumor it also denotes decreased uptake of tracer. The clinicl singnificance of brain perfusion imaging with 99m Tc-HM-PAO was discussed
Thermal conductivity improvement in carbon nanoparticle doped PAO oil: An experimental study
Shaikh, S.; Lafdi, K.; Ponnappan, R.
2007-03-01
The present work involves a study on the thermal conductivity of nanoparticle-oil suspensions for three types of nanoparticles, namely, carbon nanotubes (CNTs), exfoliated graphite (EXG), and heat treated nanofibers (HTT) with PAO oil as the base fluid. To accomplish the above task, an experimental analysis is performed using a modern light flash technique (LFA 447) for measuring the thermal conductivity of the three types of nanofluids, for different loading of nanoparticles. The experimental results show a similar trend as observed in literature for nanofluids with a maximum enhancement of approximately 161% obtained for the CNT-PAO oil suspension. The overall percent enhancements for different volume fractions of the nanoparticles are highest for the CNT-based nanofluid, followed by the EXG and the HTT. The findings from this study for the three different types of carbon nanoparticles can have great potential in the field of thermal management.
Energy Technology Data Exchange (ETDEWEB)
Stiglich, F; Bonomo, F; Barbonetti, C; Di Lorenzo, I; Bottinelli, G [Ospedale Civile, Sondrio (Italy). Div. di Medicina Nucleare e Radioterapia; Tomaiolo, S [Ospedale Civile, Sondrio (Italy). Div. di Neurologia; Campani, R; Bottinelli, O [Pavia Univ. (Italy). Ist. di Radiologia
1991-01-01
Five patients presenting with migraine attacks underwent Electroencephalography (EEC), Computed Tomography (CT) and Single Photon Emission Tomography (SPET) with {sup 99m}Tc-HM PAO. EEG qand SPET were subsequently repeated in the intercritical period. We observed that two patients only showed non-specific abnormalities in EEG; scans were in all patients; all subjects exhibited diffuse cortical hypoperfusion. A strong correlation was always found between clinical presentation and hemispheric impairment. One patient exhibited asymmetrical perfusion between cerebellum hemispheres; intercritical SPET showed homogeneous distrubution of the radio-tracer in 4 patients. In the last one minimal residual hypoperfusion was observed, although less marked than in the acute phase. Therefore SPET with {sup 99m}Tc-HM PAO can be reasonably employed as the examination of choice when a migrain attack is clinically suspected, because of its reproducibility and reliability. It can be easily performed in every nuclear medical center supplied with modern tomographic cameras.
International Nuclear Information System (INIS)
Smith, F.W.; Besson, J.A.; Gemmell, H.G.; Sharp, P.F.
1988-01-01
One hundred fourteen patients suffering from neuropsychiatric conditions have been studied using 99mTc-labeled hexamethylpropyleneamine oxime (HM-PAO) and single photon emission computed tomography (SPECT). Ninety-one patients had a firm clinical diagnosis while 23 were examined without knowledge of the clinical diagnosis. Of the 91 patients, 51 were suffering from dementia, 25 multi-infarct type and 26 Alzheimer's disease. In 19 of the Alzheimer's patients, a characteristic pattern of decreased perfusion in the parieto-occipital regions was demonstrated while those with multi-infarct type showed varying degrees of irregular uptake in the cerebral cortex. These appearances are similar to those shown with positron emission tomography (PET) and we believe that HM-PAO will provide a widely available method for identifying patients with Alzheimer's disease. Twenty-nine patients were suffering from diseases involving the basal ganglia. Fifteen patients with Parkinson's disease showed no significant abnormality in basal ganglia uptake, while 7 or 8 patients with Huntington's disease who had full examinations showed decreased uptake in the caudate nuclei. Similarly, four of six patients with other basal ganglia diseases showed impaired uptake by basal ganglia, and it is concluded that HM-PAO may be useful for the diagnosis and management of this type of patient. Twenty-three patients received HM-PAO imaging as part of their diagnostic work-up; in 19 of them, detailed follow-up was obtained, which indicated that in 7 cases the result of the HM-PAO scan altered the clinical diagnosis and in 9 cases resulted in a change in management. In the remaining 13 cases, the study was found to be helpful in confirming the diagnosis
Special applications of [sup 99m]Tc-HM-PAO SPECT in the evaluation of cerebral hemodynamics
Energy Technology Data Exchange (ETDEWEB)
Kobayashi, Shigeki; Kageyama, Yuhsuke (Chiba Emergency Medical Center (Japan)); Namba, Hiroki (and others)
1991-12-01
[sup 99m]Tc-HM-PAO has been widely used as a brain-perfusion tracer. It is known that this lipophilic tracer crosses the blood-brain barrier with a high-pass extraction fraction, is deposited in the brain proportional to the cerebral blood flow, and shows a nearly constant maintenance of the regional distribution over several hours. Taking advantage of these characteristics of the tracer, we evaluated changes in the cerebral blood flow before and after recanalization therapy in the acute stage of stroke. Recent advances in catheterization technique have made it possible to introduce a catheter superselectively into smaller cerebral vessels, such as anterior, middle, and posterior cerebral arteries and external carotid artery branches. We ourselves evaluated the areas and concentrations of anti-cancer agents by injecting HM-PAO through the microcatheter used for superselective intra-arterial chemotherapy. We also visualized the areas supplied by the grafted vessels after bypass surgery for ischemic cerebrovascular diseases by the superselective infusion of HM-PAO. We found these techniques to be useful in clinical neurosurgery. (author).
Baumgardner, James E; Markstaller, Klaus; Pfeiffer, Birgit; Doebrich, Marcus; Otto, Cynthia M
2002-12-15
One of the proposed mechanisms of ventilator-associated lung injury is cyclic recruitment of atelectasis. Collapse of dependent lung regions with every breath should lead to large oscillations in PaO2 as shunt varies throughout the respiratory cycle. We placed a fluorescence-quenching PO2 probe in the brachiocephalic artery of six anesthetized rabbits after saline lavage. Using pressure-controlled ventilation with oxygen, ventilator settings were varied in random order over three levels of positive end-expiratory pressure (PEEP), respiratory rate (RR), and plateau pressure minus PEEP (Delta). Dependence of the amplitude of PaO2 oscillations on PEEP, RR, and Delta was modeled by multiple linear regression. Before lavage, arterial PO2 oscillations varied from 3 to 22 mm Hg. After lavage, arterial PO2 oscillations varied from 5 to 439 mm Hg. Response surfaces showed markedly nonlinear dependence of amplitude on PEEP, RR, and Delta. The large PaO2 oscillations observed provide evidence for cyclic recruitment in this model of lung injury. The important effect of RR on the magnitude of PaO2 oscillations suggests that the static behavior of atelectasis cannot be accurately extrapolated to predict dynamic behavior at realistic breathing frequencies.
Okusa, Philippe N; Rasamiravaka, Tsiry; Vandeputte, Olivier; Stévigny, Caroline; Jaziri, Mondher El; Duez, Pierre
2014-01-01
The fight against infectious diseases and antimicrobial resistances needs the exploration of new active compounds with new proprieties like disrupting quorum sensing (QS) mechanisms, which is a cell-to-cell communication that regulates bacterial virulence factors. In this work, leaves and root barks extracts of a Congolese medicinal plant, Cordia gilletii, were investigated for their effect on the production of Pseudomonas aeruginosa major virulence factors regulated by QS. The effect of C. gilletii extracts on virulence factors of P. aeruginosa PAO1 was studied by the evaluation of the production of pyocyanine, elastase and biofilm; and by the measurement of the expression of QS-related genes. The dichloromethane extract from root barks was found to quench the production of pyocyanin, a QS-dependent virulence factor in P. aeruginosa PAO1. Moreover, this extract specifically inhibits the expression of several QS-regulated genes (i.e. lasB, rhlA, lasI, lasR, rhlI, and rhlR) and reduces biofilm formation by PAO1. This study contributes to explain the efficacy of C. gilletii in the traditional treatment of infectious diseases caused by P. aeruginosa.
Okusa, Philippe N.; Rasamiravaka, Tsiry; Vandeputte, Olivier; Stévigny, Caroline; Jaziri, Mondher El; Duez, Pierre
2014-01-01
Aim: The fight against infectious diseases and antimicrobial resistances needs the exploration of new active compounds with new proprieties like disrupting quorum sensing (QS) mechanisms, which is a cell-to-cell communication that regulates bacterial virulence factors. In this work, leaves and root barks extracts of a Congolese medicinal plant, Cordia gilletii, were investigated for their effect on the production of Pseudomonas aeruginosa major virulence factors regulated by QS. Materials and Methods: The effect of C. gilletii extracts on virulence factors of P. aeruginosa PAO1 was studied by the evaluation of the production of pyocyanine, elastase and biofilm; and by the measurement of the expression of QS-related genes. Results: The dichloromethane extract from root barks was found to quench the production of pyocyanin, a QS-dependent virulence factor in P. aeruginosa PAO1. Moreover, this extract specifically inhibits the expression of several QS-regulated genes (i.e. lasB, rhlA, lasI, lasR, rhlI, and rhlR) and reduces biofilm formation by PAO1. Conclusion: This study contributes to explain the efficacy of C. gilletii in the traditional treatment of infectious diseases caused by P. aeruginosa. PMID:26401363
Directory of Open Access Journals (Sweden)
Morales Maria E
2005-02-01
Full Text Available Abstract Background Of the major families of long terminal repeat (LTR retrotransposons, the Pao/BEL family is probably the least well studied. It is becoming apparent that numerous LTR retrotransposons and other mobile genetic elements have colonized the genome of the human blood fluke, Schistosoma mansoni. Results A proviral form of Sinbad, a new LTR retrotransposon, was identified in the genome of S. mansoni. Phylogenetic analysis indicated that Sinbad belongs to one of five discreet subfamilies of Pao/BEL like elements. BLAST searches of whole genomes and EST databases indicated that members of this clade occurred in species of the Insecta, Nematoda, Echinodermata and Chordata, as well as Platyhelminthes, but were absent from all plants, fungi and lower eukaryotes examined. Among the deuterostomes examined, only aquatic species harbored these types of elements. All four species of nematode examined were positive for Sinbad sequences, although among insect and vertebrate genomes, some were positive and some negative. The full length, consensus Sinbad retrotransposon was 6,287 bp long and was flanked at its 5'- and 3'-ends by identical LTRs of 386 bp. Sinbad displayed a triple Cys-His RNA binding motif characteristic of Gag of Pao/BEL-like elements, followed by the enzymatic domains of protease, reverse transcriptase (RT, RNAseH, and integrase, in that order. A phylogenetic tree of deduced RT sequences from 26 elements revealed that Sinbad was most closely related to an unnamed element from the zebrafish Danio rerio and to Saci-1, also from S. mansoni. It was also closely related to Pao from Bombyx mori and to Ninja of Drosophila simulans. Sinbad was only distantly related to the other schistosome LTR retrotransposons Boudicca, Gulliver, Saci-2, Saci-3, and Fugitive, which are gypsy-like. Southern hybridization and bioinformatics analyses indicated that there were about 50 copies of Sinbad in the S. mansoni genome. The presence of ESTs
Effect of bacteriocin and exopolysaccharides isolated from probiotic on P. aeruginosa PAO1 biofilm.
Sharma, Vivek; Harjai, Kusum; Shukla, Geeta
2018-03-01
Microorganisms develop biofilms on indwelling medical devices and are associated with biofilm-related infections, resulting in substantial morbidity and mortality. Therefore, to prevent and control biofilm-associated infections, the present study was designed to assess the anti-biofilm potential of postbiotics derived from probiotic organisms against most prevalent biofilm-forming Pseudomonas aeruginosa PAO1. Eighty lactic acid bacteria isolated from eight neonatal fecal samples possessed antibacterial activity against P. aeruginosa PAO1. Among these, only four lactic acid bacteria produced both bacteriocin and exopolysaccharides but only one isolate was found to maximally attenuate the P. aeruginosa PAO1 biofilm. More specifically, the phenotypic and probiotic characterization showed that the isolated lactic acid bacteria were gram positive, non-motile, and catalase and oxidase negative; tolerated acidic and alkaline pH; has bile salt concentration; showed 53% hydrophobicity; and was found to be non-hemolytic. Phylogenetically, the organism was found to be probiotic Lactobacillus fermentum with accession no. KT998657. Interestingly, pre-coating of a microtiter plate either with bacteriocin or with exopolysaccharides as well as their combination significantly (p < 0.05) reduced the number of viable cells forming biofilms to 41.7% compared with simultaneous coating of postbiotics that had 72.4% biofilm-forming viable cells as observed by flow cytometry and confocal laser scanning microscopy. Therefore, it can be anticipated that postbiotics as the natural biointerventions can be employed as the prophylactic agents for medical devices used to treat gastrointestinal and urinary tract infections.
Clinical applications of brain perfusion imaging with sup 99m Tc-HM-PAO
Energy Technology Data Exchange (ETDEWEB)
Xiangtong, Lin [Shanghai Medical Univ. (China). Huashan Hospital; and others
1989-11-01
200 patients with central nervous system diseases were studied with {sup 99m}Tc-HM-PAO and SPECT, including Parkinson's disease (PD) 47, Vascular headache 69, CVD 34, Epilepsy 26, Head truma 10, Brain tumor 5 and other 9 cases. Part of them have been compared with the results of MRI, X-CT and EEG. The positivity of SPECT in PD is 61.7% with decrease perfusion in local area of cerebram and basal ganglia and only 4 cases had lower perfusion in cerebellum; in headache is 46.4%, showing variable perfusion patterns; in CVD is 79.4% with decrease perfusion, luxury perfusion and the phenomenon of 'diaschsis'. In epilepsy, the abnormal foci mostly localize in temporal lobe and have close relation to the results of EEG. In brain tumor it also denotes decreased uptake of tracer. The clinicl singnificance of brain perfusion imaging with {sup 99m}Tc-HM-PAO was discussed.
Zaitseva, Julia; Granik, Vladimir; Belik, Alexandr; Koksharova, Olga; Khmel, Inessa
2009-06-01
Antibacterial drugs in the nitrofuran series, such as nitrofurazone, furazidin, nitrofurantoin and nifuroxazide, as well as the nitric oxide generators sodium nitroprusside and isosorbide mononitrate in concentrations that do not suppress bacterial growth, were shown to increase the capacity of pathogenic bacteria Pseudomonas aeruginosa PAO1 and Burkholderia cenocepacia 370 to form biofilms. At 25-100microg/ml, nitrofurans 2-2.5-fold enhanced biofilm formation of P. aeruginosa PAO1, and NO donors 3-6-fold. For B. cenocepacia 370, the enhancement was 2-5-fold (nitrofurans) and 4.5-fold (sodium nitroprusside), respectively.
Energy Technology Data Exchange (ETDEWEB)
Gemmell, H G; Sharp, P F; Besson, J A.O.; Ebmeier, K P; Smith, F W
1988-10-01
SPECT images of the brain can be obtained using either /sup 123/I labelled amines or /sup 99m/Tc-hexamethylpropyleneamineoxime (HM-PAO). Both materials produce images which are blood flow dominated and so appear similar in normal subjects, although the respective mechanisms of uptake are not yet finally established. It seems likely, however, that the different mechanisms of uptake are responsible for recent reports of some differences seen in images obtained with the two types of agent in patients with cerebral pathology, mainly cerebrovascular disease. In this study, 12 demented patients, 6 with dementia of the Alzheimer type (DAT) and 6 with multi infarct dementia (MID), were imaged with /sup 123/I-isopropylamphetamine (IMP) and /sup 99m/Tc-HM-PAO and the images compared. Significantly more lesions were seen with IMP than HM-PAO (P < 0.02); out of a possible 120 sites, 41 lesions were seen with IMP compared to 28 with HM-PAO, 23 being seen with both agents. However, it is concluded that either agent can be used for the differential diagnosis of dementia, a task for which the new cerebral blood flow agents seem well suited.
HM-PAO-SPECT in complicated migraine. Case report
Energy Technology Data Exchange (ETDEWEB)
Gruenwald, F.; Ruhlmann, J.; Biersack, H.J.; Durwen, H.; Penin, H.
1988-10-01
Three HM-PAO-SPECT investigations have been performed in a female patient with a complicated migraine. 2.5 hours after an attack with right-sided numbness and atonic hemiparesis, at the left side a reduced blood flow was seen parietotemporally and in the subcortical structures. The cerebellum showed crossed diaschisis. During a symptom-free interval the SPECT showed a slightly increased parietotemporal blood blow and a reduced right temporooccipital blood flow. During a seizure with left-sided facial spasm, unsystematic clonic movements in all extremities and a following left-sided hemiparesis, the uptake in the visual cortex was increased by 60%. In the right frontotemporal and left temporal region a slightly increased accumulation was found.
DEFF Research Database (Denmark)
Orlandi, Viviana T; Bolognese, Fabrizio; Chiodaroli, Luca
2015-01-01
by exogenous photosensitizers and visible light. To evaluate whether P. aeruginosa pigments can contribute to its relative tolerance to PDT, we analysed the response to this treatment of isogenic transposon mutants of P. aeruginosa PAO1 with altered pigmentation. In general, in the presence of pigments...
Extraction of [99mTc]-d,l-HM-PAO across the blood-brain barrier
DEFF Research Database (Denmark)
Andersen, A R; Friberg, H; Knudsen, K B
1988-01-01
The initial extraction (E) across the blood-brain barrier (BBB) of [99mTc]-d,l-HM-PAO after intracarotid injection was measured in 14 Wistar rats and 6 patients using the double indicator, single injection method with Na-24 as the cotracer. In both series, cerebral blood flow (CBF) was measured...... was increased from 20 to 120 microliters, while using a 120 microliters bolus containing 10% albumin resulted in a decrease in E. This suggests that HM-PAO binding to albumin is not totally and rapidly reversible during a single passage through brain capillaries and that binding to blood elements may reduce...... the apparent extraction across brain capillaries. In patients using a bolus of 1 ml saline, E decreased linearly with increasing CBF (r = -0.81, p less than 0.001). For a CBF of 0.59 ml/g/min and an average apparent E of 0.72, an apparent PS product of 0.76 ml/g/min was calculated.(ABSTRACT TRUNCATED AT 250...
COMPARATIVE ANALYSIS ON PERFORMANCE OF POWER CONVERTERSFOR MPPT USING PAO TECHNIQUE
Dr. S. Rajeswari*
2017-01-01
This research work is mainly spotlight to identify a suitable power converter for tracking the Maximum Power Point, an analysis of MPPT based power converters has been carried out in this work. A PV system is a non-linear power source due to the variations in the climatic conditions, hence tracking the maximum power point is difficult. It mainly explains about the PAO algorithm based MPPT method to track the maximum power. It also discuss about different types of conventional power converters...
International Nuclear Information System (INIS)
Shah, M.; Shah, H.A.; Shah, F.S.
2015-01-01
To study the changes in physiological parameters i e PAO2, pulse and blood pressure changes during ECT under GA. Study Design: Quasi-experimental study. Place and Duration of Study: Department of Psychiatry and Department of Anaesthesiology, Combined Military Hospital Abbottabad from Sep 2009 to Feb 2010. Patients and Methods: A total of 50 patients with depression were given four separate ECT sessions each. All patients were anaesthetized using propofol 180-200 mg I/V and suxamethonium 50 mg i e 0.75-1 mg per kg I/V without atropine. They were stratified according to physiological changes including PAO2, pulse and blood pressure at 1, 2 and 5 min after ECT. Oxygen saturation was measured using a pulse oximeter, which measures saturations in the range of 65-100%. Results: Age range was 19-65 years; mean 46 years (SD+-13). Mean diastolic BP before ECT was 84.72 that decreased post ECT ie 78.02 and 77.46 and 74.44 at interval of 1, 2 and 5 minute respectively. Post-ECT pulse and PAO2 behaved similarly. Post ECT systolic BP decreased at 1 and 5 minutes. Pulse rate decreased after ECT. Conclusion: ECT under propofol is one of the most effective and safe modality of treatment for psychiatric patients under the supervision of qualified psychiatrists and anaesthesiologists and it gives more stable hemodynamic changes. (author)
Expression of the recA gene of Pseudomonas aeruginosa PAO is inducible by DNA-damaging agents
International Nuclear Information System (INIS)
Miller, R.V.; Kokjohn, T.A.
1988-01-01
Western (immunoblot) analysis using Escherichia coli anti-RecA antiserum revealed that expression of the RecA protein of Pseudomonas aeruginosa PAO is induced upon exposure of the bacterium to UV irradiation or norfloxacin, a quinolone related to nalidixic acid
Evaluation of 99mTc-HM-PAO thigh accumulation in patients with cerebro-vascular disease
International Nuclear Information System (INIS)
Nishigaki, Hiroshi; Adachi, Itaru; Komori, Tsuyoshi; Tatsu, Yoshimitsu; Hisada, Youichi; Sueyoshi, Kouzou; Narabayashi, Isamu
1993-01-01
Technetium-99m d,l-hexamethyl-propyleneamine oxime ( 99m Tc-HM-PAO) cerebral SPECT and whole body scintigraphy (WBS) were performed in 5 patients without cerebro-vascular disease (CVD) (Group 1), 31 patients with CVD but not hemiparesis (Group 2) and 18 patients with CVD and hemiparesis (Group 3). Four ROIs were drawn manually around the whole body (WB), brain (Br), right and left thigh (Th). We calculated some ratios: the total counts in the brain over the total counts in the whole body (Br/WB), the total counts in the thigh over the total counts in the whole body (Th/WB) and the mean counts in the thigh over the mean counts in the brain (Th/Br). The Br/WB was 6.9±1.8%, rt-Th/WB was 4.9±2.1%, lt-Th/WB was 5.1±1.3% and Th/Br was 0.46±0.17 in group 1. Whole body scintigraphies in group 1 revealed clear and similar images between right and left thigh. The Br/WB was 6.7±1.4%, Th/WB of paretic side was 4.6±1.0%, Th/WB of non-paretic side was 5.8±1.2% and Th/Br was 0.47±0.18 in group 3. The Th/WB in non paretic side was significantly higher than that in paretic side (p 99m Tc-HM-PAO. It was possible that we evaluated not only cerebral perfusion but also muscle atrophy and/or perfusion in patients with CVD using 99m Tc-HM-PAO. (author)
Directory of Open Access Journals (Sweden)
Ana Rita Otrelo-Cardoso
2014-01-01
Full Text Available The periplasmic aldehyde oxidoreductase PaoABC from Escherichia coli is a molybdenum enzyme involved in detoxification of aldehydes in the cell. It is an example of an αβγ heterotrimeric enzyme of the xanthine oxidase family of enzymes which does not dimerize via its molybdenum cofactor binding domain. In order to structurally characterize PaoABC, X-ray crystallography and small angle X-ray scattering (SAXS have been carried out. The protein crystallizes in the presence of 20% (w/v polyethylene glycol 3350 using the hanging-drop vapour diffusion method. Although crystals were initially twinned, several experiments were done to overcome twinning and lowering the crystallization temperature (293 K to 277 K was the solution to the problem. The non-twinned crystals used to solve the structure diffract X-rays to beyond 1.80 Å and belong to the C2 space group, with cell parameters a = 109.42 Å, b = 78.08 Å, c = 151.77 Å, β = 99.77°, and one molecule in the asymmetric unit. A molecular replacement solution was found for each subunit separately, using several proteins as search models. SAXS data of PaoABC were also collected showing that, in solution, the protein is also an αβγ heterotrimer.
99mTc-ECD and 99mTc-HM-PAO SPECT in five patients with MELAS
International Nuclear Information System (INIS)
Katagiri, Shinako; Nishimaki, Hiroshi; Kitano, Masashi; Horiike, Shigeharu; Kan, Shinichi; Ishii, Katsumi; Matsubayashi, Takashi; Sakai, Fumihiko
1998-01-01
Cerebral perfusion was studied in five patients with mitochondrial encephalomyopathy with lactic acidosis and stroke-like episodes syndrome (MELAS), using single photon emission computed tomography (SPECT) with 99m Tc-ethyl cysteinate dimer ( 99m Tc-ECD) or 99m Tc-hexamethyl propyleneamine oxime ( 99m Tc-HM-PAO). In four cases, regional cerebral blood flow (rCBF) was evaluated by the method reported by Mastuda et al. Immediately after the stroke-like episodes, accumulation of the tracer was relatively increased in the temporooccipital lobe, and also increased rCBF was shown in the same area. However, the region showed decreased radioactivity at the chronic stage, and rCBF decreased also. These findings are consistent with positron emission tomography (PET) at the acute stage and autopsy. 99m Tc-ECD SPECT and 99m Tc-HM-PAO SPECT may be useful in the diagnosis and assessment of the progress of the MELAS. (author)
Brain perfusion spect imaging with sup 99m Tc-HM-PAO in Parkinson's disease
Energy Technology Data Exchange (ETDEWEB)
Wenzhong, Song; Xiangtong, Lin [Shanghai Medical Univ. (China). Huashan Hospital
1991-02-01
Forty patients with Parkinson's disease were studied using {sup 99m}Tc-HM-PAO brain perfusion SPECT. 62.5% (25 cases) showed abnormal blood perfusion. Among them 55% showed local decreased blood perfusion of cerebral cortex, 22% showed asymmetric decreased blood perfusion in basal gaglia, 10% showed decreased uptake of tracer in cerebellum. The pathophysiologic basis of the abnormality of brain blood perfusion were briefly discussed.
Radiolabelling of sperm cells with 99mTc-HM-PAO
International Nuclear Information System (INIS)
Balogh, L.; Szasz, F.; Janoki, Gy.; Zoldag, L.; Huszenicza, Gy.
1992-01-01
The study of the influence of labelling volume on the labelling efficiency showed decreased yield when the volume was increased. The survival rate was unchanged over 0.5 ml of reaction volume. During labelling procedure only a few cells (6%) survived in the incubation volume was less than 0.4 ml. Changing the incubation time the radiolabelling yield increased for 10 minutes, and thereafter practically did not change. The optimum conditions of sperm labelling yielded a high labelling efficiency (70-80%) and survival rate (50-60%). The 99m Tc-HM-PAO labelled sperm cells seem to be suitable to study the in vivo and in vitro sperm transport. (author) 14 refs.; 5 figs.; 2 tabs
DEFF Research Database (Denmark)
Laux, D.C.; Corson, J.M.; Givskov, Michael Christian
2002-01-01
. In the present study, a lysophospholipid, 1-paimitoyl-2-hydroxy-sn-glycero-3-phosphate [also called monopalmitoylphosphatidic acid (MPPA)], which accumulates in inflammatory exudates, was shown to inhibit the extracellular accumulation of P. aeruginosa PAO1 alginate, elastase, LasA protease and the siderophore...
Evaluation of [sup 99m]Tc-HM-PAO thigh accumulation in patients with cerebro-vascular disease
Energy Technology Data Exchange (ETDEWEB)
Nishigaki, Hiroshi; Adachi, Itaru; Komori, Tsuyoshi; Tatsu, Yoshimitsu; Hisada, Youichi; Sueyoshi, Kouzou; Narabayashi, Isamu (Osaka Medical College, Takatsuki (Japan))
1993-06-01
Technetium-99m d,l-hexamethyl-propyleneamine oxime ([sup 99m]Tc-HM-PAO) cerebral SPECT and whole body scintigraphy (WBS) were performed in 5 patients without cerebro-vascular disease (CVD) (Group 1), 31 patients with CVD but not hemiparesis (Group 2) and 18 patients with CVD and hemiparesis (Group 3). Four ROIs were drawn manually around the whole body (WB), brain (Br), right and left thigh (Th). We calculated some ratios: the total counts in the brain over the total counts in the whole body (Br/WB), the total counts in the thigh over the total counts in the whole body (Th/WB) and the mean counts in the thigh over the mean counts in the brain (Th/Br).The Br/WB was 6.9[+-]1.8%, rt-Th/WB was 4.9[+-]2.1%, lt-Th/WB was 5.1[+-]1.3% and Th/Br was 0.46[+-]0.17 in group 1. Whole body scintigraphies in group 1 revealed clear and similar images between right and left thigh. The Br/WB was 6.7[+-]1.4%, Th/WB of paretic side was 4.6[+-]1.0%, Th/WB of non-paretic side was 5.8[+-]1.2% and Th/Br was 0.47[+-]0.18 in group 3. The Th/WB in non paretic side was significantly higher than that in paretic side (p<0.01). The thigh images in group 3 revealed clear differences between paretic and non-paretic thighes. In conclusion we could acquire the clear thigh images with [sup 99m]Tc-HM-PAO. It was possible that we evaluated not only cerebral perfusion but also muscle atrophy and/or perfusion in patients with CVD using [sup 99m]Tc-HM-PAO. (author).
Directory of Open Access Journals (Sweden)
Jiachuan Pan
Full Text Available BACKGROUND: Bacteria are well known to form dormant persister cells that are tolerant to most antibiotics. Such intrinsic tolerance also facilitates the development of multidrug resistance through acquired mechanisms. Thus persister cells are a promising target for developing more effective methods to control chronic infections and help prevent the development of multidrug-resistant bacteria. However, control of persister cells is still an unmet challenge. METHODOLOGY/PRINCIPAL FINDINGS: We show in this report that (Z-4-bromo-5-(bromomethylene-3-methylfuran-2(5H-one (BF8 can restore the antibiotic susceptibility of Pseudomonas aeruginosa PAO1 persister cells at growth non-inhibitory concentrations. Persister control by BF8 was found to be effective against both planktonic and biofilm cells of P. aeruginosa PAO1. Interestingly, although BF8 is an inhibitor of quorum sensing (QS in Gram-negative bacteria, the data in this study suggest that the activities of BF8 to revert antibiotic tolerance of P. aeruginosa PAO1 persister cells is not through QS inhibition and may involve other targets. CONCLUSION: BF8 can sensitize P. aeruginosa persister cells to antibiotics.
Directory of Open Access Journals (Sweden)
Vincent Ouedraogo
2016-10-01
Full Text Available Background: Due to its extensive arsenal of virulence factors and inherent resistance to antibiotics, Pseudomonas aeruginosa is a threat particularly in immunocompromised patients. Considering the central role of quorum sensing in the production of virulence factors, inhibition of bacterial communication mechanism constitute an opportunity to attenuate pathogenicity of bacteria resistant to available antibiotics. Our study aimed to assess the anti-quorum sensing activity of Anogeissus leiocarpus, traditionally used in Burkina Faso, for the treatment of infected burn wounds. Methods: Investigations were carried out on methanol extract from A. leiocarpus stem bark. The reporter strains Chromobacterium violaceum CV026 and P. aeruginosa PAO1 derivatives were used to evidence any interference with the bacterial quorum sensing and expression of related genes. P. aeruginosa PAO1 was used to measure the impact on pyocyanin production. Results: At a sub-inhibitory concentration (100 µg/mL, A. leiocarpus methanol extract quenched the quorum sensing mechanism of P. aeruginosa PAO1 by down-streaming the rhlR gene, with a subsequent reduction of pyocyanin production. Moreover, the antioxidant polyphenols evidenced are able to reduce the oxidative stress induced by pyocyanin. Conclusion: The antioxidant and anti-quorum sensing activities of A. leiocarpus stem bark could justify its traditional use in the treatment of infected burn wounds.
Energy Technology Data Exchange (ETDEWEB)
Moore, Murray E. [Los Alamos National Lab. (LANL), Los Alamos, NM (United States)
2014-07-18
This document details the distinction between using PAO (4 cSt polyalphaoelfin) oil instead of DOP (di-octyl phthalate) oil for measuring the aerosol capture of filters. This document is developed to justify the use of PAO rather than DOP for evaluating the performance of filters in the SAVY 4000 and Hagan containers. The design criteria (Anderson et al, 2012) for purchasing SAVY 4000 containers and the Safety Analysis Report for the SAVY 4000 Container Series specified that the filter must “capture greater than 99.97% of 0.45 μm mean diameter dioctyl phthalate (DOP) aerosol at the rated flow with a DOP concentration of 65±15 micrograms per liter.”This corresponds to a leakage percent of 0.03% (3.0x10-2). The density of DOP oil is 985 kg/m3 and the density of PAO oil is 819 kg/m3. ATI Test Inc measured the mass mean diameter of aerosol distributions produced by a single Laskin type III-A nozzle operating at a 20 psig air pressure as 0.563 μm for DOP oil and 0.549 μm for PAO oil. (See Appendix A.) For both types of oil in this document, the single fiber method calculated the leakage percent to be 4.4x10-5 for DOP oil and 4.7x10-5 for PAO oil. Although the percent error between these two quantities is 7.7%, these calculated leakage percent values are more than two orders of magnitude less than the criterion specified in the SAVY canister SAR. As a point of reference, the photometer used to measure the SAVY canister filter performance cannot resolve values for the leakage percent below 1.0x10-5. Additionally, over a range of particle sizes from 0.01 μm to 3.0 μm, there was less than 4.0x10-5 error between the calculated filter efficiency for the two types of oil at any particular particle size diameter. In conclusion, the difference between using DOP and PAO for testing SAVY canister filters is of inconsequential concern.
Molecular cloning and characterization of the recA gene of Pseudomonas aeruginosa PAO
Energy Technology Data Exchange (ETDEWEB)
Kokjohn, T.A.; Miller, R.V.
1985-08-01
The recA gene of Pseudomonas aeruginosa PAO has been isolated and introduced into Escherichia coli K-12. Resistance to killing by UV irradiation was restored in several RecA-E. coli K-12 hosts by the P. aeruginosa gene, as was resistance to methyl methanesulfonate. Recombination proficiency was also restored, as measured by HfrH-mediated conjugation and by the ability to propagate Fec-phage lambda derivatives. The cloned P. aeruginosa recA gene restored both spontaneous and mitomycin C-stimulated induction of lambda prophage in lysogens of a recA strain of E. coli K-12.
Autar, Reshma; Khan, A Salam; Schad, Matthias; Hacker, Jörg; Liskamp, Rob M J; Pieters, Roland J
2003-12-05
In order to evaluate their inhibition of bacterial adhesion, the carbohydrate sequences GalNAcbeta1-->4Gal and GalNAcbeta1-->4Galbeta1-->4Glc were synthesized. The disaccharide was conjugated to dendrons based on the 3,5-di-(2-aminoethoxy)-benzoic acid branching unit to yield di- and tetravalent versions of these compounds. A divalent compound was also prepared that had significantly longer spacer arms. Relevant monovalent compounds were prepared for comparison. Their anti-adhesion properties against F1C-fimbriated uropathogenic Escherichia coli were evaluated in an ELISA-type assay by using a recombinant strain and also by using Pseudomonas aeruginosa strains PAO and PAK. Adhesion inhibition was observed in all cases, and multivalency effects of up to one order of magnitude were observed. The combination of spacer and multivalency effects led to a 38-fold increase in the potency of a divalent inhibitor with long spacer arms towards the PAO strain when compared with the free carbohydrate.
International Nuclear Information System (INIS)
Yang, Wen; Li, Kan; Bai, Yuwei; Zhou, Ruimin; Zhou, Weihong; Bartlam, Mark
2010-01-01
PA3885 (TpbA), a tyrosine phosphatase, may function as a balancing factor between biofilm formation and motility in the opportunistic pathogen P. aeruginosa. Here, the expression, purification, crystallization and preliminary crystallographic analysis of PA3885 from P. aeruginosa PAO1 are reported. Biofilms are important in cell communication and growth in most bacteria and are also responsible for most human clinical infections and diseases. Quorum-sensing systems have been identified to be crucial for biofilm formation and regulation. PA3885 (TpbA), a tyrosine phosphatase, is reported to convert extracellular quorum-sensing signals into internal gene-cascade reactions that result in reduced biofilm formation in the opportunistic pathogen Pseudomonas aeruginosa. Here, PA3885 from P. aeruginosa PAO1 was expressed, purified and crystallized. Single crystals were studied by X-ray crystallography and native diffraction data were collected to 2.8 Å resolution. These crystals were determined to belong to space group C2. It was not possible to conclusively determine the number of proteins in the asymmetric unit from the preliminary X-ray diffraction data analysis alone and attempts to determine the crystal structure of PA3885 are currently under way
Directory of Open Access Journals (Sweden)
Artavazd Badalyan
2014-11-01
Full Text Available Biosensors for the detection of benzaldehyde and g-aminobutyric acid (GABA are reported using aldehyde oxidoreductase PaoABC from Escherichia coli immobilized in a polymer containing bound low potential osmium redox complexes. The electrically connected enzyme already electrooxidizes benzaldehyde at potentials below −0.15 V (vs. Ag|AgCl, 1 M KCl. The pH-dependence of benzaldehyde oxidation can be strongly influenced by the ionic strength. The effect is similar with the soluble osmium redox complex and therefore indicates a clear electrostatic effect on the bioelectrocatalytic efficiency of PaoABC in the osmium containing redox polymer. At lower ionic strength, the pH-optimum is high and can be switched to low pH-values at high ionic strength. This offers biosensing at high and low pH-values. A “reagentless” biosensor has been formed with enzyme wired onto a screen-printed electrode in a flow cell device. The response time to addition of benzaldehyde is 30 s, and the measuring range is between 10–150 µM and the detection limit of 5 µM (signal to noise ratio 3:1 of benzaldehyde. The relative standard deviation in a series (n = 13 for 200 µM benzaldehyde is 1.9%. For the biosensor, a response to succinic semialdehyde was also identified. Based on this response and the ability to work at high pH a biosensor for GABA is proposed by coimmobilizing GABA-aminotransferase (GABA-T and PaoABC in the osmium containing redox polymer.
A study of 99mTc-HM-PAO brain SPECT in the senile parkinson's disease
International Nuclear Information System (INIS)
Chen Wenxin; Lin Xiangtong; Song Wenzhong; Liu Yongchang
1996-01-01
Thirty-three cases of senile Parkinson's disease (PD) imaged by 99m Tc-HM-PAO brain SPECT were reported. 66.7% of the patients had cortical hypoperfusion and 18.2% showed asymmetrical hypoperfusion in the basal ganglia. Such a finding was not related with the Hoehn-Yahr stage and the laterality of motor symptoms. If complicated with dementia, the SPECT brain imaging showed similar pattern in Alzheimer's disease with diffuse hypoperfusion in cortical area reflecting widespread pathological changes in tremor paralysis
Directory of Open Access Journals (Sweden)
Sajal Sarabhai
Full Text Available BACKGROUND: Burgeoning antibiotic resistance in Pseudomonas aeruginosa has necessitated the development of anti pathogenic agents that can quench acylhomoserine lactone (AHL mediated QS with least risk of resistance. This study explores the anti quorum sensing potential of T. chebula Retz. and identification of probable compounds(s showing anti QS activity and the mechanism of attenuation of P. aeruginosa PAO1 virulence factors. METHODS AND RESULTS: Methanol extract of T. chebula Retz. fruit showed anti QS activity using Agrobacterium tumefaciens A136. Bioactive fraction (F7, obtained by fractionation of methanol extract using Sephadex LH20, showed significant reduction (p<0.001 in QS regulated production of extracellular virulence factors in P. aeruginosa PAO1. Biofilm formation and alginate were significantly (p<0.05 reduced with enhanced (20% susceptibility to tobramycin. Real Time PCR of F7 treated P. aeruginosa showed down regulation of autoinducer synthase (lasI and rhlI and their cognate receptor (lasR and rhlR genes by 89, 90, 90 and 93%, respectively. Electrospray Ionization Mass Spectrometry also showed 90 and 64% reduction in the production of 3-oxo-C(12HSL and C(4HSL after treatment. Decrease in AHLs as one of the mechanisms of quorum quenching by F7 was supported by the reversal of inhibited swarming motility in F7-treated P. aeruginosa PAO1 on addition of C(4HSL. F7 also showed antagonistic activity against 3-oxo-C(12HSL-dependent QS in E. coli bioreporter. C. elegans fed on F7-treated P. aeruginosa showed enhanced survival with LT50 increasing from 24 to 72 h. LC-ESI-MS of F7 revealed the presence of ellagic acid derivatives responsible for anti QS activity in T. chebula extract. CONCLUSIONS: This is the first report on anti QS activity of T. chebula fruit linked to EADs which down regulate the expression of lasIR and rhlIR genes with concomitant decrease in AHLs in P. aeruginosa PAO1 causing attenuation of its virulence factors
Pliuta, V A; Andreenko, Iu V; Kuznetsov, A E; Khmel', I A
2013-01-01
In the natural ecosystems, most bacteria exist as specifically organized biofilms attached to various surfaces; the biofilms have a complex architecture and are surrounded by an exopolymeric matrix. The bacteria in the biofilms are extremely resistant to antibacterial agents. The ability of the pathogenic bacteria to produce biofilms causes serious problems in medicine. Therefore, the study of the action of different compounds with antibacterial activity is of great interest. In this work, we studied the effect of the hydrogen peroxide (H2O2) on the formation of biofilms by Pseudomonas aeruginosa PAO1. It was shown that H2O2 in concentrations that do not suppress bacterial growth (or suppress it only weakly) stimulates the formation of the biofilms. At higher concentrations, H2O2 inhibits the formation of the biofilms. In order to determine if the stimulation of the biofilm formation depends on Quorum Sensing (QS) regulation, the plasmid pME6863 containing the heterologous gene aiiA encoding the N-acyl-homoserine lactonase AiiA was introduced into P. aeruginosa PAO1. The synthesis by cells of this enzyme degrading N-acyl-homoserine lactones (AHL), signaling molecules of the QS systems, led to the absence of the stimulation of the biofilm formation by the action of H2O2. This fact indicates that the stimulation of the biofilm formation in the presence of H2O2 depends on the functioning of the QS systems of the gene expression regulation of P. aeruginosa PAO1.
Directory of Open Access Journals (Sweden)
Yee Meng Chong
2018-04-01
Full Text Available The quorum sensing (QS system has been used by many opportunistic pathogenic bacteria to coordinate their virulence determinants in relation to cell-population density. As antibiotic-resistant bacteria are on the rise, interference with QS has been regarded as a novel way to control bacterial infections. As such, many plant-based natural products have been widely explored for their therapeutic roles. These natural products may contain anti-QS compounds that could block QS signals generation or transmission to combat QS pathogens. In this study, we report the anti-QS activities of four different Chinese herbal plant extracts: Poria cum Radix pini, Angelica dahurica, Rhizoma cibotii and Schizonepeta tenuifolia, on Pseudomonas aeruginosa PAO1. All the plants extracted using hexane, chloroform and methanol were tested and found to impair swarming motility and pyocyanin production in P. aeruginosa PAO1, particularly by Poria cum Radix pini. In addition, all the plant extracts also inhibited violacein production in C. violaceum CV026 up to 50% while bioluminescence activities were reduced in lux-based E. coli biosensors, pSB401 and pSB1075, up to about 57%. These anti-QS properties of the four medicinal plants are the first documentation that demonstrates a potential approach to attenuate pathogens’ virulence determinants.
Directory of Open Access Journals (Sweden)
Javiera Ortiz-Severín
2015-01-01
Full Text Available BACKGROUND: Pseudomonas aeruginosa is known to be a multidrug resistant opportunistic pathogen. Particularly, P. aeruginosa PAO1 polyphosphate kinase mutant (ppk1 is deficient in motility, quorum sensing, biofilm formation and virulence FINDINGS: By using Phenotypic Microarrays (PM we analyzed near 2000 phenotypes of P. aeruginosa PAO1 polyP kinase mutants (ppk1 and ppk2. We found that both ppk mutants shared most of the phenotypic changes and interestingly many of them related to susceptibility toward numerous and different type of antibiotics such as Ciprofloxacin, Chloramphenicol and Rifampicin CONCLUSIONS: Combining the fact that ppk1 mutants have reduced virulence and are more susceptible to antibiotics, polyP synthesis and particularly PPK1, is a good target for the design of molecules with anti-virulence and anti-persistence properties.
Feeding behaviour of Caenorhabditis elegans is an indicator of Pseudomonas aeruginosa PAO1 virulence
Directory of Open Access Journals (Sweden)
Shawn Lewenza
2014-08-01
Full Text Available Caenorhabditis elegans is commonly used as an infection model for pathogenesis studies in Pseudomonas aeruginosa. The standard virulence assays rely on the slow and fast killing or paralysis of nematodes but here we developed a behaviour assay to monitor the preferred bacterial food sources of C. elegans. We monitored the food preferences of nematodes fed the wild type PAO1 and mutants in the type III secretion (T3S system, which is a conserved mechanism to inject secreted effectors into the host cell cytosol. A ΔexsEΔpscD mutant defective for type III secretion served as a preferred food source, while an ΔexsE mutant that overexpresses the T3S effectors was avoided. Both food sources were ingested and observed in the gastrointestinal tract. Using the slow killing assay, we showed that the ΔexsEΔpscD had reduced virulence and thus confirmed that preferred food sources are less virulent than the wild type. Next we developed a high throughput feeding behaviour assay with 48 possible food colonies in order to screen a transposon mutant library and identify potential virulence genes. C. elegans identified and consumed preferred food colonies from a grid of 48 choices. The mutants identified as preferred food sources included known virulence genes, as well as novel genes not identified in previous C. elegans infection studies. Slow killing assays were performed and confirmed that several preferred food sources also showed reduced virulence. We propose that C. elegans feeding behaviour can be used as a sensitive indicator of virulence for P. aeruginosa PAO1.
Directory of Open Access Journals (Sweden)
Eren Yılmaz
2014-12-01
Full Text Available Objective: Blood analyses are preferred in the observation of cases requiring intensive care unit (ICU following a trauma. The purpose of this study was to examine the relationship of albumin, C-reactive protein (CRP, PaO2/FiO2 and glucose levels of trauma patients at time of admission with mortality. Material and Method: The patients who were admitted into ICU following a trauma between the years of 2010 and 2012 were retrospectively evaluated. 200 trauma cases were included in the study. Their demographic data, APACHE II scores, Glasgow Coma Scales (GCS, and arterial blood gas in the lactate and PaO2/FiO2 ratio, CRP, glucose and albumin levels in the first collected arterial blood gas, as well as, the presence of thoracic, cardiac, renal, abdominal and head trauma, length of ICU stay and mortality were recorded. Results: Of the patients included in the study 84% were male, with an average age of 38.3 and an average APACHE II score of 16.6. 64% suffered from head trauma and the average GCS was calculated to be 11.2. The patients were observed in the ICU for an average of 18.7 days and the rate of mortality was 33.5%. GCS, PaO2/FiO2, age and elevated lactate levels increased mortality as independent risk factors. Conclusion: It has been concluded that parameters like age and the first GCS, lactate, glucose, albumin and PaO2/FiO2 at time of acceptance into the ICU were found to be related with mortality.
Whiting, Jeremy; Edriss, Hawa; Yang, Shengping; Nugent, Kenneth
2016-06-01
Patients requiring mechanical ventilation can have complications related to their underlying diseases and hospital-related events. It is possible that easily obtained information early in the course of mechanical ventilation can provide information about important outcomes. Medical records from 281 episodes of mechanical ventilation in the medical intensive care unit were reviewed to collect information on patient demographics, admitting diagnoses, laboratory tests, duration of mechanical ventilation, the development of ventilator-associated events and mortality. Ventilator pressures from day 2 were analyzed for this study. Most patients (72.7%) were ≥50 years, 53.8% were men and 66.3% had a body mass index (BMI) ≥ 25kg/m(2).The mean Acute Physiology and Chronic Healthy Evaluation II score was 13.6 ± 5.9. The median initial PaO2/FiO2 was 240 with interquartile range of 177-414. The median duration of ventilation was 4 days (interquartile range: 2-9 days). A PaO2/FiO2 ratio 500, and a BMI > 30kg/m(2) was associated with decreased mortality compared with normal BMIs. A PaO2/FiO2 ratio 30kg/m(2) were all associated with having a ventilator-associated event. There was a positive correlation between peak pressure (day 2) and the duration of ventilation (r = 0.263, P = 0.007). Easily available information collected on day 2 of mechanical ventilation can help identify patients at risk for poor outcomes, including the duration of mechanical ventilation, the development of ventilator-associated complications and mortality. Prospective studies measuring peak pressures are needed to evaluate the utility of this simple measurement in the management of patients requiring mechanical ventilation. Published by Elsevier Inc.
Single photon emission tomography using sup(99m)Tc-HM-PAO in the investigation of dementia
Energy Technology Data Exchange (ETDEWEB)
Neary, D; Snowden, J S; Shields, R A; Burjan, A W.I.; Northen, B; Macdermott, N; Prescott, M C; Testa, H J
1987-09-01
Single photon emission tomographic imaging of the brain using sup(99m)Tc HM-PAO was carried out in patients with a clinical diagnosis of Alzheimer's disease, non-Alzheimer frontal-lobe dementia, and progressive supranuclear palsy. Independent assessment of reductions in uptake revealed posterior hemisphere abnormalities in the majority of the Alzheimer group, and selective anterior hemisphere abnormalities in both other groups. The findings were consistent with observed patterns of mental impairment. The imaging technique has potential value in the differential diagnosis of primary cerebral atrophy.
International Nuclear Information System (INIS)
Costa, D.C.; Ell, P.J.; Burns, A.; Philpot, M.; Levy, R.
1988-01-01
We present preliminary data on the utility of functional brain imaging with [99mTc]-d,l-HM-PAO and single photon emission computed tomography (SPECT) in the study of patients with dementia of the Alzheimer type (DAT), HIV-related dementia syndrome, and the on-off syndrome of Parkinson's disease. In comparison with a group of age-matched controls, the DAT patients revealed distinctive bilateral temporal and posterior parietal deficits, which correlate with detailed psychometric evaluation. Patients with amnesia as the main symptom (group A) showed bilateral mesial temporal lobe perfusion deficits (p less than 0.02). More severely affected patients (group B) with significant apraxia, aphasia, or agnosia exhibited patterns compatible with bilateral reduced perfusion in the posterior parietal cortex, as well as reduced perfusion to both temporal lobes, different from the patients of the control group (p less than 0.05). SPECT studies of HIV patients with no evidence of intracraneal space occupying pathology showed marked perfusion deficits. Patients with Parkinson's disease and the on-off syndrome studied during an on phase (under levodopa therapy) and on another occasion after withdrawal of levodopa (off) demonstrated a significant change in the uptake of [99mTc]-d,l-HM-PAO in the caudate nucleus (lower on off) and thalamus (higher on off). These findings justify the present interest in the functional evaluation of the brain of patients with dementia. [99mTc]-d,l-HM-PAO and regional cerebral blood flow (rCBF)/SPECT appear useful and highlight individual disorders of flow in a variety of neuropsychiatric conditions
Studies for labelling of leukocytes with sup 99m Tc-HM-PAO in vitro and animal experiments
Energy Technology Data Exchange (ETDEWEB)
Zhaoxiang, Gu; Xiangtong, Lin [Shanghai Medical Univ. (China). Huashan Hospital
1989-05-01
A technigue for in vitro labelling of human leukocytes with {sup 99m}Tc-HM-PAO is described. The percentage of labelled leukocytes is 43.0 +- 5.0 (mean +- SD, n = 6). Cell function was not impaired by the labelling procedure. Sterility and exclusion of bacterial endotoxins in the final cell suspensions were demonstrated. In experiments on dogs with abscess, scintigraphic imaging showed accumulation of radioactivity in inflammation lesions, indicating the viability of the labelled leukocytes.
Functional regional cerebral blood flow SPECT using 99mTc-HM-PAO by speech memory tasks
International Nuclear Information System (INIS)
Tohyama, Junko
1993-01-01
Using single photon emission computed tomography (SPECT) with Tc-99m HA-PAO, changes in regional cerebral blood flow (rCBF) by giving word memory and Miyake's tasks were determined for localizatin of speech memory function. Twice injection method of Tc-99m HM-PAO was used to obtain subtraction SPECT images; and positioning of the 1st and 2nd SPECT was determined by phantom study. To prevent artifacts and changes in rCBF as far as possible, the subjects were informed word fluency and Miyake's tasks sufficiently. When giving word fluency approach, an increase in rCBF was observed in both the operculum and the supratemporal convolution of dominant hemisphere. When giving Miyake's approach, it was observed predominantly in the supratemporal convolution of dominant hemisphere. Although it was also observed in the base of frontal lobe and operculum, there was no bilateral difference. An increased rCBF in the basal nucleus was more clearly observed by Miyake's than word fluency tasks without bilateral differences. There was no definitive increase in rCBF in the Papez's circuit responsible for memory and emotion by either word fluency or Miyake's tasks. In mentally mild disorder patients, an increased rCBF was observed in the same areas as those in normal subjects. In such patients having a decreased rCBF at rest, an increased rCBF was seen in the contralateral hemisphere and the surrounding areas of the lesions, suggesting compensatory mechanism. (N.K.) 65 refs
International Nuclear Information System (INIS)
Liboni, W.; Baggiore, P.; Chianale, G.; Marta, G.; Castellano, G.; Cornaglia, G.
1989-01-01
The relation between variations of cerebral and acute neurologic events, followed by partial or total recovery, has been investigated with SPECT HM-PAO and with ultrasound (TRANSCRANIAL DOPPLER). (H.W.). 3 refs.; 2 figs.; 2 tabs
[/sup 99m/Tc]-HM-PAO SPECT in Parkinson's disease
International Nuclear Information System (INIS)
Pizzolato, G.; Dam, M.; Borsato, N.; Saitta, B.; Da Col, C.; Perlotto, N.; Zanco, P.; Ferlin, G.; Battistin, L.
1988-01-01
Thirty-six patients affected by Parkinson's disease were studied using single photon emission computed tomography (SPECT) and [/sup 99m/Tc]-HM-PAO as a tracer. The scanning procedure was performed 16-24 h after discontinuation of specific therapy. Tracer activity ratios were determined in 10 pairs of cerebellar, cortical, and subcortical regions. Data were compared with those of 10 age-matched controls. Most of the regions examined did not show any relevant change between parkinsonian and control subjects. Notably, mean activity in striatal regions were similar in the two groups. Increased activity in caudate-putamen was found in patients who were on chronic DOPA therapy. Side-to-side asymmetries in the basal ganglia increased with the severity of the disease. Significant reductions of tracer uptake, from control values, were observed bilaterally in the parietal cortex. These deficits were more pronounced in patients with mental deterioration and in subjects who had been chronically treated with anticholinergic drugs. Parietal perfusion deficits in parkinsonian patients resemble those described in Alzheimer's dementia. These findings suggest that the heterogeneous alterations of regional cerebral blood flow (rCBF) in parkinsonian patients reflect the multifactorial pathophysiology of the disease
Energy Technology Data Exchange (ETDEWEB)
Costa, D.C.; Ell, P.J.; Burns, A.; Philpot, M.; Levy, R.
1988-12-01
We present preliminary data on the utility of functional brain imaging with (99mTc)-d,l-HM-PAO and single photon emission computed tomography (SPECT) in the study of patients with dementia of the Alzheimer type (DAT), HIV-related dementia syndrome, and the on-off syndrome of Parkinson's disease. In comparison with a group of age-matched controls, the DAT patients revealed distinctive bilateral temporal and posterior parietal deficits, which correlate with detailed psychometric evaluation. Patients with amnesia as the main symptom (group A) showed bilateral mesial temporal lobe perfusion deficits (p less than 0.02). More severely affected patients (group B) with significant apraxia, aphasia, or agnosia exhibited patterns compatible with bilateral reduced perfusion in the posterior parietal cortex, as well as reduced perfusion to both temporal lobes, different from the patients of the control group (p less than 0.05). SPECT studies of HIV patients with no evidence of intracraneal space occupying pathology showed marked perfusion deficits. Patients with Parkinson's disease and the on-off syndrome studied during an on phase (under levodopa therapy) and on another occasion after withdrawal of levodopa (off) demonstrated a significant change in the uptake of (99mTc)-d,l-HM-PAO in the caudate nucleus (lower on off) and thalamus (higher on off). These findings justify the present interest in the functional evaluation of the brain of patients with dementia. (99mTc)-d,l-HM-PAO and regional cerebral blood flow (rCBF)/SPECT appear useful and highlight individual disorders of flow in a variety of neuropsychiatric conditions.
Toomsalu, Eve; Koppel, Ilmar A; Burk, Peeter
2013-09-10
Gas-phase acidities and basicities were calculated for 64 neutral bases (covering the scale from 139.9 kcal/mol to 251.9 kcal/mol) and 53 neutral acids (covering the scale from 299.5 kcal/mol to 411.7 kcal/mol). The following methods were used: AM1, PM3, PM6, PDDG, G2, G2MP2, G3, G3MP2, G4, G4MP2, CBS-QB3, B1B95, B2PLYP, B2PLYPD, B3LYP, B3PW91, B97D, B98, BLYP, BMK, BP86, CAM-B3LYP, HSEh1PBE, M06, M062X, M06HF, M06L, mPW2PLYP, mPW2PLYPD, O3LYP, OLYP, PBE1PBE, PBEPBE, tHCTHhyb, TPSSh, VSXC, X3LYP. The addition of the Grimmes empirical dispersion correction (D) to B2PLYP and mPW2PLYP was evaluated, and it was found that adding this correction gave more-accurate results when considering acidities. Calculations with B3LYP, B97D, BLYP, B2PLYPD, and PBE1PBE methods were carried out with five basis sets (6-311G**, 6-311+G**, TZVP, cc-pVTZ, and aug-cc-pVTZ) to evaluate the effect of basis sets on the accuracy of calculations. It was found that the best basis sets when considering accuracy of results and needed time were 6-311+G** and TZVP. Among semiempirical methods AM1 had the best ability to reproduce experimental acidities and basicities (the mean absolute error (mae) was 7.3 kcal/mol). Among DFT methods the best method considering accuracy, robustness, and computation time was PBE1PBE/6-311+G** (mae = 2.7 kcal/mol). Four Gaussian-type methods (G2, G2MP2, G4, and G4MP2) gave similar results to each other (mae = 2.3 kcal/mol). Gaussian-type methods are quite accurate, but their downside is the relatively long computational time.
Technetium-99m HM-PAO-SPECT study of regional cerebral perfusion in early Alzheimer's disease
International Nuclear Information System (INIS)
Perani, D.; Di Piero, V.; Vallar, G.
1988-01-01
Regional cerebral perfusion was evaluated by single photon emission computed tomography (SPECT) using technetium-99m hexamethylpropyleneamine oxime ([/sup 99m/Tc]HM-PAO) in sixteen patients with Alzheimer's disease (AD) in early clinical phase and in 16 healthy elderly controls. In all patients transmission computed tomography (TCT) and/or magnetic resonance imaging (MRI) did not show focal brain abnormalities. Relative to normal subjects, AD patients showed significant reductions in cortical/cerebellar activity ratio: cortical perfusion was globally depressed with the largest reductions in frontal and posterior temporo-parietal cortices. Asymmetries of relative perfusion between cerebral hemispheres were also demonstrated when language was affected or visuospatial functions were unevenly impaired. In patients with early AD, SPECT provides functional information to be compared with clinical and psychometric data
Directory of Open Access Journals (Sweden)
Saravanan ePeriasamy
2015-08-01
Full Text Available Pseudomonas aeruginosa PAO1 produces three polysaccharides, alginate, Psl and Pel that play distinct roles in attachment and biofilm formation for monospecies biofilms. Considerably less is known about their role in the development of mixed species biofilm communities. This study has investigated the roles of alginate, Psl and Pel during biofilm formation of P. aeruginosa in a defined and experimentally informative mixed species biofilm community, consisting of P. aeruginosa, Pseudomonas protegens and Klebsiella pneumoniae. Loss of the Psl polysaccharide had the biggest impact on the integration of P. aeruginosa in the mixed species biofilms, where the percent composition of the psl mutant was significantly lower (0.06% than its wild-type parent (2.44%. In contrast, loss of the Pel polysaccharide had no impact on mixed species biofilm development. Loss of alginate or its overproduction resulted in P. aeruginosa representing 8.4% and 18.11%, respectively, of the mixed species biofilm. Dual species biofilms of P. aeruginosa and K. pneumoniae were not affected by loss of alginate, Pel or Psl, while the mucoid P. aeruginosa strain achieved a greater biomass than its parent strain. When P. aeruginosa was grown with P. protegens, loss of the Pel or alginate polysaccharides resulted in biofilms that were not significantly different from biofilms formed by the wild-type PAO1. In contrast, overproduction of alginate resulted in biofilms that were comprised of 35-40% of P. aeruginosa, which was significantly higher than the wild-type (5-20%. Loss of the Psl polysaccharide significantly reduced the percentage composition of P. aeruginosa in dual species biofilms with P. protegens (<1%. Loss of the Psl polysaccharide significantly disrupted the communal stress resistance of the three species biofilms. Thus, the polysaccharide composition of an individual species significantly impacts mixed species biofilm development and the emergent properties of such
Upgrading the Control Systems of Turbines of K-160-12.8 Type Produced by PAO Turboatom
Babayev, I. N.
2018-05-01
Steam turbines of a K-160-12.8 (PVK-150) type produced by PAO Turboatom are operated at thermal power plants from the 1960s and many of them still have the complete set that was installed at that time by the factory, but they have become out of date. For this reason, the problem of upgrading the turbines to bring their characteristics into compliance with modern requirements is relevant. This article describes the main technical decisions adopted by PAO Turboatom when upgrading the automatic control system (ACS) of a K-160-12.8 (PVK-150) turbine: replacing the control valves (CV); replacing the distributing mechanism; replacing the front support components, including the main servomotor and oil control pipes; and replacing the assembly of cutoff spools by separate spools of servomotors of high-pressure control valves and reheat control valves. The schematic diagram of the ACS and description of the structure of newly installed mechanisms are presented: the cutoff spools, the high-pressure CVs, the distribution mechanism, and the main servomotor. The particularity of the ACS is the presence of electromechanical converters, which are used in each cutoff spool. For improving operating reliability of the ACS by providing the actuation of servomotors of control valves for closing regardless of ACS commands, the connection of rods of the electromechanical converter and cutoff spools are made using spring-type uncoupling devices. For actuation of the protection system by the commands of the automatic electronic safety device, the separate actuator driven by an electromagnet is installed in the ACS. During further improvement of the protection system, it is recommended to replace the controller assembly by two-spool protection devices, remove the protection spool assembly, and increase the pressure in the protection lines up to power pressure. The upgrading during this project was carried out by the Dobrotvor TPP (Ukraine).
Assessment of the arterial input curve for [99mTc]-d,l-HM-PAO by rapid octanol extraction
DEFF Research Database (Denmark)
Andersen, A R; Friberg, H; Lassen, N A
1988-01-01
The in vitro conversion of the lipophilic molecule [99mTc]-d,l-hexamethylpropyleneamine oxime [( 99mTc]-d,l-HM-PAO) to a hydrophilic form was studied in saline, plasma, and blood at 37 degrees C by paper chromatography and by octanol extraction. The octanol:saline ratio was 79.9. From this value...... and the corresponding octanol: plasma and octanol:blood partitioning values, an estimate of the transport of the lipophilic compound by various components of blood was made: 20% is carried in hemoglobin, 53% by the plasma proteins and 27% by the water phases of the red blood cell and plasma. Octanol extraction provided...
99mTc-HM-PAO SPECT of epileptic patients showing focal paroxysm on electroencephalography
International Nuclear Information System (INIS)
Takaishi, Yasuko; Hashimoto, Kiyoshi; Fujino, Osamu; Kamayachi, Satoshi; Fujita, Takehisa; Enokido, Hisashi; Komatsuzaki, Hideki; Kawakami, Yasuhiko; Hirayama, Tsunenori
1995-01-01
The usefulness of 99m Tc-HM-PAO SPECT in diagnosing epilepsy was studied. The subjects were 33 epileptic patients, ranging in age from 5 years and 5 months to 28 years and 3 months, who showed focal paroxysm on electroencephalograms. Lowered accumulation site was found on SPECT in 19 patients. Four patients with abnormal findings on X-ray CT or MRI showed lowered accumulation and focal paroxysm at the same site. Of 29 patients with normal X-ray CT or MRI findings, 15 (52%) showed lowered accumulation. Five patients showed a focal paroxysm at the site of lowered accumulation. In 8 patients the focal paroxysm site was partly coincided with the accumulation site. In some patients the focal site predicted by the findings of clinical symptoms and the lowered accumulation site coincided. SPECT is therefore a useful method in diagnosing a focal site in epilepsy and considered to reflect the severity of disease. (Y.S.)
Energy Technology Data Exchange (ETDEWEB)
Frisoni, G.B.; Bianchetti, A.; Trabucchi, M. (Alzheimer' s Disease Care Unit, Ist. S. Cuore-FBF, Brescia (Italy)); Pizzolato, G.; Battistin, L. (Neurology Clinic, University Padua, Padua (Italy)); Chierichetti, F.; Ferlin, G. (Nuclear Medicine, Castelfranco Veneto Hospital, Treviso (Italy))
1994-03-01
Dementia of frontal type (DFT) is a fairly common degenerative disease distinct from Alzheimer's disease (AD), whose reportedly distinctive instrumental feature is frontal lobe hypoperfusion on SPECT. We evaluated the cortical dopaminergic system in 6AD, 5 DFT, and 6 control subjects with SPECT and both [[sup 99]Tc]-HM-PAO, a perfusion tracer, and [[sup 123]I]-IBZM, a D2 postsynaptic ligand. Both in AD and DFT patients, [[sup 99]Tc]-HM-PAO SPECT showed a relative frontal hypoperfusion. On the contrary, [[sup 123]I]-IBZM SPECT showed significantly reduced ligand uptake in superior frontal regions of DFT (0.89 [+-] 0.08 relative to control subjects) as compared to AD patients (0.97 [+-] 0.02; difference of means: 0.08, 95% confidence Interval 0.004 to 0.156; p = 0.041). Results suggest more marked involvement of the frontal cortical dopaminergic system in DFT than in AD patients. (au) (24 refs.).
Use of [/sup 99m/Tc]-HM-PAO in the diagnosis of primary degenerative dementia
International Nuclear Information System (INIS)
Testa, H.J.; Snowden, J.S.; Neary, D.; Shields, R.A.; Burjan, A.W.; Prescott, M.C.; Northen, B.; Goulding, P.
1988-01-01
The clinical value of single photon emission computed tomography (SPECT) in the differential diagnosis of dementia due to cerebral atrophy was evaluated by comparing the pattern of distribution [/sup 99m/Tc]-HM-PAO in three dementing conditions. Imaging was carried out in 26 patients with suspected Alzheimer's disease, 14 with dementia of the frontal-lobe type, and 13 with progressive supranuclear palsy. Images were evaluated and reported without knowledge of clinical diagnosis with respect to regions of reduced uptake of tracer. Reduced uptake in the posterior cerebral hemispheres was characteristic of Alzheimer's disease, while selective anterior hemisphere abnormalities characterized both dementia of the frontal-lobe type and progressive supranuclear palsy. The latter conditions could be distinguished on the basis of the appearance of integrity of the rim of the frontal cortex. The technique has an important role in the differentiation of degenerative dementias
Vasavi, Halkare Suryanarayana; Arun, Ananthapadmanabha Bhagwath; Rekha, Punchapady-Devasya
2014-05-01
Psidium guajava L., which has been used traditionally as a medicinal plant, was explored for anti-quorum sensing (QS) activity. The anti-QS activity of the flavonoid (FL) fraction of P. guajava leaves was determined using a biosensor bioassay with Chromobacterium violaceum CV026. Detailed investigation of the effects of the FL-fraction on QS-regulated violacein production in C. violaceum ATCC12472 and pyocyanin production, proteolytic, elastolytic activities, swarming motility and biofilm formation in Pseudomonas aeruginosa PAO1 was performed using standard methods. Possible mechanisms of QS-inhibition were studied by assessing violacein production in response to N-acyl homoserine lactone (AHL) synthesis in the presence of the FL-fraction in C. violaceum ATCC31532 and by evaluating the induction of violacein in the mutant C. violaceum CV026 by AHL extracted from the culture supernatants of C. violaceum 31532. Active compounds in the FL-fraction were identified by liquid chromatography-mass spectrometry (LC-MS). Inhibition of violacein production by the FL-fraction in a C. violaceum CV026 biosensor bioassay indicated possible anti-QS activity. The FL-fraction showed concentration-dependent decreases in violacein production in C. violaceum 12472 and inhibited pyocyanin production, proteolytic and elastolytic activities, swarming motility and biofilm formation in P. aeruginosa PAO1. Interestingly, the FL-fraction did not inhibit AHL synthesis; AHL extracted from cultures of C. violaceum 31532 grown in the presence of the FL-fraction induced violacein in the mutant C. violaceum CV026. LC-MS analysis revealed the presence of quercetin and quercetin-3-O-arabinoside in the FL-fraction. Both quercetin and quercetin-3-O-arabinoside inhibited violacein production in C. violaceum 12472, at 50 and 100 μg/mL, respectively. Results of this study provide scope for further research to exploit these active molecules as anti-QS agents. © 2014 The Societies and Wiley Publishing
Normal Control Study of Cerebral Blood Flow by 99mTc HM-PAO SPECT
International Nuclear Information System (INIS)
Koong, Sung Soo; Moon, Dae Hyuk; Lee, Bum Woo; Lee, Kyung Han
1989-01-01
Regional cerebral perfusion was evaluated in 15 normal controls by single photon emission computed tomography using 99m Tc HM-PAO. For quantitative analysis, 13 pairs of homologous region of interest (ROI) were drawn on three transverse slices matching the vascular territories and cerebral cortices, and normal values of 3 semiquantitative indices including 'Right to left ratio' (R/L ratio), 'Regional index' (RI), and 'Region to cerebellum ratio (R/cbll ratio) were calculated. Mean values of R/L ratios of homologous regions were ranged from 0.985 to 1.023, and mean ± 2 s.d. of all regions did not exceed 11% of mean. Significant difference of Rls (mean count per voxel of a ROI/mean count per voxel of total ROls) between regions were found (p<0.001) with highest values in occipital cortex and cerebellum. After attenuation correction, Rls in deep gray, cranial portion of anterior cerebral artery and vascular territories in the 2nd slice increased significantly (p<0.05-0.001) hut vise versa in other ROIs. Region to cerebellum ratios also showed regional difference similar to Rls.
Datta, Siraj; Jana, Debanjan; Maity, Tilak Raj; Samanta, Aveek; Banerjee, Rajarshi
2016-06-01
Quorum sensing (QS) plays an important role in virulence of Pseudomonas aeruginosa, blocking of QS ability are viewed as viable antimicrobial chemotherapy and which may prove to be a safe anti-virulent drug. Bioactive components from Piper betle have been reported to possess antimicrobial ability. This study envisages on the anti-QS properties of ethanolic extract of P. betle leaf (PbLE) using P. aeruginosa PAO1 as a model organism. A marked reduction in swarming, swimming, and twitching ability of the bacteria is demonstrated in presence of PbLE. The biofilm and pyocyanin production also shows a marked reduction in presence of PbLE, though it does not affect the bacterial growth. Thus, the studies hint on the possible effect of the bioactive components of PbLE on reducing the virulent ability of the bacteria; identification of bioactive compounds should be investigated further.
Directory of Open Access Journals (Sweden)
Qinna Cui
Full Text Available Gene duplication often provides selective advantages for the survival of microorganisms in adapting to varying environmental conditions. P. aeruginosa PAO1 possesses two seven-gene operons [phz1 (phzA1B1C1D1E1F1G1 and phz2 (phzA2B2C2D2E2F2G2] that are involved in the biosynthesis of phenazine-1-carboxylic acid and its derivatives. Although the two operons are highly homologous and their functions are well known, it is unclear how the two phz operons coordinate their expressions to maintain the phenazine biosynthesis. By constructing single and double deletion mutants of the two phz operons, we found that the phz1-deletion mutant produced the same or less amount of phenazine-1-carboxylic acid and pyocyanin in GA medium than the phz2-knockout mutant while the phz1-phz2 double knockout mutant did not produce any phenazines. By generating phzA1 and phzA2 translational and transcriptional fusions with a truncated lacZ reporter, we found that the expression of the phz1 operon increased significantly at the post-transcriptional level and did not alter at the transcriptional level in the absence of the phz2 operon. Surprisingly, the expression the phz2 operon increased significantly at the post-transcriptional level and only moderately at the transcriptional level in the absence of the phz1 operon. Our findings suggested that a complex cross-regulation existed between the phz1 and phz2 operons. By mediating the upregulation of one phz operon expression while the other was deleted, this crosstalk would maintain the homeostatic balance of phenazine biosynthesis in P. aeruginosa PAO1.
Patel, Manisha J; Patel, Arti T; Akhani, Rekha; Dedania, Samir; Patel, Darshan H
2016-07-01
Pseudomonas aeruginosa PAO1 phosphoglucose isomerase was purified as an active soluble form by a single-step purification using Ni-NTA chromatography that showed homogeneity on SDS-PAGE with molecular mass ∼62 kDa. The optimum temperature and pH for the maximum isomerization activity with D-galactose were 60 °C and 7.0, respectively. Generally, sugar phosphate isomerases show metal-independent activity but PA-PGI exhibited metal-dependent isomerization activity with aldosugars and optimally catalyzed the D-galactose isomerization in the presence of 1.0 mM MnCl2. The apparent Km and Vmax for D-galactose under standardized conditions were calculated to be 1029 mM (±31.30 with S.E.) and 5.95 U/mg (±0.9 with S.E.), respectively. Equilibrium reached after 180 min with production of 567.51 μM D-tagatose from 1000 mM of D-galactose. Though, the bioconversion ratio is low but it can be increased by immobilization and enzyme engineering. Although various L-arabinose isomerases have been characterized for bioproduction of D-tagatose, P. aeruginosa glucose phosphate isomerase is distinguished from the other L-arabinose isomerases by its optimal temperature (60 °C) for D-tagatose production being mesophilic bacteria, making it an alternate choice for bulk production.
Energy Technology Data Exchange (ETDEWEB)
Krylov, V.N.; Solov`era, T.I.; Burkal`tseva, M.V. [State Research Institute of Genetics and Selection of Industrial Microorganisms, Moscow (Russian Federation)] [and others
1995-08-01
Various mutations cancelling the lethal effect of phage lytic development and simultaneous phenotypic modifications were found in rare clones surviving after incubation at 42{degrees}C of Pseudomonas aeruginosa (D3112 cts15), lysogenic for thermoinducible mutant cts15 of the transposable prophage (TP) D3112. All mutations arose prior to thermal induction. Temperature induction of other bacteriophages (nontransposable) did not lead to selection of bacterial morphological mutants. Therefore, it was concluded that mutagenesis occurred upon the partial (reversible) TP derepression accompanied by coupled replication-transposition of TP, the latter being the direct cause of the mutator effect. Isolation of the P. aeruginosa PAO1 mutant R10 (this mutant is resistant to infection with TP at 42{degrees}C) allowed the proper selection and examination of numerous survivors. Comparison of their types derived from lysogens with different prophage location indicated that the number of secondary sites where TP integration is possible without the loss of cell viability is limited. Several transposition events occurred in the history of some survivors (during a repeated or single derepression event). Type D clones, which produce small colonies, are of special interest, because mechanisms underlying the survival of such clones are extremely diverse, and their phenotypes indicate the possibility of stable chromosomal rearrangements in the genome of P. aeruginosa. 16 refs., 2 figs., 2 tabs.
Quantitative measurement of regional cerebral blood flow using 99mTc-HM-PAO SPECT
International Nuclear Information System (INIS)
Tanaka, Hisashi; Nakamura, Yusaku; Yagi, Yuji; Miura, Kosuke; Takahashi, Mitsuo
1994-01-01
This study examined a simple method for measuring the regional cerebral blood flow (rCBF) using 99m Tc-HM-PAO SPECT. The mean CBF (mCBF) was determined by the Patlack plot method and rCBF was calculated with Lassen's correction algorithm, as reported by Matsuda et al. The cerebral hemisphere was employed as the reference region for Lassen's correction. The reference RI count rate was calculated from the left cerebral hemisphere at the basal ganglia level and the correction factor α was fixed at 2.0. As a result, rCBF could be measured more easily than by Matsuda's method. The contribution of age, laterality and gender to the CBF of normal subjects were studied. The mCBF value of 26 normal subjects was 53.8±6.4 ml/100 g/min and showed a significant correlation with advancing age (R=0.644, p=0.0004, n=26). The mean values for rCBF of the cerebellum, frontal area, temporal area, occipital area and parietal area were 77.3±6.6 ml/100 g/min, 70.2±9.1 ml/100 g/min, 72.3±7.5 ml/100 g/min, 71.8±6.2 ml/100 g/min and 73.8±8.6 ml/100 g/min, respectively. There were no gender or laterality differences in the mCBF or respective rCBF values. Each of the above listed regions, except for the occipital area, demonstrated a significant correlation with advancing age. The most remarkable decrease in rCBF with age was noted in the frontal area (R=0.757, p=0.001, n=26). (author)
Media Fill Test for validation of autologous leukocytes separation and labelling by (99m)Tc-HmPAO.
Urbano, Nicoletta; Modoni, Sergio; Schillaci, Orazio
2013-01-01
Manufacturing of sterile products must be carried out in order to minimize risks of microbiological contamination. White blood cells (WBC) labelled with (99m)Tc-exametazime ((99m)Tc-hexamethylpropyleneamine oxime; (99m)Tc-HMPAO) are being successfully applied in the field of infection/inflammation scintigraphy for many years. In our radiopharmacy lab, separation and labelling of autologous leukocytes with (99m)Tc-HMPAO were performed in a laminar flow cabinet not classified and placed in a controlled area, whereas (99m)Tc-HMPAO radiolabelling procedure was carried out in a hot cell with manipulator gloves. This study was conducted to validate this process using a Media Fill simulation test. The study was performed using sterile Tryptic Soy Broth (TSB) in place of active product, reproducing as closely as possible the routine aseptic production process with all the critical steps, as described in the our internal standard operative procedures (SOP). The final vials containing the media of each processed step were then incubated for 14 days and examined for the evidence of microbial growth. No evidence of turbidity was observed in all the steps assayed by the Media Fill. In the separation and labelling of autologous leukocytes with (99m)Tc-HmPAO, Media-Fill test represents a reliable tool to validate the aseptic process. Copyright © 2013 Elsevier Inc. All rights reserved.
Quantitative measurement of regional cerebral blood flow using {sup 99m}Tc-HM-PAO SPECT
Energy Technology Data Exchange (ETDEWEB)
Tanaka, Hisashi; Nakamura, Yusaku; Yagi, Yuji; Miura, Kosuke; Takahashi, Mitsuo [Kinki Univ., Osaka-Sayama, Osaka (Japan)
1994-10-01
This study examined a simple method for measuring the regional cerebral blood flow (rCBF) using {sup 99m}Tc-HM-PAO SPECT. The mean CBF (mCBF) was determined by the Patlack plot method and rCBF was calculated with Lassen`s correction algorithm, as reported by Matsuda et al. The cerebral hemisphere was employed as the reference region for Lassen`s correction. The reference RI count rate was calculated from the left cerebral hemisphere at the basal ganglia level and the correction factor {alpha} was fixed at 2.0. As a result, rCBF could be measured more easily than by Matsuda`s method. The contribution of age, laterality and gender to the CBF of normal subjects were studied. The mCBF value of 26 normal subjects was 53.8{+-}6.4 ml/100 g/min and showed a significant correlation with advancing age (R=0.644, p=0.0004, n=26). The mean values for rCBF of the cerebellum, frontal area, temporal area, occipital area and parietal area were 77.3{+-}6.6 ml/100 g/min, 70.2{+-}9.1 ml/100 g/min, 72.3{+-}7.5 ml/100 g/min, 71.8{+-}6.2 ml/100 g/min and 73.8{+-}8.6 ml/100 g/min, respectively. There were no gender or laterality differences in the mCBF or respective rCBF values. Each of the above listed regions, except for the occipital area, demonstrated a significant correlation with advancing age. The most remarkable decrease in rCBF with age was noted in the frontal area (R=0.757, p=0.001, n=26). (author).
Zhou, M; Ye, J
2017-11-28
Japanese physicians of Edo Period (1603-1867) wrote many dietetic books, by combining the knowledge system (content and compiling style) and thoughts of diet therapy from China with local condition in Japan. Among them, the Pao chu bei yong wo ming ben cao ( Japanese Materia Medica Prepared for Kitchen ), written by Mukai Genshou, a physician in the early Edo, is the earliest comprehensive work of dietetic materia medica. In this book, the choice and usage of Japanese dietetic materia medica reveals obvious Japanese local color, including the name, morphology, cultivation, collection, identification, nature and flavor, and indication etc., reflecting the sprouting idea of edible herbal plant at the beginning of Edo period and the characteristic of absorbing Chinese diet thoughts by Japanese physician. This is the important first-hand historical material to understand the development of Japanese dietetic herbalism in early Edo and its dietotherapy culture.
International Nuclear Information System (INIS)
Prayer, L.; Wimberger, D.; Oder, W.; Kramer, J.; Schindler, E.; Podreka, I.; Imhof, H.
1993-01-01
Eighteen patients in the subacute or chronic state following severe closed head injury with normal cranial CT scans were examined by MR and 99m Tc HM-PAO SPECT. Correlations were sought between these 2 imaging modalities and the clinical outcome, as defined by the Glasgow Outcome Scale (GOX) score. Both MR and SPECT revealed cerebral damage in all patients examined but structural and functional alterations did not coincide topographically in 64.9% of lesions. Nevertheless, complementary injury patterns suggesting poor recovery were found; cortical contusions and diffuse axonal injury (MR) in conjunction with cortical and thalamic hypoperfusion (SPECT) were noticed in 8 out of 12 patients with unfavorable outcome (GOS = III and IV). The synthesis of MR and SPECT information clearly enhanced the ability both to accurately assess posttraumatic brain damage and to improve patients' outcome prediction. (au) (18 refs.)
International Nuclear Information System (INIS)
Prayer, L.; Wimberger, D.; Oder, W.; Kramer, J.; Schindler, E.; Podreka, I.; Imhof, H.
1993-01-01
Eighteen patients in the subacute or chronic state following severe closed head injury with normal cranial CT scans were examined by MR and 99m Tc HM-PAO SPECT. Correlations were sought between these 2 imaging modalities and the clinical outcome, as defined by the Glasgow Outcome Scale (GOS) score. Both MR and SPECT revealed cerebral damage in all patients examined but structural and functional alterations did not coincide topographically in 64.9% of lesions. Nevertheless, complementary injury patterns suggesting poor recovery were found; cortical contusions and diffuse axonal injury (MR) in conjunction with cortical and thalamic hypoperfusion (SPECT) were noticed in 8 out of 12 patients with unfavorable outcome (GOS=III and IV). The synthesis of MR and SPECT information clearly enhanced the ability both to accurately assess posttraumatic brain damage and to improve patients' outcome prediction. (orig.)
Rella, M; Haas, D
1982-01-01
Resistance to high concentrations of nalidixic acid in Pseudomonas aeruginosa PAO was due to mutations in one locus designated nalA, which was mapped by transduction between hex-9001 and leu-10. The nalA mutants were cross-resistant to pipemidic acid, a nalidixic acid analog, at relatively low concentrations. Replicative DNA synthesis was resistant to both drugs in permeabilized cells of nalA mutants. A locus coding for low-level resistance to nalidixic acid, nalB, was cotransducible with pyrB, proC, and met-28. The nalB mutants were also resistant to low levels of pipemidic acid, novobiocin, and beta-lactam antibiotics (e.g., carbenicillin, azlocillin, and cefsulodin), but not to other drugs, such as gentamicin, rifampin, kanamycin, or tetracycline. In nalB mutants, DNA replication showed wild-type sensitivity to nalidixic acid, whereas carbenicillin-induced filamentation required higher drug levels than in the wild-type strain. Thus, nalB mutations appear to decrease cell permeability to some antibiotics. The sensitivity of replicative DNA synthesis to nalidixic acid and novobiocin was very similar in P. aeruginosa and Escherichia coli; by contrast, the concentrations of these drugs needed to inhibit growth of P. aeruginosa were higher than those reported for E. coli by one or two orders of magnitude. PMID:6821455
Energy Technology Data Exchange (ETDEWEB)
Prayer, L.; Wimberger, D.; Oder, W.; Kramer, J.; Schindler, E.; Podreka, I.; Imhof, H.
1993-11-01
Eighteen patients in the subacute or chronic state following severe closed head injury with normal cranial CT scans were examined by MR and [sup 99m]Tc HM-PAO SPECT. Correlations were sought between these 2 imaging modalities and the clinical outcome, as defined by the Glasgow Outcome Scale (GOX) score. Both MR and SPECT revealed cerebral damage in all patients examined but structural and functional alterations did not coincide topographically in 64.9% of lesions. Nevertheless, complementary injury patterns suggesting poor recovery were found; cortical contusions and diffuse axonal injury (MR) in conjunction with cortical and thalamic hypoperfusion (SPECT) were noticed in 8 out of 12 patients with unfavorable outcome (GOS = III and IV). The synthesis of MR and SPECT information clearly enhanced the ability both to accurately assess posttraumatic brain damage and to improve patients' outcome prediction. (au) (18 refs.).
Directory of Open Access Journals (Sweden)
G.H.M. eSagor
2016-02-01
Full Text Available The link between polyamine oxidases (PAOs, which function in polyamine catabolism, and stress responses remains elusive. Here, we address this issue using Arabidopsis pao mutants in which the expression of the five PAO genes is knocked-out or knocked-down. As the five single pao mutants and wild type (WT showed similar response to salt stress, we tried to generate the mutants that have either the cytoplasmic PAO pathway (pao1 pao5 or the peroxisomal PAO pathway (pao2 pao3 pao4 silenced. However, the latter triple mutant was not obtained. Thus, in this study, we used two double mutants, pao1 pao5 and pao2 pao4. Of interest, pao1 pao5 mutant was NaCl- and drought-tolerant, whereas pao2 pao4 showed similar sensitivity to those stresses as WT. To reveal the underlying mechanism of salt tolerance, further analyses were performed. Na uptake of the mutant (pao1 pao5 decreased to 75% of WT. PAO activity of the mutant was reduced to 62% of WT. The content of reactive oxygen species (ROS such as hydrogen peroxide, a reaction product of PAO action, and superoxide anion in the mutant became 81% and 72% of the levels in WT upon salt treatment. The mutant contained 2.8-fold higher thermospermine compared to WT. Moreover, the mutant induced the genes of salt overly sensitive-, abscisic acid (ABA-dependent- and ABA-independent- pathways more strongly than WT upon salt treatment. The results suggest that the Arabidopsis plant silencing cytoplasmic PAOs shows salinity tolerance by reducing ROS production and strongly inducing subsets of stress-responsive genes under stress conditions.
Directory of Open Access Journals (Sweden)
Huiming Tang
2018-03-01
Full Text Available Quorum sensing (QS regulates the behavior of bacterial populations and promotes their adaptation and survival under stress. As QS is responsible for the virulence of vast majority of bacteria, quorum quenching (QQ, the interruption of QS, has become an attractive therapeutic strategy. However, the role of QS in stress tolerance and the efficiency of QQ under stress in bacteria are seldom explored. In this study, we demonstrated that QS-regulated catalase (CAT expression and biofilm formation help Pseudomonas aeruginosa PAO1 resist nicotine stress. CAT activity and biofilm formation in wild type (WT and ΔrhlR strains are significantly higher than those in the ΔlasR strain. Supplementation of ΔlasI strain with 3OC12-HSL showed similar CAT activity and biofilm formation as those of the WT strain. LasIR circuit rather than RhlIR circuit is vital to nicotine tolerance. Acylase I significantly decreased the production of virulence factors, namely elastase, pyocyanin, and pyoverdine under nicotine stress compared to the levels observed in the absence of nicotine stress. Thus, QQ is more efficient under stress. To our knowledge, this is the first study to report that QS contributes to nicotine tolerance in P. aeruginosa. This work facilitates a better application of QQ for the treatment of bacterial infections, especially under stress.
Tang, Huiming; Zhang, Yunyun; Ma, Yifan; Tang, Mengmeng; Shen, Dongsheng; Wang, Meizhen
2018-01-01
Quorum sensing (QS) regulates the behavior of bacterial populations and promotes their adaptation and survival under stress. As QS is responsible for the virulence of vast majority of bacteria, quorum quenching (QQ), the interruption of QS, has become an attractive therapeutic strategy. However, the role of QS in stress tolerance and the efficiency of QQ under stress in bacteria are seldom explored. In this study, we demonstrated that QS-regulated catalase (CAT) expression and biofilm formation help Pseudomonas aeruginosa PAO1 resist nicotine stress. CAT activity and biofilm formation in wild type (WT) and Δ rhlR strains are significantly higher than those in the Δ lasR strain. Supplementation of Δ lasI strain with 3OC12-HSL showed similar CAT activity and biofilm formation as those of the WT strain. LasIR circuit rather than RhlIR circuit is vital to nicotine tolerance. Acylase I significantly decreased the production of virulence factors, namely elastase, pyocyanin, and pyoverdine under nicotine stress compared to the levels observed in the absence of nicotine stress. Thus, QQ is more efficient under stress. To our knowledge, this is the first study to report that QS contributes to nicotine tolerance in P. aeruginosa . This work facilitates a better application of QQ for the treatment of bacterial infections, especially under stress.
Directory of Open Access Journals (Sweden)
Kovalchuk Natalia О.
2018-01-01
Full Text Available The article is aimed at studying both foreign and national methods of determining the likelihood of bankruptcy of an enterprise, identifying their main advantages and disadvantages together with the possibility of using in the practice of domestic enterprises, and also determining the necessity of application in the enterprise of these methods for efficient functioning. As a result of research of the financial status of the PAO «Chernivtsi fat-and-oil plant» according to the methods of Tereshchenko, Taffler and Tisshou, Altman, Springate, Sayfullin and Kadykov, it has been found that among the existing models of forecasting bankruptcy there is no methodology presently that can provide reliable results for domestic enterprises. This means the relevance of this topic for a comprehensive research and detection of such methods of assessment of bankruptcy of enterprise. Use of the most optimal model for definition of bankruptcy can be effective in order to evaluate financial activity to prevent an enterprise from entering the group of the insolvent ones.
Williams, E M; Viale, J P; Hamilton, R M; McPeak, H; Sutton, L; Hahn, C E
2000-09-01
Tidal ventilation causes within-breath oscillations in alveolar oxygen concentration, with an amplitude which depends on the prevailing ventilator settings. These alveolar oxygen oscillations are transmitted to arterial oxygen tension, PaO2, but with an amplitude which now depends upon the magnitude of venous admixture or true shunt, QS/QT. We investigated the effect of positive end-expiratory pressure (PEEP) on the amplitude of the PaO2 oscillations, using an atelectasis model of shunt. Blood PaO2 was measured on-line with an intravascular PaO2 sensor, which had a 2-4 s response time (10-90%). The magnitude of the time-varying PaO2 oscillation was titrated against applied PEEP while tidal volume, respiratory rate and inspired oxygen concentration were kept constant. The amplitude of the PaO2 oscillation, delta PaO2, and the mean PaO2 value varied with the level of PEEP applied. At zero PEEP, both the amplitude and the mean were at their lowest values. As PEEP was increased to 1.5 kPa, both delta PaO2 and the mean PaO2 increased to a maximum. Thereafter, the mean PaO2 increased but delta PaO2 decreased. Clear oscillations of PaO2 were seen even at the lowest mean PaO2, 9.5 kPa. Conventional respiratory models of venous admixture predict that these PaO2 oscillations will be reduced by the steep part of the oxyhaemoglobin dissociation curve if a constant pulmonary shunt exists throughout the whole respiratory cycle. The facts that the PaO2 oscillations occurred at all mean PaO2 values and that their amplitude increased with increasing PEEP suggest that QS/QT, in the atelectasis model, varies between end-expiration and end-inspiration, having a much lower value during inspiration than during expiration.
Cakar, N; Tuŏrul, M; Demirarslan, A; Nahum, A; Adams, A; Akýncý, O; Esen, F; Telci, L
2001-04-01
To determine the time required for the partial pressure of arterial oxygen (PaO2) to reach equilibrium after a 0.20 increment or decrement in fractional inspired oxygen concentration (FIO2) during mechanical ventilation. A multi-disciplinary ICU in a university hospital. Twenty-five adult, non-COPD patients with stable blood gas values (PaO2/FIO2 > or = 180 on the day of the study) on pressure-controlled ventilation (PCV). Following a baseline PaO2 (PaO2b) measurement at FIO2 = 0.35, the FIO2 was increased to 0.55 for 30 min and then decreased to 0.35 without any other change in ventilatory parameters. Sequential blood gas measurements were performed at 3, 5, 7, 9, 11, 15, 20, 25 and 30 min in both periods. The PaO2 values measured at the 30th min after a step change in FIO2 (FIO2 = 0.55, PaO2[55] and FIO2 = 0.35, PaO2[35]) were accepted as representative of the equilibrium values for PaO2. Each patient's rise and fall in PaO2 over time, PaO2(t), were fitted to the following respective exponential equations: PaO2b + (PaO2[55]-PaO2b)(1-e-kt) and PaO2[55] + (PaO2[35]-PaO2[55])(e-kt) where "t" refers to time, PaO2[55] and PaO2[35] are the final PaO2 values obtained at a new FIO2 of 0.55 and 0.35, after a 0.20 increment and decrement in FIO2, respectively. Time constant "k" was determined by a non-linear fitting curve and 90% oxygenation times were defined as the time required to reach 90% of the final equilibrated PaO2 calculated by using the non-linear fitting curves. Time constant values for the rise and fall periods were 1.01 +/- 0.71 min-1, 0.69 +/- 0.42 min-1, respectively, and 90% oxygenation times for rises and falls in PaO2 periods were 4.2 +/- 4.1 min-1 and 5.5 +/- 4.8 min-1, respectively. There was no significant difference between the rise and fall periods for the two parameters (p > 0.05). We conclude that in stable patients ventilated with PCV, after a step change in FIO2 of 0.20, 5-10 min will be adequate for obtaining a blood gas sample to measure a PaO
Patel, Arti T; Akhani, Rekha C; Patel, Manisha J; Dedania, Samir R; Patel, Darshan H
2017-06-01
Aspartase (L-aspartate ammonia lyase, EC 4.3.1.1) catalyses the reversible amination and deamination of L-aspartic acid to fumaric acid which can be used to produce important biochemical. In this study, we have explored the characteristics of aspartase from Pseudomonas aeruginosa PAO1 (PA-AspA). To overproduce PA-AspA, the 1425-bp gene was introduced in Escherichia coli BL21 and purified. A 51.0-kDa protein was observed as a homogenous purified protein on SDS-PAGE. The enzyme was optimally active at pH 8.0 and 35 °C. PA-AspA has retained 56% activity after 7 days of incubation at 35 °C, which displays the hyperthermostablility characteristics of the enzyme. PA-AspA is activated in the presence of metal ions and Mg2+ is found to be most effective. Among the substrates tested for specificity of PA-AspA, L-phenylalanine (38.35 ± 2.68) showed the highest specific activity followed by L-aspartic acid (31.21 ± 3.31) and fumarate (5.42 ± 2.94). K m values for L-phenylalanine, L-aspartic acid and fumarate were 1.71 mM, 0.346 μM and 2 M, respectively. The catalytic efficiency (k cat /K m ) for L-aspartic acid (14.18 s -1 mM -1 ) was higher than that for L-phenylalanine (4.65 s -1 mM -1 ). For bioconversion, from an initial concentration of 1000 mM of fumarate and 30 mM of L-phenylalanine, PA-AspA was found to convert 395.31 μM L-aspartic acid and 3.47 mM cinnamic acid, respectively.
Directory of Open Access Journals (Sweden)
Bing-Xian Chen
2016-08-01
Full Text Available Seed germination is a complicated biological process that requires regulated enzymatic and non-enzymatic reactions. The action of polyamine oxidase (PAO produces hydrogen peroxide (H2O2, which promotes dicot seed germination. However, whether and, if so, how PAOs regulate monocot seed germination via H2O2 production is unclear. Herein, we report that the coleorhiza is the main physical barrier to radicle protrusion during germination of rice seed (a monocot seed and that it does so in a manner similar to that of dicot seed micropylar endosperm. We found that H2O2 specifically and steadily accumulated in the coleorhizae and radicles of germinating rice seeds and was accompanied by increased PAO activity as the germination percentage increased. These physiological indexes were strongly decreased in number by guazatine, a PAO inhibitor. We also identified 11 PAO homologs (OsPAO1–11 in the rice genome, which could be classified into four subfamilies (I, IIa, IIb, and III. The OsPAO genes in subfamilies I, IIa, and IIb (OsPAO1–7 encode PAOs, whereas those in subfamily III (OsPAO8–11 encode histone lysine-specific demethylases. In silico-characterized expression profiles of OsPAO1–7 and those determined by qPCR revealed that OsPAO5 is markedly upregulated in imbibed seeds compared with dry seeds and that its transcript accumulated to a higher level in embryos than in the endosperm. Moreover, its transcriptional abundance increased gradually during seed germination in water and was inhibited by 5 mM guazatine. Taken together, these results suggest that PAO-generated H2O2 is involved in coleorhiza-limited rice seed germination and that OsPAO5 expression accounts for most PAO expression and activity during rice seed germination. These findings should facilitate further study of PAOs and provide valuable information for functional validation of these proteins during seed germination of monocot cereals.
Shvetsov, V. L.; Babaev, I. N.
2017-09-01
The main technical solutions applied by PAO Turboatom used as the compensatory measures at the increase of the period of nonstop operation of nuclear power plants' (NPP) turbines with VVER-1000 type reactors up to 18 months are (1) replacing the standard hydraulic speed controller with an electronic one, (2) introduction of overclocking protection, (3) modernization of units of stop-control valves of high pressures, (4) installation of locking dampers on the receiver tubes of turbines of the first and second modification, and (5) improving the quality of repairs by reviewing the requirements for their implementation. The introduction of complex diagnostics of a control system on the basis of automatic treatment of results of registration of working parameters of the turbine is allocated as a separate prospective direction. Using an electronic controller of speed makes it possible to simplify the procedure of its inclusion in work at the failure of an electro-hydraulic system of control and vice versa. The regimes of maintaining the turbine rotor speed, steam pressure on the outlet of turbine, and the positions of main servomotors were introduced into the functions of the electronic controller. An electronic controller of speed includes its own electro-hydraulic transducer, turbine rotor speed sensor, and sensors of the position of main servomotors. Into the functions of electro- hydraulic control system and electronic speed controller, the function of overclocking protection, which determines the formation of commands for stopping the turbine at the exceeding of both the defined level of rotation speed and the defined combination of achieved rotation speed and angular acceleration of rotor, was introduced. To simplify the correction of forces acting on the control valve cups, the design of the cups was changed, and it has the profiled inserts. The solutions proposed were implemented on K-1100-60/1500-2M turbines of Rostov NPP. From the composition of control system
Adsorption of Pb2+, UO22+ onto bentonite polyacrylamidoxime composite
International Nuclear Information System (INIS)
Simsek, S.; Ulusoy, U.
2009-01-01
Polyacrylonitryl (PAN) and bentonite (B)-PAN composites were prepared by direct polymerization of pure AN and AN saturated suspensions of B. PAN and the composite were subjected to amidoximation procedure to obtain PAO and B-PAO. FT-IR, XRD and SEM were employed to characterize their structures. The sorption dependency of the materials on ion concentration, temperature and kinetics were then investigated for Pb 2 + and UO 2 2 +. All isotherms were L and H type of the Giles classification. For both ions, the adsorption capacities of B-PAO composite were higher than that of pure PAO, when the PAO contents of composites were normalized to pure PAO. The introduction of B in to PAO significantly increased the Langmuir equilibrium constants (L mol - 1), so as 353 and 2180 for Pb 2 + 1980 and 25900 for UO 2 2 + adsorption onto PAO and B-PAO respectively. The adsorption was enthalpy controlled. The studied features of the composites suggest that these materials should be considered amongst the new adsorbents. It is envisaged that the use of B-PAO composite will provide practicality and effectiveness for separation and removal procedures involving di/trivalent cations.
Keir, Iain; Daly, Jennifer; Haggerty, Jamie; Guenther, Christine
2016-07-01
To describe the effects of high flow oxygen therapy (HFOT) in canine patients failing traditional oxygen therapy (TOT). Retrospective study. Private referral practice. Six client-owned dogs with primary pulmonary hypoxemia. None. High flow oxygen was delivered by high flow nasal prongs to dogs assessed clinically to be failing TOTs. HFOT was able to significantly improve PaO2 compared to TOT in severely hypoxemic dogs (median, 133.75 mm Hg; range, 109.2-304.8) versus median 61.85 mm Hg (range, 52.3-71.8; xsP = 0.0412). Flow rates were significantly higher with HFOT compared to TOT (median, 688 mL/kg/min; range, 523-1,667 mL/kg/min) versus median 122 mL/kg/min (range, 80-208; P = 0.0412). Complications included patient discomfort requiring light sedation in 1/6 dogs and persistence of a pneumothorax in 1 dog. Hypoxemia resolved in 4/6 dogs. These data suggest HFOT is a viable clinical intervention for dogs with moderate-to-severe hypoxemia assessed to be failing TOT. Further studies are needed to determine if HFOT can be used as an alternative to mechanical ventilation in resource limited settings and to characterize the complications associated with this therapy. © Veterinary Emergency and Critical Care Society 2016.
Applegate, Richard L; Dorotta, Ihab L; Wells, Briana; Juma, David; Applegate, Patricia M
2016-09-01
The use of intraoperative pulse oximetry (SpO2) enhances hypoxia detection and is associated with fewer perioperative hypoxic events. However, SpO2 may be reported as 98% when arterial partial pressure of oxygen (PaO2) is as low as 70 mm Hg. Therefore, SpO2 may not provide advance warning of falling arterial oxygenation until PaO2 approaches this level. Multiwave pulse co-oximetry can provide a calculated oxygen reserve index (ORI) that may add to information from pulse oximetry when SpO2 is >98%. This study evaluates the ORI to PaO2 relationship during surgery. We studied patients undergoing scheduled surgery in which arterial catheterization and intraoperative arterial blood gas analysis were planned. Data from multiple pulse co-oximetry sensors on each patient were continuously collected and stored on a research computer. Regression analysis was used to compare ORI with PaO2 obtained from each arterial blood gas measurement and changes in ORI with changes in PaO2 from sequential measurements. Linear mixed-effects regression models for repeated measures were then used to account for within-subject correlation across the repeatedly measured PaO2 and ORI and for the unequal time intervals of PaO2 determination over elapsed surgical time. Regression plots were inspected for ORI values corresponding to PaO2 of 100 and 150 mm Hg. ORI and PaO2 were compared using mixed-effects models with a subject-specific random intercept. ORI values and PaO2 measurements were obtained from intraoperative data collected from 106 patients. Regression analysis showed that the ORI to PaO2 relationship was stronger for PaO2 to 240 mm Hg (r = 0.536) than for PaO2 over 240 mm Hg (r = 0.0016). Measured PaO2 was ≥100 mm Hg for all ORI over 0.24. Measured PaO2 was ≥150 mm Hg in 96.6% of samples when ORI was over 0.55. A random intercept variance component linear mixed-effects model for repeated measures indicated that PaO2 was significantly related to ORI (β[95% confidence interval] = 0
Zhang, Zhongheng; Ji, Xuqing
2016-10-13
Oxygen therapy is widely used in emergency and critical care settings, while there is little evidence on its real therapeutic effect. The study aimed to explore the impact of arterial oxygen partial pressure (PaO 2 ) on clinical outcomes in patients with sepsis. A large clinical database was employed for the study. Subjects meeting the diagnostic criteria of sepsis were eligible for the study. All measurements of PaO 2 were extracted. The primary endpoint was death from any causes during hospital stay. Survey data analysis was performed by using individual ICU admission as the primary sampling unit. Quadratic function was assumed for PaO 2 and its interaction with other covariates were explored. A total of 199,125 PaO 2 samples were identified for 11,002 ICU admissions. Each ICU stay comprised 18 PaO 2 samples in average. The fitted multivariable model supported our hypothesis that the effect of PaO 2 on mortality risk was in quadratic form. There was significant interaction between PaO 2 and SAPS-I (p = 0.007). Furthermore, the main effect of PaO 2 on SOFA score was nonlinear. The study shows that the effect of PaO 2 on mortality risk is in quadratic function form, and there is significant interaction between PaO 2 and severity of illness.
Air to muscle O2 delivery during exercise at altitude
DEFF Research Database (Denmark)
Calbet, J.A.; Lundby, C.
2009-01-01
, diffusion limitation explains most of the additional Pao2-Pao2. With altitude, acclimatization exercise (Pao2-Pao2) is reduced, but does not reach the low values observed in high altitude natives, who possess an exceptionally high DLo2. Convective O2 transport depends on arterial O2 content (Cao2), cardiac...
Zafar, Farhan; Khan, Muhammad S; Heinle, Jeffrey S; Adachi, Iki; McKenzie, E Dean; Schecter, Marc G; Mallory, George B; Morales, David L S
2012-04-01
In lung transplantation (LTx), the arterial partial pressure of oxygen (PaO(2)) is traditionally regarded as critical information for assessment of donor lung function. Each center sets its own thresholds; by convention, a donor PaO(2) of less than 300 mm Hg has been considered disqualifying. Limited literature exists to support such a practice. We analyzed all LTxs performed in the United States over a 9-year period to assess the effect of donor PaO(2) on graft survival. The United Network for Organ Sharing (UNOS) database was queried for LTx (January 2000-November 2009). Of 12,545 LTx performed, 12,045 (96%) had donor PaO(2) data on a fraction of inspired oxygen of 1.0, recorded at the time of procurement. Mean donor PaO(2) was 407 ± 140 mm Hg. The majority of LTxs had a donor PaO(2) greater than 300 mm Hg (9593 (80%]) whereas PaO(2) was 200 mm Hg or less in 1830 (15%) and 201 to 300 in 582 (5%) donors. Use of donors with a PaO(2) of less than 200 increased over time from 5% (45) in 2000 to 21% (295) in 2009 (P = .002). Kaplan-Meier survival analysis showed no difference in graft survival with differing donor PaO(2)s, irrespective of whether patients had a single or double LTx. A Cox multivariable analysis of 21 donor characteristics demonstrated that donor PaO(2) had no association with graft survival. Donor PaO(2) levels did not affect graft survival. The use of donors with lower PaO(2)s could substantially increase the donor pool. We are not suggesting that donor PaO(2) is not important when assessing potential lung donors but its level of importance in regard to other criteria appears less than previously believed. Copyright © 2012 The American Association for Thoracic Surgery. Published by Mosby, Inc. All rights reserved.
Risk factors for the need of hip arthroscopy following periacetabular osteotomy
DEFF Research Database (Denmark)
Hartig-Andreasen, Charlotte; Troelsen, Anders; Thillemann, Theis M
2015-01-01
was to identify risk factors predicting the need for a hip arthroscopy (HA) after periacetabular osteotomy (PAO). Ninety-nine patients (104 hips) scheduled for PAO were evaluated preoperatively and at 2-year follow-up. MRA was performed in all patients prior to PAO. At follow-up, patients were divided into a non-arthroscopy...... and arthroscopy group. The two groups were compared clinical and radiological, and risk factors for HA after PAO were calculated. Patient reported outcome measures (WOMAC, Oxford Hip and SF36) were filled out before PAO and at follow-up. Ninety-five hips (91.3%) were evaluated. Twenty-six hips (27%) required...... an arthroscopy within 2 years of the PAO. Risk factors were preoperative borderline dysplasia, acetabular retroversion and complete labral detachment. Labral tearing, degeneration or hypertrophy did not negatively affect the outcome of PAO. Patients not requiring an arthroscopy had a statistically significant...
Periacetabular Osteotomy in patients with Hip Dysplasia investigated with Imaging Modalities
DEFF Research Database (Denmark)
Mechlenburg, Inger
2016-01-01
, cartilage and blood perfusion after PAO in patients with hip dysplasia. Furthermore, to investigate the relationship between the acetabular angles and health-related quality of life (QoL) after PAO. And finally, to study the level of radiation to the surgeon during PAO. Chapters 3 to 7 investigate the first......The minimal invasive periacetabular osteotomy (PAO) is a joint-preserving procedure that effectively corrects hip dysplasia, provides pain relief, improved radiographic results and a low rate of complications. The aim of this doctoral dissertation was to examine biological changes in bone...... is applied on 26 patients scheduled for PAO. In chapter 4, a cohort of patients with hip dysplasia are followed with Dual-energy X-ray absorptiometry (DXA) prior to and 1 and 2½ years after PAO to investigate changes in acetabular bone mineral density after PAO. Moreover, to examine whether bone mineral...
Kanner, R E; Crapo, R O
1986-04-01
The effects of alveolar oxygen tension (PAO2) on the single-breath carbon monoxide diffusing capacity (DLCO) were quantified and a factor was derived to accommodate for differences in PAO2 over commonly encountered altitudes and/or varying concentrations of oxygen in the test gas mixture (FIO2) We performed duplicate measurements of DLCO in 7 normal subjects with 6 different oxygen fractions (0.176, 0.196, 0.211, 0.22, 0.25, and 0.27). The PAO2 for each test was measured as the PO2 in the alveolar gas sample bag. DLCO varied inversely with PAO2 and changed by 0.35% for each mmHg change in PAO2 (r = -0.62, p less than 0.001). At an FIO2 of 0.25, PAO2 varied between subjects and was highly correlated with each subject's residual volume to total lung capacity ratio (r = -0.84, p less than 0.001). We suggest that laboratories can adjust the measured DLCO when PAO2 is not congruent to 120 mmHg by the following formula: DLCO (corrected = DLCO (measured) x [1.0 + 0.0035 (PAO2 - 120)].
Hayes, Don; Kopp, Benjamin T; Kirkby, Stephen E; Reynolds, Susan D; Mansour, Heidi M; Tobias, Joseph D; Tumin, Dmitry
2016-08-01
Donor PaO2 levels are used for assessing organs for lung transplantation (LTx), but survival implications of PaO2 levels in adult cystic fibrosis (CF) patients receiving LTx are unclear. UNOS registry data spanning 2005-2013 were used to test for associations of donor PaO2 with patient survival and bronchiolitis obliterans syndrome (BOS) in adult (age ≥ 18 years) first-time LTx recipients diagnosed with CF. The analysis included 1587 patients, of whom 1420 had complete data for multivariable Cox models. No statistically significant differences among donor PaO2 categories of ≤200, 201-300, 301-400, or >400 mmHg were found in univariate survival analysis (log-rank test p = 0.290). BOS onset did not significantly differ across donor PaO2 categories (Chi-square p = 0.480). Multivariable Cox models of patient survival supported the lack of difference across donor PaO2 categories. Interaction analysis found a modest difference in survival between the two top categories of donor PaO2 when examining patients with body mass index (BMI) in the lowest decile (≤16.5 kg/m(2)). Donor PaO2 was not associated with survival or BOS onset in adult CF patients undergoing LTx. Notwithstanding statistically significant interactions between donor PaO2 and BMI, there was no evidence of post-LTx survival risk associated with donor PaO2 below conventional thresholds in any subgroup of adults with CF.
Risk factors for the need of hip arthroscopy following periacetabular osteotomy
Hartig-Andreasen, Charlotte; Troelsen, Anders; Thillemann, Theis M.; Gelineck, John; Søballe, Kjeld
2015-01-01
Despite the frequency of labral tears in symptomatic developmental dysplasia of the hip, no consensus exists regarding the treatment of coexisting dysplasia of the hip and tearing of the acetabular labrum. The purpose of this prospective, MR arthrography (MRA) based 2-year follow-up study was to identify risk factors predicting the need for a hip arthroscopy (HA) after periacetabular osteotomy (PAO). Ninety-nine patients (104 hips) scheduled for PAO were evaluated preoperatively and at 2-year follow-up. MRA was performed in all patients prior to PAO. At follow-up, patients were divided into a non-arthroscopy and arthroscopy group. The two groups were compared clinical and radiological, and risk factors for HA after PAO were calculated. Patient reported outcome measures (WOMAC, Oxford Hip and SF36) were filled out before PAO and at follow-up. Ninety-five hips (91.3%) were evaluated. Twenty-six hips (27%) required an arthroscopy within 2 years of the PAO. Risk factors were preoperative borderline dysplasia, acetabular retroversion and complete labral detachment. Labral tearing, degeneration or hypertrophy did not negatively affect the outcome of PAO. Patients not requiring an arthroscopy had a statistically significant better outcome measured by patients reported outcome measures. After PAO, 27% of the hips needed intra-articular assessment. Conventional radiographs and MRA analysis can be used to identify predictors for patients requiring HA after PAO. At 2-year follow-up, the clinical outcome improved in all patients. However, those patients who had no need of a HA after their PAO had superior results. PMID:27011862
Cvetanovich, Gregory L.; Heyworth, Benton E.; Murray, Kerri; Yen, Yi-Meng; Kocher, Mininder S.; Millis, Michael B.
2015-01-01
To report the operative findings and outcomes of hip arthroscopy for recurrent pain following periacetabular osteotomy (PAO) for acetabular dysplasia. A departmental database was used to identify patients who underwent hip arthroscopy following PAO between 2000 and 2009. Demographic data, arthroscopic findings, functional outcome scores and patient satisfaction were analysed. Of 556 PAO patients, 17 hips in 16 patients (3.1%) underwent post-PAO hip arthroscopy. Mean age at PAO was 23.8 years, and mean age at arthroscopy was 27.0 years. Common hip arthroscopy findings included labral tears (13 hips, 81.3%), significant (≥grade 2) chondral changes (12 hips, 75%), cam impingement (7 hips, 43.8%) and pincer impingement (6 hips, 37.5%). At mean follow-up 2.8 years after arthroscopy, additional procedures had been performed in six hips (37.5%), including total hip arthroplasty in one hip. Post-PAO arthroscopy questionnaire revealed 85.7% of patients with improved hip pain, 57.1% improved hip stiffness and 57.1% improved hip function. There was no significant difference in functional outcome measures. Common post-PAO hip arthroscopy findings include labral tears, chondral changes and femoroacetabular impingement. Many patients reported subjective hip improvement from post-PAO arthroscopy, but hip outcome scores were unchanged and one-third of patients had further surgery. PMID:27011852
DEFF Research Database (Denmark)
Stokholm-Bjerregaard, Mikkel; McIlroy, Simon Jon; Nierychlo, Marta
2017-01-01
accumulating organisms (PAOs). Also considered important to EBPR are the glycogen accumulating organisms (GAOs), which are theorized to compete with the PAOs for resources at the expense of P removal efficiency. Numerous studies have sought to identify the PAOs and their GAOs competitors, with several...... sequencing. The microbial community structure in all plants was relatively stable over time. Evidence for the role of the proposed PAOs and GAOs in EBPR varies and is critically assessed, in light of their calculated amplicon abundances, to indicate which of these are important in full-scale systems...... plants. Despite observed high abundances of GAOs (periodically exceeding 20% of the amplicon reads), P removal performance was maintained, indicating that these organisms were not outcompeting the PAOs in these EBPR systems. Phylogenetic diversity within each of the PAOs and GAOs genera was observed...
Approaches and perioperative management in periacetabular osteotomy surgery
DEFF Research Database (Denmark)
Søballe, Kjeld; Troelsen, Anders
2012-01-01
.9 to 8.1 years) of 209 PAOs performed using this approach have shown Kaplan-Meier survivorship rates of 94.7% at 5 years and 88.6% at 8.1 years, with conversion to total hip arthroplasty as the end point. Perioperative management includes a patient education program, optimized pain treatment strategies...... (local infiltration analgesia), and a progressive mobilization and exercise program. The transsartorial approach coupled with a specific perioperative management program has proved successful for PAO surgery.......In the early days of periacetabular osteotomy (PAO), surgical approaches were characterized by extensive soft-tissue dissection. The Smith-Petersen approach (and iliofemoral modifications) and the ilioinguinal approach have traditionally been used for PAO. The optimal surgical approach for PAO...
Evaluation of a 99Tcm bound brain scanning agent for single photon emission computed tomography
DEFF Research Database (Denmark)
Andersen, A R; Hasselbalch, S G; Paulson, O B
1986-01-01
D,L HM-PAO-99Tcm (PAO) is a lipophilic tracer complex which is avidly taken up by the brain. We have compared the regional distribution of PAO with regional cerebral blood flow (CBF). CBF was measured by single photon emission computed tomography (SPECT) by Tomomatic 64 after 133Xe inhalation in 41...... patients. With the same SPECT the distribution of PAO was measured after intravenous injection. High resolution (HR) and low resolution (LR) studies were performed yielding a resolution of 6-10 mm (HR) and 15-20 mm (LR). PAO images showed close resemblance to 133Xe CBF tomograms. Only 20 per cent...... of the (decay corrected) brain counts were lost during 24 hours....
“Candidatus Propionivibrio aalborgensis”
DEFF Research Database (Denmark)
Albertsen, Mads; McIlroy, Simon Jon; Stokholm-Bjerregaard, Mikkel
2016-01-01
by wasting the biomass. However, glycogen accumulating organisms (GAOs) may reduce the EBPR efficiency as they compete for substrates with PAOs, but do not store excessive amounts of polyphosphate. PAOs and GAOs are thought to be phylogenetically unrelated, with the model PAO being the betaproteobacterial...
People’s Republic of China Scientific Abstracts No. 180
1977-11-25
translations of these articles. CONTENTS PAGE CHIH-WU HSUEH-PAO [ACTA BOTANICA SINICA] No 1, March 1977 1 K’UN-CH’UNG HSUEH-PAO [ACTA ENTOMOLOGICA...March 1977. 28 TUNG-WU HSUEH-PAO [ACTA ZOOLOGICA SINICA] No 2, June.1977 41 a - [III - CC - 70 S § T] ACTA BOTANICA SINICA AUTHOR...HSUEH-PAO [ACTA BOTANICA SINICA] in Chinese Vol 19 No 1, Mar 77 pp 7-10 TEXT OF ENGLISH ABSTRACT: In 1964, we some young teachers and students in
DEFF Research Database (Denmark)
Wu, H; Song, Z; Givskov, Michael
2001-01-01
To understand the importance of quorum sensing in chronic Pseudomonas aeruginosa lung infection, the in vivo pathogenic effects of the wild-type P. aeruginosa PAO1 and its double mutant, PAO1 lasI rhlI, in which the signal-generating parts of the quorum sensing systems are defective were compared....... The rat model of P. aeruginosa lung infection was used in the present study. The rats were killed on days 3, 7, 14 and 28 after infection with the P. aeruginosa strains. The results showed that during the early stages of infection, the PAO1 double mutant induced a stronger serum antibody response, higher...... number of lung bacteria, and minor serum IgG and IgG1 responses but increased lung interferon gamma production were detected in the group infected with the PAO1 double mutant when compared with the PAO1-infected group. Delayed immune responses were observed in the PAO1-infected group and they might...
DEFF Research Database (Denmark)
Wu, H.; Song, Z.J.; Givskov, Michael Christian
2001-01-01
To understand the importance of quorum sensing in chronic Pseudomonas aeruginosa lung infection, the in vivo pathogenic effects of the wild-type P aeruginosa PAO1 and its double mutant, PAO1 lasI rhlI, in which the signal-generating parts of the quorum sensing systems are defective were compared....... The rat model of P. aeruginosa lung infection was used in the present study. The rats were killed on days 3, 7, 14 and 28 after infection with the P. aeruginosa strains. The results showed that during the early stages of infection, the PAO1 double mutant induced a stronger serum antibody response, higher...... number of lung bacteria, and minor serum IgG and IgG1 responses but increased lung interferon gamma production were detected in the group infected with the PAO1 double mutant when compared with the PAO1-infected group. Delayed immune responses were observed in the PAO1-infected group and they might...
DEFF Research Database (Denmark)
McIlroy, Simon Jon; Albertsen, Mads; Stokholm-Bjerregaard, Mikkel
Enhanced biological phosphorus removal (EBPR) is widely applied for phosphorus removal from wastewater. The process relies on polyphosphate-accumulating organisms (PAOs) that are able to take up phosphorus in excess of what is needed for growth. However, glycogen-accumulating organisms (GAOs) may...... reduce the EBPR efficiency as they compete for substrates with PAOs, but do not store excess polyphosphate. “Candidatus Accumulibacter” is widely considered to be the important PAO. In this study a laboratory scale sequencing batch reactor was operated for EBPR for the enrichment of “Ca. Accumulibacter......”. Applying the PAOmix probe set, routinely applied to target the “Ca. Accumulibacter”, suggested a PAO enrichment of 70% of the biovolume by FISH. Known GAOs were detected in low abundance with FISH (PAO and GAO...
Developing Tools and Techniques to Increase Communication Effectiveness
Hayes, Linda A.; Peterson, Doug
1997-01-01
The Public Affairs Office (PAO) of the Johnson Space Center (JSC) is responsible for communicating current JSC Space Program activities as well as goals and objectives to the American Public. As part of the 1996 Strategic Communications Plan, a review of PAO' s current communication procedures was conducted. The 1996 Summer Faculty Fellow performed research activities to support this effort by reviewing current research concerning NASA/JSC's customers' perceptions and interests, developing communications tools which enable PAO to more effectively inform JSC customers about the Space Program, and proposing a process for developing and using consistent messages throughout PAO. Note that this research does not attempt to change or influence customer perceptions or interests but, instead, incorporates current customer interests into PAO's communication process.
Wakayama, H; Tazawa, H
1988-01-01
The gas exchange of chicken eggs takes place by molecular diffusion. The diffusion barrier between ambient atmosphere and erythrocyte hemoglobin of the gas exchanger (the vascularized chorioallantoic membrane) is conveniently divided into two parts by the air space in the fibrous shell membranes; i.e., the outer barrier (mainly the porous eggshell) and the inner barrier (the chorioallantoic membrane and the chemical reaction with hemoglobin). In contrast to the alveolar-arterial Po2 difference in vertebrate lungs, the difference of Po2 between the air space and the arterialized blood in the allantoic vein (delta PAo2.Pao2) is large in chick embryos. The present study analyzed the delta PAo2.Pao2 in relation to the diffusing capacity of the chorioallantoic membrane (inner barrier) and physiological shunt in the allantoic circulation with respect to widely altered diffusive conductance of the shell (outer barrier). The shell diffusive conductance (Go2) was altered of the beginning of incubation, and the O2 consumption (Mo2) was measured on day 16. The Mo2 increased hyperbolically with increasing Go2, reached a maximum at control values of Go2 and decreased with further increases in Go2. From Go2 and Mo2, the air space Po2 was determined. The delta PAo2.Pao2 was increased in eggs with augmented Go2 (from about 50 torr in control eggs to 70 torr in conductance-increased eggs). The diffusing capacity and allantoic shunt which produce a given delta PAo2.Pao2 were estimated employing a microcomputer performing the Bohr integration procedure so that a calculated Pao2 agreed with the measured Pao2. The allantoic shunt is not more than 20%; 10% is likely. The diffusing capacity becomes maximum in intact control eggs and is decreased at both lowered and augmented Go2. At lowered Go2, diffusion limitation is responsible for about 90% of delta Pao2.Pao2 even in the presence of a 10% shunt. The diffusion limitation to blood oxygenation decreases as Go2 increases, but it is still
Tu, Yunjie; Schuler, Andrew J
2013-04-16
Glycogen-accumulating organisms (GAOs) are thought to compete with polyphosphate-accumulating organisms (PAOs) in enhanced biological phosphorus removal (EBPR) wastewater treatment systems. A laboratory sequencing batch reactor (SBR) was operated for one year to test the hypothesis that PAOs have a competitive advantage at low acetate concentrations, with a focus on low pH conditions previously shown to favor GAOs. PAOs dominated the system under conventional SBR operation with rapid acetate addition (producing high in-reactor concentrations) and pH values of 7.4-8.4. GAOs dominated when the pH was decreased (6.4-7.0). Decreasing the acetate addition rate led to very low reactor acetate concentrations, and PAOs recovered, supporting the study hypothesis. When the acetate feed rate was increased, EBPR failed again. Dominant PAOs and GAOs were Candidatus Accumulibacter phosphatis and Defluviicoccus Cluster 2, respectively, according to fluorescent in situ hybridization and 454 pyrosequencing. Surprisingly, GAOs were not the immediate causes of PAO failures, based on functional and population measurements. Pyrosequencing results suggested Dechloromonas and Tetrasphaera spp. may have also been PAOs, and additional potential GAOs were also identified. Full-scale systems typically have lower in-reactor acetate concentrations than laboratory SBRs, and so, previous laboratory studies may have overestimated the practical importance of GAOs as causes of EBPR failure.
Variability in targeted arterial oxygenation levels in patients with severe sepsis or septic shock
DEFF Research Database (Denmark)
Dahl, R. M.; Grønlykke, L.; Haase, N.
2015-01-01
of arterial oxygen (PaO2 ) and mortality. METHODS: We extracted data from two Scandinavian clinical trials of ICU patients with severe sepsis or septic shock. We calculated average PaO2 and fraction of inspired oxygen (FiO2 ) from trial inclusion and the following 5 days, and assessed the association between...... PaO2 and 90-day mortality. RESULTS: The median PaO2 was 9.8 kPa [5-95% range 6.4-19.9] and FiO2 was 0.51 [5-95% range 0.27-1.00], respectively. Eight hundred and five of 1,770 patients (45%) died. The relative risk of mortality was 1.43 [95% CI: 1.19-1.65] in patients with average PaO2 ....29 [95% CI: 0.84-1.68] in patients with average PaO2 ≥ 16 kPa, as compared to patients with average PaO2 10-12 kPa. The relative risk of mortality was 1.38 [95% CI: 1.17-1.58] in patients with an average FiO2 0.60-0.80 and 2.10 [95% CI: 1.88-2.23] in patients with an average FiO2 ≥ 0.80 as compared...
DEFF Research Database (Denmark)
Pedersen, Søren Damkiær; Yang, Lei; Molin, Søren
2013-01-01
of these genetic changes, we moved the specific mutations, alone and in combination, to the genome of the reference strain PAO1. The phenotypes of the engineered PAO1 derivatives showed striking similarities with phenotypes observed among the DK2 isolates. The phenotypes observed in the DK2 isolates and PAO1...
Stokholm-Bjerregaard, Mikkel; McIlroy, Simon J; Nierychlo, Marta; Karst, Søren M; Albertsen, Mads; Nielsen, Per H
2017-01-01
Understanding the microbiology of phosphorus (P) removal is considered essential to knowledge-based optimization of enhanced biological P removal (EBPR) systems. Biological P removal is achieved in these systems by promoting the growth of organisms collectively known as the polyphosphate accumulating organisms (PAOs). Also considered important to EBPR are the glycogen accumulating organisms (GAOs), which are theorized to compete with the PAOs for resources at the expense of P removal efficiency. Numerous studies have sought to identify the PAOs and their GAOs competitors, with several candidates proposed for each over the last few decades. The current study collectively assessed the abundance and diversity of all proposed PAOs and GAOs in 18 Danish full-scale wastewater treatment plants with well-working biological nutrient removal over a period of 9 years using 16S rRNA gene amplicon sequencing. The microbial community structure in all plants was relatively stable over time. Evidence for the role of the proposed PAOs and GAOs in EBPR varies and is critically assessed, in light of their calculated amplicon abundances, to indicate which of these are important in full-scale systems. Bacteria from the genus Tetrasphaera were the most abundant of the PAOs. The " Candidatus Accumulibacter" PAOs were in much lower abundance and appear to be biased by the amplicon-based method applied. The genera Dechloromonas, Microlunatus , and Tessaracoccus were identified as abundant putative PAO that require further research attention. Interestingly, the actinobacterial Micropruina and sbr-gs28 phylotypes were among the most abundant of the putative GAOs. Members of the genera Defluviicoccus, Propionivibrio , the family Competibacteraceae, and the spb280 group were also relatively abundant in some plants. Despite observed high abundances of GAOs (periodically exceeding 20% of the amplicon reads), P removal performance was maintained, indicating that these organisms were not
Investigating the Control of Chlorophyll Degradation by Genomic Correlation Mining.
Ghandchi, Frederick P; Caetano-Anolles, Gustavo; Clough, Steven J; Ort, Donald R
2016-01-01
Chlorophyll degradation is an intricate process that is critical in a variety of plant tissues at different times during the plant life cycle. Many of the photoactive chlorophyll degradation intermediates are exceptionally cytotoxic necessitating that the pathway be carefully coordinated and regulated. The primary regulatory step in the chlorophyll degradation pathway involves the enzyme pheophorbide a oxygenase (PAO), which oxidizes the chlorophyll intermediate pheophorbide a, that is eventually converted to non-fluorescent chlorophyll catabolites. There is evidence that PAO is differentially regulated across different environmental and developmental conditions with both transcriptional and post-transcriptional components, but the involved regulatory elements are uncertain or unknown. We hypothesized that transcription factors modulate PAO expression across different environmental conditions, such as cold and drought, as well as during developmental transitions to leaf senescence and maturation of green seeds. To test these hypotheses, several sets of Arabidopsis genomic and bioinformatic experiments were investigated and re-analyzed using computational approaches. PAO expression was compared across varied environmental conditions in the three separate datasets using regression modeling and correlation mining to identify gene elements co-expressed with PAO. Their functions were investigated as candidate upstream transcription factors or other regulatory elements that may regulate PAO expression. PAO transcript expression was found to be significantly up-regulated in warm conditions, during leaf senescence, and in drought conditions, and in all three conditions significantly positively correlated with expression of transcription factor Arabidopsis thaliana activating factor 1 (ATAF1), suggesting that ATAF1 is triggered in the plant response to these processes or abiotic stresses and in result up-regulates PAO expression. The proposed regulatory network includes the
Littlejohn, A; Snow, D H
1988-01-01
These studies investigated circulatory, respiratory and metabolic responses in four Thoroughbred geldings during the first 400 metres of galloping (mean speed 14.4 +/- 0.38 m.s-1), cantering (mean speed 10.0 +/- 0.61 m.s-1) and walking (mean speed 1.58 +/- 0.05 m.s-1) from a standing start. A radio-controlled device which collected blood samples anaerobically during each 100 m section of the exercise track allowed analyses of changes in and functional relationships of the variables measured. During the 400 m gallop, the mean heart rate (HR) increased from 125 to 201 beats.min-1 and the haematocrit (Hct) from 0.513 to 0.589 l/l-1. The haemoglobin [Hb], lactate [LA] and potassium [K+] concentrations increased significantly, while the pH and the partial pressure of oxygen (PaO2) decreased significantly. The arterial partial pressure of carbon dioxide (PaCO2) and the plasma bicarbonate concentration did not change significantly. There were significant correlations between HR and Hct, HR and [Hb], HR and PaO2, HR and pH, HR and PvCO2, HR and [LA], HR and [K+], pH and [K+], Hct and PaO2, [Hb] and PaO2, PaCO2 and PaO2, [LA] and PaO2, pH and PaO2, [K+] and PaO2, stride frequency and PaO2. With the exception of the PvCO2 which increased significantly, changes in venous blood during the gallop were in the same direction as those of arterial blood. Thirty seconds before the start of the gallop, both HR and [Hb] were significantly higher than at rest, providing an approximate three-fold increase in oxygen delivery compared to that of the resting state.(ABSTRACT TRUNCATED AT 250 WORDS)
Molecular evolution of the polyamine oxidase gene family in Metazoa
Directory of Open Access Journals (Sweden)
Polticelli Fabio
2012-06-01
Full Text Available Abstract Background Polyamine oxidase enzymes catalyze the oxidation of polyamines and acetylpolyamines. Since polyamines are basic regulators of cell growth and proliferation, their homeostasis is crucial for cell life. Members of the polyamine oxidase gene family have been identified in a wide variety of animals, including vertebrates, arthropodes, nematodes, placozoa, as well as in plants and fungi. Polyamine oxidases (PAOs from yeast can oxidize spermine, N1-acetylspermine, and N1-acetylspermidine, however, in vertebrates two different enzymes, namely spermine oxidase (SMO and acetylpolyamine oxidase (APAO, specifically catalyze the oxidation of spermine, and N1-acetylspermine/N1-acetylspermidine, respectively. Little is known about the molecular evolutionary history of these enzymes. However, since the yeast PAO is able to catalyze the oxidation of both acetylated and non acetylated polyamines, and in vertebrates these functions are addressed by two specialized polyamine oxidase subfamilies (APAO and SMO, it can be hypothesized an ancestral reference for the former enzyme from which the latter would have been derived. Results We analysed 36 SMO, 26 APAO, and 14 PAO homologue protein sequences from 54 taxa including various vertebrates and invertebrates. The analysis of the full-length sequences and the principal domains of vertebrate and invertebrate PAOs yielded consensus primary protein sequences for vertebrate SMOs and APAOs, and invertebrate PAOs. This analysis, coupled to molecular modeling techniques, also unveiled sequence regions that confer specific structural and functional properties, including substrate specificity, by the different PAO subfamilies. Molecular phylogenetic trees revealed a basal position of all the invertebrates PAO enzymes relative to vertebrate SMOs and APAOs. PAOs from insects constitute a monophyletic clade. Two PAO variants sampled in the amphioxus are basal to the dichotomy between two well supported
Green, G E; Hassell, K T; Mahutte, C K
1987-05-01
We compared the partial pressure of oxygen directly via a continuous intra-arterial probe (PiaO2) and indirectly using a transcutaneous device (PtcO2) with simultaneously obtained arterial blood PaO2. The PiaO2 values were measured using a bipolar oxygen sensor placed through an 18-ga arterial catheter. The PtcO2 values were measured using a transcutaneous O2-CO2 sensor placed on the abdomen. Seven critically ill, hemodynamically stable, ventilator-dependent adult patients were studied. Measurements were obtained at varying concentrations (0.25 to 1.0) of inspired oxygen after a 10-min stabilization. A total of 78 simultaneous values were obtained; by linear regression: PiaO2 = 0.91 PaO2 + 1.39 (r = .98, standard errors of the estimate [SEE] = 18.6); PtcO2 = 0.39 PaO2 + 36.2 (r = .89, SEE = 14.1). To assess these instruments as trend monitors, we compared the changes in simultaneous PaO2, PiaO2, and PtcO2 values; by linear regression: delta PiaO2 = 0.90 delta PaO2 + 3.88 (r = .96, SEE = 27.7); delta PtcO2 = 0.43 delta PaO2 + 5.6 (r = .94, SEE = 15.2). We conclude that, although these instruments correlate highly with the PaO2, the SEE was substantial and therefore may limit their clinical reliability in adults. Any acute or clinically significant change in PiaO2 or PtcO2 should be confirmed with a blood gas PaO2.
Lee, Hyeon-Cheol; Portnoff, Alyse D; Rocco, Mark A; DeLisa, Matthew P
2014-12-22
The bacterial twin-arginine translocation (Tat) pathway is well known to translocate correctly folded monomeric and dimeric proteins across the tightly sealed cytoplasmic membrane. We identified a naturally occurring heterotrimer, the Escherichia coli aldehyde oxidoreductase PaoABC, that is co-translocated by the Tat translocase according to a ternary "hitchhiker" mechanism. Specifically, the PaoB and PaoC subunits, each devoid of export signals, are escorted to the periplasm in a piggyback fashion by the Tat signal peptide-containing subunit PaoA. Moreover, export of PaoA was blocked when either PaoB or PaoC was absent, revealing a surprising interdependence for export that is not seen for classical secretory proteins. Inspired by this observation, we created a bacterial three-hybrid selection system that links the formation of ternary protein complexes with antibiotic resistance. As proof-of-concept, a bispecific antibody was employed as an adaptor that physically crosslinked one antigen fused to a Tat export signal with a second antigen fused to TEM-1 β-lactamase (Bla). The resulting non-covalent heterotrimer was exported in a Tat-dependent manner, delivering Bla to the periplasm where it hydrolyzed β-lactam antibiotics. Collectively, these results highlight the remarkable flexibility of the Tat system and its potential for studying and engineering ternary protein interactions in living bacteria.
Directory of Open Access Journals (Sweden)
Per H. Nielsen
2017-04-01
Full Text Available Understanding the microbiology of phosphorus (P removal is considered essential to knowledge-based optimization of enhanced biological P removal (EBPR systems. Biological P removal is achieved in these systems by promoting the growth of organisms collectively known as the polyphosphate accumulating organisms (PAOs. Also considered important to EBPR are the glycogen accumulating organisms (GAOs, which are theorized to compete with the PAOs for resources at the expense of P removal efficiency. Numerous studies have sought to identify the PAOs and their GAOs competitors, with several candidates proposed for each over the last few decades. The current study collectively assessed the abundance and diversity of all proposed PAOs and GAOs in 18 Danish full-scale wastewater treatment plants with well-working biological nutrient removal over a period of 9 years using 16S rRNA gene amplicon sequencing. The microbial community structure in all plants was relatively stable over time. Evidence for the role of the proposed PAOs and GAOs in EBPR varies and is critically assessed, in light of their calculated amplicon abundances, to indicate which of these are important in full-scale systems. Bacteria from the genus Tetrasphaera were the most abundant of the PAOs. The “Candidatus Accumulibacter” PAOs were in much lower abundance and appear to be biased by the amplicon-based method applied. The genera Dechloromonas, Microlunatus, and Tessaracoccus were identified as abundant putative PAO that require further research attention. Interestingly, the actinobacterial Micropruina and sbr-gs28 phylotypes were among the most abundant of the putative GAOs. Members of the genera Defluviicoccus, Propionivibrio, the family Competibacteraceae, and the spb280 group were also relatively abundant in some plants. Despite observed high abundances of GAOs (periodically exceeding 20% of the amplicon reads, P removal performance was maintained, indicating that these organisms
Progressive apraxia of speech as a window into the study of speech planning processes.
Laganaro, Marina; Croisier, Michèle; Bagou, Odile; Assal, Frédéric
2012-09-01
We present a 3-year follow-up study of a patient with progressive apraxia of speech (PAoS), aimed at investigating whether the theoretical organization of phonetic encoding is reflected in the progressive disruption of speech. As decreased speech rate was the most striking pattern of disruption during the first 2 years, durational analyses were carried out longitudinally on syllables excised from spontaneous, repetition and reading speech samples. The crucial result of the present study is the demonstration of an effect of syllable frequency on duration: the progressive disruption of articulation rate did not affect all syllables in the same way, but followed a gradient that was function of the frequency of use of syllable-sized motor programs. The combination of data from this case of PAoS with previous psycholinguistic and neurolinguistic data, points to a frequency organization of syllable-sized speech-motor plans. In this study we also illustrate how studying PAoS can be exploited in theoretical and clinical investigations of phonetic encoding as it represents a unique opportunity to investigate speech while it progressively disrupts. Copyright © 2011 Elsevier Srl. All rights reserved.
Energy Technology Data Exchange (ETDEWEB)
Wichern, M.; Rosenwinkel, K.H.; Binder, M.
1999-07-01
The paper describes in excerpts a stationary model, suitable for engineering practice, for assessing the efficiency of enhanced biological P elimination. Adapted to the latest state of knowledge and based on only a few measuring data, it can be used to dimension or optimize existing plant. It takes into account knowledge such as the following: growth of organisms with enhanced phosphorus accumulation (PAOs) in an anoxic environment, modelling of biomass die-back in an anaerobic environment, different yield and die-back rates of PAOs and non-bioP organisms, the share of denitrifying PAOs and degradation processes through hydrolysis/fermentation. (orig.) [German] Im Rahmen dieses Beitrages wird ein in der Ingenieurpraxis anwendbares stationaeres Modell zur Abschaetzung der Leistungsfaehigkeit der vermehrten biologischen P-Elimination in Auszuegen vorgestellt, das, angepasst an neueste Erkenntnisse, auf Basis weniger Messdaten zur Bemessung sowie Optimierung von bestehenden Anlagen eingesetzt werden kann. Erkenntnisse, wie z.B. das Wachsen der vermehrt phosphorspeichernden Organismen (PAO) im Anoxischen, die Abbildung des Biomassensterbens im Anaeroben, die unterschiedlichen Ertrags- und Sterberaten von PAOs und Nicht-BioP-Organismen, der Anteil der denitrifizierenden PAOs und Abbauprozesse durch Hydrolyse/Fermentation sind im Modell beruecksichtigt. (orig.)
The role of the acetabular labrum in hip dysplasia
DEFF Research Database (Denmark)
Hartig-Andreasen, Charlotte; Søballe, Kjeld; Troelsen, Anders
2013-01-01
A periacetabular osteotomy (PAO) is the preferred joint preserving treatment for young adults with symptomatic hip dysplasia and no osteoarthritis. In symptomatic dysplasia of the hip, there is labral pathology in up to 90% of cases. However, no consensus exists as to whether a labral tear should...... be treated before the periacetabular osteotomy (PAO), treated simultaneously with the PAO, or left alone and only treated if symptoms persist after the PAO. This review is an update of aspects of labral anatomy and function, the etiology of labral tears in hip dysplasia, and diagnostic assessment of labral...... tears, and we discuss treatment strategies for coexisting labral tears and hip dysplasia....
A Rare Cause of Back Pain after Pregnancy: Postpartum Osteoporosis and Treatment Approach
Directory of Open Access Journals (Sweden)
Muzaffer İlhan
2016-12-01
Full Text Available Pregnancy associated osteoporosis (PAO is a rare disease characterized by multiple vertebral compression fractures, limitation of movement and severe back pain. A positive family history of PAO, decreased body mass index, sedentary life style, smoking, malnutrition and low calcium intake are among the risk factors of this disease. PAO should be considered in patients with back pain during pregnancy and postpartum period. As a specified therapy option is lack for PAO, discontinuation of lactation and the supplementation of calcium and vitamin D are the main steps of the treatment in patients who are planning to become pregnant in the future. The current data show that bisphosphonates should be avoided and teriparatide may be a treatment option in patients who are planning to become pregnant. In this case report, it was aimed to highlight the diagnosis and treatment approaches of PAO in a patient with back pain during postpartum period.
Pseudo-atomic orbitals as basis sets for the O(N) DFT code CONQUEST
Energy Technology Data Exchange (ETDEWEB)
Torralba, A S; Brazdova, V; Gillan, M J; Bowler, D R [Materials Simulation Laboratory, UCL, Gower Street, London WC1E 6BT (United Kingdom); Todorovic, M; Miyazaki, T [National Institute for Materials Science, 1-2-1 Sengen, Tsukuba, Ibaraki 305-0047 (Japan); Choudhury, R [London Centre for Nanotechnology, UCL, 17-19 Gordon Street, London WC1H 0AH (United Kingdom)], E-mail: david.bowler@ucl.ac.uk
2008-07-23
Various aspects of the implementation of pseudo-atomic orbitals (PAOs) as basis functions for the linear scaling CONQUEST code are presented. Preliminary results for the assignment of a large set of PAOs to a smaller space of support functions are encouraging, and an important related proof on the necessary symmetry of the support functions is shown. Details of the generation and integration schemes for the PAOs are also given.
DEFF Research Database (Denmark)
WU, H.; Song, Z.J.; Givskov, Michael Christian
2004-01-01
Levels of serum antibodies against Pseudomonas aeruginosa were observed for 106 days in a rat model of chronic lung infection. Significantly weaker responses of serum IgG and IgG1 and a lower ratio of IgGI/IgG2a were found in the rats infected with the quorum-signal-deficient mutant, PAO1 (rhl......I, lasI), compared with the wild-type PAO1. Four out of 15 rats infected with wild-type PAO1 contained bacteria in the lungs on day 106, whereas no bacteria were found in the mutant PAO1 group. The results indicate that quorum signals contribute to the persistence of the infection and influence...
Phenylarsine Oxide Inhibits the Fusicoccin-Induced Activation of Plasma Membrane H+-ATPase1
Olivari, Claudio; Albumi, Cristina; Pugliarello, Maria Chiara; De Michelis, Maria Ida
2000-01-01
To investigate the mechanism by which fusicoccin (FC) induces the activation of the plasma membrane (PM) H+-ATPase, we used phenylarsine oxide (PAO), a known inhibitor of protein tyrosine-phosphatases. PAO was supplied in vivo in the absence or presence of FC to radish (Raphanus sativus L.) seedlings and cultured Arabidopsis cells prior to PM extraction. Treatment with PAO alone caused a slight decrease of PM H+-ATPase activity and, in radish, a decrease of PM-associated 14-3-3 proteins. When supplied prior to FC, PAO drastically inhibited FC-induced activation of PM H+-ATPase, FC binding to the PM, and the FC-induced increase of the amount of 14-3-3 associated with the PM. On the contrary, PAO was completely ineffective on all of the above-mentioned parameters when supplied after FC. The H+-ATPase isolated from PAO-treated Arabidopsis cells maintained the ability to respond to FC if supplied with exogenous, nonphosphorylated 14-3-3 proteins. Altogether, these results are consistent with a model in which the dephosphorylated state of tyrosine residues of a protein(s), such as 14-3-3 protein, is required to permit FC-induced association between the 14-3-3 protein and the PM H+-ATPase. PMID:10677439
International Nuclear Information System (INIS)
Feldman, R.D.; McArdle, W.; Lai, C.
1986-01-01
In several models, desensitization of the β-adrenergic receptor (βAR) is associated with a decrease in binding of hydrophilic but not hydrophobic βAR ligands. This suggests a sequestration of cell surface βAR. Desensitization of the lymphobyte βAR is also associated with a selective reduction in the photoaffinity labelling of a 55K βAR protein as compared to a 68K βAR protein. In order to examine the relationship between sequestration and reduction in labelling of the 55K peptide, the authors have studied the effect of phenylarsine oxide (PAO; an inhibitor of sequestration) on lymphocyte βAR desensitization. Incubation of cells with PAO prior to desensitization did not block the consequent reduction in isoproterenol-stimulated adenylate cyclase activity. However, the agonist-induced reduction in binding of the hydrophilic βAR ligand CGP-12177 was blocked by PAO (without PAO:57 +/- 4% of control, with PAO: 97 +/- 2% of control). Photolabelling studies with [ 125 I] iodocyanopindolol diazirine revealed that PAO pretreatment also blocked the selective loss in labelling of the 55K βAR protein seen with desensitization. These data suggest that loss of labelling of the 55K protein of the βAR is closely coupled to βAR sequestration
People’s Republic of China Scientific Abstracts, Number 177
1977-10-06
PAO [ARCHITECTURAL JOURNAL] No 2, June 1977 1 CHIH-WU HSUEH-PAO [ACTA BOTANICA SINICA] No 4, December 1976 13 CHIH-WU TSA-CHIH [JOURNAL OF BOTANY...10424 CSO: 4009 12 ACTA BOTANICA SINICA AUTHOR: None ORG: Three-in-one Combination Experimental Group of Peking Ch’ung-wen Vegetable Station...Physiological Processes of Stored Tomatoes" SOURCE: Peking CHIH-WU HSUEH-PAO [ACTA BOTANICA SINICA] in Chinese Vol 18, No 4, Dec 76 pp 278-283 TEXT OF
Laviola, Marianna; Hajny, Ondrej; Roubik, Karel
2014-10-01
High frequency oscillatory ventilation (HFOV) is an alternative mode of mechanical ventilation. HFOV has been shown to provide adequate ventilation and oxygenation in acute respiratory distress syndrome (ARDS) patients and may represent an effective lung-protective ventilation in patients where conventional ventilation is failing. The aim of this study is to evaluate effects of continuous distending pressure (CDP) on variables that contribute to the oxygenation in healthy and ARDS lung model pigs. Methods. In order to simulate a lung disease, lung injury was induced by lavage with normal saline with detergent in three pigs. HFOV ventilation was applied before and after the lung lavage. CDP was stepwise increased by 2 cmH2O, until the maximum CDP (before the lung lavage 32 cmH2O and after the lung lavage 42 cmH2O) and then it was stepwise decreased by 2 cmH2O to the initial value. In this paper we analyzed the following parameters acquired during our experiments: partial pressure of oxygen in arterial blood (PaO2), cardiac output (CO) and mixed venous blood oxygen saturation (SvO2). In order to find how both PaO2 and CO affected SvO2 during the increase of CDP before and after lavage, a nonlinear regression fitting of the response in SvO2 on the predictors (PaO2 and CO) was implemented. Results. Before the lavage, with increasing of CDP, PaO2 remained constant, CO strongly decreased and SvO2 slightly decreased. After the lavage, with increasing of CDP, PaO2 strongly increased, CO decreased and SvO2 increased. So, development of SvO2 followed the PaO2 and CO trends. Changes in PaO2 and CO occur at decisive CDP step and it was much higher after the lung lavage compared to the healthy lungs. The implemented nonlinear model gives a good goodness of fitting in all three pigs. The values of PaO2 and CO estimated coefficients changed at the same decisive step of CDP identified by the trends. Also the algorithm identified a CDP step much higher after the lung lavage
Eyrefield Manor Nursing Home, Church Lane, Greystones, Wicklow.
LENUS (Irish Health Repository)
Gleeson, L
2012-05-01
Definition of Respiratory Failure using PaO2 alone is confounded when patients are commenced on oxygen therapy prior to arterial blood gas (ABG) measurement. Furthermore, classification of Respiratory Failure as Type 1 or Type 2 using PaCO2 alone can give an inaccurate account of events as both types can co-exist. 100 consecutive presentations of acute respiratory distress were assessed initially using PaO2, and subsequently PaO2\\/FiO2 ratio, to diagnose Respiratory Failure. Respiratory Failure cases were classified as Type 1 or Type 2 initially using PaCO2, and subsequently alveolar-arterial (A-a) gradient. Any resultant change in management was documented. Of 100 presentations, an additional 16 cases were diagnosed as Respiratory Failure using PaO2\\/FiO2 ratio in place of PaO2 alone (p = 0.0338). Of 57 cases of Respiratory Failure, 22 cases classified as Type 2 using PaCO2 alone were reclassified as Type 1 using A-a gradient (p < 0.001). Of these 22 cases, management changed in 18.
SMART phones and the acute respiratory patient.
LENUS (Irish Health Repository)
Gleeson, L
2012-05-01
Definition of Respiratory Failure using PaO2 alone is confounded when patients are commenced on oxygen therapy prior to arterial blood gas (ABG) measurement. Furthermore, classification of Respiratory Failure as Type 1 or Type 2 using PaCO2 alone can give an inaccurate account of events as both types can co-exist. 100 consecutive presentations of acute respiratory distress were assessed initially using PaO2, and subsequently PaO2\\/FiO2 ratio, to diagnose Respiratory Failure. Respiratory Failure cases were classified as Type 1 or Type 2 initially using PaCO2, and subsequently alveolar-arterial (A-a) gradient. Any resultant change in management was documented. Of 100 presentations, an additional 16 cases were diagnosed as Respiratory Failure using PaO2\\/FiO2 ratio in place of PaO2 alone (p = 0.0338). Of 57 cases of Respiratory Failure, 22 cases classified as Type 2 using PaCO2 alone were reclassified as Type 1 using A-a gradient (p < 0.001). Of these 22 cases, management changed in 18.
Directory of Open Access Journals (Sweden)
Christian Schwarzer
Full Text Available Confocal imaging was used to characterize interactions of Pseudomonas aeruginosa (PA, expressing GFP or labeled with Syto 11 with CF airway epithelial cells (CFBE41o-, grown as confluent monolayers with unknown polarity on coverglasses in control conditions and following scratch wounding. Epithelia and PAO1-GFP or PAK-GFP (2 MOI were incubated with Ringer containing typical extracellular salts, pH and glucose and propidium iodide (PI, to identify dead cells. PAO1 and PAK swam randomly over and did not bind to nonwounded CFBE41o- cells. PA migrated rapidly (began within 20 sec, maximum by 5 mins and massively (10-80 fold increase, termed "swarming", but transiently (random swimming after 15 mins, to wounds, particularly near cells that took up PI. Some PA remained immobilized on cells near the wound. PA swam randomly over intact CFBE41o- monolayers and wounded monolayers that had been incubated with medium for 1 hr. Expression of CFTR and altered pH of the media did not affect PA interactions with CFBE41o- wounds. In contrast, PAO1 swarming and immobilization along wounds was abolished in PAO1 (PAO1ΔcheYZABW, no expression of chemotaxis regulatory components cheY, cheZ, cheA, cheB and cheW and greatly reduced in PAO1 that did not express amino acid receptors pctA, B and C (PAO1ΔpctABC and in PAO1 incubated in Ringer containing a high concentration of mixed amino acids. Non-piliated PAKΔpilA swarmed normally towards wounded areas but bound infrequently to CFBE41o- cells. In contrast, both swarming and binding of PA to CFBE41o- cells near wounds were prevented in non-flagellated PAKΔfliC. Data are consistent with the idea that (i PA use amino acid sensor-driven chemotaxis and flagella-driven swimming to swarm to CF airway epithelial cells near wounds and (ii PA use pili to bind to epithelial cells near wounds.
Kristensen, T; Rosseland, B O; Kiessling, A; Djordevic, B; Massabau, J C
2010-12-01
Regulation of arterial partial pressure of O2 (PaO2) in Atlantic salmon (Salmo salar) was investigated during resting conditions in normoxic and hyperoxic water. Dorsal aorta cannulated adult Atlantic salmon (1.2-1.6 kg, n=8) were exposed to 2 week sequential periods of normoxia [16.7±1.1 kPa (mean±SD)] and hyperoxia (34.1±4.9 kPa) in individual tanks containing seawater (33.7±0.2 ppt) at stable temperature conditions (8.7±0.7°C) and a light regime of L:D=12:12. Tank design and sampling procedures were optimized to provide suitable shelter and current for the fish, and to allow repeated, undisturbed sampling of blood from free-swimming fish. Fish were sampled regularly through the experimental period. PwO2, PaO2, blood ion composition (Na+, K+, Cl-), acid-base status (pH, PCO2, HCO3-), haematocrit and glucose were measured. The most frequently observed PaO2 values were in the range of 60-80% of PwO2, both during normoxia and hyperoxia, and PaO2 values were significantly lower during normoxia than during hyperoxia. Blood pH, PCO2 and HCO3- were significantly elevated during hyperoxia, while, Na+, Cl- and Hct were significantly lower. K+ and glucose showed no significant differences. This study demonstrates a lack PaO2 regulation in Atlantic salmon to low partial pressures, in contrast to previous reports for many aquatic gill breathing animals. Both during normoxia and hyperoxia, PaO2 reflects PwO2, and alterations in external PO2 consequently result in proportional arterial PO2 changes. Physiological adaptation to hyperoxia, as illustrated by changes in several blood parameters, does not include down-regulation of PaO2 in Atlantic salmon. The lack of PaO2 regulation may make Atlantic salmon vulnerable to the oxidative stress caused by increased free radical formation in hyperoxic conditions.
Klein, K U; Boehme, S; Hartmann, E K; Szczyrba, M; Heylen, L; Liu, T; David, M; Werner, C; Markstaller, K; Engelhard, K
2013-02-01
Cyclic recruitment and derecruitment (R/D) play a key role in the pathomechanism of acute lung injury (ALI) leading to respiration-dependent oscillations of arterial partial pressure of oxygen (Pa(O(2))). These Pa(O(2)) oscillations could also be forwarded to the cerebral microcirculation. In 12 pigs, partial pressure of oxygen was measured in the thoracic aorta (Pa(O(2))) and subcortical cerebral tissue (Pbr(O(2))). Cerebral cortical haemoglobin oxygen saturation (Sbr(O(2))), cerebral blood flow (CBF), and peripheral haemoglobin saturation (Sp(O(2))) were assessed by spectroscopy and laser Doppler flowmetry. Measurements at different fractions of inspired oxygen (F(I(O(2)))) were performed at baseline and during cyclic R/D. frequency domain analysis, the Mann-Whitney test, linear models to test the influence of Pa(O(2)) and systolic arterial pressure (SAP) oscillations on cerebral measurements. Parameters [mean (SD)] remained stable during baseline. Pa(O(2)) oscillations [10.6 (8) kPa, phase(reference)], systemic arterial pressure (SAP) oscillations [20 (9) mm Hg, phase(Pa(O(2))-SAP) -33 (72)°], and Sp(O(2))oscillations [1.9 (1.7)%, phase(Pa(O(2))-Sp(O(2))) 264 (72)°] were detected during lung R/D at 1.0. Pa(O(2)) oscillations decreased [2.7 (3.5) kPa, P=0.0008] and Sp(O(2)) oscillations increased [6.8 (3.9)%, P=0.0014] at F(I(O(2))) 0.3. In the brain, synchronized Pbr(O(2)) oscillations [0.6 (0.4) kPa, phase(Pa(O(2))-Pbr(O(2))) 90 (39)°], Sbr(O(2)) oscillations [4.1 (1.5)%, phase(Pa(O(2))-Sbr(O(2))) 182 (54)°], and CBF oscillations [198 (176) AU, phase(Pa(O(2))-CBF) 201 (63)°] occurred that were dependent on Pa(O(2)) and SAP oscillations. Pa(O(2)) oscillations caused by cyclic R/D are transmitted to the cerebral microcirculation in a porcine model of ALI. These cyclic oxygen alterations could play a role in the crosstalk of acute lung and brain injury.
Directory of Open Access Journals (Sweden)
Lazić Zorica
2008-01-01
Full Text Available Background/Aim. Oxygen therapy is a necessary therapeutic method in treatment of severe chronic respiratory failure (CRF, especially in phases of acute worsening. Risks which are to be taken into consideration during this therapy are: unpredictable increase of carbon dioxide in blood, carbonarcosis, respiratory acidosis and coma. The aim of this study was to show the influence of oxygen therapy on changes of arterial blood carbon dioxide partial pressure. Methods. The study included 93 patients in 104 admittances to the hospital due to acute exacerbation of CFR. The majority of the patients (89.4% had chronic obstructive pulmonary disease (COPD, while other causes of respiratory failure were less common. The effect of oxygenation was controlled through measurement of PaO2 and PaCO2 in arterial blood samples. To analyze the influence of oxygen therapy on levels of carbon dioxide, greatest values of change of PaO2 and PaCO2 values from these measurements, including corresponding PaO2 values from the same blood analysis were taken. Results. The obtained results show that oxygen therapy led to the increase of PaO2 but also to the increase of PaCO2. The average increase of PaO2 for the whole group of patients was 2.42 kPa, and the average increase of PaCO2 was 1.69 kPa. There was no correlation between the initial values of PaO2 and PaCO2 and changes of PaCO2 during the oxygen therapy. Also, no correlation between the produced increase in PaO2 and change in PaCO2 during this therapy was found. Conclusion. Controlled oxygen therapy in patients with severe respiratory failure greatly reduces the risk of unwanted increase of PaCO2, but does not exclude it completely. The initial values of PaO2 and PaCO2 are not reliable parameters which could predict the response to oxygen therapy.
Kasulike kogunemiste lainel / Bruno Pao
Pao, Bruno, 1931-
2007-01-01
Esimese maailmasõja ajal toimunud Moonsundi lahingu meenutuseks korraldatud konverentsist "Moonsund 1917-2007" Kuressaare linnuses 19. oktoobril ja kohanimepäevast Ülikoolide keskuses Saaremaal 26. oktoobril
International Nuclear Information System (INIS)
Torigoe, Ryuichiro; Hayashi, Takashi; Anegawa, Shigetaka; Harada, Katsuhiko; Matsuo, Hiromasa; Yoshikawa, Ichiro.
1991-01-01
123 I-IMP and Tc-PAO SPECT were performed in 20 cases of cerebral concussion ranging in age from 4 to 20 years old, including six cases of the juvenile head trauma syndrome (JHTS). The SPECT findings were divided into two main types: six cases in the normal group with no blood flow abnormalities, and 14 cases in abnormal group showing reduced blood flow, mainly in cerebellum and occipital lobe except in one case. In 10 cases of reduced blood flow which could be analyzed, calculation of the blood flow ratio in the temporal and occipital lobes and the cerebellum with the frontal lobe taken as 100 showed values of 93.5% for the temporal lobe, 82.7% for the occipital lobe and 76.8% for the cerebellum. A statistically significant reduction in blood flow occurred in the occipital lobe and cerebellum. In blood examination, abnormally high values of white blood cell counts were observed transiently in 94% of cerebral concussion cases. Abnormalities in brain stem and hypothalamus appeared to cause these abnormal WBC values. From these findings, it was suggested that the blood flow regions of the basilar and posterior cerebral arteries, i.e., the brain stem and hypothalamus are closely connected with the lesions responsible for cerebral concussion. It also appeared that the JHTS occurs in cerebral concussion cases where recovery of the abnormal blood flow in these regions in poor. (author)
Kadlecek, Stephen; Hamedani, Hooman; Xu, Yinan; Emami, Kiarash; Xin, Yi; Ishii, Masaru; Rizi, Rahim
2013-10-01
Alveolar oxygen tension (Pao2) is sensitive to the interplay between local ventilation, perfusion, and alveolar-capillary membrane permeability, and thus reflects physiologic heterogeneity of healthy and diseased lung function. Several hyperpolarized helium ((3)He) magnetic resonance imaging (MRI)-based Pao2 mapping techniques have been reported, and considerable effort has gone toward reducing Pao2 measurement error. We present a new Pao2 imaging scheme, using parallel accelerated MRI, which significantly reduces measurement error. The proposed Pao2 mapping scheme was computer-simulated and was tested on both phantoms and five human subjects. Where possible, correspondence between actual local oxygen concentration and derived values was assessed for both bias (deviation from the true mean) and imaging artifact (deviation from the true spatial distribution). Phantom experiments demonstrated a significantly reduced coefficient of variation using the accelerated scheme. Simulation results support this observation and predict that correspondence between the true spatial distribution and the derived map is always superior using the accelerated scheme, although the improvement becomes less significant as the signal-to-noise ratio increases. Paired measurements in the human subjects, comparing accelerated and fully sampled schemes, show a reduced Pao2 distribution width for 41 of 46 slices. In contrast to proton MRI, acceleration of hyperpolarized imaging has no signal-to-noise penalty; its use in Pao2 measurement is therefore always beneficial. Comparison of multiple schemes shows that the benefit arises from a longer time-base during which oxygen-induced depolarization modifies the signal strength. Demonstration of the accelerated technique in human studies shows the feasibility of the method and suggests that measurement error is reduced here as well, particularly at low signal-to-noise levels. Copyright © 2013 AUR. Published by Elsevier Inc. All rights reserved.
Shu, Jwu-Ching; Kuo, An-Jing; Su, Lin-Hui; Liu, Tsui-Ping; Lee, Ming-Hsun; Su, I-Ning; Wu, Tsu-Lan
2017-09-01
Pan-susceptible Pseudomonas aeruginosa (PSPA) clinical isolates carrying an OprD with loop 7 shortening (the group-1A allele) were found to rapidly develop carbapenem resistance under continuous selection pressure. We further studied whether OprD polymorphisms are associated with the potential to develop carbapenem resistance. OprD amino acid sequences of 126 PSPA clinical isolates were analysed to determine their STs using P. aeruginosa strain PAO1 as the control strain. Site-directed mutagenesis was performed in PAO1 to generate polymorphisms of interest. A disc diffusion method was used to select carbapenem-resistant variants from the mutant strains. Expression levels of oprD were determined by quantitative RT-PCR. MICs of carbapenems were determined by Etest. Forty-eight (38.1%) of the tested isolates carried the group-1A allele. Another two major STs, C1 and C2, both of which harboured an F170L polymorphism, were found in 21 (16.7%) and 39 (31.0%) isolates, respectively. The PAO1 type was also found in 14 (11.1%) isolates. Under continuous selective pressure, isolates of most STs developed carbapenem resistance at different numbers of passaging events; only those belonging to the PAO1 type remained susceptible. However, PAO1 mutants carrying either the oprD group-1A allele or the OprD-F170L polymorphism were able to develop carbapenem resistance. Reduced oprD expression triggered by continuous imipenem challenge was found in PAO1 mutants, but not in the PAO1 WT strain. OprD polymorphisms, particularly the F170L substitution and the specific shortening in loop 7, appear to determine the potential for P. aeruginosa to develop carbapenem resistance. © The Author 2017. Published by Oxford University Press on behalf of the British Society for Antimicrobial Chemotherapy. All rights reserved. For Permissions, please email: journals.permissions@oup.com.
Long-term monitoring of arterial pO2 in burned patients.
Nilsson, E; Arnander, C
1984-02-01
Five patients, who were treated in a special ward for burns were followed by continuous intra-arterial pO2 monitoring for a total of 1612 h (range 13-604 h). The pao2 catheter electrodes used were surface-heparinized, and inserted either in the radial or the femoral artery. Some electrodes were accidentally withdrawn. Recalibration was performed for two of the 10 electrodes used. These electrodes presented a changed sensitivity after heavy stretching of the sensor during the nursing. The sensitivity of one of these electrodes was altered downwards and the other one upwards. After recalibration the pao2 electrodes presented accurate values for the rest of the monitoring period. Without compensation for drift, the pao2 electrode readout was compared to the results of traditional blood-gas analysis, which served as a reference. The regression function found was y = -0.62 + 1.04 chi (r = 0.93, SD = 1.40, n = 60). The blood flow velocity around some of the pao2 electrodes was studied by the pulsed Doppler technique. There was no influence of the surface-heparinized pao2 electrode on the femoral artery blood flow velocity as compared to the contralateral, non-catheterized femoral artery. The blood flow velocity proximal to a traditional radial artery catheter was compared to the flow velocity in the contralateral radial artery containing a surface-heparinized pao2 electrode. The surface-heparinized electrode did not decrease the mean flow velocity in contrast with the traditional radial artery catheter, which had to be withdrawn after 8 days because of clotting. The surface-heparinized catheter electrode was still monitoring pao2 accurately after 25 days in the artery, which was the longest period studied for a particular sensor.
Pseudomonas cepacia adherence to respiratory epithelial cells is enhanced by Pseudomonas aeruginosa
International Nuclear Information System (INIS)
Saiman, L.; Cacalano, G.; Prince, A.
1990-01-01
Pseudomonas aeruginosa and Pseudomonas cepacia are both opportunistic pathogens of patients with cystic fibrosis. The binding characteristics of these two species were compared to determine if they use similar mechanisms to adhere to respiratory epithelial cells. P. cepacia 249 was shown to be piliated, but there was no detectable homology between P. aeruginosa pilin gene probes and P. cepacia genomic DNA. P. cepacia and P. aeruginosa did not appear to compete for epithelial receptors. In the presence of purified P. aeruginosa pili, the adherence of 35S-labeled strain 249 to respiratory epithelial monolayers was unaffected, while that of P. aeruginosa PAO1 was decreased by 55%. The binding of P. cepacia 249 and 715j was increased by 2.4-fold and 1.5-fold, respectively, in the presence of an equal inoculum of PAO1. Interbacterial agglutination contributed to the increased adherence of P. cepacia, as the binding of 249 was increased twofold in the presence of irradiated PAO1. PAO1 exoproducts had a marked effect in enhancing the ability of the P. cepacia strains to adhere to the epithelial monolayers. A PAO1 supernatant increased the binding of 249 by eightfold and that of 715j by fourfold. Thus, there appears to be a synergistic relationship between P. aeruginosa and P. cepacia in which PAO1 exoproducts modify the epithelial cell surface, exposing receptors and facilitating increased P. cepacia attachment
Concomitant Hip Arthroscopy and Periacetabular Osteotomy.
Domb, Benjamin G; LaReau, Justin M; Hammarstedt, Jon E; Gupta, Asheesh; Stake, Christine E; Redmond, John M
2015-11-01
To detail our early experience using concomitant hip arthroscopy and periacetabular osteotomy (PAO) for the treatment of acetabular dysplasia. We prospectively collected and retrospectively reviewed the surgical and outcome data of 17 patients who underwent concomitant hip arthroscopy and PAO between October 2010 and July 2013. Preoperative and postoperative range of motion, outcome and pain scores, and radiographic data were collected. Intraoperative arthroscopic findings and postoperative complications were recorded. The group consisted of 3 male and 14 female patients with a mean follow-up period of 2.4 years. Three patients had undergone previous surgery on the affected hip. Chondrolabral pathology was identified in all 17 patients. Twelve patients underwent labral repair, and five patients underwent partial labral debridement. No patient was converted to total hip arthroplasty or required revision surgery at short-term follow-up. All 4 patient-reported outcome scores showed statistically significant changes from baseline to latest follow-up (P arthroscopy and PAO has been favorable. We noted that all our patients have evidence of chondrolabral damage at the time of PAO when the joint is distracted and evaluated. All patients in this series had intra-articular pathology treated arthroscopically and showed satisfactory mean clinical improvement. Hip arthroscopy with PAO did not appear to introduce complications beyond the PAO alone. Level IV, therapeutic case series. Copyright © 2015 Arthroscopy Association of North America. Published by Elsevier Inc. All rights reserved.
DEFF Research Database (Denmark)
Klit, Jakob
2013-01-01
The utilization of alternative outcome measures in the evaluation of outcome after PAO, TKA, and THA in young adults seem warranted to better understand the patients perception of successful treatment. Due to the lack of focus in contemporary literature on alternative aspects of outcome measurement...... in younger PAO, TKA, and THA patients our aims were, to explore patient satisfaction, fulfillment of expectations, symptoms of depression, the effect on socioeconomic status, and abilities in sex-life in younger PAO, TKA, and THA patients using PROMs. These alternative endpoints were collected in addition...... the surgeon and patient with information, when deciding the right time for surgery. 3. To investigate functional and quality of life aspects after PAO surgery in relation to the effect on the patient’s sex-life, the patient’s ability to participate in sports, the patient’s ability to interact socially...
Enhanced Biological Phosphorus Removal : Metabolic Insights and Salinity Effects
Welles, L.
2015-01-01
Enhanced biological phosphorus removal (EBPR) is a biological process for efficient phosphate removal from wastewaters through intracellular storage of polyphosphate by polyphosphate-accumulating organisms (PAO) and subsequent removal of PAO from the system through wastage of sludge. In comparison
Italian Studies in Southern Africa/Studi d'Italianistica nell'Africa ...
African Journals Online (AJOL)
Italian Studies in Southern Africa/Studi d'Italianistica nell'Africa Australe - Vol 9, No 1 (1996) ... Politics and power in Giovanni Comisso's Giorni Di Guerra and Pier Vittorio Tondelli's Pao Pao ... Anna Meda, Gerhard van der Linde, 80-81 ...
Effect of salt on the metabolism of 'Candidatus Accumulibacter' clade I and II
Wang, Zhongwei; Dunne, Aislinn; van Loosdrecht, Mark C.M.; Saikaly, Pascal E.
2018-01-01
Saline wastewater is known to affect the performance of phosphate-accumulating organisms (PAOs) in enhanced biological phosphorus removal (EBPR) process. However, studies comparing the effect of salinity on different PAO clades are lacking. In this study, 'Candidatus Accumulibacter phosphatis'
DEFF Research Database (Denmark)
Klit, Jakob
2014-01-01
, hip OA is associated with FAI covering three fundamentally different hip deformities, including acetabular dysplasia; all hypothesized to initiates OA development. Where PAO is used worldwide as a joint-preserving procedure in acetabular dysplasia, TKA and THA are the treatment of choice of end stage......BACKGROUND: Knee and hip OA is the clinical and pathological outcome of a functional and structural failure of the joint, resulting in pain and physical dysfunction. Despite the similarity in clinical presentation the pathogenesis seems to differ. Where knee OA is associated with obesity and trauma...... information prior to PAO, TKA and THA surgery. MATERIAL AND METHODS: This PhD thesis is based on three studies. Study I is a cross-sectional survey of preserved hip joints with a mean follow-up of ten years after PAO. One hundred patients (121 PAO's) were eligible for inclusion. An inquiry to the National...
DEFF Research Database (Denmark)
Kristiansen, Rikke; Nguyen, Hien Thi Thu; Saunders, Aaron Marc
2013-01-01
Members of the genus Tetrasphaera are considered to be putative polyphosphate accumulating organisms (PAOs) in enhanced biological phosphorus removal (EBPR) from wastewater. Although abundant in Danish full-scale wastewater EBPR plants, how similar their ecophysiology is to ‘Candidatus Accumuliba......Members of the genus Tetrasphaera are considered to be putative polyphosphate accumulating organisms (PAOs) in enhanced biological phosphorus removal (EBPR) from wastewater. Although abundant in Danish full-scale wastewater EBPR plants, how similar their ecophysiology is to ‘Candidatus....... japonica and T. elongata. Based on the models, we propose that under anaerobic conditions the Tetrasphaerarelated PAOs take up glucose and ferment this to succinate and other components. They also synthesize glycogen as a storage polymer, using energy generated from the degradation of stored polyphosphate...... by ‘Candidatus Accumulibacter phosphatis’, and reveals Tetrasphaera populations to be unusual and physiologically versatile PAOs carrying out denitrification, fermentation and polyphosphate accumulation....
Nondestructive characterization of surface chemical wear films via X-rays
Energy Technology Data Exchange (ETDEWEB)
Hershberger, J.; Ajayi, O.O.; Fenske, G.R
2004-01-15
This work describes and demonstrates a suite of techniques for the non-destructive examination of surface films formed from oil additives. X-Ray diffraction, reflectivity and fluorescence have been used in grazing-incidence geometry to provide information on the thickness, roughness, density, structure and composition of the layers that compose reaction films. The lubricating oils were not rinsed off the surfaces of the samples before analysis. Films were formed from neat polyalphaolefin (PAO) oil and PAO with chloroform, dimethyl disulfide, or zinc or molybdenum dialkyl dithiophosphate additive. A thick layer of crystalline FeO formed during wear lubricated by neat PAO.
International Nuclear Information System (INIS)
Awan, M.M.A.; Awan, F.G.
2017-01-01
Extraction of maximum power from PV (Photovoltaic) cell is necessary to make the PV system efficient. Maximum power can be achieved by operating the system at MPP (Maximum Power Point) (taking the operating point of PV panel to MPP) and for this purpose MPPT (Maximum Power Point Trackers) are used. There are many tracking algorithms/methods used by these trackers which includes incremental conductance, constant voltage method, constant current method, short circuit current method, PAO (Perturb and Observe) method, and open circuit voltage method but PAO is the mostly used algorithm because it is simple and easy to implement. PAO algorithm has some drawbacks, one is low tracking speed under rapid changing weather conditions and second is oscillations of PV systems operating point around MPP. Little improvement is achieved in past papers regarding these issues. In this paper, a new method named 'Decrease and Fix' method is successfully introduced as improvement in PAO algorithm to overcome these issues of tracking speed and oscillations. Decrease and fix method is the first successful attempt with PAO algorithm for stability achievement and speeding up of tracking process in photovoltaic system. Complete standalone photovoltaic system's model with improved perturb and observe algorithm is simulated in MATLAB Simulink. (author)
Costa-Farré, Cristina; Prades, Marta; Ribera, Thaïs; Valero, Oliver; Taurà, Pilar
2014-04-01
Decreased tissue oxygenation is a critical factor in the development of wound infection as neutrophil mediated oxidative killing is an essential mechanism against surgical pathogens. The objective of this prospective case series was to assess the impact of intraoperative arterial partial pressure of oxygen (PaO2) on surgical site infection (SSI) in horses undergoing emergency exploratory laparotomy for acute gastrointestinal disease. The anaesthetic and antibiotic protocol was standardised. Demographic data, surgical potential risk factors and PaO2, obtained 1h after induction of anaesthesia were recorded. Surgical wounds were assessed daily for infection during hospitalisation and follow up information was obtained after discharge. A total of 84 adult horses were included. SSI developed in 34 (40.4%) horses. Multivariate logistic regression showed that PaO2, anaesthetic time and subcutaneous suture material were predictors of SSI (AUC=0.76, sensitivity=71%, specificity=65%). The use of polyglycolic acid sutures increased the risk and horses with a PaO2 value 2h had the highest risk of developing SSI (OR=9.01; 95% CI 2.28-35.64). The results of this study confirm the hypothesis that low intraoperative PaO2 contributes to the development of SSI following colic surgery. Copyright © 2014 Elsevier Ltd. All rights reserved.
Nanoscale Organic−Inorganic Hybrid Lubricants
Kim, Daniel
2011-03-15
Silica (SiO2) nanoparticles densely grafted with amphiphilic organic chains are used to create a family of organic-inorganic hybrid lubricants. Short sulfonate-functionalized alkylaryl chains covalently tethered to the particles form a dense corona brush that stabilizes them against aggregation. When these hybrid particles are dispersed in poly-α-olefin (PAO) oligomers, they form homogeneous nanocomposite fluids at both low and high particle loadings. By varying the volume fraction of the SiO2 nanostructures in the PAO nanocomposites, we show that exceptionally stable hybrid lubricants can be created and that their mechanical properties can be tuned to span the spectrum from simple liquids to complex gels. We further show that these hybrid lubricants simultaneously exhibit lower interfacial friction coefficients, enhanced wear and mechanical properties, and superior thermal stability in comparison with either PAO or its nanocomposites created at low nanoparticle loadings. Profilometry and energy dispersive X-ray spectroscopic analysis of the wear track show that the enhanced wear characteristics in PAO-SiO2 composite lubricants originate from two sources: localization of the SiO2 particles into the wear track and extension of the elastohydrodynamic lubrication regime to Sommerfeld numbers more than an order of magnitude larger than for PAO. © 2011 American Chemical Society.
Energy Technology Data Exchange (ETDEWEB)
Kokjohn, T.A.; Miller, R.V.
1987-04-01
We cloned a 2.3-kilobase-pair fragment of the Pseudomonas aeruginosa PAO chromosome which is capable of complementing recA mutations of Escherichia coli. The recA-complementing activity was further localized to a 1.5-kilobase-pair PvuII-HindIII fragment. Southern blot analysis under conditions of high stringency indicated that DNA sequence homology is shared by the E. coli recA gene and the P. aeruginosa recA analog. The cloned recA analog was shown to restore resistance to methyl methanesulfonate, nitrofurantoin, and UV irradiation to E. coli recA mutants. Upon introduction of the cloned P. aeruginosa gene, these mutants regained recombination proficiency in HfrH-mediated conjugation and the ability to induce lambda prophages and SOS functions (din gene transcription) after exposure to DNA-damaging agents. Lambda prophage carrying a cI ind mutation was not inducible, suggesting that the mechanism of induction of these SOS functions by the P. aeruginosa RecA analog is similar to that by the activated E. coli RecA protein. The product of the recA analog was identified in minicells as a protein of approximately 47,000 daltons. Western blot analysis using anti-E. coli RecA antibody demonstrated that this protein is antigenically cross-reactive with the E. coli recA protein. The recA-containing fragment was cloned into the broad-host-range vector pCP13 and introduced into Rec- strains of P. aeruginosa containing the rec-102 allele. The plasmid was shown to restore recombination proficiency in FP5-mediated conjugations and to restore resistance to UV irradiation and methyl methanesulfonate to these Rec- mutants. It was shown that a wild-type allele of rec-102 is necessary for UV-mediated induction of D3 and F116 prophages. The cloned recA analog restored the UV inducibility of these prophages in rec-102 mutants.
International Nuclear Information System (INIS)
Kokjohn, T.A.; Miller, R.V.
1987-01-01
We cloned a 2.3-kilobase-pair fragment of the Pseudomonas aeruginosa PAO chromosome which is capable of complementing recA mutations of Escherichia coli. The recA-complementing activity was further localized to a 1.5-kilobase-pair PvuII-HindIII fragment. Southern blot analysis under conditions of high stringency indicated that DNA sequence homology is shared by the E. coli recA gene and the P. aeruginosa recA analog. The cloned recA analog was shown to restore resistance to methyl methanesulfonate, nitrofurantoin, and UV irradiation to E. coli recA mutants. Upon introduction of the cloned P. aeruginosa gene, these mutants regained recombination proficiency in HfrH-mediated conjugation and the ability to induce lambda prophages and SOS functions (din gene transcription) after exposure to DNA-damaging agents. Lambda prophage carrying a cI ind mutation was not inducible, suggesting that the mechanism of induction of these SOS functions by the P. aeruginosa RecA analog is similar to that by the activated E. coli RecA protein. The product of the recA analog was identified in minicells as a protein of approximately 47,000 daltons. Western blot analysis using anti-E. coli RecA antibody demonstrated that this protein is antigenically cross-reactive with the E. coli recA protein. The recA-containing fragment was cloned into the broad-host-range vector pCP13 and introduced into Rec- strains of P. aeruginosa containing the rec-102 allele. The plasmid was shown to restore recombination proficiency in FP5-mediated conjugations and to restore resistance to UV irradiation and methyl methanesulfonate to these Rec- mutants. It was shown that a wild-type allele of rec-102 is necessary for UV-mediated induction of D3 and F116 prophages. The cloned recA analog restored the UV inducibility of these prophages in rec-102 mutants
Where bio meets nano: The many uses for nanoporous aluminium oxide in biotechnology
Ingham, C.J.; Maat, ter J.; Vos, de W.M.
2012-01-01
Porous aluminum oxide (PAO) is a ceramic formed by an anodization process of pure aluminum that enables the controllable assembly of exceptionally dense and regular nanopores in a planar membrane. As a consequence, PAO has a high porosity, nanopores with high aspect ratio, biocompatibility and the
What factors predict failure 4 to 12 years after periacetabular osteotomy?
DEFF Research Database (Denmark)
Hartig-Andreasen, Charlotte; Troelsen, Anders; Thillemann, Theis Muncholm
2012-01-01
The goal of periacetabular osteotomy (PAO) is to delay or prevent osteoarthritic development in dysplastic hips. However, it is unclear whether the surgical goals are achieved and if so in which patients. This information is essential to select appropriate patients for a durable PAO that achieves...
Energy Technology Data Exchange (ETDEWEB)
Zolper, Thomas J.; He, Yifeng; Delferro, Massimiliano; Shiller, Paul; Doll, Gary; LotfizadehDehkordi, Babak; Ren, Ning; Lockwood, Frances; Marks, Tobin J.; Chung, Yip-Wah; Greco, Aaron; Erdemir, Ali; Wang, Qian
2016-08-11
This study investigates the rheological properties, elastohydrodynamic (EHD) film-forming capability, and friction coefficients of low molecular mass poly-alpha-olefin (PAO) base stocks with varying contents of high molecular mass olefin copolymers (OCPs) to assess their shear stability and their potential for energy-efficient lubrication. Several PAO-OCP mixtures were blended in order to examine the relationship between their additive content and tribological performance. Gel permeation chromatography (GPC) and nuclear magnetic resonance (NMR) spectroscopy were used to characterize the molecular masses and structures, respectively. Density, viscosity, EHD film thickness, and friction were measured at 303 K, 348 K, and 398 K. Film thickness and friction were studied at entrainment speeds relevant to the boundary, mixed, and full-film lubrication regimes. The PAO-OCP mixtures underwent temporary shear-thinning resulting in decreases in film thickness and hydrodynamic friction. These results demonstrate that the shear characteristics of PAO-OCP mixtures can be tuned with the OCP content and provide insight into the effects of additives on EHD characteristics.
DEFF Research Database (Denmark)
Radova, A.; Sebela, M.; Galuszka, P.
2001-01-01
This paper reports the first purification method developed for the isolation of an homogeneous polyamine oxidase (PAO) from etiolated barley seedlings. The crude enzyme preparation was obtained after initial precipitation of the extract with protamine sulphate and ammonium sulphate. The enzyme...... was further confirmed by measuring the fluorescence spectra, Barley PAO is an acidic protein (pI 5.4) containing 3% of neutral sugars: its molecular mass determined by SDS-PAGE was 56 kDa, whilst gel permeation chromatography revealed the higher value of 76 kDa. The N-terminal amino acid sequence of barley...... PAO shows a high degree of similarity to that of maize PAO and to several other flavoprotein oxidases. The polyamines spermine and spermidine were the only two substrates of the enzyme with K-m values 4 x 10(-5) and 3 x 10(-5) M and pH optima of 5.0 and 6.0, respectively. Barley polyamine oxidase...
Directory of Open Access Journals (Sweden)
Lizhen Xing
2013-01-01
Full Text Available Enhanced biological phosphorus removal (EBPR may deteriorate or fail during low organic carbon loading periods. Polyphosphate accumulating organisms (PAOs in EBPR were acclimated under both high and low organic carbon conditions, and then dynamics of polymers in typical cycles, anaerobic conditions with excess organic carbons, and endogenous respiration conditions were examined. After long-term acclimation, it was found that organic loading rates did not affect the yield of PAOs and the applied low organic carbon concentrations were advantageous for the enrichment of PAOs. A low influent organic carbon concentration induced a high production of extracellular carbohydrate. During both anaerobic and aerobic endogenous respirations, when glycogen decreased to around 80 ± 10 mg C per gram of volatile suspended solids, PAOs began to utilize polyphosphate significantly. Regressed by the first-order reaction model, glycogen possessed the highest degradation rate and then was followed by polyphosphate, while biomass decay had the lowest degradation rate.
DEFF Research Database (Denmark)
Jensen, Peter Østrup; Briales, Alejandra; Brochmann, Rikke Prejh
2014-01-01
induction of cytotoxic hydroxyl radicals (OH˙) during antibiotic treatment of planktonically grown cells may contribute to action of the commonly used antibiotic ciprofloxacin on P. aeruginosa biofilms. For this purpose, WT PAO1, a catalase deficient ΔkatA and a ciprofloxacin resistant mutant of PAO1 (gyr...
A multislice single breath-hold scheme for imaging alveolar oxygen tension in humans.
Hamedani, Hooman; Kadlecek, Stephen J; Emami, Kiarash; Kuzma, Nicholas N; Xu, Yinan; Xin, Yi; Mongkolwisetwara, Puttisarn; Rajaei, Jennia; Barulic, Amy; Wilson Miller, G; Rossman, Milton; Ishii, Masaru; Rizi, Rahim R
2012-05-01
Reliable, noninvasive, and high-resolution imaging of alveolar partial pressure of oxygen (p(A)O(2)) is a potentially valuable tool in the early diagnosis of pulmonary diseases. Several techniques have been proposed for regional measurement of p(A)O(2) based on the increased depolarization rate of hyperpolarized (3) He. In this study, we explore one such technique by applying a multislice p(A)O(2) -imaging scheme that uses interleaved-slice ordering to utilize interslice time-delays more efficiently. This approach addresses the low spatial resolution and long breath-hold requirements of earlier techniques, allowing p(A)O(2) measurements to be made over the entire human lung in 10-15 s with a typical resolution of 8.3 × 8.3 × 15.6 mm(3). PO(2) measurements in a glass syringe phantom were in agreement with independent gas analysis within 4.7 ± 4.1% (R = 0.9993). The technique is demonstrated in four human subjects (healthy nonsmoker, healthy former smoker, healthy smoker, and patient with COPD), each imaged six times on 3 different days during a 2-week span. Two independent measurements were performed in each session, consisting of 12 coronal slices. The overall p(A)O(2) mean across all subjects was 95.9 ± 12.2 Torr and correlated well with end-tidal O(2) (R = 0.805, P < 0.0001). The alveolar O(2) uptake rate was consistent with the expected range of 1-2 Torr/s. Repeatable visual features were observed in p(A)O(2) maps over different days, as were characteristic differences among the subjects and gravity-dependent effects. Copyright © 2011 Wiley Periodicals, Inc.
Effect of high calcium concentration influents on enhanced biological phosphorus removal process
International Nuclear Information System (INIS)
Montoya Martinez, T.; Aguado Garcia, D.; Ferrer Polo, J.
2010-01-01
In this work, the effect of calcium concentration in wastewater on the polyphosphate accumulating organisms (PAO) is investigated as well as its influence in PAO metabolism, specifically in the Y P O4 (ratio between phosphorus release and acetic acid uptake). For this study a sequencing batch reactor (SBR) anaerobic-aerobic was used, in which the PAO enriched biomass was exposed to different calcium concentrations in the influent wastewater. The results indicate that until a given calcium level in the influent wastewater (35 mg Ca/l) the metabolism is not affect, but higher calcium concentrations lead to significant Y P O4 decline. (Author) 18 refs.
Effect of a Facial Muscle Exercise Device on Facial Rejuvenation.
Hwang, Ui-Jae; Kwon, Oh-Yun; Jung, Sung-Hoon; Ahn, Sun-Hee; Gwak, Gyeong-Tae
2018-01-20
The efficacy of facial muscle exercises (FMEs) for facial rejuvenation is controversial. In the majority of previous studies, nonquantitative assessment tools were used to assess the benefits of FMEs. This study examined the effectiveness of FMEs using a Pao (MTG, Nagoya, Japan) device to quantify facial rejuvenation. Fifty females were asked to perform FMEs using a Pao device for 30 seconds twice a day for 8 weeks. Facial muscle thickness and cross-sectional area were measured sonographically. Facial surface distance, surface area, and volumes were determined using a laser scanning system before and after FME. Facial muscle thickness, cross-sectional area, midfacial surface distances, jawline surface distance, and lower facial surface area and volume were compared bilaterally before and after FME using a paired Student t test. The cross-sectional areas of the zygomaticus major and digastric muscles increased significantly (right: P jawline surface distances (right: P = 0.004, left: P = 0.003) decreased significantly after FME using the Pao device. The lower facial surface areas (right: P = 0.005, left: P = 0.006) and volumes (right: P = 0.001, left: P = 0.002) were also significantly reduced after FME using the Pao device. FME using the Pao device can increase facial muscle thickness and cross-sectional area, thus contributing to facial rejuvenation. © 2018 The American Society for Aesthetic Plastic Surgery, Inc.
Jensen, Peter Ø; Briales, Alejandra; Brochmann, Rikke P; Wang, Hengzhuang; Kragh, Kasper N; Kolpen, Mette; Hempel, Casper; Bjarnsholt, Thomas; Høiby, Niels; Ciofu, Oana
2014-04-01
Antibiotic-tolerant, biofilm-forming Pseudomonas aeruginosa has long been recognized as a major cause of chronic lung infections of cystic fibrosis patients. The mechanisms involved in the activity of antibiotics on biofilm are not completely clear. We have investigated whether the proposed induction of cytotoxic hydroxyl radicals (OH˙) during antibiotic treatment of planktonically grown cells may contribute to action of the commonly used antibiotic ciprofloxacin on P. aeruginosa biofilms. For this purpose, WT PAO1, a catalase deficient ΔkatA and a ciprofloxacin resistant mutant of PAO1 (gyrA), were grown as biofilms in microtiter plates and treated with ciprofloxacin. Formation of OH˙ and total amount of reactive oxygen species (ROS) was measured and viability was estimated. Formation of OH˙ and total ROS in PAO1 biofilms treated with ciprofloxacin was shown but higher levels were measured in ΔkatA biofilms, and no ROS production was seen in the gyrA biofilms. Treatment with ciprofloxacin decreased the viability of PAO1 and ΔkatA biofilms but not of gyrA biofilms. Addition of thiourea, a OH˙ scavenger, decreased the OH˙ levels and killing of PAO1 biofilm. Our study shows that OH˙ is produced by P. aeruginosa biofilms treated with ciprofloxacin, which may contribute to the killing of biofilm subpopulations. © 2013 Federation of European Microbiological Societies. Published by John Wiley & Sons Ltd. All rights reserved.
DEFF Research Database (Denmark)
McIlroy, Simon Jon; Albertsen, Mads; Stokholm-Bjerregaard, Mikkel
“Candidatus Accumulibacter phosphatis” (Accumulibacter) and the model GAO being the gammaproteobacterial “Candidatus Competibacter phosphatis” (see Oehmen et al., 2007). Here, we report the discovery of a GAO from the genus Propionivibrio, which is closely related to Accumulibacter. Propionivibrio is often...
Directory of Open Access Journals (Sweden)
Qing-qing XIANG
2016-03-01
Full Text Available Objective To investigate the effects of lasR/rhlR gene on Foxp3, TGF-β1 and IL-10 of lung tissue in rat tracheal intubation model with biofilm infection of Pseudomonas aeruginosa (Ps. aer wild strain (PAO1 and quorum sensing (QS deficient strain (ΔlasRΔrhlR. Methods Twenty-one SD rats were randomly assigned into 3 groups (7 each: ΔlasRΔrhlR-treated group, PAO1-treated group and sterile control group. Biofilms (BF were cultured in vitro, and the BF coated tube (infected respectively with Ps. aer PAO1 strain, ΔlasRΔrhlR strain, or with asepsis was inserted into the trachea to establish the rat model. The rats were sacrificed on the 7th day after intubation. Colony count of lung tissue homogenate (cfu and lung HE staining were performed, and IL-10 content in bronchoalveolar lavage fluid (BALF, TGF-β1 in lung tissue, and the expression of Foxp3 mRNA in lung cells were determined. Results The bacterial counts were significantly higher in PAO1 and ΔlasRΔrhlR groups than that in sterile control group, and the counts were obviously higher in PAO1 group (10 400.00±6313.70/g lung tissue than that in ΔlasRΔrhlR group (975.00±559.97/g lung tissue, P<0.05. There was no significant pathological changes in lung tissue in sterile control group, while the bronchi and blood vessels in PAO1 group were infiltrated by a large number of inflammatory cells and complicated with alveolar septum thickening and local abscess and necrosis. The pathological changes were milder in ΔlasRΔrhlR group than in PAO1 group; the expression of Foxp3 mRNA was higher in the two Ps. aer infected groups than that in sterile control group (0.65±0.32, and it was significantly higher in PAO1 group (4.62±1.07 than in ΔlasRΔrhlR group (2.15±1.43, P<0.05. The accumulated optical density value of TGF-β1 was significantly higher in the two Ps. aer infected groups than in sterile control group (3721.66±1412.95, and significantly higher in PAO1 group (65 090.56±33
Avaliação dos parâmetros gasométricos dos traumatizados durante o atendimento pré-hospitalar móvel
Directory of Open Access Journals (Sweden)
Ricardo Alessandro Teixeira Gonsaga
Full Text Available OBJETIVO: avaliar diferenças gasométricas dos pacientes traumatizados graves que necessitaram de intubação orotraqueal no atendimento pré-hospitalar. MÉTODOS: foram colhidas amostras de sangue dos pacientes que necessitaram de manejo de via aérea no início do atendimento pré-hospitalar e ao dar entrada na Unidade de Urgência. Foram analisados: pH, pressão arterial de CO2 (PaCO2, pressão arterial de O2 (PaO2, excesso de base (BE, saturação da hemoglobina por O2 (satO2 e a relação PaO2 e a fração inspirada de O2 (PaO2/FiO2. RESULTADOS: houve significância estatística entre as diferenças das médias entre os dados coletados no local do sinistro e na entrada da UUE na Frequência respiratória (p=0,0181, na Escala de Coma de Glasgow (p=0,0084, na pressão parcial arterial de oxigênio (PaO2; p<0,0001 e na saturação da hemoglobina pelo oxigênio (p=0,0018. CONCLUSÃO: a intubação orotraqueal altera os parâmetros PaO2 e saturação de oxigênio pela hemoglobina. Não houve diferença nos parâmetros metabólicos (pH, Bicarbonato e excesso de base. Na análise dos parâmetros hemogasométricos dos sobreviventes e não sobreviventes observou-se diferença estatística entre o PaO2, saturação de oxigênio pela hemoglobina e excesso de base.
Directory of Open Access Journals (Sweden)
Henry Bernard
Full Text Available The administration of prebiotics as oligosaccharides (OS, by acting on intestinal microbiota, could modulate the immune and inflammatory response and represent a new strategy to improve the outcome of bacterial infection. The aim of this study was to determine whether pectin-derived acidic oligosaccharides (pAOS could modulate the outcome of pulmonary P. aeruginosa (PA infection in C57BL/6 mice, which develop a Th1 response to PA lung infection. Mice were randomized for 5 weeks to consume a control or a 5% pAOS diet and chronically infected by PA. Resistance to a second PA infection was also analyzed by reinfecting the surviving mice 2 weeks after the first infection. Compared with control mice, mice fed pAOS had reduced mortality (P<0.05. This improvement correlated with a better control of the inflammatory response with a lower neutrophil count on day 1 (P<0.05, a sustained neutrophil and macrophage recruitment on days 2 and 3 (P<0.01 a greater and sustained IL-10 release in lung (P<0.05 and a reduction of the Th1 response and M1 activation with a lower IFN-γ/IL-4 (P<0.01 and nos2/arg1 (P<0.05 ratios. These results coincided with a modulation of the intestinal microbiota as shown by an increased butyric acid concentration in feces (P<0.05. Moreover, pAOS decreased the bacterial load (P<0.01 in mice reinfected 2 weeks after the first infection, suggesting that pAOS could reduce pulmonary exacerbations. In conclusion, pAOS improved the outcome of PA infection in C57BL/6 mice by modulating the intestinal microbiota and the inflammatory and immune responses.
2001-06-01
Research Centre; 1994:54-59. 15. Rudge FW. Relationship of menstrual history to altitude chamber decompression sickness. Aviation, Space, and...This is due to the pattern of the O2 dissociation curve. At low O2 saturation the same shunt gives a smaller effect on Pa,O2 versus PA,O2. 41-4 COPA
[Lung dysfunction in patients with mild chronic obstructive bronchitis].
Nefedov, V B; Popova, L A; Shergina, E A
2004-01-01
VC, FVC, FEV1, FEV1/VC%, PEF, MEF25, MEF50, MEF75, TCL, TGV, RV, Ravt, Riin, Rex, DLCO-SS, PaO2, and PaO2 were determined in 33 patients with mild chronic obstructive lung disease (FEV1 > 70% of the normal value). All the patients were found to have impaired bronchial patency; most (63.6%) patients had lung volume and capacity changes, almost half (45.5%) the patients had pulmonary gas exchange dysfunction. Impaired bronchial patency mainly appeared as decreased MEF50, MEF15, and FEV1/VC%; altered lung volumes and capacities manifested chiefly by increased RV and decreased VC; pulmonary gas exchange dysfunction showed up primarily as lowered PaO2. The magnitude of the observed functional changes was generally slight. MEF50, MEF75, FEV1/VC%, and VC dropped to 59-20 and 79-70% of the normal value, respectively. RV increased up to 142-196% of the normal value; PaO2 reduced up to 79-60% mm Hg.
Nicolini, A; Tonveronachi, E; Navalesi, P; Antonelli, M; Valentini, I; Melotti, R M; Pigna, A; Carrassi, A; Righini, P; Ferrari Bravo, M; Pelosi, P; Nicoli, F; Cosentini, R; Vaschetto, R; Faenza, S; Nava, S
2012-12-01
The use of non-invasive ventilation (NIV) in acute hypoxemic respiratory failure (AHRF) due to H1N1 virus infection is controversial. In this multicenter study we aimed to assess the efficacy of NIV in avoiding endotracheal intubation (ETI) and to identify predictors of success or failure. In this prospective multicenter study, 98 patients with new pulmonary infiltrate(s) sustained by H1N1 virus and a PaO(2)/FiO229 and a PaO(2)/FIO(2)≤127 at admission and PaO2/FIO(2)≤149 after 1 hr of NIV were independently associated with the need for ETI. The early application of NIV, with the aim to avoid invasive ventilation, during the H1N1 pandemics was associated with an overall success rate of 47/98 (48%). Patients presenting at admission with an high SAPS II score and a low PaO(2)/FiO(2) ratio and/or unable to promptly correct gas exchange are at high risk of intubation and mortality.
Is Cup Positioning Challenged in Hips Previously Treated With Periacetabular Osteotomy?
DEFF Research Database (Denmark)
Hartig-Andreasen, Charlotte; Stilling, Maiken; Søballe, Kjeld
2014-01-01
After periacetabular osteotomy (PAO), some patients develop osteoarthritis with need of a total hip arthroplasty (THA). We evaluated the outcome of THA following PAO and explored factors associated with inferior cup position and increased polyethylene wear. Follow-up were performed 4 to 10years...... after THA in 34 patients (38 hips) with previous PAO. Computer analysis evaluated cup position and wear rates. No patient had dislocations or revision surgery. Median scores were: Harris hip 96, Oxford hip 38 and WOMAC 78. Mean cup anteversion and abduction angles were 22(o) (range 7°-43°) and 45......° (range 28°-65°). Outliers of cup abduction were associated with persisting dysplasia (CE...
ORF Alignment: NC_002516 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_002516 gi|15595667 >1kmoA 10 661 142 802 6e-74 ... ref|NP_249161.1| probable hydroxamate-type ferris...le hydroxamate-type ... ferrisiderophore receptor PA0470 [imported] - ... ... ... hydroxamate-type ferrisiderophore receptor [Pseudomonas ... aeruginosa PAO1] pir||C83588 probab...iderophore receptor [Pseudomonas ... aeruginosa PAO1] gb|AAG03859.1| probable ...
Wu, Guangxue; Nielsen, Michael; Sorensen, Ketil; Zhan, Xinmin; Rodgers, Michael
2009-10-01
The spatial distributions and activities of ammonia oxidizing bacteria (AOB) and polyphosphate accumulating organisms (PAOs) were investigated for a novel laboratory-scale sequencing batch pumped-flow biofilm reactor (PFBR) system that was operated for carbon, nitrogen and phosphorus removal. The PFBR comprised of two 16.5l tanks (Reactors 1 and 2), each with a biofilm module of 2m(2) surface area. To facilitate the growth of AOB and PAOs in the reactor biofilms, the influent wastewater was held in Reactor 1 under stagnant un-aerated conditions for 6 h after feeding, and was then pumped over and back between Reactors 1 and 2 for 12 h, creating aerobic conditions in the two reactors during this period; as a consequence, the biofilm in Reactor 2 was in an aerobic environment for almost all the 18.2 h operating cycle. A combination of micro-sensor measurements, molecular techniques, batch experiments and reactor studies were carried out to analyse the performance of the PFBR system. After 100 days operation at a filtered chemical oxygen demand (COD(f)) loading rate of 3.46 g/m(2) per day, the removal efficiencies were 95% COD(f), 87% TN(f) and 74% TP(f). While the PFBR microbial community structure and function were found to be highly diversified with substantial AOB and PAO populations, about 70% of the phosphorus release potential and almost 100% of the nitrification potential were located in Reactors 1 and 2, respectively. Co-enrichment of AOB and PAOs was realized in the Reactor 2 biofilm, where molecular analyses revealed unexpected microbial distributions at micro-scale, with population peaks of AOB in a 100-250 microm deep sub-surface zone and of PAOs in the 0-150 microm surface zone. The micro-distribution of AOB coincided with the position of the nitrification peak identified during micro-sensor analyses. The study demonstrates that enrichment of PAOs can be realized in a constant or near constant aerobic biofilm environment. Furthermore, the findings suggest
Periodic local MP2 method employing orbital specific virtuals
International Nuclear Information System (INIS)
Usvyat, Denis; Schütz, Martin; Maschio, Lorenzo
2015-01-01
We introduce orbital specific virtuals (OSVs) to represent the truncated pair-specific virtual space in periodic local Møller-Plesset perturbation theory of second order (LMP2). The OSVs are constructed by diagonalization of the LMP2 amplitude matrices which correspond to diagonal Wannier-function (WF) pairs. Only a subset of these OSVs is adopted for the subsequent OSV-LMP2 calculation, namely, those with largest contribution to the diagonal pair correlation energy and with the accumulated value of these contributions reaching a certain accuracy. The virtual space for a general (non diagonal) pair is spanned by the union of the two OSV sets related to the individual WFs of the pair. In the periodic LMP2 method, the diagonal LMP2 amplitude matrices needed for the construction of the OSVs are calculated in the basis of projected atomic orbitals (PAOs), employing very large PAO domains. It turns out that the OSVs are excellent to describe short range correlation, yet less appropriate for long range van der Waals correlation. In order to compensate for this bias towards short range correlation, we augment the virtual space spanned by the OSVs by the most diffuse PAOs of the corresponding minimal PAO domain. The Fock and overlap matrices in OSV basis are constructed in the reciprocal space. The 4-index electron repulsion integrals are calculated by local density fitting and, for distant pairs, via multipole approximation. New procedures for determining the fit-domains and the distant-pair lists, leading to higher efficiency in the 4-index integral evaluation, have been implemented. Generally, and in contrast to our previous PAO based periodic LMP2 method, the OSV-LMP2 method does not require anymore great care in the specification of the individual domains (to get a balanced description when calculating energy differences) and is in that sense a black box procedure. Discontinuities in potential energy surfaces, which may occur for PAO-based calculations if one is not
Directory of Open Access Journals (Sweden)
Alexander S. Little
2018-01-01
Full Text Available Pseudomonas aeruginosa employs numerous, complex regulatory elements to control expression of its many virulence systems. The P. aeruginosa AlgZR two-component regulatory system controls the expression of several crucial virulence phenotypes. We recently determined, through transcriptomic profiling of a PAO1 ΔalgR mutant strain compared to wild-type PAO1, that algZR and hemCD are cotranscribed and show differential iron-dependent gene expression. Previous expression profiling was performed in strains without algR and revealed that AlgR acts as either an activator or repressor, depending on the gene. Thus, examination of P. aeruginosa gene expression from cells locked into different AlgR phosphorylation states reveals greater physiological relevance. Therefore, gene expression from strains carrying algR alleles encoding a phosphomimetic (AlgR D54E or a phosphoablative (AlgR D54N form were compared by microarray to PAO1. Transcriptome analyses of these strains revealed 25 differentially expressed genes associated with iron siderophore biosynthesis or heme acquisition or production. The PAO1 algR D54N mutant produced lower levels of pyoverdine but increased expression of the small RNAs prrf1 and prrf2 compared to PAO1. In contrast, the algR D54N mutant produced more pyocyanin than wild-type PAO1. On the other hand, the PAO1 algR D54E mutant produced higher levels of pyoverdine, likely due to increased expression of an iron-regulated gene encoding the sigma factor pvdS, but it had decreased pyocyanin production. AlgR specifically bound to the prrf2 and pvdS promoters in vitro. AlgR-dependent pyoverdine production was additionally influenced by carbon source rather than the extracellular iron concentration per se. AlgR phosphorylation effects were also examined in a Drosophila melanogaster feeding, murine acute pneumonia, and punch wound infection models. Abrogation of AlgR phosphorylation attenuated P. aeruginosa virulence in these infection
Periodic local MP2 method employing orbital specific virtuals
Energy Technology Data Exchange (ETDEWEB)
Usvyat, Denis, E-mail: denis.usvyat@chemie.uni-regensburg.de; Schütz, Martin, E-mail: martin.schuetz@chemie.uni-regensburg.de [Institute for Physical and Theoretical Chemistry, Universität Regensburg, Universitätsstraße 31, D-93040 Regensburg (Germany); Maschio, Lorenzo, E-mail: lorenzo.maschio@unito.it [Dipartimento di Chimica, and Centre of Excellence NIS (Nanostructured Interfaces and Surfaces), Università di Torino, via Giuria 5, I-10125 Torino (Italy)
2015-09-14
We introduce orbital specific virtuals (OSVs) to represent the truncated pair-specific virtual space in periodic local Møller-Plesset perturbation theory of second order (LMP2). The OSVs are constructed by diagonalization of the LMP2 amplitude matrices which correspond to diagonal Wannier-function (WF) pairs. Only a subset of these OSVs is adopted for the subsequent OSV-LMP2 calculation, namely, those with largest contribution to the diagonal pair correlation energy and with the accumulated value of these contributions reaching a certain accuracy. The virtual space for a general (non diagonal) pair is spanned by the union of the two OSV sets related to the individual WFs of the pair. In the periodic LMP2 method, the diagonal LMP2 amplitude matrices needed for the construction of the OSVs are calculated in the basis of projected atomic orbitals (PAOs), employing very large PAO domains. It turns out that the OSVs are excellent to describe short range correlation, yet less appropriate for long range van der Waals correlation. In order to compensate for this bias towards short range correlation, we augment the virtual space spanned by the OSVs by the most diffuse PAOs of the corresponding minimal PAO domain. The Fock and overlap matrices in OSV basis are constructed in the reciprocal space. The 4-index electron repulsion integrals are calculated by local density fitting and, for distant pairs, via multipole approximation. New procedures for determining the fit-domains and the distant-pair lists, leading to higher efficiency in the 4-index integral evaluation, have been implemented. Generally, and in contrast to our previous PAO based periodic LMP2 method, the OSV-LMP2 method does not require anymore great care in the specification of the individual domains (to get a balanced description when calculating energy differences) and is in that sense a black box procedure. Discontinuities in potential energy surfaces, which may occur for PAO-based calculations if one is not
Directory of Open Access Journals (Sweden)
Alonso Gómez Duque
2002-01-01
Full Text Available Background: Arteriovenous admixture or intrapulmonary shunt and the relation between PaO2 and FI02 (PaO2/FiO2 have been advocated as the main indicators of pulmonary function. Because the Pa02 is a measure of the oxygen given to the tissues, as well as the Sa02, we could expect a close relationship between the Pa02IFI02 index and a new one, the SaO2/FiO2 index, Methods: We conducted a prospective study in a cohortofl07 patients with different pathologies in an Intensive Care Unit, collecting 507 samples of arterial and central venous gases and measuring the Sa02 by pulse oximeter at the same time. PaO2/FiO2 and Sa O2/FiO2, as well as intrapulmonary shunt using invasive and noninvasive methods, were caIculated. The Lung Injury Score (LIS and the Multiple Organ Dysfunction score were calculated too. Results: We found a good correlation between Sa O2/FiO2 and PaO2/FiO2. (R2=0,81,R=0.9, and between the intrapulmonary shuntfraction calculated with invasive and noninvasive methods.(R2=0.75, R=0.86. The data were correlationed with a simple linear regression analysis. Five groups of SaO2/FiO2 were found and a punctuation from Oto 4 was established for them, in a similar approach to the one used by Murray in the Lung Injury Score (LIS and Marshall in the Multiple Organ Dysfunction score. By using this punctuation, we replaced the PaO2/FiO2 by the SaO2/FiO2 in the scale and recalculated the LIS finding a good correlation between the score with PaO2/FiO2 and the one with SaO2/FiO2 (R2=0.94,R=0.96. The same was true for the correlation between the Marshall score with PaO2/FiO2 and the one with SaO2/FiO2. (R2=O.85, R=0.92. The correlation was mantained when a stratified analysis was made according to the degree of severity of the pulmonary injury. Conclusions: SaO2/FiO2 is an useful indicator of the oxygenation in a similar way as the PaO2/FiO2 índex, It could be incorporated into the LIS and Marshall score with similar results. The usefulness of the
Directory of Open Access Journals (Sweden)
I. A. Kozlov
2011-01-01
Full Text Available Objective: to study the efficacy of inhaled nitric oxide used intraoperatively to prevent lung oxygenating dysfunction in patients with coronary heart disease after myocardial revascularization under extracorporeal circulation (EC. Subjects and methods. Thirty-two patients aged 55.0±2.0 years were examined. The inclusion criteria were the standard course of surgical intervention (the absence of hemorrhage, acute cardiovascular insufficiency, perioperative myocardial infarction, etc., a pulmonary artery wedge pressure of less than 15 – mm Hg throughout the study, and the baseline arterial partial oxygen tension/inspired mixture oxygen fraction (PaO2/FiO2 ratio of at least 350 mm Hg. There was a control group (n=21; Group 1 that used no special measures to prevent and/or to correct lung oxygenating dysfunction and Group 2 (n=11 that received inhaled nitric oxide. Ihe administration of inhaled nitric oxide at a concentration of 10 ppm was initiated after water anesthesia, stopped during EC, and resumed in the postperfusion period. Results. At the end, PaO2/FiO2 and intrapulmonary shunt fraction did not differ between the groups (p>0.05. Before EC, the patients receiving inhaled nitric oxide had a lower intrapulmonary blood shunting (8.9±0.7 and 11.7±1.0%; p<0.05. There were no intergroup differences in the values of PaO2/FiO2 at this stage. In the earliest postperfusion period, PaO2/FiO2 was higher in Group 2 than that in Group 1. At the end of operations, Groups 1 and 2 had a PaO2/FiO2 of 336.0±16.8 and 409.0±24.3 mm Hg, respectively (p<0.05 and an intrapulmonary shunt fraction of 14.5±1.0 and 10.4±1.0% (p<0.05. At the end of surgery, the rate of a reduction in PaO2/FiO2 to the level below 350 mm Hg was 52.4±11.1% in Group 1 and 18.2±11.6% in Group 2 (p<0.05. Six hours after surgery, PaO2/FiO2 values less than 300 mm Hg were diagnosed in 61.9±10.5% of Group 1 patients and in 27.3±13.4% of Group 2 ones (p<0.05. Conclusion. The
Heim, U; Clauss, M; Bürki, N; Lutz, T; Ilchmann, T
2010-11-01
Musculoskeletal pain during pregnancy and lactation is a common finding. Differential diagnoses range from"normal" findings to disturbances in bone metabolism and pregnancy-associated osteoporosis (PAO). Imaging options are limited due to pregnancy, and laboratory diagnostics are time-consuming. Treatment of PAO with physiotherapy, pain killers and substitution of vitamin D and calcium leads to a rapid recovery from symptoms.
Effect of acute hypoxia on cognition: A systematic review and meta-regression analysis.
McMorris, Terry; Hale, Beverley J; Barwood, Martin; Costello, Joseph; Corbett, Jo
2017-03-01
A systematic meta-regression analysis of the effects of acute hypoxia on the performance of central executive and non-executive tasks, and the effects of the moderating variables, arterial partial pressure of oxygen (PaO 2 ) and hypobaric versus normobaric hypoxia, was undertaken. Studies were included if they were performed on healthy humans; within-subject design was used; data were reported giving the PaO 2 or that allowed the PaO 2 to be estimated (e.g. arterial oxygen saturation and/or altitude); and the duration of being in a hypoxic state prior to cognitive testing was ≤6days. Twenty-two experiments met the criteria for inclusion and demonstrated a moderate, negative mean effect size (g=-0.49, 95% CI -0.64 to -0.34, p<0.001). There were no significant differences between central executive and non-executive, perception/attention and short-term memory, tasks. Low (35-60mmHg) PaO 2 was the key predictor of cognitive performance (R 2 =0.45, p<0.001) and this was independent of whether the exposure was in hypobaric hypoxic or normobaric hypoxic conditions. Copyright © 2017 Elsevier Ltd. All rights reserved.
The microbial community in a high-temperature enhanced biological phosphorus removal (EBPR process
Directory of Open Access Journals (Sweden)
Ying Hui Ong
2016-01-01
Full Text Available An enhanced biological phosphorus removal (EBPR process operated at a relatively high temperature, 28 °C, removed 85% carbon and 99% phosphorus from wastewater over a period of two years. This study investigated its microbial community through fluorescent in situ hybridization (FISH and clone library generation. Through FISH, considerably more Candidatus “Accumulibacter phosphatis” (Accumulibacter-polyphosphate accumulating organisms (PAOs than Candidatus ‘Competibacter phosphatis’ (Competibacter-glycogen accumulating organisms were detected in the reactor, at 36 and 7% of total bacterial population, respectively. A low ratio of Glycogen/Volatile Fatty Acid of 0.69 further indicated the dominance of PAOs in the reactor. From clone library generated, 26 operational taxonomy units were retrieved from the sludge and a diverse population was shown, comprising Proteobacteria (69.6%, Actinobacteria (13.7%, Bacteroidetes (9.8%, Firmicutes (2.94%, Planctomycetes (1.96%, and Acidobacteria (1.47%. Accumulibacter are the only recognized PAOs revealed by the clone library. Both the clone library and FISH results strongly suggest that Accumulibacter are the major PAOs responsible for the phosphorus removal in this long-term EBPR at relatively high temperature.
Energy Technology Data Exchange (ETDEWEB)
D.M. Jolley
1999-12-02
As directed by a written development plan (CRWMS M&O 1999a), a conceptual model for steel and corrosion products in the engineered barrier system (EBS) is to be developed. The purpose of this conceptual model is to assist Performance Assessment Operations (PAO) and its Engineered Barrier Performance Department in modeling the geochemical environment within a repository drift, thus allowing PAO to provide a more detailed and complete in-drift geochemical model abstraction and to answer the key technical issues (KTI) raised in the NRC Issue Resolution Status Report (IRSR) for the Evolution of the Near-Field Environment (NFE) Revision 2 (NRC 1999). This document provides the conceptual framework for the in-drift corrosion products sub-model to be used in subsequent PAO analyses including the EBS physical and chemical model abstraction effort. This model has been developed to serve as a basis for the in-drift geochemical analyses performed by PAO. However, the concepts discussed within this report may also apply to some near and far-field geochemical processes and may have conceptual application within the unsaturated zone (UZ) and saturated zone (SZ) transport modeling efforts.
Romero-Fernández, Ma Mar; Royo-Bordonada, Miguel Angel; Rodríguez-Artalejo, Fernando
2010-07-01
To evaluate the level of compliance with the PAOS Code (Publicidad, Actividad, Obesidad y Salud), which establishes standards for the self-regulation of food marketing aimed at minors, in television advertising by food and beverage companies that have agreed to abide by the Code. The study sample consisted of food and beverage advertisements targeting children during 80 h of programming by four Spanish television networks. The level of compliance with each standard of the PAOS Code was classified into three categories: 'compliance', 'non-compliance' and 'uncertain compliance'. Overall, an advertisement was considered compliant with the PAOS Code if it met all the standards; non-compliant if it contravened one or more standards; and uncertain in all other cases. Of a total of 203 television advertisements from companies that agreed to the PAOS Code, the overall prevalence of non-compliance was 49.3% (v. 50.8% among those that did not agree to the code), with 20.7% of advertisements considered of uncertain compliance. Non-compliance was more frequent on Saturdays, in longer advertisements, in advertisements containing promotions or dairy products, and for advertisements from companies of French or US origin. Non-compliance with the PAOS Code was very high and was similar for companies that did and did not agree to the Code, casting doubt on the Code's effectiveness and oversight system. It seems the time has come to commit to statutory regulations that reduce the negative impact of advertising on children's diets, as demanded by public health experts and consumer associations.
Mielczarek, Artur Tomasz; Nguyen, Hien Thi Thu; Nielsen, Jeppe Lund; Nielsen, Per Halkjær
2013-03-15
The enhanced biological phosphorus removal (EBPR) process is increasingly popular as a sustainable method for removal of phosphorus (P) from wastewater. This study consisted of a comprehensive three-year investigation of the identity and population dynamics of polyphosphate-accumulating organisms (PAOs) and glycogen-accumulating organisms (GAOs) in 28 Danish municipal wastewater treatment plants with nutrient removal. Fluorescence in situ hybridization was applied to quantify ten probe-defined populations of PAO and GAO that in total constituted a large fraction (30% on average) of the entire microbial community targeted by the EUBmix probes. Two PAO genera, Accumulibacter and Tetrasphaera, were very abundant in all EBPR plants (average of 3.7% and 27% of all bacteria, respectively), and their abundance was relatively stable in the Danish full-scale plants without clear temporal variations. GAOs were occasionally present in some plants (Competibacter in 11 plants, Defluviicoccus in 6 plants) and were consistent in only a few plants. This shows that these were not core species in the EBPR communities. The total GAO abundance was always lower than that of Accumulibacter. In plants without EBPR design, the abundance of PAO and GAO was significantly lower. Competibacter correlated in general with high fraction of industrial wastewater. In specific plants Accumulibacter correlated with high C/P ratio of the wastewater and Tetrasphaera with high organic loading. Interestingly, the relative microbial composition of the PAO/GAO species was unique to each plant over time, which gives a characteristic plant-specific "fingerprint". Copyright © 2012 Elsevier Ltd. All rights reserved.
Mariappan, Yogesh K; Kolipaka, Arunark; Manduca, Armando; Hubmayr, Rolf D; Ehman, Richard L; Araoz, Philip; McGee, Kiaran P
2012-01-01
Quantification of the mechanical properties of lung parenchyma is an active field of research due to the association of this metric with normal function, disease initiation and progression. A phase contrast MRI-based elasticity imaging technique known as magnetic resonance elastography is being investigated as a method for measuring the shear stiffness of lung parenchyma. Previous experiments performed with small animals using invasive drivers in direct contact with the lungs have indicated that the quantification of lung shear modulus with (1) H based magnetic resonance elastography is feasible. This technique has been extended to an in situ porcine model with a noninvasive mechanical driver placed on the chest wall. This approach was tested to measure the change in parenchymal stiffness as a function of airway opening pressure (P(ao) ) in 10 adult pigs. In all animals, shear stiffness was successfully quantified at four different P(ao) values. Mean (±STD error of mean) pulmonary parenchyma density corrected stiffness values were calculated to be 1.48 (±0.09), 1.68 (±0.10), 2.05 (±0.13), and 2.23 (±0.17) kPa for P(ao) values of 5, 10, 15, and 20 cm H2O, respectively. Shear stiffness increased with increasing P(ao) , in agreement with the literature. It is concluded that in an in situ porcine lung shear stiffness can be quantitated with (1) H magnetic resonance elastography using a noninvasive mechanical driver and that it is feasible to measure the change in shear stiffness due to change in P(ao) . Copyright © 2011 Wiley-Liss, Inc.
Enhanced Biological Phosphorus Removal: Metabolic Insights and Salinity Effects
Welles, L.
2015-01-01
Enhanced biological phosphorus removal (EBPR) is a biological process for efficient phosphate removal from wastewaters through intracellular storage of polyphosphate by polyphosphate-accumulating organisms (PAO) and subsequent removal of PAO from the system through wastage of sludge. In comparison to physical and chemical phosphorus removal processes, the biological process has several advantages such as high removal efficiency, low cost, and no chemical sludge production, but disturbances an...
Lai, Chih-Cheng; Sung, Mei-I; Liu, Hsiao-Hua; Chen, Chin-Ming; Chiang, Shyh-Ren; Liu, Wei-Lun; Chao, Chien-Ming; Ho, Chung-Han; Weng, Shih-Feng; Hsing, Shu-Chen; Cheng, Kuo-Chen
2016-04-01
The initial hypoxemic level of acute respiratory distress syndrome (ARDS) defined according to Berlin definition might not be the optimal predictor for prognosis. We aimed to determine the predictive validity of the stabilized ratio of partial pressure arterial oxygen and fraction of inspired oxygen (PaO2/FiO2 ratio) following standard ventilator setting in the prognosis of patients with ARDS.This prospective observational study was conducted in a single tertiary medical center in Taiwan and compared the stabilized PaO2/FiO2 ratio (Day 1) following standard ventilator settings and the PaO2/FiO2 ratio on the day patients met ARDS Berlin criteria (Day 0). Patients admitted to intensive care units and in accordance with the Berlin criteria for ARDS were collected between December 1, 2012 and May 31, 2015. Main outcome was 28-day mortality. Arterial blood gas and ventilator setting on Days 0 and 1 were obtained.A total of 238 patients met the Berlin criteria for ARDS were enrolled, and they were classified as mild (n = 50), moderate (n = 125), and severe (n = 63) ARDS, respectively. Twelve (5%) patients who originally were classified as ARDS did not continually meet the Berlin definition, and a total of 134 (56%) patients had the changes regarding the severity of ARDS from Day 0 to Day 1. The 28-day mortality rate was 49.1%, and multivariate analysis identified age, PaO2/FiO2 on Day 1, number of organ failures, and positive fluid balance within 5 days as significant risk factors of death. Moreover, the area under receiver-operating curve for mortality prediction using PaO2/FiO2 on Day 1 was significant higher than that on Day 0 (P = 0.016).PaO2/FiO2 ratio on Day 1 after applying mechanical ventilator is a better predictor of outcomes in patients with ARDS than those on Day 0.
Cook, Fiona J; Mumm, Steven; Whyte, Michael P; Wenkert, Deborah
2014-04-01
Pregnancy-associated osteoporosis (PAO) is a rare, idiopathic disorder that usually presents with vertebral compression fractures (VCFs) within 6 months of a first pregnancy and delivery. Spontaneous improvement is typical. There is no known genetic basis for PAO. A 26-year-old primagravida with a neonatal history of unilateral blindness attributable to hyperplastic primary vitreous sustained postpartum VCFs consistent with PAO. Her low bone mineral density (BMD) seemed to respond to vitamin D and calcium therapy, with no fractures after her next successful pregnancy. Investigation of subsequent fetal losses revealed homozygosity for the methylenetetrahydrofolate reductase (MTHFR) C677T polymorphism associated both with fetal loss and with osteoporosis (OP). Because her neonatal unilateral blindness and OP were suggestive of loss-of-function mutation(s) in the gene that encodes LDL receptor-related protein 5 (LRP5), LRP5 exon and splice site sequencing was also performed. This revealed a unique heterozygous 12-bp deletion in exon 21 (c.4454_4465del, p.1485_1488del SSSS) in the patient, her mother and sons, but not her father or brother. Her mother had a normal BMD, no history of fractures, PAO, ophthalmopathy, or fetal loss. Her two sons had no ophthalmopathy and no skeletal issues. Her osteoporotic father (with a family history of blindness) and brother had low BMDs first documented at ages ∼40 and 32 years, respectively. Serum biochemical and bone turnover studies were unremarkable in all subjects. We postulate that our patient's heterozygous LRP5 mutation together with her homozygous MTHFR polymorphism likely predisposed her to low peak BMD. However, OP did not cosegregate in her family with the LRP5 mutation, the homozygous MTHFR polymorphism, or even the combination of the two, implicating additional genetic or nongenetic factors in her PAO. Nevertheless, exploration for potential genetic contributions to PAO may explain part of the pathogenesis of this
Zhang, Chao; Chen, Yin-Guang
2013-07-01
As a high-quality carbon source, fermentation broth could promote the phosphorus removal efficiency in enhanced biological phosphorus removal (EBPR). The transformation of substrates in EBPR fed with fermentation broth was well simulated using the modified activated sludge model No. 2 (ASM2) based on the carbon source metabolism. When fermentation broth was used as the sole carbon source, it was found that heterotrophic bacteria acted as a promoter rather than a competitor to the phosphorus accumulating organisms (PAO). When fermentation broth was used as a supplementary carbon source of real municipal wastewater, the wastewater composition was optimized for PAO growth; and the PAO concentration, which was increased by 3.3 times compared to that in EBPR fed with solely real municipal wastewater, accounting for about 40% of the total biomass in the reactor.
High frequency of labral pathology in dysplastic hips with a CE angle between 20-25
DEFF Research Database (Denmark)
Jakobsen, Stig Storgaard; Hartig-Andreasen, Charlotte; Mikkelsen, Lone Rømer
Background: Hip dysplasia becomes symptomatic due to labral pathology and secondary muscular pain. A CE angle dysplasia in PAO centres in Denmark. However, it is debated whether a CE angle between 20 and 25 is borderline. Purpose / Aim of Study: We aimed...... to investigate the degree of labral pathology in symptomatic patients with CE between 20 and 25 compared with patients with CE hips) with a mean age 34.1 years (range 14.5- 58.9 years) consecutively scheduled for PAO due to symptomatic DDH were enrolled...... in the study. Five patients were excluded from the study and four patients failed to show up at follow- up, hence 90 patients were evaluated. Indication for PAO were persisting hip pain, a center-edge angle of Wiberg 15, hip flexion
Benzene observations and source appointment in a region of oil and natural gas development
Halliday, Hannah Selene
Benzene is a primarily anthropogenic volatile organic compound (VOC) with a small number of well characterized sources. Atmospheric benzene affects human health and welfare, and low level exposure (Atmospheric Observatory (PAO) in Colorado to investigate how O&NG development impacts air quality within the Wattenburg Gas Field (WGF) in the Denver-Julesburg Basin. The measurements were carried out in July and August 2014 as part of NASA's DISCOVER-AQ field campaign. The PTR-QMS data were supported by pressurized whole air canister samples and airborne vertical and horizontal surveys of VOCs. Unexpectedly high benzene mixing ratios were observed at PAO at ground level (mean benzene = 0.53 ppbv, maximum benzene = 29.3 ppbv), primarily at night (mean nighttime benzene = 0.73 ppbv). These high benzene levels were associated with southwesterly winds. The airborne measurements indicate that benzene originated from within the WGF, and typical source signatures detected in the canister samples implicate emissions from O&NG activities rather than urban vehicular emissions as primary benzene source. This conclusion is backed by a regional toluene-to-benzene ratio analysis which associated southerly flow with vehicular emissions from the Denver area. Weak benzene-to-CO correlations confirmed that traffic emissions were not responsible for the observed high benzene levels. Previous measurements at the Boulder Atmospheric Observatory (BAO) and our data obtained at PAO allow us to locate the source of benzene enhancements between the two atmospheric observatories. Fugitive emissions of benzene from O&NG operations in the Platteville area are discussed as the most likely causes of enhanced benzene levels at PAO. A limited information source attribution with the PAO dataset was completed using the EPA's positive matrix factorization (PMF) source receptor model. Six VOCs from the PTR-QMS measurement were used along with CO and NO for a total of eight chemical species. Six sources
Osteoporosis with vertebral fractures associated with pregnancy: two case reports
Raffaetà, Gloria; Mazzantini, Maurizio; Menconi, Agnese; Bottai, Vanna; Falossi, Francesca; Celauro, Ilenia; Guido, Giulio
2014-01-01
Pregnancy and lactation-associated osteoporosis (PAO) is a rare condition characterized by the occurrence of fragility fractures, most commonly vertebral, in late pregnancy or the early postpartum period. The prevalence, etiology and pathogenesis of this osteoporosis are unknown, although there are several hypotheses attempting to explain the etiopathogenesis of pregnancy associated osteoporosis. In this paper we present two cases of young women who developed severe PAO with vertebral fractur...
Translations on People’s Republic of China, Number 390
1977-08-15
machine, chemical refrigerators, high transparency fluoroscopic screen, radiotherapy localization model machine, and peritoneal dialysis machine. Some...PAO, 1 Apr 77) 18 Treatment of Carcinoma Being Studied, Improved (TA KUNG PAO, 6 Apr 77) 21 Medical Instrument Industry Increases Production...4th 5-year plan, the growth rate rose to 18.4 percent. Nan-ning city adheres to the policy of "small, native, mass" and successfully promotes
Batchinsky, Andriy I; Burkett, Samuel E; Zanders, Thomas B; Chung, Kevin K; Regn, Dara D; Jordan, Bryan S; Necsoiu, Corina; Nguyen, Ruth; Hanson, Margaret A; Morris, Michael J; Cancio, Leopoldo C
2011-10-01
The role of airway pressure release ventilation in the management of early smoke inhalation injury has not been studied. We compared the effects of airway pressure release ventilation and conventional mechanical ventilation on oxygenation in a porcine model of acute respiratory distress syndrome induced by wood smoke inhalation. Prospective animal study. Government laboratory animal intensive care unit. Thirty-three Yorkshire pigs. Smoke inhalation injury. Anesthetized female Yorkshire pigs (n = 33) inhaled room-temperature pine-bark smoke. Before injury, the pigs were randomized to receive conventional mechanical ventilation (n = 15) or airway pressure release ventilation (n = 12) for 48 hrs after smoke inhalation. As acute respiratory distress syndrome developed (PaO2/Fio2 ratio conventional mechanical ventilation for 48 hrs and served as time controls. Changes in PaO2/Fio2 ratio, tidal volume, respiratory rate, mean airway pressure, plateau pressure, and hemodynamic variables were recorded. Survival was assessed using Kaplan-Meier analysis. PaO2/Fio2 ratio was lower in airway pressure release ventilation vs. conventional mechanical ventilation pigs at 12, 18, and 24 hrs (p conventional mechanical ventilation animals between 30 and 48 hrs post injury (p animals between 6 and 48 hrs (p conventional mechanical ventilation and airway pressure release ventilation pigs. In this model of acute respiratory distress syndrome caused by severe smoke inhalation in swine, airway pressure release ventilation-treated animals developed acute respiratory distress syndrome faster than conventional mechanical ventilation-treated animals, showing a lower PaO2/Fio2 ratio at 12, 18, and 24 hrs after injury. At other time points, PaO2/Fio2 ratio was not different between conventional mechanical ventilation and airway pressure release ventilation.
Moreau-Marquis, Sophie; Coutermarsh, Bonita; Stanton, Bruce A
2015-01-01
Chelating iron may be a promising new therapy to eliminate Pseudomonas aeruginosa biofilms in the lungs of cystic fibrosis (CF) patients. Here, we investigate whether ALX-109 [a defined combination of an investigational drug containing lactoferrin (an iron-binding glycoprotein) and hypothiocyanite (a bactericidal agent)], alone and in combination with tobramycin or aztreonam, reduces P. aeruginosa biofilms grown on human CF airway epithelial cells. P. aeruginosa (PAO1 and six clinical isolates of Pseudomonas) biofilms grown at the apical surface of confluent monolayers of CF airway epithelial cells were treated with ALX-109, either alone or in combination with tobramycin or aztreonam. Bacterial cfu remaining after treatment were determined by plate counting. ALX-109 alone reduced PAO1 biofilm formation, but had no effect on established biofilms. ALX-109 enhanced the ability of tobramycin and aztreonam to inhibit PAO1 biofilm formation and to reduce established PAO1 biofilms. ALX-109 and tobramycin were additive in disrupting established biofilms formed by six clinical isolates of P. aeruginosa obtained from the sputum of CF patients. Mucoid P. aeruginosa isolates were most susceptible to the combination of ALX-109 and tobramycin. In addition, ALX-109 also enhanced the ability of aztreonam to reduce established PAO1 biofilms. Inhalation therapy combining hypothiocyanite and lactoferrin with TOBI(®) (tobramycin) or Cayston(®) (aztreonam) may be beneficial to CF patients by decreasing the airway bacterial burden of P. aeruginosa. © The Author 2014. Published by Oxford University Press on behalf of the British Society for Antimicrobial Chemotherapy. All rights reserved. For Permissions, please e-mail: journals.permissions@oup.com.
Directory of Open Access Journals (Sweden)
Fukushima Kensuke
2017-01-01
Full Text Available Introduction: Periacetabular osteotomy (PAO is an effective joint-preserving procedure for young adults with developmental dysplasia of the hip. Although PAO provides excellent radiographic and clinical results, it is a technically demanding procedure with a distinct learning curve that requires careful 3D planning and, above all, has a number of potential complications. We therefore developed a pre-operative simulation method for PAO via creation of a new full-scale model. Methods: The model was prepared from the patient’s Digital Imaging and Communications in Medicine (DICOM formatted data from computed tomography (CT, for construction and assembly using 3D printing technology. A major feature of our model is that it is constructed from salt. In contrast to conventional models, our model provides a more accurate representation, at a lower manufacturing cost, and requires a shorter production time. Furthermore, our model realized simulated operation normally with using a chisel and drill without easy breakage or fissure. We were able to easily simulate the line of osteotomy and confirm acetabular version and coverage after moving to the osteotomized fragment. Additionally, this model allowed a dynamic assessment that avoided anterior impingement following the osteotomy. Results: Our models clearly reflected the anatomical shape of the patient’s hip. Our models allowed for surgical simulation, making realistic use of the chisel and drill. Our method of pre-operative simulation for PAO allowed for the assessment of accurate osteotomy line, determination of the position of the osteotomized fragment, and prevented anterior impingement after the operation. Conclusion: Our method of pre-operative simulation might improve the safety, accuracy, and results of PAO.
Wang, Chaoyun; Wang, Chunhua; Ma, Chunlei; Huang, Qingxian; Sun, Hongliu; Zhang, Xiaomin; Bai, Xianyong
2014-02-15
Long-term inhalation of gasoline engine exhaust (GEE) increases the risk of respiratory disease. Studies have suggested involvement of platelets in the development of some lung diseases. Hydroxysafflor yellow A (HSYA), a flavonoid compound, prevents hemostasis. Therefore, we investigated its effects on GEE-induced lung injury, and role of platelets in injury. Sixty-week-old male Sprague-Dawley rats were exposed to GEE for 4h/day for 6 weeks, and then grouped as follows: control, GEE, GEE+HSYA, GEE+HSYA+GW9662, and GEE+GW9662. Arterial oxygen tension (PaO2), carbon dioxide tension (PaCO2), pH, and the PaO2/fraction of inspired oxygen ratio (PaO2/FiO2) in the blood were detected using a blood gas analyzer. Wet/dry lung weight ratio, total protein in bronchoalveolar lavage fluid (BALF), and cytokine concentrations in serum and BALF were determined. Furthermore, cyclic adenosine monophosphate (cAMP) level and expression levels of target proteins were analyzed. Platelets were counted and their state was evaluated. HSYA attenuated GEE-mediated decreases in PaO2, PaO2/FiO2, platelet cAMP level, protein kinase A (PKA) activity, and peroxisome proliferator-activated receptor γ (PPARγ) expression. HSYA also attenuated GEE-mediated increases in lung permeability, cytokine levels in serum and BALF, plasma platelet count, and ADP-mediated platelet aggregation. Moreover, it suppressed GEE-induced increases in the expression of adhesion molecules and proinflammatory cytokines in platelets and lung tissue. Therefore, HSYA is therapeutically effective for GEE-mediated lung injury and acts by enhancing PKA activity and inhibiting platelet activation. Copyright © 2013 Elsevier GmbH. All rights reserved.
Christ, Bastien; Das, Aditi; Hörtensteiner, Stefan
2016-01-01
Chlorophyll degradation is the most obvious hallmark of leaf senescence. Phyllobilins, linear tetrapyrroles that are derived from opening of the chlorin macrocycle by the Rieske-type oxygenase PHEOPHORBIDE a OXYGENASE (PAO), are the end products of chlorophyll degradation. Phyllobilins carry defined modifications at several peripheral positions within the tetrapyrrole backbone. While most of these modifications are species-specific, hydroxylation at the C32 position is commonly found in all species analyzed to date. We demonstrate that this hydroxylation occurs in senescent chloroplasts of Arabidopsis thaliana. Using bell pepper (Capsicum annuum) chromoplasts, we establish that phyllobilin hydroxylation is catalyzed by a membrane-bound, molecular oxygen-dependent, and ferredoxin-dependent activity. As these features resemble the requirements of PAO, we considered membrane-bound Rieske-type oxygenases as potential candidates. Analysis of mutants of the two Arabidopsis Rieske-type oxygenases (besides PAO) uncovered that phyllobilin hydroxylation depends on TRANSLOCON AT THE INNER CHLOROPLAST ENVELOPE55 (TIC55). Our work demonstrates a catalytic activity for TIC55, which in the past has been considered as a redox sensor of protein import into plastids. Given the wide evolutionary distribution of both PAO and TIC55, we consider that chlorophyll degradation likely coevolved with land plants. PMID:27655840
Mann, Dwayne L; Edwards, Bradley A; Joosten, Simon A; Hamilton, Garun S; Landry, Shane; Sands, Scott A; Wilson, Stephen J; Terrill, Philip I
2017-10-01
Short pauses or "transition-periods" at the end of expiration and prior to subsequent inspiration are commonly observed during sleep in humans. However, the role of transition periods in regulating ventilation during physiological challenges such as partial airway obstruction (PAO) has not been investigated. Twenty-nine obstructive sleep apnea patients and eight controls underwent overnight polysomnography with an epiglottic catheter. Sustained-PAO segments (increased epiglottic pressure over ≥5 breaths without increased peak inspiratory flow) and unobstructed reference segments were manually scored during apnea-free non-REM sleep. Nasal pressure data was computationally segmented into inspiratory (T I , shortest period achieving 95% inspiratory volume), expiratory (T E , shortest period achieving 95% expiratory volume), and inter-breath transition period (T Trans , period between T E and subsequent T I ). Compared with reference segments, sustained-PAO segments had a mean relative reduction in T Trans (-24.7±17.6%, P<0.001), elevated T I (11.8±10.5%, P<0.001), and a small reduction in T E (-3.9±8.0, P≤0.05). Compensatory increases in inspiratory period during PAO are primarily explained by reduced transition period and not by reduced expiratory period. Copyright © 2017 Elsevier B.V. All rights reserved.
Polarized atomic orbitals for linear scaling methods
Berghold, Gerd; Parrinello, Michele; Hutter, Jürg
2002-02-01
We present a modified version of the polarized atomic orbital (PAO) method [M. S. Lee and M. Head-Gordon, J. Chem. Phys. 107, 9085 (1997)] to construct minimal basis sets optimized in the molecular environment. The minimal basis set derives its flexibility from the fact that it is formed as a linear combination of a larger set of atomic orbitals. This approach significantly reduces the number of independent variables to be determined during a calculation, while retaining most of the essential chemistry resulting from the admixture of higher angular momentum functions. Furthermore, we combine the PAO method with linear scaling algorithms. We use the Chebyshev polynomial expansion method, the conjugate gradient density matrix search, and the canonical purification of the density matrix. The combined scheme overcomes one of the major drawbacks of standard approaches for large nonorthogonal basis sets, namely numerical instabilities resulting from ill-conditioned overlap matrices. We find that the condition number of the PAO overlap matrix is independent from the condition number of the underlying extended basis set, and consequently no numerical instabilities are encountered. Various applications are shown to confirm this conclusion and to compare the performance of the PAO method with extended basis-set calculations.
Energy Technology Data Exchange (ETDEWEB)
Javadrashid, Reza; Mozayan, Maryam; Tarzamni, Mohammad Kazem [Imam Reza Teaching Hospital, Tabriz University of Medical Sciences, Department of Radiology, Tabriz (Iran, Islamic Republic of); Ghaffari, Mohammad Reza [Imam Reza Teaching Hospital, Tabriz University of Medical Sciences, Department of Lung and Respiratory Disease, Tabriz (Iran, Islamic Republic of); Fouladi, Daniel F. [Tabriz University of Medical Sciences, Drug Applied Research Center, Tabriz (Iran, Islamic Republic of)
2015-01-15
To investigate the prognostic validity of the right ventricular to left ventricular diameter (RVD/LVD) ratio and Qanadli pulmonary artery obstruction score (PAOS) in hemodynamically stable patients with no pre-existing comorbidities. Sixty-three patients with no previous comorbidity were recruited for this study. The RVD/LVD ratio was calculated based on axial image measurements obtained from contrast-enhanced non-electrocardiography-gated spiral computed tomography (CT) pulmonary angiographic studies. Patients were followed up for 60 days after the initial CT and study variables including demographic data, the RVD/LVD ratio and PAOS were compared between deceased cases and survivors via univariate and multivariate statistical models. The 60-day mortality rate was 22.2 %. The deceased and surviving groups were comparable for PAOS, whereas both the median age and RVD/LVD ratio were significantly higher in the first group. In multivariate analysis, however, age was the only significant, independent predictor of 60-day mortality (p = 0.02, Exp(B) = 1.06). At a cut-off age of 63 years the 60-day mortality was predicted with a sensitivity and specificity of 64.3 % and 69.4 %, respectively. The RVD/LVD ratio and PAOS are not independent predictors of mortality in hemodynamically stable patients with acute PE and no pre-existing comorbidities. (orig.)
Tsai, Yung-Pin; Chen, Hsiu-Ting
2011-12-01
This study explored the influence of sludge retention time (SRT) on tolerance of copper invasion for polyphosphate accumulating organisms (PAOs) in an enhanced biological phosphorus removal (EBPR). The experimental data showed the anaerobic polyhydroxyalkanoates (PHA) storage for the sludge at 10d SRT was less influenced by copper invasion than those at 5d and 15d SRTs. The reaction of PAOs aerobically taking up phosphate for the sludge at 5d or 15d SRT almost ceased at 2 mg Cu L(-1), whereas PAOs in the sludge at 10d SRT retained half of the ability to take up phosphate. Both the PHAs degradation and synthesis rates decreased with increasing copper concentration, regardless of the SRTs. However, the copper inhibition of the former was greater than that of the later. Copyright © 2011 Elsevier Ltd. All rights reserved.
Effects of Iron on DNA Release and Biofilm Development by Pseudomonas Aeruginosa
DEFF Research Database (Denmark)
Yang, Liang; Barken, Kim Bundvig; Skindersø, Mette Elena
2007-01-01
Extracellular DNA is one of the major matrix components in Pseudomonas aeruginosa biofilms. It functions as an intercellular connector and plays a role in stabilization of the biofilms. Evidence that DNA release in P. aeruginosa PAO1 biofilms is controlled by the las-rhl and pqs quorum-sensing sy......Extracellular DNA is one of the major matrix components in Pseudomonas aeruginosa biofilms. It functions as an intercellular connector and plays a role in stabilization of the biofilms. Evidence that DNA release in P. aeruginosa PAO1 biofilms is controlled by the las-rhl and pqs quorum......-sensing systems has been previously presented. This paper provides evidence that DNA release in P. aeruginosa PAO1 biofilms is also under iron regulation. Experiments involving cultivation of P. aeruginosa in microtitre trays suggested that pqs expression, DNA release and biofilm formation were favoured in media...
DEFF Research Database (Denmark)
Hartig-Andreasen, Charlotte; Nielsen, Torsten G; Lund, Bent
2017-01-01
To identify factors predicting failure after hip arthroscopy in patients with previous periacetabular osteotomy (PAO) defined as a conversion to total hip replacement (THR) and to evaluate the patient reported outcome scores. Of 55 hips treated with hip arthroscopy after PAO from Aug 2008 to 2012....... Nine hips were converted to a THR. Kaplan-Meier survival rate was 52.8% (95% CI, 10%-83.8%) at 6.5 years follow-up. Statistically significant predictors of failure: joint space width after PAO ...% of the hips. In 42% of the hips cartilage lesions of Becks grade >3 were found. Mean mHHS and HOS were 65.7 and 68.8 respectively at follow-up. A NRS pain score of >3 in rest and during activity were present in respectively, 43% and 62% of the patients. Hip arthroscopy after PAO demonstrated limited clinical...
Duke, Joseph W; Davis, James T; Ryan, Benjamin J; Elliott, Jonathan E; Beasley, Kara M; Hawn, Jerold A; Byrnes, William C; Lovering, Andrew T
2016-09-01
The mechanism(s) that regulate hypoxia-induced blood flow through intrapulmonary arteriovenous anastomoses (QIPAVA ) are currently unknown. Our previous work has demonstrated that the mechanism of hypoxia-induced QIPAVA is not simply increased cardiac output, pulmonary artery systolic pressure or sympathetic nervous system activity and, instead, it may be a result of hypoxaemia directly. To determine whether it is reduced arterial PO2 (PaO2) or O2 content (CaO2) that causes hypoxia-induced QIPAVA , individuals were instructed to breathe room air and three levels of hypoxic gas at rest before (control) and after CaO2 was reduced by 10% by lowering the haemoglobin concentration (isovolaemic haemodilution; Low [Hb]). QIPAVA , assessed by transthoracic saline contrast echocardiography, significantly increased as PaO2 decreased and, despite reduced CaO2 (via isovolaemic haemodilution), was similar at iso-PaO2. These data suggest that, with alveolar hypoxia, low PaO2 causes the hypoxia-induced increase in QIPAVA , although where and how this is detected remains unknown. Alveolar hypoxia causes increased blood flow through intrapulmonary arteriovenous anastomoses (QIPAVA ) in healthy humans at rest. However, it is unknown whether the stimulus regulating hypoxia-induced QIPAVA is decreased arterial PO2 (PaO2) or O2 content (CaO2). CaO2 is known to regulate blood flow in the systemic circulation and it is suggested that IPAVA may be regulated similar to the systemic vasculature. Thus, we hypothesized that reduced CaO2 would be the stimulus for hypoxia-induced QIPAVA . Blood volume (BV) was measured using the optimized carbon monoxide rebreathing method in 10 individuals. Less than 5 days later, subjects breathed room air, as well as 18%, 14% and 12.5% O2 , for 30 min each, in a randomized order, before (CON) and after isovolaemic haemodilution (10% of BV withdrawn and replaced with an equal volume of 5% human serum albumin-saline mixture) to reduce [Hb] (Low [Hb]). PaO2
People’s Republic of China Scientific Abstracts No. 179
1977-11-08
No 2, April 1977 7 CHIH-WU HSUEH-PAO [ACTA BOTANICA SINICA] No 2, June 1977 22 I-CH’UAN HSUEH-PAO [ACTA GENETICA SINICA] No 1...2^-129 ^675] WANG Hsiang-yun [37*9 7^9 0061] ORG: Roth of Office of Microbiology Teaching and Research, First College of Military...2799 2973 3163], SHIH Wei-k’ang [2457 3262 1660], et al. AtmiOR: None ORG: Third Teaching and Research Group, Department of Hygiene
People’s Republic of China Scientific Abstracts, Number 185
1978-02-14
CONTENTS PAGE HANG-K’UNG CHIH-SHIH [AERONAUTICAL KNOWLEDGE] No 10, October 1977 .... 1 CHIH-WU HSUEH-PAO [ACTA BOTANICA SINICA] No 3, September 1977 8...launch units; 3) Chairman Hua visiting an earthquake damaged region; 4) a group of female pilots of a minority race. 3012 CSO: 4009 ACTA BOTANICA ...CHIH-WU HSUEH-PAO [ACTA BOTANICA SINICä] in Chinese Vol 19 No 3, Sep 77 pp 167-171 TEXT OF ENGLISH ABSTRACT: 1. The process of microsporogenesis
DEFF Research Database (Denmark)
Wang, Hengzhuang; Ciofu, Oana; Yang, Liang
2013-01-01
the role of beta-lactamase in the pharmacokinetics (PK) and pharmacodynamics (PD) of ceftazidime and imipenem on P. aeruginosa biofilms. P. aeruginosa PAO1 and its corresponding beta-lactamase-overproducing mutant, PA Delta DDh2Dh3, were used in this study. Biofilms of these two strains in flow chambers......, microtiter plates, and on alginate beads were treated with different concentrations of ceftazidime and imipenem. The kinetics of antibiotics on the biofilms was investigated in vitro by time-kill methods. Time-dependent killing of ceftazidime was observed in PAO1 biofilms, but concentration-dependent killing...... activity of ceftazidime was observed for beta-lactamase-overproducing biofilms of P. aeruginosa in all three models. Ceftazidime showed time-dependent killing on planktonic PAO1 and PA Delta DDh2Dh3. This difference is probably due to the special distribution and accumulation in the biofilm matrix of beta...
DEFF Research Database (Denmark)
Line, Laura; Alhede, Morten; Kolpen, Mette
2014-01-01
denitrification. The growth rate of P. aeruginosa achieved by denitrification at physiological levels (~400 μM) of nitrate (NO(-) 3) is however, not known. Therefore, we have measured growth rates of anoxic cultures of PAO1 and clinical isolates (n = 12) in LB media supplemented with NO(-) 3 and found...... a significant increase of growth when supplementing PAO1 and clinical isolates with ≥150 μM NO(-) 3 and 100 μM NO(-) 3, respectively. An essential contribution to growth by denitrification was demonstrated by the inability to establish a significantly increased growth rate by a denitrification deficient Δnir...... of the four N-oxide reductases in PAO1 (Nar, Nir, Nor, Nos) further verified the engagement of denitrification, showing a transient increase in activation and expression and rapid consumption of NO(-) 3 followed by a transient increase of NO(-) 2. Growth rates obtained by denitrification in this study were...
Wang, Zhongwei; van Loosdrecht, Mark C.M.; Saikaly, Pascal
2017-01-01
Salinity can affect the performance of biological wastewater treatment in terms of nutrient removal. The effect of salt on aerobic granular sludge (AGS) process in terms of granulation and nutrient removal was examined in this study. Experiments were conducted to evaluate the effect of salt (15 g/L NaCl) on granule formation and nutrient removal in AGS system started with flocculent sludge and operated at DO of 2.5 mg/L (phase I). In addition, experiments were conducted to evaluate the effect of gradually increasing the salt concentration (2.5 g/L to 15 g/L NaCl) or increasing the DO level (2.5 mg/L to 8 mg/L) on nutrient removal in AGS system started with granular sludge (phase II) taken from an AGS reactor performing well in terms of N and P removal. Although the addition of salt in phase I did not affect the granulation process, it significantly affected nutrient removal due to inhibition of ammonia oxidizing bacteria (AOB) and phosphate accumulating organisms (PAOs). Increasing the DO to 8 mg/L or adapting granules by gradually increasing the salt concentration minimized the adverse effect of salt on nitrification (phase II). However, these strategies were not successful for mitigating the effect of salt on biological phosphorus removal. No nitrite accumulation occurred in all the reactors suggesting that inhibition of biological phosphorus removal was not due to the accumulation of nitrite as previously reported. Also, glycogen accumulating organisms were shown to be more tolerant to salt than PAO II, which was the dominant PAO clade detected in this study. Future studies comparing the salinity tolerance of different PAO clades are needed to further elucidate the effect of salt on PAOs.
Tan, P Seow Koon; Genc, F; Delgado, E; Kellum, J A; Pinsky, M R
2002-08-01
We tested the hypothesis that NO contamination of hospital compressed air also improves PaO(2) in patients with acute lung injury (ALI) and following lung transplant (LTx). Prospective clinical study. Cardiothoracic intensive care unit. Subjects following cardiac surgery (CABG, n=7); with ALI (n=7), and following LTx (n=5). Four sequential 15-min steps at a constant FiO(2) were used: hospital compressed air-O(2) (H1), N(2)-O(2) (A1), repeat compressed air-O(2) (H2), and repeat N(2)-O(2) (A2). NO levels were measured from the endotracheal tube. Cardiorespiratory values included PaO(2) were measured at the end of each step. FiO(2) was 0.46+/-0.05, 0.53+/-0.15, and 0.47+/-0.06 (mean+/-SD) for three groups, respectively. Inhaled NO levels during H1 varied among subjects (30-550 ppb, 27-300 ppb, and 5-220 ppb, respectively). Exhaled NO levels were not detected in 4/7 of CABG (0-300 ppb), 3/6 of ALI (0-140 ppb), and 3/5 of LTx (0-59 ppb) patients during H1, whereas during A1 all but one patient in ALI and three CABG patients had measurable exhaled NO levels (P<0.05). Small but significant decreases in PaO(2) occurred for all groups from H1 to A1 and H2 to A2 (132-99 Torr and 128-120 Torr, P <0.01, respectively). There was no correlation between inhaled NO during H1 and exhaled NO during A1 or the change in PaO(2) from H1 to A1. Low-level NO contamination improves PaO(2) in patients with ALI and following LTx.
Directory of Open Access Journals (Sweden)
Efthimios A. Andronis
2014-04-01
Full Text Available Homeostasis of reactive oxygen species (ROS in the intracellular compartments is of critical importance as ROS have been linked with nearly all cellular processes and more importantly with diseases and aging. PAs are nitrogenous molecules with an evolutionary conserved role in the regulation of metabolic and energetic status of cells. Recent evidence also suggests that polyamines (PA are major regulators of ROS homeostasis. In Arabidopsis the backconversion of the PAs spermidine (Spd and spermine (Spm to putrescine (Put and Spd, respectively is catalyzed by two peroxisomal PA oxidases (AtPAO. However, the physiological role of this pathway remains largely elusive. Here we explore the role of peroxisomal PA backconversion and in particular that catalyzed by the highly expressed AtPAO3 in the regulation of ROS homeostasis and mitochondrial respiratory burst. Exogenous PAs exert an NADPH-oxidase dependent stimulation of oxygen consumption, with Spd exerting the strongest effect. This increase is attenuated by treatment with the NADPH-oxidase blocker diphenyleneiodonium iodide (DPI. Loss-of-function of AtPAO3 gene results to increased NADPH-oxidase-dependent production of superoxide anions (O2.-, but not H2O2, which activate the mitochondrial alternative oxidase pathway (AOX. On the contrary, overexpression of AtPAO3 results to an increased but balanced production of both H2O2 and O2.-. These results suggest that the ratio of O2.-/H2O2 regulates respiratory chain in mitochondria, with PA-dependent production of O2.- by NADPH-oxidase tilting the balance of electron transfer chain in favor of the AOX pathway. In addition, AtPAO3 seems to be an important component in the regulating module of ROS homeostasis, while a conserved role for PA backconversion and ROS across kingdoms is discussed.
Pozzi, Michelle Henderson; Gawandi, Vijay; Fitzpatrick, Paul F.
2009-01-01
Mammalian polyamine oxidases (PAO) catalyze the oxidation of N1-acetylspermine and N1-acetylspermidine to produce N-acetyl-3-aminopropanaldehyde and spermidine or putrescine. Structurally, PAO is a member of the monoamine oxidase family of flavoproteins. The effects of pH on kinetic parameters of mouse PAO have been determined to provide insight into the protonation state of the polyamine required for catalysis and the roles of ionizable residues in the active site in amine oxidation. For N1-acetylspermine, N1-acetylspermidine, and spermine, the kcat/Kamine-pH profiles are bell-shaped. In each case the profile agrees with that expected if the productive form of the substrate has a single positively charged nitrogen. The pKi-pH profiles for a series of polyamine analogs are most consistent with the nitrogen at the site of oxidation being neutral and one other nitrogen being positively charged in the reactive form of the substrate. With N1-acetylspermine as substrate, the value of kred, the limiting rate constant for flavin reduction, is pH dependent, decreasing below a pKa value of 7.3, again consistent with the requirement for an uncharged nitrogen for substrate oxidation. Lys315 in PAO corresponds to a conserved active site residue found throughout the monoamine oxidase family. Mutation of Lys315 to methionine has no effect on the kcat/Kamine profile for spermine, the kred value with N1-acetylspermine is only 1.8-fold lower in the mutant protein, and the pKa in the kred-pH profile with N1-acetylspermine shifts to 7.8. These results rule out Lys315 as a source of a pKa in the kcat/Kamine or kcat/kred profiles. They also establish that this residue does not play a critical role in amine oxidation by PAO. PMID:19199575
Directory of Open Access Journals (Sweden)
Simon J. McIlroy
2018-05-01
Full Text Available Enhanced biological phosphorus removal (EBPR involves the cycling of biomass through carbon-rich (feast and carbon-deficient (famine conditions, promoting the activity of polyphosphate accumulating organisms (PAOs. However, several alternate metabolic strategies, without polyphosphate storage, are possessed by other organisms, which can compete with the PAO for carbon at the potential expense of EBPR efficiency. The most studied are the glycogen accumulating organisms (GAOs, which utilize aerobically stored glycogen to energize anaerobic substrate uptake and storage. In full-scale systems the Micropruina spp. are among the most abundant of the proposed GAO, yet little is known about their ecophysiology. In the current study, genomic and metabolomic studies were performed on Micropruina glycogenica str. Lg2T and compared to the in situ physiology of members of the genus in EBPR plants using state-of-the-art single cell techniques. The Micropruina spp. were observed to take up carbon, including sugars and amino acids, under anaerobic conditions, which were partly fermented to lactic acid, acetate, propionate, and ethanol, and partly stored as glycogen for potential aerobic use. Fermentation was not directly demonstrated for the abundant members of the genus in situ, but was strongly supported by the confirmation of anaerobic uptake of carbon and glycogen storage in the absence of detectable polyhydroxyalkanoates or polyphosphate reserves. This physiology is markedly different from the classical GAO model. The amount of carbon stored by fermentative organisms has potentially important implications for phosphorus removal – as they compete for substrates with the Tetrasphaera PAO and stored carbon is not made available to the “Candidatus Accumulibacter” PAO under anaerobic conditions. This study shows that the current models of the competition between PAO and GAO are too simplistic and may need to be revised to take into account the impact of
Reference values of arterial oxygen tension in the middle-aged and elderly.
Cerveri, I; Zoia, M C; Fanfulla, F; Spagnolatti, L; Berrayah, L; Grassi, M; Tinelli, C
1995-09-01
The lack of available reference values of arterial PO2, particularly for elderly persons, led us to study a sample of 194 normal nonsmoking subjects, equally distributed over all age ranges from 40 to 90 yr. The radial artery was punctured and blood samples were taken and analyzed on an automated, computerized gas-analyzer. The trend of the mean values of PaO2 in the 5-yr class intervals of age showed a clear decline up to the 70- to 74-yr class, and then an inversion. The two regression lines intersecting at this point provided a better fit to the data than did a single regression line (R22 - R12 = 0.918 - 0.678 = 0.24; F = 20.49, p = 0.0027). The relationship of PaO2 with age was thus subsequently considered for the two subgroups (40 to 74 yr; > or = 75 yr) identified on the basis of this cutoff. Because of the significant influence on Pao2 of age, body-mass index (BMI), and PaCO2 in the group 40 to 74 yr of age, the following reference equation was constructed: Pao2 (mm Hg) = 143.6 - (0.39 . age) - (0.56 . BMI) - (0.57 . PaCO2); R2 = 0.28; SEE = 7.48; p or = 75 yr old, for whom there was no correlation with age, BMI, or PaCO2, only the mean +/- SD and 5th percentile of PaO2 were reported (83.4 +/- 9.15 mm Hg and 68.4 mm Hg, respectively). PaCO2 values were not correlated with either age or BMI; the mean +/- SD was 35.79 +/- 3.87 mm Hg.(ABSTRACT TRUNCATED AT 250 WORDS)
Wang, Zhongwei
2017-08-13
Salinity can affect the performance of biological wastewater treatment in terms of nutrient removal. The effect of salt on aerobic granular sludge (AGS) process in terms of granulation and nutrient removal was examined in this study. Experiments were conducted to evaluate the effect of salt (15 g/L NaCl) on granule formation and nutrient removal in AGS system started with flocculent sludge and operated at DO of 2.5 mg/L (phase I). In addition, experiments were conducted to evaluate the effect of gradually increasing the salt concentration (2.5 g/L to 15 g/L NaCl) or increasing the DO level (2.5 mg/L to 8 mg/L) on nutrient removal in AGS system started with granular sludge (phase II) taken from an AGS reactor performing well in terms of N and P removal. Although the addition of salt in phase I did not affect the granulation process, it significantly affected nutrient removal due to inhibition of ammonia oxidizing bacteria (AOB) and phosphate accumulating organisms (PAOs). Increasing the DO to 8 mg/L or adapting granules by gradually increasing the salt concentration minimized the adverse effect of salt on nitrification (phase II). However, these strategies were not successful for mitigating the effect of salt on biological phosphorus removal. No nitrite accumulation occurred in all the reactors suggesting that inhibition of biological phosphorus removal was not due to the accumulation of nitrite as previously reported. Also, glycogen accumulating organisms were shown to be more tolerant to salt than PAO II, which was the dominant PAO clade detected in this study. Future studies comparing the salinity tolerance of different PAO clades are needed to further elucidate the effect of salt on PAOs.
Morosin, Marco; Vignati, Carlo; Novi, Angela; Salvioni, Elisabetta; Veglia, Fabrizio; Alimento, Marina; Merli, Guido; Sciomer, Susanna; Sinagra, Gianfranco; Agostoni, Piergiuseppe
2016-11-01
In chronic heart failure (HF), the alveolar-capillary membrane undergoes a remodeling process that negatively affects gas exchange. In case of alveolar-capillary gas diffusion impairment, arterial desaturation (SaO 2 ) is rarely observed in HF patients. At play are 3 factors: overall pulmonary diffusing capacity (assessed as lung diffusion for CO, DLCO), global O 2 consumption (VO 2 ) and alveolar (A) to arterial (a) pO 2 gradient (AaDO 2 ). In 100 consecutive stable HF patients, DLCO, resting respiratory gases and arterial blood gases were measured to determine VO 2, paO 2 , pAO 2 and AaDO 2 . DLCO was poorly but significantly related to AaDO 2 . The correlation improved after correcting AaDO 2 for VO 2 (p<0.001, r=0.49). Both VO 2 and AaDO 2 were independently associated with DLCO (p<0.001). Patients with reduced DLCO showed no differences as regards paO 2 and pAO 2 . AaDO 2 /VO 2 showed a higher gradient in patients with lower DLCO. AaDO 2 increase and VO 2 reduction allow preventing low SaO 2 in HF patients with reduced DLCO. Accordingly, we suggest considering AaDO 2 and VO 2 combined and reporting AaDO 2 /VO 2 . Copyright © 2016 Elsevier B.V. All rights reserved.
People’s Republic of China Scientific Abstracts No. 164.
1977-02-23
of these articles. CONTENTS PAGE K’ O-HSUEH SHIH-YEN /SCIENTIFIC EXPERIMENT/ No 8, Äug 76 1 CHIH-WU HSUEH-PAO /ÄCTA BOTANICA SINICA/ Vol 18, No...AUTHOR: None ORG: Digital Control Teaching Group, Shanghai Sparetime Industrial University TITLE: "On the Principles of Digital Machine Tool Control...8217 College" SOURCE: Peking CHIH-WU HSUEH-PAO [AGTA BOTANICA SINICA] Vol 18 No 3, Sep 76 pp 198-201 EXCERPT OF ENGLISH ABSTRACT: The May-7 Agricultural
Chlorophyll catabolism in olive fruits (var. Arbequina and Hojiblanca) during maturation.
Vergara-Domínguez, Honorio; Ríos, José Julían; Gandul-Rojas, Beatriz; Roca, María
2016-12-01
The central reaction of chlorophyll (chl) breakdown pathway occurring during olive fruits maturation is the cleavage of the macrocycle pheophorbide a to a primary fluorescent chl catabolite (pFCC) and it is catalyzed by two enzymes: pheophorbide a oxygenase (PaO) and red chl catabolite reductase (RCCR). In subsequent steps, pFCC is converted to different fluorescent chlorophyll catabolites (FCCs) and nonfluorescent chlorophyll catabolites (NCCs). This work demonstrated that RCCR activity of olive fruits is type II. During the study of evolution of PaO and RCCR activities through the olive fruits maturation in two varieties: Hojiblanca and Arbequina, a significant increase in PaO and RCCR activity was found in ripening stage. In addition, the profile and structure of NCCs present in epicarp of this fruit was studied using HPLC/ESI-TOF-MS. Five different NCCs were defined and for the first time the enzymatic reactions implied in chlorophyll degradations in olive fruits elucidated. Copyright © 2016 Elsevier Ltd. All rights reserved.
DEFF Research Database (Denmark)
Bagge, N; Ciofu, O; Skovgaard, L T
2000-01-01
The aim of this study was to examine the development of resistance of biofilm-growing P. aeruginosa during treatment with ceftazidime. Biofilms were established in vitro using a modified Robbins device (MRD) and in vivo in the rat model of chronic lung infection. Three P. aeruginosa strains...... of ceftazidime to biofilms established in MDR, a statistically significant development of resistance to ceftazidime in PAO 579 or 19676A bacterial populations occurred. When ceftazidime was administered 4 h/day (200 mg/l) for 2 weeks, the frequency of resistant 19676A having MIC>25 mg/l was 4.4 10(-1) compared...... to 6.0-10(-5) in the control biofilm. The same trend was observed after continuous administration of ceftazidime. MICceftazidime of the more resistant variants was increased 500-fold for PAO 579 and 8-fold for 19676A, and the specific basal beta-lactamase activities from 19 to 1,400 units for PAO 579...
DEFF Research Database (Denmark)
Mandsberg, Lotte Frigaard; Macia, Maria D.; Bergmann, Kirsten R.
2011-01-01
showed only a fivefold increase, whereas the single mutant PAOMMgm (mutM) showed a nonsignificant increase in MR compared with PAO1 and the single mutants. Mutations in the regulator nfxB leading to hyperexpression of MexCD-OprJ efflux pump were found as the mechanism of resistance to ciprofloxacin....... In this study, we constructed a double mutant in mutY and mutM (PAOMY-Mgm) and characterized the phenotype and the gene expression profile using microarray and RT-PCR. PAOMY-Mgm presented 28-fold increases in MR compared with wild-type reference strain PAO1. In comparison, the PAOMYgm (mutY) single mutant...... in the double mutant. A better fitness of the mutator compared with PAO1 was found in growth competition experiments in the presence of ciprofloxacin at concentrations just below minimal inhibitory concentration. Up-regulation of the antimutator gene pfpI, that has been shown to provide protection to oxidative...
International Nuclear Information System (INIS)
Schueller, G.; Neumann, K.; Helbich, T.; Herold, C.J.; Riemer, H.; Backfrieder, W.; Sertl, K.; Pittner, B.
2004-01-01
Purpose: To characterize parenchymal lung affections morphologically in patients with asthma and healthy subjects by high resolution computed tomography (HRCT) subsequent to histamine-triggered inhalation bronchoprovocation and salbutamolinduced broncholysis, and to compare the results with pulmonary function tests. Materials and Methods: Fifteen asthmatics with bronchial hyperreactivity, with a>20% decrease in FEV1 and a>10 mmHg decrease in PaO 2 after bronchoprovocation (PC20%+), twelve asthmatics with a 10 mmHg decrease in PaO 2 after bronchoprovocation (PC20%-), and eight healthy persons without bronchial hyperreactivity underwent inhalation bronchoprovocation and broncholysis. Spirometer-triggered HRCT at high lung volumes was performed, and total and peripheral lung densities and the amount of solid lung structures, representing predominantly vessels, were measured. Results: After bronchoprovocation, we observed significant decreases in total and peripheral lung densities in all groups (p 0.05), as compared to the baseline measurements. In hyperreactive patients, PaO 2 significantly decreased after provocation and significantly increased after lysis (p [de
International Nuclear Information System (INIS)
Sui, T.; Song, B.; Zhang, F.; Yang, Q.
2015-01-01
Hairy nanoparticles, which graft organic chains on nanoparticles, have led to a wide variety of advanced materials and have been applied in many fields over the past two decades. In this paper, effects of nanoparticle size and organic chain on the tribological properties of amino functionalized hairy silica nanoparticles (HSN_s) were investigated. Silica nanoparticles with different sizes and amino group organic chains were synthesized and dispersed into polyalphaolefin (PAO) via a modified process. The synthesized HSN_s were characterized by variety of methods. The tribology properties of those HSN_s were investigated using a four-ball tetrabromo. The coefficient of friction and wear scar diameter were measured and analyzed. It was found that the HSN_s could form a stable homogeneous solution with PAO. The tribological performance of the PAO 100 was enhanced dramatically by adding the HSN_s. The data suggested that HSN_s with larger size, longer organic chains, and more amino groups gave better anti wear and friction reduction properties than other nanoparticles
Directory of Open Access Journals (Sweden)
Joaquim Moita
1995-05-01
Full Text Available RESUMO: A presença e magnitude da hipertensão da hipertensão da artéria pulmonar (HTAP tem um impacto negativo no prognóstico dos doentes com Insuficiência Respiratória Crónica Grave (IRCG, definida por PaO2<65 mmHg, secundária a Bronquite Crónica e Enfisema (BCE. O aumento de sobrevida destes doentes depende, em grande medida, da identificação precoce da HTA e da sua correcção com a administração de Oxigénioterapia de Longo Termo (OLT, motivo pelo qual a medição directa da Pressão da Artéria Pulmonar (PAP, por cateterismo de Swan-Ganz, integra o protocolo de avaliação a que subtemos todos os doentes com IRCG.Com vista a esclarecer o papel do cateterismo como critério complementar na selecção de candidatos a OLT, apresentamos nos primeiros 49 doentes cateterizados, a relação da PAP com: VEMS, PaO2 e PaCO2, sinais electrocardiogréficos de Cor Pulmonale Crónico (CPC e sinais de Insuficiência CardÃaca Direita (ICD.No grupo de 39 doentes com HTAP (PAPâ¥20 os valores de VEMS, PaO2, e PaCO2 (28,9;54,6 e 49,0 são mais graves que os encontrados nos doentes sem HTAP (40,0;58,4 e 46,7.A HTAP está presente quase universalmente nos doentes com PaO2â¤55 mmHg (em 24 de 27 casos nestas circunstâncias e, em grande número de doentes com PaO2â¤65 mmHg (15 de 22.O padrão electrocardiográfico de CPC e/ou semiologia de ICD, presente em cerca de 1/3 dos doentes, mostraram-se elementos diagnósticos de HTAP especÃficos, mas pouco sensÃveis.Conclui-se que o cateterismo do coração direito desempenha um papel importante na selecção de candidatos a OLT com critérios de prescrição âborderlineâ (55 â¤: PaO2â¥65. ABTRACT: HEMODYNAMIC EVALUATION AS A CRITERION IN THE PRESCRIPTION OF LONG TERM OXYGEN THERAPY IN SEVERE CHRONIC RESPIRATORY FAILURE SECONDARY TO CHRONIC OBSTRUCTIVE PULMONARY DISEASEThe
Pressure effects on single chain magnets
Energy Technology Data Exchange (ETDEWEB)
Mito, M. E-mail: mitoh@elcs.kyutech.ac.jp; Shindo, N.; Tajiri, T.; Deguchi, H.; Takagi, S.; Miyasaka, H.; Yamashita, M.; Clerac, R.; Coulon, C
2004-05-01
Pressure effects on a single chain magnet [Mn{sub 2}(saltmen){sub 2}Ni(pao){sub 2}(py){sub 2}](ClO{sub 4}){sub 2} (saltmen{sup 2-}=N,N'-(1,1,2,2-tetramethylethylene)bis(salicylideneiminate), and pao{sup -}=pyridine-2-aldoximate) have been investigated through AC magnetic measurements under pressure (P). The slow relaxation of the magnetization depends on pressure. Both the blocking temperature (T{sub B}) and energy barrier ({delta}) increase by pressurization, and those enhancements saturate at around P=7 kbar.
Bucki, Robert; Niemirowicz, Katarzyna; Wnorowska, Urszula; Byfield, Fitzroy J; Piktel, Ewelina; Wątek, Marzena; Janmey, Paul A; Savage, Paul B
2015-10-01
Ceragenins constitute a novel family of cationic antibiotics characterized by a broad spectrum of antimicrobial activities, which have mostly been assessed in vitro. Using a polarized human lung epithelial cell culture system, we evaluated the antibacterial activities of the ceragenin CSA-13 against two strains of Pseudomonas aeruginosa (PAO1 and Xen5). Additionally, the biodistribution and bactericidal activity of a CSA-13-IRDye 800CW derivate were assessed using an animal model of peritoneal infection after PAO1 challenge. In cell culture, CSA-13 bactericidal activities against PAO1 and Xen5 were higher than the activities of the human cathelicidin peptide LL-37. Increased CSA-13 activity was observed in polarized human lung epithelial cell cultures subjected to butyric acid treatment, which is known to increase endogenous LL-37 production. Eight hours after intravenous or intraperitoneal injection, the greatest CSA-13-IRDye 800CW accumulation was observed in mouse liver and kidneys. CSA-13-IRDye 800CW administration resulted in decreased bacterial outgrowth from abdominal fluid collected from animals subjected to intraperitoneal PAO1 infection. These observations indicate that CSA-13 may synergistically interact with antibacterial factors that are naturally present at mucosal surfaces and it maintains its antibacterial activity in the infected abdominal cavity. Cationic lipids such as CSA-13 represent excellent candidates for the development of new antibacterial compounds. Copyright © 2015, American Society for Microbiology. All Rights Reserved.
Gao, Han; Liu, Miaomiao; Griffin, James S; Xu, Longcheng; Xiang, Da; Scherson, Yaniv D; Liu, Wen-Tso; Wells, George F
2017-04-18
Coupled aerobic-anoxic nitrous decomposition operation (CANDO) is a promising emerging bioprocess for wastewater treatment that enables direct energy recovery from nitrogen (N) in three steps: (1) ammonium oxidation to nitrite; (2) denitrification of nitrite to nitrous oxide (N 2 O); and (3) N 2 O conversion to N 2 with energy generation. However, CANDO does not currently target phosphorus (P) removal. Here, we demonstrate that denitrifying polyphosphate-accumulating organism (PAO) enrichment cultures are capable of catalyzing simultaneous biological N and P removal coupled to N 2 O generation in a second generation CANDO process, CANDO+P. Over 7 months (>300 cycles) of operation of a prototype lab-scale CANDO+P sequencing batch reactor treating synthetic municipal wastewater, we observed stable and near-complete N removal accompanied by sustained high-rate, high-yield N 2 O production with partial P removal. A substantial increase in abundance of the PAO Candidatus Accumulibacter phosphatis was observed, increasing from 5% of the total bacterial community in the inoculum to over 50% after 4 months. PAO enrichment was accompanied by a strong shift in the dominant Accumulibacter population from clade IIC to clade IA, based on qPCR monitoring of polyphosphate kinase 1 (ppk1) gene variants. Our work demonstrates the feasibility of combining high-rate, high-yield N 2 O production for bioenergy production with combined N and P removal from wastewater, and it further suggests a putative denitrifying PAO niche for Accumulibacter clade IA.
Karpinska, Barbara; Zhang, Kaiming; Rasool, Brwa; Pastok, Daria; Morris, Jenny; Verrall, Susan R; Hedley, Pete E; Hancock, Robert D; Foyer, Christine H
2018-05-01
The redox state of the apoplast is largely determined by ascorbate oxidase (AO) activity. The influence of AO activity on leaf acclimation to changing irradiance was explored in wild-type (WT) and transgenic tobacco (Nicotiana tobaccum) lines containing either high [pumpkin AO (PAO)] or low [tobacco AO (TAO)] AO activity at low [low light (LL); 250 μmol m -2 s -1 ] and high [high light (HL); 1600 μmol m -2 s -1 ] irradiance and following the transition from HL to LL. AO activities changed over the photoperiod, particularly in the PAO plants. AO activity had little effect on leaf ascorbate, which was significantly higher under HL than under LL. Apoplastic ascorbate/dehydroascorbate (DHA) ratios and threonate levels were modified by AO activity. Despite decreased levels of transcripts encoding ascorbate synthesis enzymes, leaf ascorbate increased over the first photoperiod following the transition from HL to LL, to much higher levels than LL-grown plants. Photosynthesis rates were significantly higher in the TAO leaves than in WT or PAO plants grown under HL but not under LL. Sub-sets of amino acids and fatty acids were lower in TAO and WT leaves than in the PAO plants under HL, and following the transition to LL. Light acclimation processes are therefore influenced by the apoplastic as well as chloroplastic redox state. © 2017 John Wiley & Sons Ltd.
Phosphorus Mobility in the Landscape: First Steps to Linking Hydrology and Microbiology
Saia, S. M.; Walter, M. T.; Regan, J.
2011-12-01
Numerous resources are spent each year to control phosphorus (P) nonpoint source pollution around the world. Despite these efforts, high P levels in freshwater bodies are still a persistent issue. Eutrophication and subsequent algal bloom die-offs, brought about by excess P, can harm local economies as well as human and ecosystem health. To overcome this disconnect between nutrient management strategies and observed P concentrations, scientists must advance research beyond the physical and chemical mechanisms commonly included in P transport experiments. Microbiological techniques (e.g. PCR and flow cytometry) are making it easier to tease out the influence of specific microorganisms on nutrient transport. Polyphosphate accumulating organisms (PAOs) are often used in wastewater treatment plants (WWTP) to remove P from effluent water but have rarely been studied in natural settings. In this study, we combined field and laboratory column experiments to identifying the influence of changing water content and temperature on PAO-facilitated P mobility. In the field, we collected a gridded network of soil samples and measured the temperature, water content, and P concentrations (bioavailable and total P) for each. We also quantified PAO presence using qPCR techniques. In the lab, we added various concentrations of WWTP sludge (with PAO present) to autoclaved soils. We measured dissolved P concentrations in effluent water with respect to moisture content and temperature. Based on the results to these experiments, we hope to draw attention to the importance of microbiological controls on P mobility in freshwater ecosystems.
Meng, Yuan; Su, Fenghua; Chen, Yangzhi
2017-11-15
Au nanoparticles are successfully decorated onto graphene oxide (GO) sheets with the aid of supercritical carbon dioxide (ScCO 2 ) fluid. The synthesized nanocomposite (Sc-Au/GO) was characterized by X-ray diffraction (XRD), Raman spectroscopy, thermal gravimetric analysis (TGA), and transmission electron microscopy (TEM). The characterization results show that the Au nanoparticles are featured with face-centered cubic crystal structure and disperse well on the GO nanosheet surfaces with average diameters of 4-10 nm. The tribological behaviors of Sc-Au/GO as lubricating additive in PAO6 oil were investigated using a ball-on-disc friction tester, and a control experiment by respectively adding GO, nano-Au particles, and Au/GO produced in the absence of ScCO 2 was performed as well. It is found that Sc-Au/GO exhibits the best lubricating performances among all the samples tested. When 0.10 wt % Sc-Au/GO is dispersed into PAO6 oil, the friction coefficient and wear rate are respectively reduced by 33.6% and 72.8% as compared to that of the pure PAO6 oil, indicating that Sc-Au/GO is an energy efficient lubricant additive. A possible lubricating mechanism of Sc-Au/GO additive in PAO6 oil has been tentatively proposed on the basis of the analyzed results of the worn surface examined by scanning electron microscopy (SEM), Raman spectroscopy, and X-ray photoelectron spectroscopy (XPS).
Cho, Do-Yeon; Lim, Dong-Jin; Mackey, Calvin; Weeks, Christopher G; Peña Garcia, Jaime A; Skinner, Daniel; Grayson, Jessica W; Hill, Harrison S; Alexander, David K; Zhang, Shaoyan; Woodworth, Bradford A
2018-05-01
Biofilms may contribute to refractory chronic rhinosinusitis (CRS), as they lead to antibiotic resistance and failure of effective clinical treatment. l-Methionine is an amino acid with reported biofilm-inhibiting properties. Ivacaftor is a cystic fibrosis transmembrane conductance regulator (CFTR) potentiator with mild antimicrobial activity via inhibition of bacterial DNA gyrase and topoisomerase IV. The objective of this study was to evaluate whether co-treatment with ivacaftor and l-methionine can reduce the formation of Pseudomonas aeruginosa biofilms. P aeruginosa (PAO-1 strain) biofilms were studied in the presence of l-methionine and/or ivacaftor. For static biofilm assays, PAO-1 was cultured in a 48-well plate for 72 hours with stepwise combinations of these agents. Relative biofilm inhibitions were measured according to optical density of crystal violet stain at 590 nm. Live/dead assays (BacTiter-Glo™ assay, Promega) were imaged with laser scanning confocal microscopy. An agar diffusion test was used to confirm antibacterial effects of the drugs. l-Methionine (0.5 μM) significantly reduced PAO-1 biofilm mass (32.4 ± 18.0%; n = 4; p l-methionine (two-way analysis of variane, p = 0.0415) compared with corresponding concentrations of l-methionine alone. Ivacaftor enhanced the anti-biofilm activity of l-methionine against the PAO-1 strain of P aeruginosa. Further studies evaluating the efficacy of ivacaftor/l-methionine combinations for P aeruginosa sinusitis are planned. © 2018 ARS-AAOA, LLC.
Wang, Shuo; Hao, Youai; Lam, Joseph S; Vlahakis, Jason Z; Szarek, Walter A; Vinnikova, Anna; Veselovsky, Vladimir V; Brockhausen, Inka
2015-06-15
The opportunistic pathogen Pseudomonas aeruginosa produces two major cell surface lipopolysaccharides, characterized by distinct O antigens, called common polysaccharide antigen (CPA) and O-specific antigen (OSA). CPA contains a polymer of D-rhamnose (D-Rha) in α1-2 and α1-3 linkages. Three putative glycosyltransferase genes, wbpX, wbpY, and wbpZ, are part of the CPA biosynthesis cluster. To characterize the enzymatic function of the wbpZ gene product, we chemically synthesized the donor substrate GDP-D-Rha and enzymatically synthesized GDP-D-[(3)H]Rha. Using nuclear magnetic resonance (NMR) spectroscopy, we showed that WbpZ transferred one D-Rha residue from GDP-D-Rha in α1-3 linkage to both GlcNAc- and GalNAc-diphosphate-lipid acceptor substrates. WbpZ is also capable of transferring D-mannose (D-Man) to these acceptors. Therefore, WbpZ has a relaxed specificity with respect to both acceptor and donor substrates. The diphosphate group of the acceptor, however, is required for activity. WbpZ does not require divalent metal ion for activity and exhibits an unusually high pH optimum of 9. WbpZ from PAO1 is therefore a GDP-D-Rha:GlcNAc/GalNAc-diphosphate-lipid α1,3-D-rhamnosyltransferase that has significant activity of GDP-D-Man:GlcNAc/GalNAc-diphosphate-lipid α1,3-D-mannosyltransferase. We used site-directed mutagenesis to replace the Asp residues of the two DXD motifs with Ala. Neither of the mutant constructs of wbpZ (D172A or D254A) could be used to rescue CPA biosynthesis in the ΔwbpZ knockout mutant in a complementation assay. This suggested that D172 and D254 are essential for WbpZ function. This work is the first detailed characterization study of a D-Rha-transferase and a critical step in the development of CPA synthesis inhibitors. This is the first characterization of a D-rhamnosyltransferase and shows that it is essential in Pseudomonas aeruginosa for the synthesis of the common polysaccharide antigen. Copyright © 2015, American Society for
Directory of Open Access Journals (Sweden)
Sérgio Leite Rodrigues
2008-12-01
Full Text Available Introdução: A capacidade de exercício em portadores de DPOC depende da gravidade da limitação ao fluxo aéreo, do grau de hipoxemia e da função muscular esquelética. Nesses doentes, a atrofia e a fraqueza da musculatura periférica são consideradas consequências sistémicas da DPOC e estão associadas à redução da capacidade de exercício. Objectivos: Investigar a possível correlação entre hipoxemia moderada e o comprometimento muscular periférico na DPOC. Doentes e métodos: Dez doentes encaminhados ao Programa de Reabilitação Pulmonar do Hospital Universitário de Brasília foram incluídos neste estudo. A função pulmonar foi avaliada por espirometria, gasometria arterial e avaliação funcional pelo teste de caminhada de seis minutos, sinal electromiográfico e força de deltóide e quadricípetes. Resultados: As correlações entre PaO2 e a força quadricíptica (r2 = 0,61 e p = 0,007 e a distância percorrida no TC6 (r2 = 0,96 e p = 0,001 foram positivas e significativas. Houve correlação negativa e significativa entre PaO2 e a frequência mediana de quadricípetes (r2 = -0,42 e p = 0,04. Observámos também correlação significativa entre força de quadricípetes e o TC6 (r2 = 0,67 e p = 0,001. Assim como houve correlação negativa e significativa entre a frequência mediana de quadricípetes, e o TC6 (r2 = -0,42 e p = 0,04. Não encontrámos correlação significativa entre a PaO2 e força ou frequência mediana do músculo deltóide. Conclusão: A PaO2 tem correlação importante e significativa com variáveis de função muscular periférica. A hipoxemia moderada e a disfunção muscular periférica precoce possuem como principal impacto negativo a deterioração da capacidade funcional de portadores de DPOC.Rationale: Exercise capacity in COPD patients depends on the degree of airflow obstruction, the severity of the hypoxaemia and skeletal muscle function. Muscle atrophy and weakness are considered systemic
DEFF Research Database (Denmark)
Andersen, A S; Joergensen, B; Bjarnsholt, T
2010-01-01
Maggot debridement therapy (MDT) is widely used for debridement of chronic infected wounds; however, for wounds harbouring specific bacteria limited effect or failure of the treatment has been described. Here we studied the survival of Lucilia sericata maggots encountering Pseudomonas aeruginosa...... PAO1 in a simple assay with emphasis on the quorum-sensing (QS)-regulated virulence. The maggots were challenged with GFP-tagged P. aeruginosa wild-type (WT) PAO1 and a GFP-tagged P. aeruginosa DeltalasR rhlR (DeltaRR) QS-deficient mutant in different concentrations. Maggots were killed...
Successful resolution of severe hepatopulmonary syndrome following liver transplantation.
Asthana, Sonal; Maguire, Connor; Lou, Lawrence; Meier, Michael; Bain, Vincent; Townsend, Derek R; Townsend, Rex; Lien, Dale; Bigam, David; Kneteman, Norman; Shapiro, Andrew Mark James
2010-04-01
Hepatopulmonary syndrome (HPS) is a complication of portal hypertension, defined by the presence of liver disease, abnormal pulmonary gas exchange and evidence of intrapulmonary vascular dilatations producing a right-to-left intrapulmonary shunt. Liver transplantation (LT) is the treatment of choice; however, severe hypoxemia (PaO(2) < 50 mmHg on room air) is considered a contraindication to LT. This approach disadvantages some patients, particularly young patients with no intrinsic cardio-respiratory disease. We discuss one such patient who improved with LT despite having extremely severe HPS (PaO2 < 29 mmHg).
Study of the kinetics of three new radiopharmaceuticals for the evaluation of cerebral blood flow
International Nuclear Information System (INIS)
Demonceau, G.; Brihaye, C.; Depresseux, J.C.; Cantineau, R.; Rigo, P.; Merchie, G.
1986-01-01
The following labelled compounds with potential for single photon emission computed tomography brain blood flow studies are studied in 6 normal patients: N-isopropyl-p-[123-I] iodoamphetamine (123-I-AMP); N,N,N'-trimethyl-N'-[2-hydroxyl-3-methyl-5-[123-I] iodobenzyl] 1-3 propanediamine, (123-I-HIPDM) and 99mTC-hexamethyl-propyleneamine oxime (99mTc-HM-PAO). 99mTc-HM-PAO has the advantage of rapid and stable brain uptake compared to the rather slow brain uptake of 123I-AMP and 123I-HIPDM [fr
In-Drift Precipitates/Salts Analysis
International Nuclear Information System (INIS)
Mariner, P.
2001-01-01
As directed by a written development plan (CRWMS M and O 1999a), an analysis of the effects of salts and precipitates on the repository chemical environment is to be developed and documented in an Analyses/Model Report (AMR). The purpose of this analysis is to assist Performance Assessment Operations (PAO) and the Engineered Barrier Performance Department in modeling the geochemical environment within a repository drift, thus allowing PAO to provide a more detailed and complete in-drift geochemical model abstraction and to answer the key technical issues (KTI) raised in the NRC Issue Resolution Status Report (IRSR) for the Evolution of the Near Field Environment (NFE) Revision 2 (NRC 1999). The purpose of this ICN is to qualify and document qualification of the AMR's technical products. The scope of this document is to develop a model of the processes that govern salt precipitation and dissolution and resulting water composition in the Engineered Barrier System (EBS). This model is developed to serve as a basis for the in-drift geochemical modeling work performed by PAO and is to be used in subsequent PAO analyses including the EBS physical and chemical model abstraction effort. However, the concepts may also apply to some near and far field geochemical processes and can have conceptual application within the unsaturated zone and saturated zone transport modeling efforts. The intended use of the model developed in this report is to estimate, within an appropriate level of confidence, the pH, chloride concentration, and ionic strength of water on the drip shield or other location within the drift during the post-closure period. These estimates are based on evaporative processes that are subject to a broad range of potential environmental conditions and are independent of the presence or absence of backfill. An additional intended use is to estimate the environmental conditions required for complete vaporization of water. The presence and composition of liquid water
Directory of Open Access Journals (Sweden)
Sipe Eilynn K
2004-01-01
Full Text Available Abstract Background We sought to determine torso injury rates and sensitivities associated with fluid-positive abdominal ultrasound, metabolic acidosis (increased base deficit and lactate, and impaired pulmonary physiology (decreased spirometric volume and PaO2/FiO2. Methods Level I trauma center prospective pilot and post-pilot study (2000–2001 of stable patients. Increased base deficit was 2.5 mmol/L in ethanol-negative and ≥ 3.0 mmol/L in ethanol-positive patients. Decreased PaO2/FiO2 was Results Of 215 patients, 66 (30.7% had a torso injury (abdominal/pelvic injury n = 35 and/or thoracic injury n = 43. Glasgow Coma Scale score was 14.8 ± 0.5 (13–15. Torso injury rates and sensitivities were: abdominal ultrasound negative and normal base deficit, lactate, PaO2/FiO2, and spirometric volume – 0.0% & 0.0%; normal base deficit and normal spirometric volume – 4.2% & 4.5%; chest/abdominal soft tissue injury – 37.8% & 47.0%; increased lactate – 39.7% & 47.0%; increased base deficit – 41.3% & 75.8%; increased base deficit and/or decreased spirometric volume – 43.8% & 95.5%; decreased PaO2/FiO2 – 48.9% & 33.3%; positive abdominal ultrasound – 62.5% & 7.6%; decreased spirometric volume – 73.4% & 71.2%; increased base deficit and decreased spirometric volume – 82.9% & 51.5%. Conclusions Trauma patients with normal base deficit and spirometric volume are unlikely to have a torso injury. Patients with increased base deficit or lactate, decreased spirometric volume, decreased PaO2/FiO2, or positive FAST have substantial risk for torso injury. Increased base deficit and/or decreased spirometric volume are highly sensitive for torso injury. Base deficit and spirometric volume values are readily available and increase or decrease the suspicion for torso injury.
Ciofu, Oana; Yang, Liang; Wu, Hong; Song, Zhijun; Oliver, Antonio; Høiby, Niels
2013-01-01
Resistance to β-lactam antibiotics is a frequent problem in Pseudomonas aeruginosa lung infection of cystic fibrosis (CF) patients. This resistance is mainly due to the hyperproduction of chromosomally encoded β-lactamase and biofilm formation. The purpose of this study was to investigate the role of β-lactamase in the pharmacokinetics (PK) and pharmacodynamics (PD) of ceftazidime and imipenem on P. aeruginosa biofilms. P. aeruginosa PAO1 and its corresponding β-lactamase-overproducing mutant, PAΔDDh2Dh3, were used in this study. Biofilms of these two strains in flow chambers, microtiter plates, and on alginate beads were treated with different concentrations of ceftazidime and imipenem. The kinetics of antibiotics on the biofilms was investigated in vitro by time-kill methods. Time-dependent killing of ceftazidime was observed in PAO1 biofilms, but concentration-dependent killing activity of ceftazidime was observed for β-lactamase-overproducing biofilms of P. aeruginosa in all three models. Ceftazidime showed time-dependent killing on planktonic PAO1 and PAΔDDh2Dh3. This difference is probably due to the special distribution and accumulation in the biofilm matrix of β-lactamase, which can hydrolyze the β-lactam antibiotics. The PK/PD indices of the AUC/MBIC and Cmax/MBIC (AUC is the area under concentration-time curve, MBIC is the minimal biofilm-inhibitory concentration, and Cmax is the maximum concentration of drug in serum) are probably the best parameters to describe the effect of ceftazidime in β-lactamase-overproducing P. aeruginosa biofilms. Meanwhile, imipenem showed time-dependent killing on both PAO1 and PAΔDDh2Dh3 biofilms. An inoculum effect of β-lactams was found for both planktonic and biofilm P. aeruginosa cells. The inoculum effect of ceftazidime for the β-lactamase-overproducing mutant PAΔDDh2Dh3 biofilms was more obvious than for PAO1 biofilms, with a requirement of higher antibiotic concentration and a longer period of treatment
In-Drift Precipitates/Salts Analysis
Energy Technology Data Exchange (ETDEWEB)
P. Mariner
2001-01-10
As directed by a written development plan (CRWMS M&O 1999a), an analysis of the effects of salts and precipitates on the repository chemical environment is to be developed and documented in an Analyses/Model Report (AMR). The purpose of this analysis is to assist Performance Assessment Operations (PAO) and the Engineered Barrier Performance Department in modeling the geochemical environment within a repository drift, thus allowing PAO to provide a more detailed and complete in-drift geochemical model abstraction and to answer the key technical issues (KTI) raised in the NRC Issue Resolution Status Report (IRSR) for the Evolution of the Near Field Environment (NFE) Revision 2 (NRC 1999). The purpose of this ICN is to qualify and document qualification of the AMR's technical products. The scope of this document is to develop a model of the processes that govern salt precipitation and dissolution and resulting water composition in the Engineered Barrier System (EBS). This model is developed to serve as a basis for the in-drift geochemical modeling work performed by PAO and is to be used in subsequent PAO analyses including the EBS physical and chemical model abstraction effort. However, the concepts may also apply to some near and far field geochemical processes and can have conceptual application within the unsaturated zone and saturated zone transport modeling efforts. The intended use of the model developed in this report is to estimate, within an appropriate level of confidence, the pH, chloride concentration, and ionic strength of water on the drip shield or other location within the drift during the post-closure period. These estimates are based on evaporative processes that are subject to a broad range of potential environmental conditions and are independent of the presence or absence of backfill. An additional intended use is to estimate the environmental conditions required for complete vaporization of water. The presence and composition of liquid water
B-iTRS: A Bio-Inspired Trusted Routing Scheme for Wireless Sensor Networks
Directory of Open Access Journals (Sweden)
Mingchuan Zhang
2015-01-01
Full Text Available In WSNs, routing algorithms need to handle dynamical changes of network topology, extra overhead, energy saving, and other requirements. Therefore, routing in WSNs is an extremely interesting and challenging issue. In this paper, we present a novel bio-inspired trusted routing scheme (B-iTRS based on ant colony optimization (ACO and Physarum autonomic optimization (PAO. For trust assessment, B-iTRS monitors neighbors’ behavior in real time, receives feedback from Sink, and then assesses neighbors’ trusts based on the acquired information. For routing scheme, each node finds routes to the Sink based on ACO and PAO. In the process of path finding, B-iTRS senses the load and trust value of each node and then calculates the link load and link trust of the found routes to support the route selection. Moreover, B-iTRS also assesses the route based on PAO to maintain the route table. Simulation results show how B-iTRS can achieve the effective performance compared to existing state-of-the-art algorithms.
Long term high flow humidified oxygen treatment in COPD – effect on blood gases
DEFF Research Database (Denmark)
Storgaard, Line; Weinreich, Ulla; Hockey, Hans
2017-01-01
.Aim: To investigate the treatment effect on arterial blood gases (PaO2, PaCO2 and SaO2) in patients with resting hypoxemia over 12 months.Method: In this prospective, randomized controlled, one-year study, 200 COPD patients treated with LTOT, all GOLD class 4, were randomized to NHF (n=100) or usual care (n=100......) between March 2013 and June 2015.Results: The groups are comparable in average days in study, age, gender, smoking status, pack years, BMI, FEV1%, 6 minutes walking test, administered oxygen (L/min), PaO2 PaCO2 and Sa02 at baseline and number of exacerbations and admissions one year prior to study start....... Treated with a mean NHF-flow of 20 L/min, no significant difference was seen in PaO2 or SaO2 over the study, but a significantly different change in PaCO2 was seen after 6 months (p<0.05) and after 12 months (p<0.01) in favor of patients treated with NHF. Increase in PaCO<2 was approximately 0...
Halliday, Hannah S.; Thompson, Anne M.; Wisthaler, Armin; Blake, Donald; Hornbrook, Rebecca S.; Mikoviny, Tomas; Mueller, Markus; Eichler, Philipp; Apel, Eric C.; Hills, Alan
2016-01-01
High time resolution measurements of volatile organic compounds (VOCs) were collectedusing a proton-transfer-reaction quadrupole mass spectrometry (PTR-QMS) instrument at the PlattevilleAtmospheric Observatory (PAO) in Colorado to investigate how oil and natural gas (ONG) developmentimpacts air quality within the Wattenburg Gas Field (WGF) in the Denver-Julesburg Basin. The measurementswere carried out in July and August 2014 as part of NASAs Deriving Information on Surface Conditions fromColumn and Vertically Resolved Observations Relevant to Air Quality (DISCOVER-AQ) field campaign. ThePTR-QMS data were supported by pressurized whole air canister samples and airborne vertical and horizontalsurveys of VOCs. Unexpectedly high benzene mixing ratios were observed at PAO at ground level (meanbenzene 0.53 ppbv, maximum benzene 29.3 ppbv), primarily at night (mean nighttime benzene 0.73ppbv). These high benzene levels were associated with southwesterly winds. The airborne measurementsindicate that benzene originated from within the WGF, and typical source signatures detected in the canistersamples implicate emissions from ONG activities rather than urban vehicular emissions as primary benzenesource. This conclusion is backed by a regional toluene-to-benzene ratio analysis which associated southerlyflow with vehicular emissions from the Denver area. Weak benzene-to-CO correlations confirmed that trafficemissions were not responsible for the observed high benzene levels. Previous measurements at the BoulderAtmospheric Observatory (BAO) and our data obtained at PAO allow us to locate the source of benzeneenhancements between the two atmospheric observatories. Fugitive emissions of benzene from ONGoperations in the Platteville area are discussed as the most likely causes of enhanced benzene levels at PAO.
Nonverbal oral apraxia in primary progressive aphasia and apraxia of speech.
Botha, Hugo; Duffy, Joseph R; Strand, Edythe A; Machulda, Mary M; Whitwell, Jennifer L; Josephs, Keith A
2014-05-13
The goal of this study was to explore the prevalence of nonverbal oral apraxia (NVOA), its association with other forms of apraxia, and associated imaging findings in patients with primary progressive aphasia (PPA) and progressive apraxia of speech (PAOS). Patients with a degenerative speech or language disorder were prospectively recruited and diagnosed with a subtype of PPA or with PAOS. All patients had comprehensive speech and language examinations. Voxel-based morphometry was performed to determine whether atrophy of a specific region correlated with the presence of NVOA. Eighty-nine patients were identified, of which 34 had PAOS, 9 had agrammatic PPA, 41 had logopenic aphasia, and 5 had semantic dementia. NVOA was very common among patients with PAOS but was found in patients with PPA as well. Several patients exhibited only one of NVOA or apraxia of speech. Among patients with apraxia of speech, the severity of the apraxia of speech was predictive of NVOA, whereas ideomotor apraxia severity was predictive of the presence of NVOA in those without apraxia of speech. Bilateral atrophy of the prefrontal cortex anterior to the premotor area and supplementary motor area was associated with NVOA. Apraxia of speech, NVOA, and ideomotor apraxia are at least partially separable disorders. The association of NVOA and apraxia of speech likely results from the proximity of the area reported here and the premotor area, which has been implicated in apraxia of speech. The association of ideomotor apraxia and NVOA among patients without apraxia of speech could represent disruption of modules shared by nonverbal oral movements and limb movements.
ORF Alignment: NC_002516 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available ginosa (strain PAO1) ... Length = 117 ... Query: 8 ... SPMESLFDIRSLEAITGGEPAALQ...RLLETLLASSRDDRTRLAELLALADLQGVAELAHRI 67 ... SPMESLFDIRSLEAITGGEPAALQRLLETLLASSRDDRTRLAELLALADLQGVAELAHRI Sbjct: 1 ... SPME
ORF Alignment: NC_002516 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available a (strain ... PAO1) ... Length = 58 ... Query: 4 ... FHIPNMTCGGCAKTVTRILHGVDPQARVETDPP...RREARVESTLDKHAFLEALSEAGYP 61 ... FHIPNMTCGGCAKTVTRILHGVDPQARVETDPPRREARVESTLDKHAFLEALSEAGYP Sbjct: 1 ... FHIPNMTCGGCAKTVTRILHGVDPQARVETDPPRREARVESTLDKHAFLEALSEAGYP 58
ORF Alignment: NC_002516 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available Pseudomonas ... aeruginosa (strain PAO1) ... Length = 246 ... Query: 28 ... EDAVKRGTLRVGMDPTYMPFEMT...NKRGQIIGFEVDLLKAMAKSMGVKLELVSTSYDGIIP 87 ... EDAVKRGTLRVGMDPTYMPFEMTNKRGQIIGFEVDLLKAMAKSMGVKLELVSTSYD...GIIP Sbjct: 13 ... EDAVKRGTLRVGMDPTYMPFEMTNKRGQIIGFEVDLLKAMAKSMGVKLELVSTSYDGIIP 72 ...
Klit, Jakob
2014-04-01
Knee and hip OA is the clinical and pathological outcome of a functional and structural failure of the joint, resulting in pain and physical dysfunction. Despite the similarity in clinical presentation the pathogenesis seems to differ. Where knee OA is associated with obesity and trauma, hip OA is associated with FAI covering three fundamentally different hip deformities, including acetabular dysplasia; all hypothesized to initiates OA development. Where PAO is used worldwide as a joint-preserving procedure in acetabular dysplasia, TKA and THA are the treatment of choice of end stage OA. Traditional main outcomes are clinically objective surgeon-reported endpoints. Patient perceived outcomes are known to differ from these and PROMs are now recommended as the core set of outcomes. When evaluating the outcome in younger patients, this high demanding group can show ceiling-effects of the scores. The overall aim of this thesis was to investigate the consequences of PAO, TKA, and THA in younger patients evaluated by alternative outcomes in relation to satisfaction, fulfillment of expectations, symptoms of depression, the socioeconomic effects, and abilities in sex-life; to improve patient information prior to PAO, TKA and THA surgery. This PhD thesis is based on three studies. Study I is a cross-sectional survey of preserved hip joints with a mean follow-up of ten years after PAO. One hundred patients (121 PAO's) were eligible for inclusion. An inquiry to the National Patient registry identified 36 of PAO's (in 35 patients) being converted to THA. The 61 remaining patients (80 preserved hip joints) were asked to participate in this questionnaire based follow-up. Fifty-five patients (70 preserved hip-joints) accepted and constituted the study population. All patients received a questionnaire concerning aspects of functional ability, patient satisfaction, expectations, and quality of life following PAO. Both Study II and Study III are prospective multicenter cohort
Guo, Lei; Wang, Weiwei; Zhao, Nana; Guo, Libo; Chi, Chunjie; Hou, Wei; Wu, Anqi; Tong, Hongshuang; Wang, Yue; Wang, Changsong; Li, Enyou
2016-07-22
It has been shown that the application of a lung-protective mechanical ventilation strategy can improve the prognosis of patients with acute lung injury (ALI) or acute respiratory distress syndrome (ARDS). However, the optimal mechanical ventilation strategy for intensive care unit (ICU) patients without ALI or ARDS is uncertain. Therefore, we performed a network meta-analysis to identify the optimal mechanical ventilation strategy for these patients. We searched the Cochrane Central Register of Controlled Trials (CENTRAL) in the Cochrane Library, EMBASE, MEDLINE, CINAHL, and Web of Science for studies published up to July 2015 in which pulmonary compliance or the partial pressure of arterial oxygen/fraction of inspired oxygen (PaO2/FIO2) ratio was assessed in ICU patients without ALI or ARDS, who received mechanical ventilation via different strategies. The data for study characteristics, methods, and outcomes were extracted. We assessed the studies for eligibility, extracted the data, pooled the data, and used a Bayesian fixed-effects model to combine direct comparisons with indirect evidence. Seventeen randomized controlled trials including a total of 575 patients who received one of six ventilation strategies were included for network meta-analysis. Among ICU patients without ALI or ARDS, strategy C (lower tidal volume (VT) + higher positive end-expiratory pressure (PEEP)) resulted in the highest PaO2/FIO2 ratio; strategy B (higher VT + lower PEEP) was associated with the highest pulmonary compliance; strategy A (lower VT + lower PEEP) was associated with a shorter length of ICU stay; and strategy D (lower VT + zero end-expiratory pressure (ZEEP)) was associated with the lowest PaO2/FiO2 ratio and pulmonary compliance. For ICU patients without ALI or ARDS, strategy C (lower VT + higher PEEP) was associated with the highest PaO2/FiO2 ratio. Strategy B (higher VT + lower PEEP) was superior to the other strategies in improving pulmonary
Wagner, Cynthia E; Pope, Nicolas H; Charles, Eric J; Huerter, Mary E; Sharma, Ashish K; Salmon, Morgan D; Carter, Benjamin T; Stoler, Mark H; Lau, Christine L; Laubach, Victor E; Kron, Irving L
2016-02-01
Ex vivo lung perfusion has been successful in the assessment of marginal donor lungs, including donation after cardiac death (DCD) donor lungs. Ex vivo lung perfusion also represents a unique platform for targeted drug delivery. We sought to determine whether ischemia-reperfusion injury would be decreased after transplantation of DCD donor lungs subjected to prolonged cold preservation and treated with an adenosine A2A receptor agonist during ex vivo lung perfusion. Porcine DCD donor lungs were preserved at 4°C for 12 hours and underwent ex vivo lung perfusion for 4 hours. Left lungs were then transplanted and reperfused for 4 hours. Three groups (n = 4/group) were randomized according to treatment with the adenosine A2A receptor agonist ATL-1223 or the dimethyl sulfoxide vehicle: Infusion of dimethyl sulfoxide during ex vivo lung perfusion and reperfusion (DMSO), infusion of ATL-1223 during ex vivo lung perfusion and dimethyl sulfoxide during reperfusion (ATL-E), and infusion of ATL-1223 during ex vivo lung perfusion and reperfusion (ATL-E/R). Final Pao2/Fio2 ratios (arterial oxygen partial pressure/fraction of inspired oxygen) were determined from samples obtained from the left superior and inferior pulmonary veins. Final Pao2/Fio2 ratios in the ATL-E/R group (430.1 ± 26.4 mm Hg) were similar to final Pao2/Fio2 ratios in the ATL-E group (413.6 ± 18.8 mm Hg), but both treated groups had significantly higher final Pao2/Fio2 ratios compared with the dimethyl sulfoxide group (84.8 ± 17.7 mm Hg). Low oxygenation gradients during ex vivo lung perfusion did not preclude superior oxygenation capacity during reperfusion. After prolonged cold preservation, treatment of DCD donor lungs with an adenosine A2A receptor agonist during ex vivo lung perfusion enabled Pao2/Fio2 ratios greater than 400 mm Hg after transplantation in a preclinical porcine model. Pulmonary function during ex vivo lung perfusion was not predictive of outcomes after transplantation. Copyright
Does Participation in Sports Affect Osteoarthritic Progression After Periacetabular Osteotomy?
Hara, Daisuke; Hamai, Satoshi; Fukushi, Jun-Ichi; Kawaguchi, Ken-Ichi; Motomura, Goro; Ikemura, Satoshi; Komiyama, Keisuke; Nakashima, Yasuharu
2017-09-01
Periacetabular osteotomy (PAO) is an effective treatment for symptomatic acetabular dysplasia. However, whether postoperative participation in sports leads to progression of the Kellgren-Lawrence (KL) grade of osteoarthritis (OA) in these patients is unclear. To investigate (1) participation in sports before and after PAO and (2) whether postoperative participation in sports leads to progression of the KL grade. Case-control study; Level of evidence, 3. The authors retrospectively reviewed data on 161 patients (183 hips) who underwent PAO for symptomatic acetabular dysplasia with preoperative KL grade 1 or 2 between 1998 and 2011. The mean age at the time of surgery was 42.0 ± 10.9 years (range, 12-64 years), and the mean follow-up duration was 100 months (range, 13-180 months). Data included participation in sports, the University of California, Los Angeles (UCLA) activity scale score, age at the time of surgery, body mass index, follow-up duration, history of treatment for developmental hip dislocations, Merle d'Aubigné-Postel score, Oxford Hip Score, center-edge angle, and KL grade. Univariate and multivariate analyses were applied to determine which factors were associated with progression to KL grade 3 or 4 after PAO. The number of patients who participated in sports significantly increased from 50 (31.1%) preoperatively to 89 (55.3%) postoperatively. The mean UCLA score significantly increased from 4.7 ± 2.1 preoperatively to 5.5 ± 2.0 postoperatively. The KL grade progressed to grade 3 or 4 in 16 hips, including 4 hips that underwent conversion to total hip arthroplasty. No significant differences were found in postoperative participation in sports (89 hips [53.3%] vs 11 hips [68.8%], respectively; P = .24) and the UCLA score (5.6 ± 2.0 vs 5.1 ± 2.0, respectively; P = .30) between hips with KL grade 1 or 2 and KL grade 3 or 4. A multivariate analysis revealed that no factors, including postoperative participation in sports, were significantly
Directory of Open Access Journals (Sweden)
I. A. Kozlov
2007-01-01
Full Text Available Objective: to study the time course of changes in the respiratory biomechanics, extravascular water of the lung (EVWL and its oxygenizing function and their relationship at different stages of surgical interventions under extracorporeal circulation (EC. Subjects and methods. 29 patients aged 37 to 72 years were examined during uncomplicated operations under EC. The parameters of artificial ventilation (AV and lung biomechanics were recorded in real time on a Servo-I monitoring apparatus. PaO2/FiO2, Qs/Qt, and body mass index (BMI were calculated. The EVWL index (EVWLI was determined by the transpulmonary thermodilution technique. Studies were conducted at stages: 1 after tracheal intubation and the initiation of AV; 2 before sternotomy; 3 after sternal uniting at the end of surgery. Results. Pressures in the airways and their resistance were statistically significantly unchanged. There were significant reductions in Cdyn and Cst at the end of surgery (Stage 3. The mean values of PaO2/FiO2, Qs/Qt, and EVWLI did not undergo considerable changes. There was a significant correlation between PaO2/FiO2 and Qs/Qt (r=-0.5 to -0.8; p<0.05. At Stage 1, BMI proved to be a significant predictor of the level of PaO2/FiO2 and Qs/Qt (r=-0.5 and 0.65; p<0.05. A significant moderate relationship between Qs/Qt and Cdyn was found at Stage 3 (r=-0.44; p<0.05. There were no statistically significant correlations between the parameters of respiratory biomechanics, PaO2/FiO2, Qs/Qt, and EVWLI. At the end of surgery, pulmonary oxygenizing dysfunction (POD was detected in 5 (17.2% patients with increased BMI. Alveolar mobilization with a steady-state effect was used to correct POD. Conclusion. When cardiac surgery is uncomplicated and the AV and EC protocols are carefully followed, the rate of intraoperative POD is not greater than 20%, its leading causes are obesity and, most likely, microatelectasis under AV. Key words: pulmonary oxygenizing dysfunction
Halliday, Hannah S.; Thompson, Anne M.; Wisthaler, Armin; Blake, Donald R.; Hornbrook, Rebecca S.; Mikoviny, Tomas; Müller, Markus; Eichler, Philipp; Apel, Eric C.; Hills, Alan J.
2016-09-01
High time resolution measurements of volatile organic compounds (VOCs) were collected using a proton-transfer-reaction quadrupole mass spectrometry (PTR-QMS) instrument at the Platteville Atmospheric Observatory (PAO) in Colorado to investigate how oil and natural gas (O&NG) development impacts air quality within the Wattenburg Gas Field (WGF) in the Denver-Julesburg Basin. The measurements were carried out in July and August 2014 as part of NASA's "Deriving Information on Surface Conditions from Column and Vertically Resolved Observations Relevant to Air Quality" (DISCOVER-AQ) field campaign. The PTR-QMS data were supported by pressurized whole air canister samples and airborne vertical and horizontal surveys of VOCs. Unexpectedly high benzene mixing ratios were observed at PAO at ground level (mean benzene = 0.53 ppbv, maximum benzene = 29.3 ppbv), primarily at night (mean nighttime benzene = 0.73 ppbv). These high benzene levels were associated with southwesterly winds. The airborne measurements indicate that benzene originated from within the WGF, and typical source signatures detected in the canister samples implicate emissions from O&NG activities rather than urban vehicular emissions as primary benzene source. This conclusion is backed by a regional toluene-to-benzene ratio analysis which associated southerly flow with vehicular emissions from the Denver area. Weak benzene-to-CO correlations confirmed that traffic emissions were not responsible for the observed high benzene levels. Previous measurements at the Boulder Atmospheric Observatory (BAO) and our data obtained at PAO allow us to locate the source of benzene enhancements between the two atmospheric observatories. Fugitive emissions of benzene from O&NG operations in the Platteville area are discussed as the most likely causes of enhanced benzene levels at PAO.
Ferguson, Lee P; Durward, Andrew; Tibby, Shane M
2012-07-17
Observational studies in adults have shown a worse outcome associated with hyperoxia after resuscitation from cardiac arrest. Extrapolating from adult data, current pediatric resuscitation guidelines recommend avoiding hyperoxia. We investigated the relationship between arterial partial oxygen pressure and survival in patients admitted to the pediatric intensive care unit (PICU) after cardiac arrest. We conducted a retrospective cohort study using the Pediatric Intensive Care Audit Network (PICANet) database between 2003 and 2010 (n=122,521). Patients aged oxygen status and outcome was modeled with logistic regression, with nonlinearities explored via multivariable fractional polynomials. Covariates included age, sex, ethnicity, congenital heart disease, out-of-hospital arrest, year, Pediatric Index of Mortality-2 (PIM2) mortality risk, and organ supportive therapies. Of 1875 patients, 735 (39%) died in PICU. Based on the first arterial gas, 207 patients (11%) had hyperoxia (Pa(O)(2) ≥300 mm Hg) and 448 (24%) had hypoxia (Pa(O)(2) <60 mm Hg). We found a significant nonlinear relationship between Pa(O)(2) and PICU mortality. After covariate adjustment, risk of death increased sharply with increasing hypoxia (odds ratio, 1.92; 95% confidence interval, 1.80-2.21 at Pa(O)(2) of 23 mm Hg). There was also an association with increasing hyperoxia, although not as dramatic as that for hypoxia (odds ratio, 1.25; 95% confidence interval, 1.17-1.37 at 600 mm Hg). We observed an increasing mortality risk with advancing age, which was more pronounced in the presence of congenital heart disease. Both severe hypoxia and, to a lesser extent, hyperoxia are associated with an increased risk of death after PICU admission after cardiac arrest.
Gu, April Z; Saunders, A; Neethling, J B; Stensel, H D; Blackall, L L
2008-08-01
The abundance and relevance ofAccumulibacter phosphatis (presumed to be polyphosphate-accumulating organisms [PAOs]), Competibacter phosphatis (presumed to be glycogen-accumulating organisms [GAOs]), and tetrad-forming organisms (TFOs) to phosphorus removal performance at six full-scale enhanced biological phosphorus removal (EBPR) wastewater treatment plants were investigated. Coexistence of various levels of candidate PAOs and GAOs were found at these facilities. Accumulibacter were found to be 5 to 20% of the total bacterial population, and Competibacter were 0 to 20% of the total bacteria population. The TFO abundance varied from nondetectable to dominant. Anaerobic phosphorus (P) release to acetate uptake ratios (P(rel)/HAc(up)) obtained from bench tests were correlated positively with the abundance ratio of Accumulibacter/(Competibacter +TFOs) and negatively with the abundance of (Competibacter +TFOs) for all plants except one, suggesting the relevance of these candidate organisms to EBPR processes. However, effluent phosphorus concentration, amount of phosphorus removed, and process stability in an EBPR system were not directly related to high PAO abundance or mutually exclusive with a high GAO fraction. The plant that had the lowest average effluent phosphorus and highest stability rating had the lowest P(rel)/HAc(up) and the most TFOs. Evaluation of full-scale EBPR performance data indicated that low effluent phosphorus concentration and high process stability are positively correlated with the influent readily biodegradable chemical oxygen demand-to-phosphorus ratio. A system-level carbon-distribution-based conceptual model is proposed for capturing the dynamic competition between PAOs and GAOs and their effect on an EBPR process, and the results from this study seem to support the model hypothesis.
International Nuclear Information System (INIS)
P.S. Domski
2000-01-01
As directed by a written development plan (CRWMS M andO 1999a), a conceptual model for water entering the drift and reacting with the invert materials is to be developed. The purpose of this conceptual model is to assist Performance Assessment Operations (PAO) and its Engineered Barrier Performance Department in modeling the geochemical environment within a repository drift, thus allowing PAO to provide a more detailed and complete in-drift geochemical model abstraction, and to answer the key technical issues (KTI) raised in the NRC Issue Resolution Status Report (IRSR) for the Evolution of the Near-Field Environment (NFE), Revision 2 (NRC 1999). This AMR also seeks to: (1) Develop a logical conceptual model for physical/chemical interactions between seepage and the invert materials; (2) screen potential processes and reactions that may occur between seepage and invert to evaluate the potential consequences of the interactions; and (3) outline how seepage/invert processes may be quantified. This document provides the conceptual framework for screening out insignificant processes and for identifying and evaluating those seepage/invert interactions that have the potential to be important to subsequent PAO analyses including the Engineered Barrier System (EBS) physical and chemical model abstraction effort. This model has been developed to serve as a basis for the in-drift geochemical analyses performed by PAO. Additionally, the concepts discussed within this report may also apply to certain near and far-field geochemical processes and may have conceptual application within the unsaturated zone (UZ) and saturated zone (SZ) transport modeling efforts. The seepage/invert interactions will not directly affect any principal factors
Fu, Xing-Zheng; Chen, Chuan-Wu; Wang, Yin; Liu, Ji-Hong; Moriguchi, Takaya
2011-03-28
Enormous work has shown that polyamines are involved in a variety of physiological processes, but information is scarce on the potential of modifying disease response through genetic transformation of a polyamine biosynthetic gene. In the present work, an apple spermidine synthase gene (MdSPDS1) was introduced into sweet orange (Citrus sinensis Osbeck 'Anliucheng') via Agrobacterium-mediated transformation of embryogenic calluses. Two transgenic lines (TG4 and TG9) varied in the transgene expression and cellular endogenous polyamine contents. Pinprick inoculation demonstrated that the transgenic lines were less susceptible to Xanthomonas axonopodis pv. citri (Xac), the causal agent of citrus canker, than the wild type plants (WT). In addition, our data showed that upon Xac attack TG9 had significantly higher free spermine (Spm) and polyamine oxidase (PAO) activity when compared with the WT, concurrent with an apparent hypersensitive response and the accumulation of more H₂O₂. Pretreatment of TG9 leaves with guazatine acetate, an inhibitor of PAO, repressed PAO activity and reduced H₂O₂ accumulation, leading to more conspicuous disease symptoms than the controls when both were challenged with Xac. Moreover, mRNA levels of most of the defense-related genes involved in synthesis of pathogenesis-related protein and jasmonic acid were upregulated in TG9 than in the WT regardless of Xac infection. Our results demonstrated that overexpression of the MdSPDS1 gene prominently lowered the sensitivity of the transgenic plants to canker. This may be, at least partially, correlated with the generation of more H₂O₂ due to increased production of polyamines and enhanced PAO-mediated catabolism, triggering hypersensitive response or activation of defense-related genes.
Butscheidt, S; Delsmann, A; Rolvien, T; Barvencik, F; Al-Bughaili, M; Mundlos, S; Schinke, T; Amling, M; Kornak, U; Oheim, R
2018-03-29
Pregnancy was found to be a skeletal risk factor promoting the initial onset of previously unrecognized monogenic bone disorders, thus explaining a proportion of cases with pregnancy-associated osteoporosis. Therapeutic measures should focus in particular on the normalization of the disturbed calcium homeostasis in order to enable the partial skeletal recovery. Pregnancy-associated osteoporosis (PAO) is a rare skeletal condition, which is characterized by a reduction in bone mineral density (BMD) in the course of pregnancy and lactation. Typical symptoms include vertebral compression fractures and transient osteoporosis of the hip. Since the etiology is not well understood, this prospective study was conducted in order to elucidate the relevance of pathogenic gene variants for the development of PAO. Seven consecutive cases with the diagnosis of PAO underwent a skeletal assessment (blood tests, DXA, HR-pQCT) and a comprehensive genetic analysis using a custom-designed gene panel. All cases showed a reduced BMD (DXA T-score, lumbar spine - 3.2 ± 1.0; left femur - 2.2 ± 0.5; right femur - 1.9 ± 0.5), while the spine was affected more severely (p Pregnancy should be considered a skeletal risk factor, which can promote the initial clinical onset of such skeletal disorders. The underlying increased calcium demand is essential in terms of prophylactic and therapeutic measures, which are especially required in individuals with a genetically determined low bone mass. The implementation of this knowledge in clinical practice can enable the partial recovery of the skeleton. Consistent genetic studies are needed to analyze the frequency of pathogenic variants in women with PAO.
León-Flández, K; Rico-Gómez, A; Moya-Geromin, M Á; Romero-Fernández, M; Bosqued-Estefania, M J; Damián, J; López-Jurado, L; Royo-Bordonada, M Á
2017-09-01
To evaluate compliance levels with the Spanish Code of self-regulation of food and drinks advertising directed at children under the age of 12 years (Publicidad, Actividad, Obesidad, Salud [PAOS] Code) in 2012; and compare these against the figures for 2008. Cross-sectional study. Television advertisements of food and drinks (AFD) were recorded over 7 days in 2012 (8am-midnight) of five Spanish channels popular to children. AFD were classified as core (nutrient-rich/low-calorie products), non-core (nutrient-poor/rich-calorie products) or miscellaneous. Compliance with each standard of the PAOS Code was evaluated. AFD were deemed to be fully compliant when it met all the standards. Two thousand five hundred and eighty-two AFDs came within the purview of the PAOS Code. Some of the standards that registered the highest levels of non-compliance were those regulating the suitability of the information presented (79.4%) and those prohibiting the use of characters popular with children (25%). Overall non-compliance with the Code was greater in 2012 than in 2008 (88.3% vs 49.3%). Non-compliance was highest for advertisements screened on children's/youth channels (92.3% vs. 81.5%; P < 0.001) and for those aired outside the enhanced protection time slot (89.3% vs. 86%; P = 0.015). Non-compliance with the PAOS Code is higher than for 2008. Given the lack of effectiveness of self-regulation, a statutory system should be adopted to ban AFD directed at minors, or at least restrict it to healthy products. Copyright © 2017 The Royal Society for Public Health. Published by Elsevier Ltd. All rights reserved.
Zhou, Bao-Chun; Liu, Li-Jun; Liu, Bing
2016-09-01
Although hyperbaric oxygen (HBO) therapy can promote the recovery of neural function in patients who have suffered traumatic brain injury (TBI), the underlying mechanism is unclear. We hypothesized that hyperbaric oxygen treatment plays a neuroprotective role in TBI by increasing regional transcranial oxygen saturation (rSO 2 ) and oxygen partial pressure (PaO 2 ). To test this idea, we compared two groups: a control group with 20 healthy people and a treatment group with 40 TBI patients. The 40 patients were given 100% oxygen of HBO for 90 minutes. Changes in rSO 2 were measured. The controls were also examined for rSO 2 and PaO 2 , but received no treatment. rSO 2 levels in the patients did not differ significantly after treatment, but levels before and after treatment were significantly lower than those in the control group. PaO 2 levels were significantly decreased after the 30-minute HBO treatment. Our findings suggest that there is a disorder of oxygen metabolism in patients with sub-acute TBI. HBO does not immediately affect cerebral oxygen metabolism, and the underlying mechanism still needs to be studied in depth.
[Pulmonary function in patients with focal pulmonary tuberculosis].
Nefedov, V B; Popova, L A; Shergina, E A
2008-01-01
Vital capacity (VC), forced vital capacity (FVC), forced expiratory volume in 1 second (FEV1), FEV1/VC%, PEF, MEF25, MEF50, MEF75, TLC, TGV, pulmonary residual volume (PRV), Raw, Rin, Rcx, DLCO-SB, DLCO-SS/VA, PaO2, and PaCO2 were determined in 40 patients with focal pulmonary tuberculosis. Changes were found in lung volumes and capacities in 75%, impaired bronchial patency and pulmonary gas exchange dysfunction were in 57.5 and 25%, respectively. The lung volume and capacity changes appeared mainly as increased TGV and PRV; impaired bronchial patency presented as decreased MEF50, MEF75, and FEV1/VC%; pulmonary gas exchange dysfunction manifested itself as reduced DLCO-SB, PaO2, and PaCO2. The magnitude of the observed functional changes was generally slight. TGV and PRL increased up to 148-187 and 142-223% of the normal values, respectively; MEF50, MEF75, FEV1/VC%, and DLCO decreased to 59-24, 58-26, 78-57, and 78-67% of the normal values and PaO2 and PaCO2 did to 79-69 and 34-30 cm Hg.
ORF Alignment: NC_002516 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available udomonas ... aeruginosa (strain PAO1) ... Length = 137 ... Query: 1 ... MKIIILGAGQVGGTLAEHLASEAN...DIXXXXXXXXXXXXXXXXXXIRTVQGKASFPTVLRQ 60 ... MKIIILGAGQVGGTLAEHLASEANDI ... ... ... IRTVQGKASFPTVLRQ Sbjct: 1 ... MKIIILGAGQVGGTLAEHLASEANDITVVDTDGDRLRDLGDRLDIRTVQGKASFPTVLRQ 60 ... Quer
ORF Alignment: NC_002516 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available ruginosa (strain PAO1) ... Length = 261 ... Query: 19 ... FDWVRFQRRDLLLIDHPLCQAV...FSRQGAQLLHFQPQGERPLLWCASEWPALSSAPVRGGI 78 ... FDWVRFQRRDLLLIDHPLCQAVFSRQGAQLLHFQPQGERPLLWCASEWPALSSAP...VRGGI Sbjct: 1 ... FDWVRFQRRDLLLIDHPLCQAVFSRQGAQLLHFQPQGERPLLWCASEWPALSSAPVRGGI 60 ... Query: 139 RLELELCSYHEEDDD
Selections from the Peiping TA KUNG PAO - Communist China
National Research Council Canada - National Science Library
1961-01-01
.... The articles contains topics such as the processing of tobacco, tea, cotton and flax, agricultural products, transportation production, textile industries, grain storage, weather forecasts, fishing...
Clavieras, Noémie; Wysocki, Marc; Coisel, Yannael; Galia, Fabrice; Conseil, Matthieu; Chanques, Gerald; Jung, Boris; Arnal, Jean-Michel; Matecki, Stefan; Molinari, Nicolas; Jaber, Samir
2013-09-01
Intellivent is a new full closed-loop controlled ventilation that automatically adjusts both ventilation and oxygenation parameters. The authors compared gas exchange and breathing pattern variability of Intellivent and pressure support ventilation (PSV). In a prospective, randomized, single-blind design crossover study, 14 patients were ventilated during the weaning phase, with Intellivent or PSV, for two periods of 24 h in a randomized order. Arterial blood gases were obtained after 1, 8, 16, and 24 h with each mode. Ventilatory parameters were recorded continuously in a breath-by-breath basis during the two study periods. The primary endpoint was oxygenation, estimated by the calculation of the difference between the PaO2/FIO2 ratio obtained after 24 h of ventilation and the PaO2/FIO2 ratio obtained at baseline in each mode. The variability in the ventilatory parameters was also evaluated by the coefficient of variation (SD to mean ratio). There were no adverse events or safety issues requiring premature interruption of both modes. The PaO2/FIO2 (mean ± SD) ratio improved significantly from 245 ± 75 at baseline to 294 ± 123 (P = 0.03) after 24 h of Intellivent. The coefficient of variation of inspiratory pressure and positive end-expiratory pressure (median [interquartile range]) were significantly higher with Intellivent, 16 [11-21] and 15 [7-23]%, compared with 6 [5-7] and 7 [5-10]% in PSV. Inspiratory pressure, positive end-expiratory pressure, and FIO2 changes were adjusted significantly more often with Intellivent compared with PSV. Compared with PSV, Intellivent during a 24-h period improved the PaO2/FIO2 ratio in parallel with more variability in the ventilatory support and more changes in ventilation settings.
Directory of Open Access Journals (Sweden)
Clara L Oeste
2011-01-01
Full Text Available Ras proteins are crucial players in differentiation and oncogenesis and constitute important drug targets. The localization and activity of Ras proteins are highly dependent on posttranslational modifications at their C-termini. In addition to an isoprenylated cysteine, H-Ras, but not other Ras proteins, possesses two cysteine residues (C181 and C184 in the C-terminal hypervariable domain that act as palmitoylation sites in cells. Cyclopentenone prostaglandins (cyPG are reactive lipidic mediators that covalently bind to H-Ras and activate H-Ras dependent pathways. Dienone cyPG, such as 15-deoxy-Δ(12,14-PGJ(2 (15d-PGJ(2 and Δ(12-PGJ(2 selectively bind to the H-Ras hypervariable domain. Here we show that these cyPG bind simultaneously C181 and C184 of H-Ras, thus potentially altering the conformational tendencies of the hypervariable domain. Based on these results, we have explored the capacity of several bifunctional cysteine reactive small molecules to bind to the hypervariable domain of H-Ras proteins. Interestingly, phenylarsine oxide (PAO, a widely used tyrosine phosphatase inhibitor, and dibromobimane, a cross-linking agent used for cysteine mapping, effectively bind H-Ras hypervariable domain. The interaction of PAO with H-Ras takes place in vitro and in cells and blocks modification of H-Ras by 15d-PGJ(2. Moreover, PAO treatment selectively alters H-Ras membrane partition and the pattern of H-Ras activation in cells, from the plasma membrane to endomembranes. These results identify H-Ras as a novel target for PAO. More importantly, these observations reveal that small molecules or reactive intermediates interacting with spatially vicinal cysteines induce intramolecular cross-linking of H-Ras C-terminus potentially contributing to the modulation of Ras-dependent pathways.
Khemani, Robinder G; Sward, Katherine; Morris, Alan; Dean, J Michael; Newth, Christopher J L
2011-11-01
Although pediatric intensivists claim to embrace lung protective ventilation for acute lung injury (ALI), ventilator management is variable. We describe ventilator changes clinicians made for children with hypoxemic respiratory failure, and evaluate the potential acceptability of a pediatric ventilation protocol. This was a retrospective cohort study performed in a tertiary care pediatric intensive care unit (PICU). The study period was from January 2000 to July 2007. We included mechanically ventilated children with PaO(2)/FiO(2) (P/F) ratio less than 300. We assessed variability in ventilator management by evaluating actual changes to ventilator settings after an arterial blood gas (ABG). We evaluated the potential acceptability of a pediatric mechanical ventilation protocol we adapted from National Institutes of Health/National Heart, Lung, and Blood Institute (NIH/NHLBI) Acute Respiratory Distress Syndrome (ARDS) Network protocols by comparing actual practice changes in ventilator settings to changes that would have been recommended by the protocol. A total of 2,719 ABGs from 402 patients were associated with 6,017 ventilator settings. Clinicians infrequently decreased FiO(2), even when the PaO(2) was high (>68 mmHg). The protocol would have recommended more positive end expiratory pressure (PEEP) than was used in actual practice 42% of the time in the mid PaO(2) range (55-68 mmHg) and 67% of the time in the low PaO(2) range (ventilator rate (VR) when the protocol would have recommended a change, even when the pH was greater than 7.45 with PIP at least 35 cmH(2)O. There may be lost opportunities to minimize potentially injurious ventilator settings for children with ALI. A reproducible pediatric mechanical ventilation protocol could prompt clinicians to make ventilator changes that are consistent with lung protective ventilation.
How Useful is Extravascular Lung Water Measurement in Managing Lung Injury in Intensive Care Unit?
Bhattacharjee, Anirban; Pradhan, Debasis; Bhattacharyya, Prithwis; Dey, Samarjit; Chhunthang, Daniala; Handique, Akash; Barman, Angkita; Yunus, Mohd
2017-08-01
The primary goal of septic shock management is optimization of organ perfusion, often at the risk of overloading the interstitium and causing pulmonary edema. The conventionally used end points of resuscitation do not generally include volumetric parameters such as extravascular lung water index (EVLWI) and pulmonary vascular permeability index (PVPI). This study aimed to assess the prognostic value of EVLWI and PVPI by calculating their correlation with the severity of lung injury. This prospective observational study included twenty mechanically ventilated critically ill patients with Acute Physiology and Chronic Health Evaluation score (APACHE II) >20. EVLWI and PVPI were measured using transpulmonary thermodilution, and simultaneously, PaO 2 :FiO 2 ratio, alveolar-arterial gradient of oxygen (AaDO 2 ), and chest radiograph scores from two radiologists were obtained. The correlation of EVLWI and PVPI with chest radiograph scores, PaO 2 :FiO 2 ratio, and AaDO 2 were calculated. The inter-observer agreement between the two radiologists was tested using kappa test. EVLWI and PVPI correlated modestly with PaO 2 :FiO 2 ( r = -0.32, P = 0.0004; r = -0.39, P = 0.0001). There was a better correlation of EVLWI and PVPI with PaO 2 :FiO 2 ratio ( r = -0.71, P < 0.0001; r = -0.58, P = 0.0001) in the acute respiratory distress syndrome (ARDS) subgroup. The EVLWI values correlated significantly with corresponding chest radiograph scores ( r = 0.71, P < 0.0001 for observer 1 and r = 0.68, P < 0.0001 for observer 2). EVLWI and PVPI may have a prognostic significance in the assessment of lung injury in septic shock patients with ARDS. Further research is required to reveal the usefulness of EVLWI as an end point of fluid resuscitation in the management of septic shock with ARDS.
Directory of Open Access Journals (Sweden)
Wanchao Yang
Full Text Available Therapeutic hypercapnia has the potential for neuroprotection after global cerebral ischemia. Here we further investigated the effects of different degrees of acute systemic hypoxia in combination with hypercapnia on brain damage in a rat model of hypoxia and ischemia. Adult wistar rats underwent unilateral common carotid artery (CCA ligation for 60 min followed by ventilation with normoxic or systemic hypoxic gas containing 11%O2,13%O2,15%O2 and 18%O2 (targeted to PaO2 30-39 mmHg, 40-49 mmHg, 50-59 mmHg, and 60-69 mmHg, respectively or systemic hypoxic gas containing 8% carbon dioxide (targeted to PaCO2 60-80 mmHg for 180 min. The mean artery pressure (MAP, blood gas, and cerebral blood flow (CBF were evaluated. The cortical vascular permeability and brain edema were examined. The ipsilateral cortex damage and the percentage of hippocampal apoptotic neurons were evaluated by Nissl staining and terminal deoxynucleotidyl transferase-mediated 2'-deoxyuridine 5'-triphosphate-biotin nick end labeling (TUNEL assay as well as flow cytometry, respectively. Immunofluorescence and western blotting were performed to determine aquaporin-4 (AQP4 expression. In rats treated with severe hypoxia (PaO2 50 mmHg, hypercapnia protected against these pathophysiological changes. Moreover, hypercapnia treatment significantly reduced brain damage in the ischemic ipsilateral cortex and decreased the percentage of apoptotic neurons in the hippocampus after the CCA ligated rats were exposed to mild or moderate hypoxemia (PaO2 > 50 mmHg; especially under mild hypoxemia (PaO2 > 60 mmHg, hypercapnia significantly attenuated the expression of AQP4 protein with brain edema (p < 0.05. Hypercapnia exerts beneficial effects under mild to moderate hypoxemia and augments detrimental effects under severe hypoxemia on brain damage in a rat model of hypoxia-ischemia.
Directory of Open Access Journals (Sweden)
Wang Yin
2011-03-01
Full Text Available Abstract Background Enormous work has shown that polyamines are involved in a variety of physiological processes, but information is scarce on the potential of modifying disease response through genetic transformation of a polyamine biosynthetic gene. Results In the present work, an apple spermidine synthase gene (MdSPDS1 was introduced into sweet orange (Citrus sinensis Osbeck 'Anliucheng' via Agrobacterium-mediated transformation of embryogenic calluses. Two transgenic lines (TG4 and TG9 varied in the transgene expression and cellular endogenous polyamine contents. Pinprick inoculation demonstrated that the transgenic lines were less susceptible to Xanthomonas axonopodis pv. citri (Xac, the causal agent of citrus canker, than the wild type plants (WT. In addition, our data showed that upon Xac attack TG9 had significantly higher free spermine (Spm and polyamine oxidase (PAO activity when compared with the WT, concurrent with an apparent hypersensitive response and the accumulation of more H2O2. Pretreatment of TG9 leaves with guazatine acetate, an inhibitor of PAO, repressed PAO activity and reduced H2O2 accumulation, leading to more conspicuous disease symptoms than the controls when both were challenged with Xac. Moreover, mRNA levels of most of the defense-related genes involved in synthesis of pathogenesis-related protein and jasmonic acid were upregulated in TG9 than in the WT regardless of Xac infection. Conclusion Our results demonstrated that overexpression of the MdSPDS1 gene prominently lowered the sensitivity of the transgenic plants to canker. This may be, at least partially, correlated with the generation of more H2O2 due to increased production of polyamines and enhanced PAO-mediated catabolism, triggering hypersensitive response or activation of defense-related genes.
Energy Technology Data Exchange (ETDEWEB)
Lehmus, M.; Nissfolk, F.; Kulmala, K. [Fortum Oil and Gas Oyj / Base Oils, Fortum (Finland)
2002-01-01
Next to polyalphaolefines (PAOs base oils of the API/ATIEL Group IV), VHVI base oils (belonging to API/ATIEL Group III) are being increasingly used in high-performance automotive and industrial lubricants. A comparative study of the properties of VHVI base oils and polyalphaolefins shows that high-quality VHVI base oils have comparable volatility, oxidation stability and viscosity indices to polyalphaolefins, whereas the most pronounced differences are viscometric properties in the low-temperature range. However, there are noticeable differences between different market-typical VHVI base oils, depending primarily on the manufacturing process. The differences in the physicochemical properties of PAOs and various VHVI base oils are attributable to differences in the typical molecular composition. This is illustrated by a compositional analysis of several VHVI base oils, in which the (iso)paraffin content and the content of different naphthenic and aromatic compounds is analyzed. The base oil influence on specific properties of formulated lubricants is discussed on the basis of several examples, and studies conducted with passenger car engine oils (PCMOs), heavy-duty engine oils (HDEOs) and gear oils are described in detail. As a result of extremely low CCS viscosities, PAOs are optimally suited for use in 0W-X PCMOs whereas 5W-X PCMOs meeting highest performance requirements can also be formulated with high-quality VHVI base oils. Emission measurements with HDEOs formulated with either SN mineral base oil or VHVI base oil demonstrated that the base oil type affects tailpipe particle emissions in the particle size range <5 {mu}m as replacement of SN mineral base oil with VHVI base oil resulted in lower particle emissions. Test stand measurements with gear oils formulated with either VHVI base oils or PAOs yielded comparable results in terms of power transfer ratio and oil temperature increase. (orig.)
Caironi, Pietro; Carlesso, Eleonora; Cressoni, Massimo; Chiumello, Davide; Moerer, Onner; Chiurazzi, Chiara; Brioni, Matteo; Bottino, Nicola; Lazzerini, Marco; Bugedo, Guillermo; Quintel, Michael; Ranieri, V Marco; Gattinoni, Luciano
2015-04-01
The Berlin definition of acute respiratory distress syndrome has introduced three classes of severity according to PaO2/FIO2 thresholds. The level of positive end-expiratory pressure applied may greatly affect PaO2/FIO2, thereby masking acute respiratory distress syndrome severity, which should reflect the underlying lung injury (lung edema and recruitability). We hypothesized that the assessment of acute respiratory distress syndrome severity at standardized low positive end-expiratory pressure may improve the association between the underlying lung injury, as detected by CT, and PaO2/FIO2-derived severity. Retrospective analysis. Four university hospitals (Italy, Germany, and Chile). One hundred forty-eight patients with acute lung injury or acute respiratory distress syndrome according to the American-European Consensus Conference criteria. Patients underwent a three-step ventilator protocol (at clinical, 5 cm H2O, or 15 cm H2O positive end-expiratory pressure). Whole-lung CT scans were obtained at 5 and 45 cm H2O airway pressure. Nine patients did not fulfill acute respiratory distress syndrome criteria of the novel Berlin definition. Patients were then classified according to PaO2/FIO2 assessed at clinical, 5 cm H2O, or 15 cm H2O positive end-expiratory pressure. At clinical positive end-expiratory pressure (11±3 cm H2O), patients with severe acute respiratory distress syndrome had a greater lung tissue weight and recruitability than patients with mild or moderate acute respiratory distress syndrome (pBerlin definition of acute respiratory distress syndrome assessed at 5 cm H2O allows a better evaluation of lung recruitability and edema than at higher positive end-expiratory pressure clinically set.
Yağlıoğlu, Hatice; Köksal, Güniz Meyancı; Erbabacan, Emre; Ekici, Birsel
2015-08-01
The aim of our study is to investigate the effect of two different methods of continuous positive airway pressure (CPAP) and bilevel positive airway pressure (BIPAP) and oxygen support under spontaneous ventilation on respiration mechanics, gas exchange, dry mouth and face mask lesion during an early postoperative period in patients undergoing upper abdominal surgery. Eighty patients undergoing elective abdominal surgery with laparotomy, between the age of 25 and 75 years and American Society of Anesthesiologists Physical Status score (ASA) II-III with chronic obstructive pulmonary disease (COPD) diagnosis were included to the study. Subjects were randomly allocated in to four groups. During the first postoperative hour, the first group received BIPAP, second group received high-flow CPAP, third group received low-flow CPAP and fourth group received deep breathing exercises, respiratory physiotherapy and O2 therapy. Preoperative, postoperative before and after treatment PaO2, PaCO2, SpO2, tidal volume (TV), respiratory rate (RR) levels were recorded. Subjects with dry mouth or face mask lesion were recorded. In all groups, PaO2 and TV measurements were higher at the postoperative first hour than the postoperative zero hour. We found that low-flow CPAP increased PaO2 and SpO2 values more, and TV levels were higher in the postoperative period than the preoperative period. PaCO2 levels were elevated at the zero hour postoperatively and at the end of the first hour; they decreased approximately to preoperative values, except in the fourth group. Administration of prophylactic respiratory support can prevent the deterioration of pulmonary functions and hypoxia in patients with COPD undergoing upper abdominal surgery. In addition, we found that low-flow CPAP had better effects on PaO2, SpO2, TV compared to other techniques.
Feasibility and safety of fiber optic micro-imaging in canine peripheral airways.
Directory of Open Access Journals (Sweden)
Yijun Liu
Full Text Available PURPOSE: To assess the feasibility and safety of imaging canine peripheral airways (0.05. Comparing pre-manipulation and post-manipulation values, SpO2 (F = 13.06, P<0.05 and PaO2 (F = 3.01, P = 0.01 were decreased, whereas RR (F = 3.85, P<0.05 was elevated during the manipulation. (3 Self-limited bleeding was observed in one dog; severe bleeding or other complications did not occur. CONCLUSION: Although the new apparatus had little effect on SpO2, PaO2 and RR, it can probe into small peripheral airways (<1 mm, which may provide a new platform for the early diagnosis of bronchiolar diseases.
Miles, Lachlan F; Bailey, Michael; Young, Paul; Pilcher, David V
2012-03-01
To define the relationship between worsening oxygenation status (worst PaO(2)/FiO(2) ratio in the first 24 hours after intensive care unit admission) and mortality in immunosuppressed and immunocompetent ICU patients in the presence and absence of mechanical ventilation. Retrospective cohort study. Data were extracted from the Australian and New Zealand Intensive Care Society Adult Patient Database. Adult patients admitted to 129 ICUs in Australasia, 2000-2010. In hospital and ICU mortality; relationship between mortality and declining PaO(2)/FiO(2) ratio by ventilation status and immune status. 457 750 patient records were analysed. Worsening oxygenation status was associated with increasing mortality in all groups. Higher mortality was seen in immunosuppressed patients than immunocompetent patients. After multivariate analysis, in mechanically ventilated patients, declining PaO(2)/FiO(2) ratio in the first 24 hours of ICU admission was associated with a more rapidly rising mortality rate in immunosuppressed patients than non-immunosuppressed patients. Immunosuppression did not affect the relationship between oxygenation status and mortality in non-ventilated patients. Immunosuppression increases the risk of mortality with progressively worsening oxygenation status, but only in the presence of mechanical ventilation. Further research into the impact of mechanical ventilation in immunosuppressed patients is required.
Directory of Open Access Journals (Sweden)
Benoit Wallaert
2012-01-01
Full Text Available In patients with fibrotic idiopathic interstitial pneumonia (f-IIP, the diffusing capacity for carbon monoxide (DLCO has been used to predict abnormal gas exchange in the lung. However, abnormal values for arterial blood gases during exercise are likely to be the most sensitive manifestations of lung disease. The aim of this study was to compare DLCO, resting PaO2, P(A-aO2 at cardiopulmonary exercise testing peak, and oxygen desaturation during a 6-min walk test (6MWT. Results were obtained in 121 patients with idiopathic pulmonary fibrosis (IPF, n=88 and fibrotic nonspecific interstitial pneumonias (NSIP, n=33. All but 3 patients (97.5% had low DLCO values (35 mmHg and 100 (83% demonstrated significant oxygen desaturation during 6MWT (>4%. Interestingly 27 patients had low DLCO and normal P(A-aO2, peak and/or no desaturation during the 6MWT. The 3 patients with normal DLCO also had normal PaO2, normal P(A-aO2, peak, and normal oxygen saturation during 6MWT. Our results demonstrate that in fibrotic IIP, DLCO better defines impairment of pulmonary gas exchange than resting PaO2, exercise P(A-aO2, peak, or 6MWT SpO2.
Directory of Open Access Journals (Sweden)
Sérgio Leite Rodrigues
2008-11-01
Full Text Available Resumo: Introdução: A capacidade de exercÃcio em portadores de DPOC depende da gravidade da limitação ao fluxo aéreo, do grau de hipoxemia e da função muscular esquelética. Nesses doentes, a atrofia e a fraqueza da musculatura periférica são consideradas consequências sistémicas da DPOC e estão associadas à redução da capacidade de exercÃcio.Objectivos: Investigar a possÃvel correlação entre hipoxemia moderada e o comprometimento muscular periférico na DPOC.Doentes e métodos: Dez doentes encaminhados ao Programa de Reabilitação Pulmonar do Hospital Universitário de BrasÃlia foram incluÃdos neste estudo. A função pulmonar foi avaliada por espirometria, gasometria arterial e avaliação funcional pelo teste de caminhada de seis minutos, sinal electromiográfico e força de deltóide e quadricÃpetes.Resultados: As correlações entre PaO2 e a força quadricÃptica (r2=0,61 e p=0,007 e a distância percorrida no TC6 (r2=0,96 e p=0,001 foram positivas e significativas. Houve correlação negativa e significativa entre PaO2 e a frequência mediana de quadricÃpetes (r2=-0,42 e p=0,04. Observámos também correlação significativa entre força de quadricÃpetes e o TC6 (r2=0,67 e p=0,001. Assim como houve correlação negativa e significativa entre a frequência mediana de quadricÃpetes, e o TC6 (r2=-0,42 e p=0,04. Não encontrámos correlação significativa entre a PaO2 e força ou frequência mediana do músculo deltóide.Conclusão: A PaO2 tem correlação importante e significativa com variáveis de função muscular periférica. A hipoxemia moderada e a disfunção muscular periférica precoce possuem como principal impacto negativo a deterioração da capacidade funcional de portadores de DPOC.Rev Port Pneumol 2008; XIV (6: 769-785 Abstract: Rationale: Exercise
EARLY STAGE OF THE CENTRAL ASIAN OROGENIC BELT BUILDING: EVIDENCES FROM THE SOUTHERN SIBERIAN CRATON
Directory of Open Access Journals (Sweden)
D. P. Gladkochub
2017-01-01
Full Text Available The origin of the Central-Asian Orogenic Belt (CAOB, especially of its northern segment nearby the southern margin of the Siberian craton (SC is directly related to development and closure of the Paleo-Asian Ocean (PAO. Signatures of early stages of the PAO evolution are recorded in the Late Precambrian sedimentary successions of the Sayan-Baikal-Patom Belt (SBPB on the southern edge of SC. These successions are spread over 2000 km and can be traced along this edge from north-west (Sayan area to south-east (Baikal area and further to north-east (Patom area. Here we present the synthesis of all available and reliable LA-ICP-MS U-Pb geochronological studies of detrital zircons from these sedimentary successions.
Pregnancy associated osteoporosis--a case report.
Dytfeld, Joanna; Horst-Sikorska, Wanda
2012-05-01
Loss of bone mineral density (BMD)--usually temporary--occurs during pregnancy and lactation. Pregnancy associated osteoporosis (PAO) is an uncommon disease of unknown etiology. We present a case of a 35-year old woman with PAO, manifesting initially at the end of the first pregnancy as back pain. It reappeared in the second pregnancy four years later X-ray revealed multilevel compression fractures of Th12, L1, L2. DEXA showed L2-L4 T-score: -3.3 SD, hip T-score: -2.09 SD. Laboratory findings were irrelevant. She was put on antiresorptive treatment, calcium and vitamin D. Although there has been an improvement in BMD, the patient is a definite candidate for vertebral kyphoplasty due to disabling pain.
2008-01-01
Täiusliku massaazhisüsteemiga hüdromassaazhivann Pacific (disainer Matti Õunapuu), SolidSurface materjalist disainvann Pao (disainer Matti Õunapuu), dushikabiin Visio (disainer Aivar Habakukk), nurgavann Linea (disainer Aivar Habakukk)
2013-08-29
... Pao, General Deputy Assistant Secretary for Policy Development and Research. Attachment List of... University of Utah at Salt Lake City, Ms. Shauna Peterson, 1471 East Federal Way, Salt Lake City, UT. Grant...
Directory of Open Access Journals (Sweden)
Fohad Mabood Husain
2015-01-01
Full Text Available Trigonella foenum-graecum L. (Fenugreek is an important plant of the Leguminosae family known to have medicinal properties. However, fraction based antiquorum sensing and antibiofilm activities have not been reported from this plant. In the present study T. foenum-graecum seed extract was sequentially fractionated and sub-MICs were tested for above activities. The methanol fraction of the extract demonstrated significant inhibition of AHL regulated virulence factors: protease, LasB elastase, pyocyanin production, chitinase, EPS, and swarming motility in Pseudomonas aeruginosa PAO1 and PAF79. Further, QS dependent virulence factor in the aquatic pathogen Aeromonas hydrophila WAF38 was also reduced. Application of T. foenum-graecum seed extract to PAO1, PAF79, and WAF38 decreased the biofilm forming abilities of the pathogens by significant levels. The extract also exhibited reduced AHL levels and subsequent downregulation of lasB gene. In vivo study showed an enhanced survival of PAO1-preinfected C. elegans after treatment with extract at 1 mg/mL. Further, the major compound detected by GC-MS, caffeine, reduced the production of QS regulated virulence factors and biofilm at 200 µg/mL concentration indicating its role in the activity of the methanol extract. The results of the present study reveal the potential anti-QS and antibiofilm property of T. foenum-graceum extract and caffeine.
Directory of Open Access Journals (Sweden)
Emre Ayintap
2014-01-01
Full Text Available Purpose. To investigate the changes of partial oxygen pressure (PaO2 in aqueous humour after injecting air or oxygen bubble into the anterior chamber in sickle cell hyphema. Methods. Blood samples were taken from the same patient with sickle cell disease. Thirty-two rabbits were divided into 4 groups. In group 1 (n=8, there was no injection. Only blood injection constituted group 2 (n=8, both blood and air bubble injection constituted group 3 (n=8, and both blood and oxygen bubble injection constituted group 4 (n=8. Results. The PaO2 in the aqueous humour after 10 hours from the injections was 78.45 ± 9.9 mmHg (Mean ± SD for group 1, 73.97 ± 8.86 mmHg for group 2, 123.35 ± 13.6 mmHg for group 3, and 306.47 ± 16.5 mmHg for group 4. There was statistically significant difference between group 1 and group 2, when compared with group 3 and group 4. Conclusions. PaO2 in aqueous humour was increased after injecting air or oxygen bubble into the anterior chamber. We offer to leave an air bubble in the anterior chamber of patients with sickle cell hemoglobinopathies and hyphema undergoing an anterior chamber washout.
Park, Yongjin; Yoon, Sang Sun
2011-01-01
Pseudomonas aeruginosa, a gram-negative bacterium of clinical importance, forms more robust biofilm during anaerobic respiration, a mode of growth presumed to occur in abnormally thickened mucus layer lining the cystic fibrosis (CF) patient airway. However, molecular basis behind this anaerobiosis-triggered robust biofilm formation is not clearly defined yet. Here, we identified a morphological change naturally accompanied by anaerobic respiration in P. aeruginosa and investigated its effect on the biofilm formation in vitro. A standard laboratory strain, PAO1 was highly elongated during anaerobic respiration compared with bacteria grown aerobically. Microscopic analysis demonstrated that cell elongation likely occurred as a consequence of defective cell division. Cell elongation was dependent on the presence of nitrite reductase (NIR) that reduces nitrite (NO2 −) to nitric oxide (NO) and was repressed in PAO1 in the presence of carboxy-PTIO, a NO antagonist, demonstrating that cell elongation involves a process to respond to NO, a spontaneous byproduct of the anaerobic respiration. Importantly, the non-elongated NIR-deficient mutant failed to form biofilm, while a mutant of nitrate reductase (NAR) and wild type PAO1, both of which were highly elongated, formed robust biofilm. Taken together, our data reveal a role of previously undescribed cell biological event in P. aeruginosa biofilm formation and suggest NIR as a key player involved in such process. PMID:21267455
Ge, R L; Shai, H R; Takeoka, M; Hanaoka, M; Koizumi, T; Matsuzawa, Y; Kubo, K; Kobayashi, T
2001-01-01
Individuals with chronic mountain sickness (CMS) show severe hypoxemia, excessive polycythemia, and marked pulmonary hypertension. The pathophysiologic mechanisms of CMS are still not completely understood. We determined plasma atrial natriuretic peptide (ANP), red cell 2,3-diphosphoglycerate (2,3-DPG), hematocrit, hemoglobin, and arterialized ear lobe blood gas values in 13 patients with CMS (9 Hans, 4 Tibetans) and 18 control Han Chinese men of similar age, height, and weight who had been living at 4300 m on the Tibetan plateau of Qinghai Province, China, for approximately 14 years. A significantly higher level of ANP was found in the CMS patients compared to the non-CMS patients (113.4+/-5.5 pg/mL vs 87.6+/-4.7 pg/mL, P levels of ANP correlated positively with the hemoglobin concentration (r = 0.8282, P levels in the CMS patients were significantly increased compared to the non-CMS subjects (5.23+/-0.16 mmol/L vs 4.40+/-0.12 mmol/L, P levels, lower pH values, lower PaO2 levels, and greater alveolar-arterial oxygen differences (PAO2 - PaO2) compared to the non-CMS subjects. These findings suggest that overproduction of ANP and 2,3-DPG at high altitudes may play an important role in the pathophysiology of chronic mountain sickness.
Usefulness of 99mTc-ECD SPECT in diseases of central nerve system
International Nuclear Information System (INIS)
Ono, Shimato; Yanagimoto, Shinichi; Mimura, Hiroaki
1992-01-01
The usefulness of a new cerebral perfusion imaging radiopharmaceutical, 99m Tc-ethyl cysteinate dimer (ECD), was clinically evaluated. The subjects of this study were 14 patients with neurological disorders including 10 patients with cerebral infarction and 4 patients with other diseases. A total of 15 examinations was performed. 99m Tc-hexamethylpropyleneamine oxime ( 99m Tc-HM-PAO) or 123 I-N-isopropyl-p-iodoamphetamine ( 123 I-IMP) SPECTs were performed simultaneously, and the findings from those examinations were compared with 99m Tc-ECD. As to the count ratio of lesions to normal area (L/N), the L/N ratio in severe ischemic patients was lower in 99m Tc-ECD than in 99m Tc-HM-PAO or 123 I-IMP. In mild ischemic patients, on the other hand, the L/N ratio was the lowest in 123 I-IMP. When the relationship between regional cerebral blood flows (rCBFs) obtained from 123 I-IMP and the values of L/N in 99m Tc-ECD or 99m Tc-HM-PAO was compared, the values of L/N in 99m Tc-ECD or 99m Tc-HM-PAO were found to have decreased linearity with increasing rCBF. In a patient showing luxury perfusion, the accumulation pattern of 99m Tc-ECD was different from that of the other two radiopharmaceuticals, and focal defect was revealed in 99m Tc-ECD SPECT. On the dynamic SPECT of 99m Tc-ECD in a patient with meningioma, the tumor showed a change from high to low perfusion with the passage of time. This finding indicated that care should be taken in the evaluation of accumulation of 99m Tc-ECD. Therefore, 99m Tc-ECD was found to be useful as a cerebral perfusion agent. In addition, as accumulation of 99m Tc-ECD might somehow reflect metabolism in some cases, further careful investigation of many cases should be carried out. (author)
Directory of Open Access Journals (Sweden)
Xiao-Jing Li
2017-04-01
Full Text Available Objective: To observe the influence of ganglioside on the blood gas analysis and serum levels of inflammatory cytokines in newborns with anoxic ischemic encephalopathy. Method: A total of 100 newborns with anoxic ischemic encephalopathy in our hospital were selected and randomly divided into 2 groups: the control group and the observation group. Conventional oxygen inhalation, reducing intracranial pressure, controlling eclampsia and neurotrophic drug treatment were given to the observation group. Treatment of ganglioside was given to the control group on the basis of observation group. Blood gas analysis and serum levels of inflammatory cytokines were detected before treatment (T0, 3 d after treatment (T1, and 7 d after treatment (T2. Result: (1 The comparison of pH, PaO2, PaCO2, SaO2 in the two groups in T0 was not statistically significant. The comparison of pH, PaO2, PaCO2, SaO2 in T0, T1, T2 was considered to be statistically significant. Among these, the result of comparision of pH, PaO2, SaO2: T0<T1<T2. comparision of PaCO2: T0>T1>T2. The pH, PaO2, SaO2 in observation group were higher, PaCO2 in observation group was lower compared with that in control group in T1 and T2. The difference was considered to be statistically significant. (2 The comparision of IL-2, IL-6, hs-CRP, TNF-α in the two groups in T0 was not statistically significant. IL-2 in the observation in T1 and T2 was higher than that in the control group, IL-6, hs-CRP, TNF-α in the observation in T1 and T2 was lower than that in the control group. The difference was considered to be statistically significant. Conclusion: Ganglioside can improve blood gas analysis indexes, decrease the serum inflammatory cytokines in newborns with anoxic ischemic encephalopathy.
Biological nitrogen and phosphorus removal by filamentous bacteria ...
African Journals Online (AJOL)
the intracellular denitrification intermediates inhibit the aero- bic cytochrome o of ... using an auto-analyzer (Technicon Auto Analyzer AAII, Der- motech South ..... PAO's and deni- trifiers in situ collectively, and using novel molecular techniques.
The generation of river alimentation in response to precipitation : a soil physical approach
Wind, G.P.; Vandenberg, A.
1983-01-01
River alimentation can be simulated with the aid of models developed by agricultural hydrologists. One dimensional models with a Fourrier boundary condition are the most appropriote. Chapter of PAO-course Real-time River Flow
FRAM telescope - monitoring of atmospheric extinction and variable star photometry
Jurysek, J.; Honkova, K.; Masek, M.
2015-02-01
The FRAM (F/(Ph)otometric Robotic Atmospheric Monitor) telescope is a part of the Pierre Auger Observatory (PAO) located near town Malargüe in Argentina. The main task of the FRAM telescope is the continuous night - time monitoring of the atmospheric extinction and its wavelength dependence. The current methodology of the measurement of a atmospheric extinction and for instrumentation properties also allows simultaneous observation of other interesting astronomical targets. The current observations of the FRAM telescope are focused on the photometry of eclipsing binaries, positional refinement of minor bodies of the Solar system and observations of optical counterparts of gamma ray bursts. In this contribution, we briefly describe the main purpose of the FRAM telescope for the PAO and we also present its current astrono mical observing program.
Asthma and hemoglobinopathy: when is supplemental oxygen required?
Joseph, Leon; Brickner-Braun, Inbal; Pinshow, Berry; Goldberg, Shmuel; Miskin, Hagit; Picard, Elie
2013-10-01
Asthma is the most common reason for referral to the emergency department in childhood. In severe attacks, supplemental O2 is given when oxygen saturation level is asthma attack. Simultaneously, P(a)O2 was normal. A diagnosis of abnormal hemoglobin with decreased oxygen affinity (hemoglobin Seattle) was made on hemoglobin electrophoresis and genetic analysis. To ascertain when supplemental oxygen was needed, an oxygen dissociation curve was plotted using the tonometer technique, and it was found that an S(p)O2 of 70% is parallel to a P(a)O2 of 60 mmHg. Plotting an oxygen dissociation curve is a simple reproducible method to determine when supplemental oxygen is required for a child with a hemoglobinopathy. © 2013 The Authors. Pediatrics International © 2013 Japan Pediatric Society.
Directory of Open Access Journals (Sweden)
Cédric Tarayre
2016-05-01
Full Text Available Phosphate minerals have long been used for the production of phosphorus-based chemicals used in many economic sectors. However, these resources are not renewable and the natural phosphate stocks are decreasing. In this context, the research of new phosphate sources has become necessary. Many types of wastes contain non-negligible phosphate concentrations, such as wastewater. In wastewater treatment plants, phosphorus is eliminated by physicochemical and/or biological techniques. In this latter case, a specific microbiota, phosphate accumulating organisms (PAOs, accumulates phosphate as polyphosphate. This molecule can be considered as an alternative phosphate source, and is directly extracted from wastewater generated by human activities. This review focuses on the techniques which can be applied to enrich and try to isolate these PAOs, and to detect the presence of polyphosphate in microbial cells.
Eesti tahab Aasia paisuvast pirukast oma osa haugata / Adele Pao
Pao, Adele
2011-01-01
Majandus- ja kommunikatsiooniministeeriumis on valmimas programm, mille sihiks on suurendada eksporti Aasia riikidesse ja suurendada Eesti atraktiivsust sealsete investorite silmis. Arengufond töötab Eesti ja India majandusssuhete kallal, Kaubandus-Tööstuskoda püüab Hiina turu suhtes leida ühist keelt Rootsi ja Soome partneritega. Diagramm: Aasia riikide kasvuootused Europast suuremad
Directory of Open Access Journals (Sweden)
Sérgio Leite Rodrigues
2008-11-01
Full Text Available Rationale: Exercise capacity in COPD patients depends on the degree of airflow obstruction, the severity of the hypoxaemia and skeletal muscle function. Muscle atrophy and weakness are considered systemic consequences of COPD and are associated with reduced exercise capacity. Aims: To investigate the correlation between mild hypoxaemia and muscular strength, muscular fatigue and functional capacity in COPD patients. Methods: Ten patients enrolled on a PRP at the Hospital Universitário de BrasÃlia â HUB were included in this study. Lung function was evaluated by spirometry and arterial blood gas analysis. Functional evaluation was made using the 6MWT and using isometric contraction of deltoid and quadriceps muscles. Results: There were positive correlations between PaO2, quadriceps strength (r2 = 0.61 and p = 0.007 and PaO2 and the 6MWT (r2 = 0.96, p = 0.001. There were negative correlations between PaO2 and median frequency of quadriceps (r2 = -0.42 and p = 0.04. We observed significant correlation between quadriceps strength and the 6MWT (r2 = 0.67 and p = 0.001. There was negative correlation between median frequency of quadriceps and the 6MWT (r2 = -0.42 and p = 0.04. We did not observe any correlation between PaO2 and strength or median frequency of deltoid muscle. Conclusions: PaO2 has important correlations with muscular function variables. The main negative impact of mild hypoxaemia and precocious limb muscular disability on COPD patients is decreased functional capacity. Resumo: Introdução: A capacidade de exercÃcio em portadores de DPOC depende da gravidade da limitação ao fluxo aéreo, do grau de hipoxemia e da função muscular esquelética. Nesses doentes, a atrofia e a fraqueza da musculatura periférica são consideradas consequências sistémicas da DPOC e estão associadas à redução da capacidade de exercÃcio. Objectivos
DEFF Research Database (Denmark)
Onnis-Hayden, Annalisa; Majed, Nehreen; Schramm, Andreas
2011-01-01
This study investigated the abundance and distribution of key functional microbial populations and their activities in a full-scale integrated fixed film activated sludgeeenhanced biological phosphorus removal (IFAS-EBPR) process. Polyphosphate accumulating organisms (PAOs) including Accumulibacter...
Inhibitors of polyamine metabolism: review article.
Wallace, H M; Fraser, A V
2004-07-01
The identification of increased polyamine concentrations in a variety of diseases from cancer and psoriasis to parasitic infections has led to the hypothesis that manipulation of polyamine metabolism is a realistic target for therapeutic or preventative intervention in the treatment of certain diseases. The early development of polyamine biosynthetic single enzyme inhibitors such as alpha-difluoromethylornithine (DFMO) and methylglyoxal bis(guanylhydrazone) showed some interesting early promise as anticancer drugs, but ultimately failed in vivo. Despite this, DFMO is currently in use as an effective anti-parasitic agent and has recently also been shown to have further potential as a chemopreventative agent in colorectal cancer. The initial promise in vitro led to the development and testing of other potential inhibitors of the pathway namely the polyamine analogues. The analogues have met with greater success than the single enzyme inhibitors possibly due to their multiple targets. These include down regulation of polyamine biosynthesis through inhibition of ornithine decarboxylase and S-adenosylmethionine decarboxylase and decreased polyamine uptake. This coupled with increased activity of the catabolic enzymes, polyamine oxidase and spermidine/spermine N1-acetyltransferase, and increased polyamine export has made the analogues more effective in depleting polyamine pools. Recently, the identification of a new oxidase (PAO-h1/SMO) in polyamine catabolism and evidence of induction of both PAO and PAO-h1/SMO in response to polyamine analogue treatment, suggests the analogues may become an important part of future chemotherapeutic and/or chemopreventative regimens.
Plasma Orexin-A Levels in COPD Patients with Hypercapnic Respiratory Failure
Directory of Open Access Journals (Sweden)
Lin-Yun Zhu
2011-01-01
Full Text Available Orexins have previously been shown to promote wakefulness, regulate lipid metabolism and participate in energy homeostasis. The aim of the study was to determine the relationship between plasma orexin-A and body composition in COPD in-patients with hypercapnic respiratory failure. 40 patients with hypercapnic respiratory failure and 22 healthy individuals were enrolled prospectively in this study. Plasma orexin-A levels, BMI, SaO2, PaCO2 and PaO2 were noted for all the patients. Plasma orexin-A levels were higher in the underweight (UW group, normal weight (NW group and overweight (OW group of COPD patients as compared with UW, NW and OW group of the control group (P<.05. Plasma orexin-A in COPD patients were higher in the OW group than in the NW group and the UW group. Plasma orexin-A levels showed significant correlation with body mass index (BMI, independent of PaO2 (r=0.576; P<.05 and %fat (r=0.367; P<.05; a negative correlation was noted between plasma orexin-A levels and PaO2 (r=−0.738; P<.05 and SaO2 (r=−0.616; P<.05. Our results suggest that orexin-A levels are high in COPD patients with hypercapnic respiratory failure, and vary according to BMI and body composition. Orexin-A may be associated with the severity of hypoxemia in COPD patients with hypercapnic respiratory failure.
Effects of perfluorochemical distribution and elimination dynamics on cardiopulmonary function.
Miller, T F; Milestone, B; Stern, R; Shaffer, T H; Wolfson, M R
2001-03-01
Based on a physicochemical property profile, we tested the hypothesis that different perfluorochemical (PFC) liquids may have distinct effects on intrapulmonary PFC distribution, lung function, and PFC elimination kinetics during partial liquid ventilation (PLV). Young rabbits were studied in five groups [healthy, PLV with perflubron (PFB) or with perfluorodecalin (DEC); saline lavage injury and conventional mechanical ventilation (CMV); saline lavage injury PLV with PFB or with DEC]. Arterial blood chemistry, respiratory compliance (Cr), quantitative computed tomography of PFC distribution, and PFC loss rate were assessed for 4 h. Initial distribution of PFB was more homogenous than that of DEC; over time, PFB redistributed to dependent regions whereas DEC distribution was relatively constant. PFC loss rate decreased over time in all groups, was higher with DEC than PFB, and was lower with injury. In healthy animals, arterial PO(2) (Pa(O(2))) and Cr decreased with either PFC; the decrease was greater and sustained with DEC. Lavaged animals treated with either PFC demonstrated increased Pa(O(2)), which was sustained with PFB but deteriorated with DEC. Lavaged animals treated with PFB demonstrated increased Cr, higher Pa(O(2)), and lower arterial PCO(2) than with CMV or PLV with DEC. The results indicate that 1) initial distribution and subsequent intrapulmonary redistribution of PFC are related to PFC properties; 2) PFC distribution influences PFC elimination, gas exchange, and Cr; and 3) PFC elimination, gas exchange, and Cr are influenced by PFC properties and lung condition.
Directory of Open Access Journals (Sweden)
S. Mustafi
2015-01-01
Full Text Available Increasing resistance of Pseudomonas aeruginosa (P. aeruginosa to conventional treatments demands the search for novel therapeutic strategies. In this study, the antimicrobial activity of dehydroleucodine (DhL, a sesquiterpene lactone obtained from Artemisia (A. douglasiana, was screened against several pathogenic virulence effectors of P. aeruginosa. In vitro, minimum inhibitory concentration of DhL was determined against P. aeruginosa strains PAO1, PA103, PA14, and multidrug resistant clinical strain, CDN118. Results showed that DhL was active against each strain where PAO1 and PA103 showed higher susceptibility (MIC 0.48 mg/mL as compared to PA14 (MIC 0.96 mg/mL and CDN118 (MIC 0.98 mg/mL. Also, when PAO1 strain was grown in the presence of DhL (MIC50, 0.12 mg/mL, a delay in the generation time was noticed along with significant inhibition of secretory protease and elastase activities, interruption in biofilm attachment phase in a stationary culture, and a significant decline in Type III effector ExoS. At MIC50, DhL treatment increased the sensitivity of P. aeruginosa towards potent antibiotics. Furthermore, treatment of P. aeruginosa with DhL prevented toxin-induced apoptosis in macrophages. These observations suggest that DhL activity was at the bacterial transcriptional level. Hence, antimicrobial activity of DhL may serve as leads in the development of new anti-Pseudomonas pharmaceuticals.
Arterial blood gas reference values for sea level and an altitude of 1,400 meters.
Crapo, R O; Jensen, R L; Hegewald, M; Tashkin, D P
1999-11-01
Blood gas measurements were collected on healthy lifetime nonsmokers at sea level (n = 96) and at an altitude of 1,400 meters (n = 243) to establish reference equations. At each study site, arterial blood samples were analyzed in duplicate on two separate blood gas analyzers and CO-oximeters. Arterial blood gas variables included Pa(O(2)), Pa(CO(2)), pH, and calculated alveolar-arterial PO(2) difference (AaPO(2)). CO-oximeter variables were Hb, COHb, MetHb, and Sa(O(2)). Subjects were 18 to 81 yr of age with 166 male and 173 female. Outlier data were excluded from multiple regression analysis, and reference equations were fitted to the data in two ways: (1) best fit using linear, squared, and cross-product terms; (2) simple equations, including only the variables that explained at least 3% of the variance. Two sets of equations were created: (1) using only the sea level data and (2) using the combined data with barometric pressure as an independent variable. Comparisons with earlier studies revealed small but significant differences; the decline in Pa(O(2)) with age at each altitude was consistent with most previous studies. At sea level, the equation that included barometric pressure predicted Pa(O(2)) slightly better than the sea level specific equation. The inclusion of barometric pressure in the equations allows better prediction of blood gas reference values at sea level and at altitudes as high as 1,400 meters.
Spindelboeck, Walter; Schindler, Otmar; Moser, Adrian; Hausler, Florian; Wallner, Simon; Strasser, Christa; Haas, Josef; Gemes, Geza; Prause, Gerhard
2013-06-01
As recent clinical data suggest a harmful effect of arterial hyperoxia on patients after resuscitation from cardiac arrest (CA), we aimed to investigate this association during cardiopulmonary resuscitation (CPR), the earliest and one of the most crucial phases of recirculation. We analysed 1015 patients who from 2003 to 2010 underwent out-of-hospital CPR administered by emergency medical services serving 300,000 inhabitants. Inclusion criteria for further analysis were nontraumatic background of CA and patients >18 years of age. One hundred and forty-five arterial blood gas analyses including oxygen partial pressure (paO2) measurement were obtained during CPR. We observed a highly significant increase in hospital admission rates associated with increases in paO2 in steps of 100 mmHg (13.3 kPa). Subsequently, data were clustered according to previously described cutoffs (≤ 60 mmHg [8 kPa
Computed tomography and blood gas analysis of anesthetized bloodhounds with induced pneumothorax
International Nuclear Information System (INIS)
Walker, M.; Hartsfield, S.; Matthews, N.; White, G.; Slater, M.; Thoos, J.
1993-01-01
Increasingly severe degrees of pneumothorax were produced in 6 adult anesthetized bloodhounds. Computed tomography (CT) of the thorax was performed on each dog to evaluate the effects of pneumo thorax on thoracic and on pulmonary cross-sectional area (TA and PA). Arterial PO 2 (PaO 2 ) and PCO 2 (PaCO 2 ), heart rate (HR), and mean arterial blood pressure (MAP) were determined and related to the severity of pneumothorax. Volumes of air equal to 1, 1.5 and 2 times functional residual capacity of the lung produced approximately 33%, 40%, and 50% reductions in pulmonary area respectively. These amounts of atelectasis correspond to a radiographically “moderate” degree of pneumothorax. As severity of pneumothorax increased, thoracic area consistently increased, PaO 2 consistently decreased, and PaCO 2 consistently increased, with all being statistically significant relationships (p 0.2)
DEFF Research Database (Denmark)
Trøstrup, Hannah; Thomsen, Kim; Christophersen, Lars J
2013-01-01
model in C3H/HeN and BALB/c mice. The chronic wound was established by an injection of seaweed alginate-embedded P. aeruginosa PAO1 beneath a third-degree thermal lesion providing full thickness skin necrosis, as in human chronic wounds. Cultures revealed growth of PA, and both alginate with or without......Chronic wounds are presumed to persist in the inflammatory state, preventing healing. Emerging evidence indicates a clinical impact of bacterial biofilms in soft tissues, including Pseudomonas aeruginosa (PA) biofilms. To further investigate this, we developed a chronic PA biofilm wound infection...... bacteria organized in clusters, resembling biofilms, and inflammation located adjacent to the PA. The chronic wound infection showed a higher number of PAO1 in the BALB/c mice at day 4 after infection as compared to C3H/HeN mice (p
[Lung dysfunction in patients with severe chronic obstructive bronchitis].
Nefedov, V B; Popova, L A; Shergina, E A
2005-01-01
VC, FVC, FEV1, FEV1/VC%, PEF, MEF25, MEF50, MEF75, TCL, TGV, RV, Raw, Rin, Rex, DLCO-SS, PaO2, and PaCO2 were determined in 36 patients with severe chronic obstructive lung disease (FEV1 volumes and capacities; 83.3% of the patients had pulmonary gas exchange dysfunction. Impaired bronchial patency mainly appeared as decreased FEV1, FEV1/VC%, PEF, MEF25, MEF50, MEF75, Raw, Rin, Rex; altered lung volumes and capacities manifested by increased RV, TGV, and TLC, and by decreased VC and FVC; pulmonary gas exchange dysfunction showed up as lowered PaO2 and DLCO-SS, as decreased or increased PaCO2. The observed bronchial patency disorders varied from significant to severe; functional changes in lung volumes and capacities were mild to severe.
Spatiotemporal pharmacodynamics of meropenem- and tobramycin-treated Pseudomonas aeruginosa biofilms
DEFF Research Database (Denmark)
Haagensen, Janus Anders Juul; Verotta, Davide; Huang, Liusheng
2017-01-01
The selection and dose of antibiotic therapy for biofilm-related infections are based on traditional pharmacokinetic studies using planktonic bacteria. The objective of this study was to characterize the time course and spatial activity of human exposure levels of meropenem and tobramycin against...... Pseudomonas aeruginosa biofilms grown in an in vitro flow-chamber model. Pharmacokinetic profiles of meropenem and tobramycin used in human therapy were administered to GFP-labelled P. aeruginosa PAO1 grown in flow chambers for 24 or 72 h. Images were acquired using confocal laser scanning microscopy...... throughout antibiotic treatment. Bacterial biomass was measured using COMSTAT and pharmacokinetic/pharmacodynamic models were fitted using NONMEM7. Meropenem treatment resulted in more rapid and sustained killing of both the 24 and 72 h PAO1 biofilm compared with tobramycin. Biofilm regrowth after antibiotic...
Directory of Open Access Journals (Sweden)
Tripathy Swagata
2010-01-01
Full Text Available The increased incidence of ventilator-associated complications in patients with chronic obstructive pulmonary disease (COPD necessitates rapid weaning and extubation. The presence of secondary polycythemia in this subgroup increases the incidence of stroke and myocardial infarction due to hyperviscosity and tissue hypoxia. We present a 58-year-old male patient of COPD with secondary polycythemia (hematocrit 64% who had possible hyperviscosity-related complications leading to cardiac arrest after a minor surgical procedure. The patient developed ventilator dependence after recovery. Phlebotomy was done to remove 10% of total blood volume. Symptomatic improvement was dramatic. Improvement in weaning indices like rapid shallow breathing index and PaO 2 /PAO 2 was observed facilitating rapid weaning and early extubation. Monitored, acute phlebotomy is safe and cost-effective. It decreases blood volume and viscosity, increases cardiac output and improves exercise tolerance in patients.
Clinical evaluation of SPECT in cerebrovascular disease
International Nuclear Information System (INIS)
Oshibuchi, Masao; Satoh, Mitsutaka; Kanda, Tetsuro; Nishi, Fumiaki; Yamane, Kanji; Fujimatsu, Masahiko; Edamitsu, Satoshi; Anno, Yasuro; Ohtake, Hisashi.
1989-01-01
In 131 patients with cerebrovascular disease, regional cerebral blood flow were determined by 123 I-IMP (N-isopropyl ( 123 I)-iodoamphetamine) or 99m Tc-HM-PAO ( 99m Tc (d, 1)-hexamethyl propyleneamine oxime) SPECT and findings were compared with those of X-CT or MRI. The perfusion deficit detected by SPECT was larger than the deficit by X-CT or MRI in every case. The perfusion deficit area was more clearly demonstrated by SPECT than by X-CT or MRI in patients with acute cerebral infarction. The hypoperfusion area determined by 123 I-IMP SPECT was wider than that by 99m Tc-HM-PAO SPECT. The crossed cerebellar diaschisis was observed in 56 out of 131 cases (43%). The results of operation were quantitatively evaluated by 123 I-IMP SPECT in 25 patients. (author)
Clerbaux, T; Frans, A
1985-02-01
Clinical and pharmacological studies have shown that almitrine increased arterial blood oxygen partial pressure (PaO2) and tissular oxygenation. We have verified whether this drug could also increase the 2,3 diphosphoglycerate (DPG) level and so modify the oxyhemoglobin dissociation curve (ODC). Determinations performed 3 hours and 5 days after daily oral administration (1,5 mg/kg) of the drug showed no alterations of DPG and ODC in normal subjects. The presence of almitrine does not explain the observed PaO2 increase by means of a direct effect on the hemoglobin oxygen affinity. However, one cannot exclude almitrine long term effect; indeed, after 15 days, DPG levels and Hill coefficient increased significantly (p less than 0.05) but no the P50 (respectively + 1,5 mumole/gHb; +0.1 and 26.0 vs 26.5 mmHg).
Effect of biochar on aerobic processes, enzyme activity, and crop yields in two sandy loam soils
DEFF Research Database (Denmark)
Sun, Zhencai; Bruun, Esben; Arthur, Emmanuel
2014-01-01
Biochar added to agricultural soils may sequester carbon and improve physico-chemical conditions for crop growth, due to effects such as increased water and nutrient retention in the root zone. The effects of biochar on soil microbiological properties are less certain. We addressed the effects...... of wood-based biochar on soil respiration, water contents, potential ammonia oxidation (PAO), arylsulfatase activity (ASA), and crop yields at two temperate sandy loam soils under realistic field conditions. In situ soil respiration, PAO, and ASA were not significantly different in quadruplicate field...... plots with or without biochar (20 Mg ha−1); however, in the same plots, volumetric water contents increased by 7.5 % due to biochar (P = 0.007). Crop yields (oat) were not significantly different in the first year after biochar application, but in the second year, total yields of spring barley increased...
Hong, Yan; Ding, Shujiang; Wu, Wei; Hu, Jianjun; Voevodin, Andrey A; Gschwender, Lois; Snyder, Ed; Chow, Louis; Su, Ming
2010-06-01
This paper describes a new method to enhance the heat-transfer property of a single-phase liquid by adding encapsulated phase-change nanoparticles (nano-PCMs), which absorb thermal energy during solid-liquid phase changes. Silica-encapsulated indium nanoparticles and polymer-encapsulated paraffin (wax) nanoparticles have been made using colloid method, and suspended into poly-alpha-olefin (PAO) and water for potential high- and low-temperature applications, respectively. The shells prevent leakage and agglomeration of molten phase-change materials, and enhance the dielectric properties of indium nanoparticles. The heat-transfer coefficients of PAO containing indium nanoparticles (30% by mass) and water containing paraffin nanoparticles (10% by mass) are 1.6 and 1.75 times higher than those of corresponding single-phase fluids. The structural integrity of encapsulation allows repeated use of such nanoparticles for many cycles in high heat generating devices.
Perfusion lung scintigraphy in primary pulmonary hypertension
International Nuclear Information System (INIS)
Ogawa, Yoji; Nishimura, Tsunehiko; Kumita, Shin-ichirou; Hayashida, Kohei; Uehara, Toshiisa; Shimonagata, Tsuyoshi; Ohno, Akira
1991-01-01
Fifteen cases with primary pulmonary hypertension (PPH) were classified into two groups by using the perfusion lung scan pattern. Eight cases had multiple, small, ill-defined defects (mottled pattern), and remaining seven cases had no mottled pattern. These two groups were compared with mean pulmonary arterial pressure (mean PAP), right ventricular ejection fraction (RVEF), blood gas at room air (PaO 2 ), and alveolar-arterial O 2 difference (A-aDo 2 ). The cases with mottled pattern showed a significant increase in mean PAP. There were no significant differences in RVEF, PaO 2 , and A-aDo 2 , between the groups. The survival rate of the patients with mottled pattern was significantly lower than that without mottled pattern (p<0.05). We concluded that perfusion lung scan is very useful for evaluation of the prognosis in primary pulmonary hypertension. (author)
Balteco esitleb : loodusest inspireeritud - puhas ja kordumatu vorm
2010-01-01
Parima Disaini rakrendaja tiitli 2010. aastal pälvinid Balteco (disainijuht Aivar Habakukk) Onyx kivivannide sarjast, vannidest Rego (Sven Sõrmus, 2010), Senzo (Harri Ehrlich, 2010), Pao (Matti Õunapuu, 2008), dušialustest Visio ja Vibe, massaaživannidest
Full Life Wind Turbine Gearbox Lubricating Fluids
Energy Technology Data Exchange (ETDEWEB)
Lutz, Glenn A.; Jungk, Manfred; Bryant, Jonathan J.; Lauer, Rebecca S.; Chobot, Anthony; Mayer, Tyler; Palmer, Shane; Kauffman, Robert E.
2012-02-28
Industrial gear box lubricants typically are hydrocarbon based mineral oils with considerable amounts of additives to overcome the lack of base fluid properties like wear protection, oxidation stability, load carrying capacity, low temperature solidification and drop of viscosity at higher temperatures. For today's wind turbine gearboxes, the requirements are more severe and synthetic hydrocarbon oils are used to improve on this, but all such hydrocarbon based lubricants require significant amounts of Extreme Pressure (EP) additives to meet performance requirements. Perfluoropolyether (PFPE) fluids provide load carrying capacity as an inherent property. During the course of the project with the main tasks of 'Establish a Benchmark', 'Lubricant Evaluation', 'Full Scale Gearbox Trial' and 'Economic Evaluation', the PAO Reference oil exhibited significant changes after laboratory gear testing, in service operation in the field and full scale gearbox trial. Four hydrocarbon base oils were selected for comparison in the benchmarking exercise and showed variation with respect to meeting the requirements for the laboratory micro-pitting tests, while the PFPE fluid exceeded the requirements even with the material taken after the full scale gear box trial. This is remarkable for a lubricant without EP additives. Laboratory bearing tests performed on the PFPE fluids before and after the full scale gear box trial showed the results met requirements for the industry standard. The PFPE fluid successfully completed the full scale gear box test program which included baseline and progressive staged load testing. The evaluation of gears showed no micro-pitting or objectionable wear. By the final stage, lubricant film thickness had been reduced to just 21% of its original value, this was by design and resulted in a lambda ratio of well below 1. This test design scenario of a low lambda ratio is a very undesirable lubrication condition
Directory of Open Access Journals (Sweden)
G. A. Raimondi
2003-04-01
Full Text Available El síndrome de dificultad respiratoria aguda (ARDS se caracteriza por presentar alteraciones severas del intercambio gaseoso (IG causadas por «shunt» e importante irregularidad de la ventilación perfusión (V A/Q. Esto es consecuencia del edema intersticial y el colapso y ocupación alveolar. Además de la fracción inspirada de oxígeno y la evolución de la patología pulmonar, hay distintas variables que son capaces de alterar la presión parcial de oxígeno arterial (PaO2. Es así que los cambios del volumen minuto circulatorio, la concentración de hemoglobina, el consumo de oxígeno o la alcalosis pueden modificar la PaO2 a través de su influencia en la PO2 de sangre venosa mixta. A pesar de la influencia de estas diferentes variables, la anormalidad del IG se ha podido analizar adecuadamente por medio de la técnica de eliminación de múltiples gases inertes (MIGET. Asimismo, se han descripto diversas estrategias ventilatorias (presión positiva de fin de espiración, relaciones inspiratorias-espiratorias invertidas, volúmenes corrientes elevados, etc. que producen mejoría del IG principalmente a través del aumento de la presión media en la vía aérea al reclutar áreas pulmonares previamente colapsadas. También el cambio de decúbito a posición ventral, por modificaciones en la distribución de presión pleural regional, disminuye el colapso alveolar con mejoría de la PaO2. Asimismo hay distintas intervenciones farmacológicas capaces de mejorar el IG tales como la administración de óxido nítrico (ON o de prostaglandinas (PGI2 o PGE1 por vía inhalatoria. Estas producen vasodilatación de las áreas bien ventiladas aumentando el flujo cardíaco a ese nivel y disminuyendo relativamente el flujo por las áreas de «shunt». La almitrina endovenosa, droga vasoconstrictora pulmonar, mejora el IG al aumentar la vasoconstricción hipóxica. Se ha demostrado efecto aditivo de la almitrina con la inhalación de ON. A pesar del
A case that underwent bilateral video- assisted thoracoscopic ...
African Journals Online (AJOL)
Adele
C ventilator was used for controlled ventilation of the lungs. Pres- ... sufficient tidal volume, and the PaO2 value of the Paratrend 7TN ... operative lung. The cause was probably airway obstruction due to his intraluminal tumor plus secretions.
DEFF Research Database (Denmark)
McIlroy, Simon Jon; Albertsen, Mads; Andresen, Eva Kammer
2014-01-01
as for denitrification, nitrogen fixation, fermentation, trehalose synthesis and utilisation of glucose and lactate. Genetic comparison of P metabolism pathways with sequenced PAOs revealed the absence of the Pit phosphate transporter in the Competibacter-lineage genomes—identifying a key metabolic difference...
Impact of reverse nutrient diffusion on membrane biofouling in fertilizer-drawn forward osmosis
Li, Sheng; Kim, Youngjin; Chekli, Laura; Phuntsho, Sherub; Shon, Ho Kyong; Leiknes, TorOve; Ghaffour, NorEddine
2017-01-01
Biofouling in fertilizer-drawn forward osmosis (FDFO) for water reuse was investigated by spiking pure bacteria species Pseudomonas aeruginosa PAO1+GFP and using three different fertilizers KNO3, KCl and KH2PO4 as draw solutions. The performance
van den Berg, Jolice P; Westerbeek, Elisabeth A M; van der Klis, Fiona R M; Sanders, Elisabeth A M; Berbers, Guy A M; van Elburg, Ruurd M
BACKGROUND: Supplementation of oligosaccharides in premature infants was shown to influence the immune system. We determined the effect of combined short-chain galacto-oligosaccharides (scGOS), long-chain fructo-oligosaccharides (lcFOS) and pectin-derived acidic oligosaccharides (pAOS) on antibody
Collaboration in Performing Arts
C.B.G. Langeveld (Cees); Belme, D.; Koppenberg, T.
2014-01-01
markdownabstract__Abstract__ As a result of declining government support, performing arts organisations (PAOs) face increased challenges and difficulties in the sector. They attempt to develop new ways of generating income and seek new models of organising the production and presentation of
van den Berg, Jolice P.; Westerbeek, Elisabeth A. M.; van der Klis, Fiona R. M.; Sanders, Elisabeth A. M.; Berbers, Guy A. M.; van Elburg, Ruurd M.
2015-01-01
Supplementation of oligosaccharides in premature infants was shown to influence the immune system. We determined the effect of combined short-chain galacto-oligosaccharides (scGOS), long-chain fructo-oligosaccharides (lcFOS) and pectin-derived acidic oligosaccharides (pAOS) on antibody
DEFF Research Database (Denmark)
Klit, Jakob; Hartig-Andreasen, Charlotte; Jacobsen, Steffen
2013-01-01
Hip joint survivorship and functional outcome are traditional outcome measures applied after periacetabular osteotomy (PAO). Younger adults however have greater demands and expectations on the function of their hip joints and these demands are not expressed using traditional outcome assessment to...
Häfner, Dietrich; Germann, Paul-Georg; Hauschke, Dieter
1998-01-01
In a previous paper we showed that an SP-C containing surfactant preparation has similar activity as bovine-derived surfactants in a rat lung lavage model of the adult respiratory distress syndrome. In this study surfactant was given ten minutes after the last lavage (early treatment). In the present investigation we were interested how different surfactant preparations behave when they are administered 1 h after the last lavage (late treatment). Four protein containing surfactants (rSP-C surfactant, bLES, Infasurf and Survanta) were compared with three protein-free surfactants (ALEC, Exosurf and the phospholipid (PL) mixture of the rSP-C surfactant termed PL surfactant) with respect to their ability to improve gas exchange in this more stringent model when surfactant is given one hour after the last lavage. For better comparison of the surfactants the doses were related to phospholipids. The surfactants were given at doses of 25, 50 and 100 mg kg−1 body weight. The surfactants were compared to an untreated control group that was only ventilated for the whole experimental period. Tracheotomized rats (8–12 per dose and surfactant) were pressure-controlled ventilated (Siemens Servo Ventilator 900C) with 100% oxygen at a respiratory rate of 30 breaths min−1, inspiration expiration ratio of 1 : 2, peak inspiratory pressure of 28 cmH2O at positive endexpiratory pressure (PEEP) of 8 cmH2O. Animals were ventilated for one hour after the last lavage and thereafter the surfactants were intratracheally instilled. During the whole experimental period the ventilation was not changed. Partial arterial oxygen pressures (PaO2, mmHg) at 30 min and 120 min after treatment were used for statistical comparison. All protein containing surfactants caused a dose-dependent increase of the reduced PaO2 values at 30 min after treatment. The protein-free surfactants showed only weak dose-dependent increase in PaO2 values at this time. This difference between the
Verbeek, G L; Myles, P S; Westall, G P; Lin, E; Hastings, S L; Marasco, S F; Jaffar, J; Meehan, A C
2017-08-01
Primary graft dysfunction occurs in up to 25% of patients after lung transplantation. Contributing factors include ventilator-induced lung injury, cardiopulmonary bypass, ischaemia-reperfusion injury and excessive fluid administration. We evaluated the feasibility, safety and efficacy of an open-lung protective ventilation strategy aimed at reducing ventilator-induced lung injury. We enrolled adult patients scheduled to undergo bilateral sequential lung transplantation, and randomly assigned them to either a control group (volume-controlled ventilation with 5 cmH 2 O, positive end-expiratory pressure, low tidal volumes (two-lung ventilation 6 ml.kg -1 , one-lung ventilation 4 ml.kg -1 )) or an alveolar recruitment group (regular step-wise positive end-expiratory pressure-based alveolar recruitment manoeuvres, pressure-controlled ventilation set at 16 cmH 2 O with 10 cmH 2 O positive end-expiratory pressure). Ventilation strategies were commenced from reperfusion of the first lung allograft and continued for the duration of surgery. Regular PaO 2 /F I O 2 ratios were calculated and venous blood samples collected for inflammatory marker evaluation during the procedure and for the first 24 h of intensive care stay. The primary end-point was the PaO 2 /F I O 2 ratio at 24 h after first lung reperfusion. Thirty adult patients were studied. The primary outcome was not different between groups (mean (SD) PaO 2 /F I O 2 ratio control group 340 (111) vs. alveolar recruitment group 404 (153); adjusted p = 0.26). Patients in the control group had poorer mean (SD) PaO 2 /F I O 2 ratios at the end of the surgical procedure and a longer median (IQR [range]) time to tracheal extubation compared with the alveolar recruitment group (308 (144) vs. 402 (154) (p = 0.03) and 18 (10-27 [5-468]) h vs. 15 (11-36 [5-115]) h (p = 0.01), respectively). An open-lung protective ventilation strategy during surgery for lung transplantation is feasible, safe and achieves favourable
Directory of Open Access Journals (Sweden)
Qian Yang
2017-10-01
Full Text Available Objective: To investigate the effect of dexmedetomidine combined with parecoxib sodium on the levels of inflammatory factors, blood gas analysis and stress hormone in patients undergoing radical resection of esophageal carcinoma during one lung ventilation. Methods: According to the random data table, 81 cases of esophageal cancer patients were divided into the control group (n=41 and observation group (n=40, the patients in the two groups underwent left thoracotomy esophageal cancer radical resection, the control group patients were treated with parecoxib sodium, and patients in the observation group were treated with parecoxib sodium combined with dexmedetomidine medetomidine treatment, before induction of anesthesia (T 0 , 30 min of one lung ventilation (T 1 and 120 min after operation (T 2 at three time points, the levels of inflammatory factors [tumor necrosis factor-α (TNF-α, C reactive protein (CRP], blood gas analysis[oxygen partial pressure (PaO 2 , carbon dioxide partial pressure (PaCO 2 ] and stress hormone[epinephrine (E, norepinephrine (NE] of the two groups were compared. Results: Intra group level comparison, compared with the levels of two groups at the T 0 moment, the levels of TNF-α, CRPand NE of theT 1 and T 2 moment were significantly increased, the level of PaO 2 were significantly decreased, and T 2 moment levels were significantly higher than that of T 1 moment, the difference was statistical significance; There were no significant differences between the two groups of the levels of TNF-α, CRP, PaO 2 , E and NE of the T 0 moment, the levels of TNF-α, CRP, E and NE of the observation group at the T 1 and T 2 moment were significantly lower than the control group, at the same time the PaO 2 level was significantly higher than the control group, the difference was statistically significant; There were no statistically significant differences in PaCO 2 levels between groups and at any time. Conclusion: Dexmedetomidine
Haan, J D; Hay Kraus, B L; Sathe, S R
2018-07-01
To determine if abdominal insufflation with medical air will improve oxygenation and ventilation parameters when compared to insufflation with CO 2 in xylazine-sedated sheep undergoing laparoscopic artificial insemination (AI). Forty-seven sheep underwent oestrus synchronisation and were fasted for 24 hours prior to laparoscopic AI. Each animal was randomised to receive either CO 2 or medical air for abdominal insufflation. An auricular arterial catheter was placed and utilised for serial blood sampling. Respiratory rates (RR) and arterial blood samples were collected at baseline, after xylazine (0.1 mg/kg I/V) sedation, 2 minutes after Trendelenburg positioning, 5 minutes after abdominal insufflation, and 10 minutes after being returned to a standing position. Blood samples were collected in heparinised syringes, stored on ice, and analysed for arterial pH, partial pressure of arterial O 2 (PaO 2 ), and CO 2 (PaCO 2 ). The number of ewes conceiving to AI was also determined. Repeated measures ANOVA demonstrated temporal effects on RR, PaO 2 , PaCO 2 and arterial pH during the laparoscopic AI procedure (p0.01). No sheep experienced hypercapnia (PaCO 2 >50 mmHg) or acidaemia (pH<7.35). Hypoxaemia (PaO 2 <70 mmHg) was diagnosed during the procedure in 14/22 (64%) ewes in the CO 2 group compared with 8/23 (35%) ewes in the medical air group (p=0.053). Overall, 15/20 (75%) ewes in the CO 2 group conceived to AI compared with 16/22 (72.7%) in the medical air group (p=0.867). There were no statistical or clinical differences in RR, PaO 2 , PaCO 2 , pH, or conception to AI when comparing the effects of CO 2 and medical air as abdominal insufflation gases. None of the sheep experienced hypercapnia or acidaemic, yet 42% (19/45) of sheep developed clinical hypoxaemia, with a higher percentage of ewes in the CO 2 group developing hypoxaemia than in the medical air group. Based on the overall analysis, medical air could be utilised as a comparable alternative for
Pérez-Padilla, Rogelio; Hernández-Cárdenas, Carmen Margarita; Lugo-Goytia, Gustavo
2016-01-01
In the well-known Berlin definition of acute respiratory distress syndrome (ARDS), there is a recommended adjustment for arterial oxygen partial pressure to fractional inspired oxygen (PaO2/FIO2) at altitude, but without a reference as to how it was derived.
Elastohydrodynamic Traction Properties of Seed Oils
The elastohydrodynamic traction coefficient (tc) properties of nine seed oils of varying chemical structures, PAO and hexadecane, were investigated using a ball-on disk traction apparatus. The seed oils were: castor oil, a triglyceride with hydroxyl functional group; jojoba, a monoglyceride; and s...
Elastohydrodynamic (EHD) traction properties of seed oils
The elastohydrodynamic traction coefficient (tc) properties of nine seed oils of varying chemical structures, PAO and hexadecane, were investigated using a ball-on disk traction apparatus. The seed oils were: castor oil, a triglyceride with hydroxyl functional group; jojoba, a monoglyceride; and sev...
Pseudomonas aeruginosa with lasI quorum-sensing deficiency during corneal infection
DEFF Research Database (Denmark)
Zhu, H.; Bandara, R.; Conibear, T.C.
2004-01-01
To understand the importance of Pseudomonas aeruginosa quorum-sensing systems in the development of corneal infection, the genotypic characteristics and pathogenesis of seven ocular isolates with low-protease and acyl homoserine lactone (AHL) activity and quorum-sensing mutants of PAO1 deficient...
Medema, J. P.; Pronk, G. J.; de Vries-Smits, A. M.; Clark, R.; McCormick, F.; Bos, J. L.
1996-01-01
We have used two approaches to identify possible substrates of the insulin receptor (IR) tyrosine kinase. First, we used a potent tyrosine phosphatase inhibitor, phenylarsine oxide (PAO), which is reported to be specific for the insulin-induced signal transduction route, to augment tyrosine
DEFF Research Database (Denmark)
Nedergaard, Helene Korvenius; Jensen, Hanne Irene; Lauridsen, Jørgen T
2015-01-01
will be intubated, mechanically ventilated patients with expected duration of mechanical ventilation >24 h. Exclusion criteria will be patients with severe head trauma, coma at admission or status epilepticus, patients treated with therapeutic hypothermia, patients with PaO2/FiO2
DEFF Research Database (Denmark)
Chua, Song Lin; Sivakumar, Krishnakumar; Rybtke, Morten Levin
2015-01-01
tellurite (TeO3(2-)) exposure induced the intracellular content of the secondary messenger cyclic di-GMP (c-di-GMP) of Pseudomonas aeruginosa. Two diguanylate cyclases (DGCs), SadC and SiaD, were responsible for the increased intracellular content of c-di-GMP. Enhanced c-di-GMP levels by TeO3(2-) further...... increased P. aeruginosa biofilm formation and resistance to TeO3(2-). P. aeruginosa ΔsadCΔsiaD and PAO1/p(lac)-yhjH mutants with low intracellular c-di-GMP content were more sensitive to TeO3(2-) exposure and had low relative fitness compared to the wild-type PAO1 planktonic and biofilm cultures exposed...... to TeO3(2-). Our study provided evidence that c-di-GMP level can play an important role in mediating stress response in microbial communities during both planktonic and biofilm modes of growth....
DEFF Research Database (Denmark)
Jørgensen, Karin Meinike; Wassermann, Tina; Jensen, Peter Østrup
2013-01-01
that mutants with high-level ciprofloxacin resistance are selected in P. aeruginosa bacterial populations exposed to sub-MICs of ciprofloxacin. This can have implications for the long-term persistence of resistant bacteria and spread of antibiotic resistance by exposure of commensal bacterial flora to low......The dynamics of occurrence and the genetic basis of ciprofloxacin resistance were studied in a long-term evolution experiment (940 generations) in wild-type, reference strain (PAO1) and hypermutable (PAOΔmutS and PAOMY-Mgm) P. aeruginosa populations continuously exposed to sub-MICs (1....../4) of ciprofloxacin. A rapid occurrence of ciprofloxacin-resistant mutants (MIC of ≥12 μg/ml, representing 100 times the MIC of the original population) were observed in all ciprofloxacin-exposed lineages of PAOΔmutS and PAOMY-Mgm populations after 100 and 170 generations, respectively, and in one of the PAO1...
Quorum quenching properties of Actinobacteria isolated from Malaysian tropical soils.
Devaraj, Kavimalar; Tan, Geok Yuan Annie; Chan, Kok-Gan
2017-08-01
In this study, a total of 147 soil actinobacterial strains were screened for their ability to inhibit response of Chromobacterium violaceum CV026 to short chain N-acyl homoserine lactone (AHL) which is a quorum sensing molecule. Of these, three actinobacterial strains showed positive for violacein inhibition. We further tested these strains for the inhibition of Pseudomonas aeruginosa PAO1 quorum sensing-regulated phenotypes, namely, swarming and pyocyanin production. The three strains were found to inhibit at least one of the quorum sensing-regulated phenotypes of PAO1. Phylogenetic analysis of the 16S rRNA gene sequences indicated that these strains belong to the genera Micromonospora, Rhodococcus and Streptomyces. This is the first report presenting quorum quenching activity by a species of the genus Micromonospora. Our data suggest that Actinobacteria may be a rich source of active compounds that can act against bacterial quorum sensing system.
[Oxyhemoglobin dissociation curve and 2,3-diphosphoglycerate in chronic hypoxemia].
Koizumi, M
1991-05-01
The measurement of the oxyhemoglobin dissociation curve (ODC) and 2,3-diphosphoglycerate (2,3-DPG) in patients with chronic hypoxemia is important from the view point of tissue oxygenation. However, there have been no consistent results that explain the relation among chronic hypoxemia, 2,3-DPG and P50, which is oxygen pressure at an oxygen saturation of 50 percent. The aim of this study is to clarify what factors affect P50 and 2,3-DPG. 1) Patients with chronic hypoxemia, who showed PaO2 less than 60 Torr, had significantly higher P50 than normal subjects. 2) The concentration of Hb showed significant negative correlation with both P50 and 2,3-DPG. 3) Arterial blood pH showed significant positive correlation with both P50 and 2,3-DPG. 4) In a group with normal levels of Hb and pH, there was significant negative relationship between PaO2 and P50. 5) In a group with normal levels of Hb and pH, there was significant positive relationship between PaCO2 and P50. 6) In a group with normal levels of Hb, pH and PaCO2, there was significant negative relationship between PaO2 and 2,3-DPG. In conclusion, P50 and 2,3-DPG are affected largely by Hb concentration or blood pH, with or without hypoxemia. However there is a mechanism by which P50 and 2,3-DPG are increased by hypoxemia itself in a group with normal levels of Hb, pH and PaCO2.
Blandin, Gaetan; Verliefde, Arne R D; Comas, Joaquim; Rodriguez-Roda, Ignasi; Le-Clech, Pierre
2016-07-01
Forward osmosis (FO) is a promising membrane technology to combine seawater desalination and water reuse. More specifically, in a FO-reverse osmosis (RO) hybrid process, high quality water recovered from the wastewater stream is used to dilute seawater before RO treatment. As such, lower desalination energy needs and/or water augmentation can be obtained while delivering safe water for direct potable reuse thanks to the double dense membrane barrier protection. Typically, FO-RO hybrid can be a credible alternative to new desalination facilities or to implementation of stand-alone water reuse schemes. However, apart from the societal (public perception of water reuse for potable application) and water management challenges (proximity of wastewater and desalination plants), FO-RO hybrid has to overcome technical limitation such as low FO permeation flux to become economically attractive. Recent developments (i.e., improved FO membranes, use of pressure assisted osmosis, PAO) demonstrated significant improvement in water flux. However, flux improvement is associated with drawbacks, such as increased fouling behaviour, lower rejection of trace organic compounds (TrOCs) in PAO operation, and limitation in FO membrane mechanical resistance, which need to be better considered. To support successful implementation of FO-RO hybrid in the industry, further work is required regarding up-scaling to apprehend full-scale challenges in term of mass transfer limitation, pressure drop, fouling and cleaning strategies on a module scale. In addition, refined economics assessment is expected to integrate fouling and other maintenance costs/savings of the FO/PAO-RO hybrid systems, as well as cost savings from any treatment step avoided in the water recycling.
Varrica, Alessandro; Satriano, Angela; Gavilanes, Antonio D W; Zimmermann, Luc J; Vles, Hans J S; Pluchinotta, Francesca; Anastasia, Luigi; Giamberti, Alessandro; Baryshnikova, Ekaterina; Gazzolo, Diego
2017-11-28
S100B has been proposed as a consolidated marker of brain damage in infants with congenital heart disease (CHD) undergoing cardiac surgery and cardiopulmonary bypass (CPB). The present study aimed to investigate whether S100B blood levels in the perioperative period differed in infants complicated or not by cyanotic CHD (CHDc) and correlated with oxygenation status (PaO 2 ). We conducted a case-control study of 48 CHD infants without pre-existing neurological disorders undergoing surgical repair and CPB. 24 infants were CHDc and 24 were CHD controls. Blood samples for S100B assessment were collected at six monitoring time-points: before the surgical procedure (T0), after sternotomy but before CPB (T1), at the end of the cross-clamp CPB phase (T2), at the end of CPB (T3), at the end of the surgical procedure (T4), at 24 h postsurgery (T5). In the CHDc group, S100B multiples of median (MoM) were significantly higher (p .05, for all) were found at T2, T3, T5. Linear regression analysis showed a positive correlation between S100B MoM at T3 and PaO 2 (R = 0.84; p < .001). The present data showing higher hypoxia/hyperoxia-mediated S100B concentrations in CHDc infants suggest that CHDc are more prone to perioperative brain stress/damage and suggest the usefulness of further investigations to detect the "optimal" PaO 2 target in order to avoid the side effects associated with reoxygenation during CPB.
Uued juhtimispaneelid panevad massaazhivannid mugavamalt tööle
2008-01-01
Vannitootja AS-i Balteco insenerid on loonud kaks tehniliselt täiustatud elektroonilist juhtimispaneeli EVO ja EVO+, mis sobivad firma kõikide elektrooniliste massaazhivannidega, millest uuemad on kaheosaline nurgavann Linea 14 (disainer Aivar Habakukk) ja Solid Surface'i kivimassist vann Pao (disainer Matti Õunapuu)
Rhamnolipid but not motility is associated with the initiation of biofilm ...
Indian Academy of Sciences (India)
2013-01-10
Jan 10, 2013 ... In this study, confocal scanning laser microscope combined with .... Images were obtained by ... plates were inverted and incubated at 37°C for 24 h. .... and twitching motility of PAO1; d, e and f represent the motility of PA17.
DNA-mediated bacterial aggregation is dictated by acid-base interactions
Das, Theerthankar; Krom, Bastiaan P.; van der Mei, Henny C.; Busscher, Henk J.; Sharma, Prashant K.
2011-01-01
Extracellular DNA (eDNA) plays a significant role in bacterial biofilm formation and aggregation. Here, for the first time, we present a physico-chemical analysis of the DNA-mediated aggregation for three bacterial strains (Streptococcus mutans LT11, Pseudomonas aeruginosa PAO1 and Staphylococcus
2017-05-01
simultaneously to the 502 ISG/JAC legal office and PAO for review to help reduce tum-around time. If you have any questions regarding legal reviews...oral penicillin to intramuscular bicillin (January 2012). Although causality should not be assumed, these interventions appear to be inversely
DEFF Research Database (Denmark)
Duan, Yun-Feng (Kevin); Kong, Xianwang; Schramm, Andreas
2017-01-01
corresponded to plowing or rotovation to study the effects of soil-residue contact on N transformations. DMPP was sprayed on aboveground parts of ryegrass and white clover plants before incorporation. During a 42-day incubation, soil mineral N dynamics, potential ammonia oxidation (PAO), denitrifying enzyme...
Westerbeek, E. A. M.; Hensgens, R. L.; Mihatsch, W. A.; Boehm, G.; Lafeber, H. N.; van Elburg, R. M.
2011-01-01
To determine the effect of neutral oligosaccharides [small-chain galacto-oligosaccharides/long-chain fructo-oligosaccharides (scGOS/lcFOS)] in combination with acidic oligosaccharides (pAOS) on stool viscosity, stool frequency and stool pH in preterm infants. In this explorative RCT, preterm infants
African Journal of Biotechnology - Vol 12, No 22 (2013)
African Journals Online (AJOL)
Estimates of combining ability and heterosis for growth traits in a full diallel cross of three strains of common carp, Cyprinus carpio L. EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. Shengyan Su, Pao Xu, Xinhua Yuan ...
Reduced baroreflex sensitivity and pulmonary dysfunction in alcoholic cirrhosis: effect of hyperoxia
DEFF Research Database (Denmark)
Møller, Søren; Iversen, Jens S; Krag, Aleksander
2010-01-01
matched controls underwent hemodynamic and pulmonary investigations. BRS was assessed by cross-spectral analysis of variabilities between blood pressure and heart rate time series. A 100% oxygen test was performed with the assessment of arterial oxygen tensions (Pa(O(2))) and alveolar-arterial oxygen...
Mooij, Marlies J.; Drenkard, Eliana; Llamas, María A.; Vandenbroucke-Grauls, Christina M. J. E.; Savelkoul, Paul H. M.; Ausubel, Frederick M.; Bitter, Wilbert
2007-01-01
Bacteriophages play an important role in bacterial virulence and phenotypic variation. It has been shown that filamentous bacteriophage Pf4 of Pseudomonas aeruginosa strain PAO1 mediates the formation of small-colony variants (SCVs) in biofilms. This morphology type is associated with parameters of
Proteomic Response of Pseudomonas aeruginosa PAO1 Adhering to Solid Surfaces
Directory of Open Access Journals (Sweden)
Morgan Guilbaud
2017-08-01
Full Text Available Pseudomonas aeruginosa is a pathogenic micro-organism responsible for many hospital-acquired infections. It is able to adhere to solid surfaces and develop an immobilized community or so-called biofilm. Many studies have been focusing on the use of specific materials to prevent the formation of these biofilms, but the reactivity of the bacteria in contact to surfaces remains unknown. The aim of this study was to evaluate the impact of the abiotic surface on the physiology of adherent bacteria. Three different materials, stainless steel (SS, glass (G, and polystyrene (PS that were relevant to industrial or medical environments were characterized at the physicochemical level in terms of their hydrophobicity and roughness. We showed that SS was moderately hydrophilic and rough, potentially containing crevices, G was hydrophilic and smooth while PS was hydrophobic and smooth. We further showed that P. aeruginosa cells were more likely able to adhere to SS and G rather than PS surfaces under our experimental conditions. The physiological response of P. aeruginosa when adhering to each of these materials was then evaluated by global proteomic analysis. The abundance of 70 proteins was shown to differ between the materials suggesting that their abundance was modified as a function of the material to which bacteria adhered. Our data lead to enabling the identification of abundance patterns that appeared to be specific to a given surface. Taken together, our data showed that P. aeruginosa is capable of sensing and responding to a surface probably via specific programmes to adapt its physiological response accordingly.
Response of Pseudomonas aeruginosa PAO1 to low shear modeled microgravity
National Aeronautics and Space Administration — Anticipating the risk for infectious disease during space exploration and habitation is a critical factor to ensure safety health and performance of the crewmembers....
Clinical and radiological outcome after periacetabular osteotomy
DEFF Research Database (Denmark)
Dahl, Line B; Dengsø, Kristine; Bang-Christiansen, Karl
2014-01-01
PURPOSE: Few papers have described results after periacetabular osteotomy (PAO) and risk factors for conversion to total hip arthroplasty (THA). The aim of the present paper was to analyse clinical and radiographic outcome, survival of the hip joint and risk factors of early conversion to THA in ...
2009-01-01
applied atomic and molecular spectroscopy, thermophysics and high temperature dielectric materials, thermal nanofluids for heat transfer...Films Doped With BZO, Y203, and BSnO .......................... 13 APPENDIX B Ball Bearing Raceway Fatigue Spall Propagation...APPENDIX H Flow Loop Experiments Using PAO/CNT Nanofluids ............................................................. 115 APPENDIX I Thermal
Bos, Lieuwe D.; Schouten, Laura R.; Cremer, Olaf L.; Ong, David S. Y.; Schultz, Marcus J.; Frencken, Jos F.; Bonten, Marc; Klein Klouwenberg, Peter M. C.; Ong, David; van Hooijdonk, Roosmarijn T. M.; Huson, Mischa A.; Schouten, Laura R. A.; Straat, Marleen; van Vught, Lonneke A.; Wiewel, Maryse A.; Witteveen, Esther; Glas, Gerie J.; Wieske, Luuk; van der Poll, Tom
2016-01-01
A recently developed prediction score based on age, arterial oxygen partial pressure to fractional inspired oxygen ratio (PaO2/FiO2) and plateau pressure (abbreviated as 'APPS') was shown to accurately predict mortality in patients diagnosed with the acute respiratory distress syndrome (ARDS). After
Kerperien, J; Jeurink, P V; Wehkamp, T; van der Veer, A; van de Kant, H J G; Hofman, G A; van Esch, E C A M; Garssen, J; Willemsen, L E M; Knippels, L M J
2014-01-01
BACKGROUND: Cow's milk allergy is a common food allergy in childhood and no effective preventive or curative treatment is available. This study aimed at comparing single short-chain galacto- (scGOS), long-chain fructo- (lcFOS) or pectin-derived acidic oligosaccharides (pAOS) and/or mixtures of
Zeng, Guangming; Zhang, Jiachao; Chen, Yaoning; Yu, Zhen; Yu, Man; Li, Hui; Liu, Zhifeng; Chen, Ming; Lu, Lunhui; Hu, Chunxiao
2011-10-01
The aim of this study was to compare the relative contribution of ammonia-oxidizing archaea (AOA) and bacteria (AOB) to nitrification during agricultural waste composting. The AOA and AOB amoA gene abundance and composition were determined by quantitative PCR and denaturing gradient gel electrophoresis (DGGE), respectively. The results showed that the archaeal amoA gene was abundant throughout the composting process, while the bacterial amoA gene abundance decreased to undetectable level during the thermophilic and cooling stages. DGGE showed more diverse archaeal amoA gene composition when the potential ammonia oxidation (PAO) rate reached peak values. A significant positive relationship was observed between the PAO rate and the archaeal amoA gene abundance (R²=0.554; Parchaea dominated ammonia oxidation during the thermophilic and cooling stages. Bacteria were also related to ammonia oxidation activity (R²=0.503; P=0.03) especially during the mesophilic and maturation stages. Copyright © 2011 Elsevier Ltd. All rights reserved.
Directory of Open Access Journals (Sweden)
Qi LU
2013-07-01
Full Text Available Objective To investigate the effects of ambroxol on the biofilm viability and pristine adhesion of Pseudomonas aeruginosa wild (PAO1 and quorum sensing defective strain (QS, gene deletion of ∆lasI and ∆rhlI. Methods The biofilm was treated by different concentrations (0, 1.875, 3.75mg/ml of ambroxol. The number of colony was measured with agar plate, multifunction fluorometer was used to measure the fluorescence intensity of PAO1 and QS strains at the bottom of 96-well plate. The adhesion ratio (% was calculated to determine the effects of ambroxol on bacterial biofilm adhesion. Results Ambroxol treatment reduced the survival rate of the mutant strains compared to that of wild strain, even though the QS strain had increased the adhesion in the presence of ambroxol compared to that of wild strain (P<0.05. Conclusion Ambroxol has a property of significantly antagonizing quorum-sensing system, suggesting that it might be of importance in treatment against chronic Pseudomonasaeruginosainfections.
Ahn, H J; Kim, J A; Yang, M; Shim, W S; Park, K J; Lee, J J
2012-09-01
Recent papers suggest protective ventilation (PV) as a primary ventilation strategy during one-lung ventilation (OLV) to reduce postoperative pulmonary morbidity. However, data regarding the advantage of the PV strategy in patients with normal preoperative pulmonary function are inconsistent, especially in the case of minimally invasive thoracic surgery. Therefore we compared conventional OLV (VT 10 ml/kg, FiO2 1.0, zero PEEP) to protective OLV (VT 6 ml/kg, FiO2 0.5, PEEP 5 cmH2O) in patients with normal preoperative pulmonary function tests undergoing video-assisted thoracic surgery. Oxygenation, respiratory mechanics, plasma interleukin-6 and malondialdehyde levels were measured at baseline, 15 and 60 minutes after OLV and 15 minutes after restoration of two-lung ventilation. PaO2 and PaO2/FiO2 were higher in conventional OLV than in protective OLV (PProtective ventilation did not provide advantages over conventional ventilation for video-assisted thoracic surgery in this group of patients with normal lung function.
Li, Dong; Lv, Yufeng; Zeng, Huiping; Zhang, Jie
2016-11-01
The effect of sludge retention time (SRT) on the continuous-flow system with enhanced biological phosphorus removal (EBPR) granules at different COD loading was investigated during the operation of more than 220days. And the results showed that when the system operated at long SRT (30days) and low COD loading (200mg·L(-1)), it could maintain excellent performance. However, long SRT and high COD loading (300mg·L(-1)) deteriorated the settling ability of granules and the performance of system and resulted in the overgrowth of filamentous bacteria. Meanwhile, the transformation of poly-β-hydroxyalkanoates (PHAs) and glycogen in metabolism process was inhibited. Moreover, the results of pyrosequencing indicated that filamentous bacteria had a competitive advantage over polyphosphate-accumulating organisms (PAOs) at high COD loading and long SRT. The PAOs specious of Candidatus_Accumlibater and system performance increased obviously when the SRT was reduced to 20days at high COD loading. Copyright © 2016 Elsevier Ltd. All rights reserved.
Li, Dong; Lv, Yufeng; Zeng, Huiping; Zhang, Jie
2016-09-01
In this study, a continuous-flow system with enhanced biological phosphorus removal (EBPR) granules was operated at different COD concentrations (200, 300 and 400mgL(-)(1)) to investigate the effect of COD loading on this system. The results showed that when the COD concentration in influent was increased to 400mgL(-)(1), the anaerobic COD removal efficiency and total phosphorus removal efficiency reduced obviously and the settling ability of granules deteriorated due to the proliferation of filamentous bacteria. Moreover, high COD loading inhibited the EPS secretion and destroyed the stability of granules. Results of high-through pyrosequencing indicated that filamentous bacteria had a competitive advantage over polyphosphate-accumulating organisms (PAOs) at high COD loading. The performance of system, settling ability of granules and proportion of PAOs gradually recovered to the initial level after the COD concentration was reduced to 200mgL(-)(1) on day 81. Copyright © 2016 Elsevier Ltd. All rights reserved.
Yu, Shenjing; Sun, Peide; Zheng, Wei; Chen, Lujun; Zheng, Xiongliu; Han, Jingyi; Yan, Tao
2014-11-01
In this study, the effect of varied COD loading (200, 400, 500, 600 and 800 mg L(-1)) on stability and recoverability of granule-based enhanced biological phosphorus removal (EBPR) system was investigated during continuously 53-d operation. Results showed that COD loading higher than 500 mg L(-1) could obviously deteriorate the granular EBPR system and result in sludge bulking with filamentous bacteria. High COD loading also changed the transformation patterns of poly-β-hydroxyalkanoates (PHAs) and glycogen in metabolism process of polyphosphate-accumulating organisms (PAOs) and inhibited the EPS secretion, which completely destroyed the stability and integrality of granules. Results of FISH indicated that glycogen-accumulating organisms (GAOs) and other microorganisms had a competitive advantage over PAOs with higher COD loading. The community composition and EBPR performance were recovered irreversibly in long time operation when COD loading was higher than 500 mg L(-1). Copyright © 2014 Elsevier Ltd. All rights reserved.
Wassilew, Georgi I; Janz, Viktor; Renner, Lisa; Perka, Carsten; Pruss, Axel
2016-12-01
The objective of the present study was to analyze the clinical and radiological results of periacetabular osteotomies (PAO) using Kirschner wire fixation and an allogeneic cancellous bone graft. This retrospective cohort study included 73 patients (85 PAOs). The allografts were processed from distal femur of cadaveric donors, defatted, sterilized with a peracetic-acid ethanol solution and freeze-dried. The clinical outcome, as measured by the Harris Hip Scores (HHS), the complication rate and the acetabular correction, as measured by radiological parameters, were compared. The postoperative femoral head coverage and HSS were significantly improved. Major complications occurred in five cases (6 %), but in no case did we observe a non-union or a graft-associated adverse effect. Fixation of the acetabular fragment with Kirschner wires in combination with an allogeneic cancellous bone graft is a safe method, with a low complication rate, no loss of correction and can prevent the occurrence of non-union with a high degree of probability.
Trends in Intergenerational Income Mobility in Denmark
DEFF Research Database (Denmark)
Munk, Martin David
) intergenerational elasticity of parent-child income increases between 1962 and 1982, indicating a decrease in social mobility across the period. We have used the cohorts 1962, 1967, 1972, 1977 and 1982 in the analysis in the period 1980-2012. Estimates proved very sensitive to changes in the (average) parental age......We study Intergenerational Income Mobility over time. (we do not do earnings mobility, here). The results are very preliminary! Compared to other countries IIM seems to relatively high in Denmark (around 0.2), so IGE is small, but is IIM also stable over time? We show that the (unconditional...... of outcome (PAO) and child age of outcome (CAO), particularly in respect to the latter. Indeed, depending on CAO (conditional on a fixed PAO), estimates for the 1962 cohort range from -0,14 (age 20) to 0,19 (age 50). Findings suggest that income measured at (roughly) age 35 or less reflect transitory income...
Parot, S; Miara, B; Milic-Emili, J; Gautier, H
1982-11-01
The results of lung function tests (total and functional residual capacities, residual volume/total lung capacity ratio, forced expiratory volume in one second) breathing patterns and arterial PO2 and PCO2 were studied in 651 ambulatory male patients with chronic obstructive pulmonary disease, functionally and clinically stable. Function tests were only loosely correlated with gas tensions: abnormalities in mechanics and in gas exchange are not necessarily related. In patients matched for the degree of obstruction, the breathing pattern depended upon both PaO2 and PaCO2. Isolated hypoxemia was accompanied by increased respiratory frequency without any variation in tidal volume: this suggests that the chemoreceptive systems still responded to changes in PaO2. Isolated hypercapnia was accompanied by a decrease in tidal volume and an increase in respiratory frequency. Consequently, the dead space/tidal volume ratio increased, leading to a drop in alveolar ventilation and to CO2 retention.
Pregnancy-associated osteoporosis presenting severe vertebral fractures.
Ozturk, Cihat; Atamaz, Funda Calis; Akkurt, Halil; Akkoc, Yesim
2014-01-01
The syndrome of pregnancy-associated osteoporosis (PAO) is a rare disorder which occurs either in late pregnancy or early post-partum period leading to fragility fracture(s), most commonly in the vertebral bodies. We presented two cases with PAO who had compression fractures at multiple levels involving five vertebrae in one case and 10 vertebrae in the other. Their spinal bone mineral density values were below -2.5 standard deviations. Anti-osteoporotic treatments with nasal calcitonin 400 IU/day, vitamin D 300.000 IU single dose, calcium 1000 mg/day, vitamin D 880 IU/day were initiated. In one case, kyphoplasty was performed by a spinal surgeon. In addition to a thoracolumbosacral orthosis, a rehabilitation program including muscle strengthening, range of motion, relaxation and weight-bearing exercises was started for both cases. These cases emphasize that all pregnant women with complaints of back/lumbar pain should be carefully evaluated. © 2013 The Authors. Journal of Obstetrics and Gynaecology Research © 2013 Japan Society of Obstetrics and Gynecology.
Directory of Open Access Journals (Sweden)
Weihua Chu
2013-01-01
Full Text Available Traditional Chinese herbal medicines (TCHMs were tested for their ability of antiquorum sensing. Water extracts of Rhubarb, Fructus gardeniae, and Andrographis paniculata show antiquorumsensing activity when using Chromobacterium violaceum CV12472 as reporter; the sub-MIC concentrations of these TCHMs were tested against AHL-dependent phenotypic expressions of PAO1. Results showed significant reduction in pyocyanin pigment, protease, elastase production, and biofilm formation in PAO1 without inhibiting the bacterial growth, revealing that the QSI by the extracts is not related to static or killing effects on the bacteria. The results indicate a potential modulation of bacterial cell-cell communication, P. aeruginosa biofilm, and virulence factors by traditional Chinese herbal medicine. This study introduces not only a new mode of action for traditional Chinese herbal medicines, but also a potential new therapeutic direction for the treatment of bacterial infections, which have QSI activity and might be important in reducing virulence and pathogenicity of pathogenic bacteria.
Understanding the Determinants of Weight-Related Quality of Life among Bariatric Surgery Candidates
Directory of Open Access Journals (Sweden)
Annie Tessier
2012-01-01
Full Text Available Obesity and its relation to quality of life are multifaceted. The purpose of this paper was to contribute evidence to support a framework for understanding the impact of obesity on quality of life in 42 morbidly obese subjects considering a wide number of potential determinants. A model of weight-related quality of life (WRQL was developed based on the Wilson-Cleary model, considering subjects' weight characteristics, arterial oxygen pressure (PaO2, walking capacity (6-minute walk test, 6MWT, health-related quality of life (HRQL; Physical and Mental Component Summaries of the SF-36 PCS/MCS, and WRQL. The model of WRQL was tested with linear regressions and a path analysis, which showed that as PaO2 at rest increased 6MWT increased. 6MWT was positively associated with the PCS, which in turn was positively related to WRQL along with the MCS. The model showed good fit and explained 38% of the variance in WRQL.
de Jonge, Evert; Peelen, Linda; Keijzers, Peter J.; Joore, Hans; de Lange, Dylan; van der Voort, Peter Hj; Bosman, Robert J.; de Waal, Ruud Al; Wesselink, Ronald; de Keizer, Nicolette F.
2008-01-01
Introduction The aim of this study was to investigate whether in-hospital mortality was associated with the administered fraction of oxygen in inspired air (FiO(2)) and achieved arterial partial pressure of oxygen (PaO2). Methods This was a retrospective, observational study on data from the first
de Jonge, Evert; Peelen, Linda; Keijzers, Peter J.; Joore, Hans; de Lange, Dylan; van der Voort, Peter H. J.; Bosman, Robert J.; de Waal, Ruud A. L.; Wesselink, Ronald; de Keizer, Nicolette F.
2008-01-01
Introduction The aim of this study was to investigate whether in-hospital mortality was associated with the administered fraction of oxygen in inspired air (FiO(2)) and achieved arterial partial pressure of oxygen (PaO(2)). Methods This was a retrospective, observational study on data from the first
Activity Cycle of Solar Filaments KJ Li , QX Li , PX Gao , J. Mu , HD ...
Indian Academy of Sciences (India)
form software was provided by C. Torrence and G. Campo and is available at URL: http://paos.colorado.edu/research/wavelets/. This work is supported by the 973 project. (2006CB806300), the National Natural Science Foundations of China (40636031 and. 10573034), and the Chinese Academy of Sciences. References.
DEFF Research Database (Denmark)
Kolpen, Mette; Appeldorff, Cecilie F.; Brandt, Sarah
2016-01-01
that production of OH˙may not contribute significantly to the bactericidal activity of colistin on P. aeruginosa biofilm. Thus, we investigated the effect of colistin treatment on biofilm of wild-type PAO1, a catalase-deficient mutant (katA) and a colistin-resistant CF isolate cultured in microtiter plates...
Wahjudi, Mariana; Papaioannou, Evelina; Hendrawati, Oktavia; van Assen, Aart H. G.; van Merkerk, Ronald; Cool, Robbert H.; Poelarends, Gerrit J.; Quax, Wim
The Pseudomonas aeruginosa PAO1 genome has at least two genes, pvdQ and quiP, encoding acylhomoserine lactone (AHL) acylases. Two additional genes, pa 1893 and pa0305, have been predicted to encode penicillin acylase proteins, but have not been characterized. Initial studies on a pa0305 transposon
Ito, Hiroshi; Tanino, Hiromasa; Sato, Tatsuya; Nishida, Yasuhiro; Matsuno, Takeo
2014-07-11
It has not been shown whether accelerated rehabilitation following periacetabular osteotomy (PAO) is effective for early recovery. The purpose of this retrospective study was to compare complication rates in patients with standard and accelerated rehabilitation protocols who underwent PAO. Between January 2002 and August 2011, patients with a lateral center-edge (CE) angle of rehabilitation protocol. In 65 patients (76 hips) with the accelerated rehabilitation protocol, postoperative strengthening of the hip, thigh and core musculature was begun on the day of surgery as tolerated. The exercise program included active hip range of motion, and gentle isometric hamstring and quadriceps muscle sets; these exercises were performed for 30 minutes in the morning and 30 minutes in the afternoon with a physical therapist every weekday for 6 weeks. Full weight-bearing with two axillary crutches started on the day of surgery as tolerated. Complications were evaluated for 2 years. The clinical results at the time of follow-up were similar in the two groups. The average periods between the osteotomy and full-weight-bearing walking without support were 4.2 months and 6.9 months in patients with the accelerated and standard rehabilitation protocols (P rehabilitation protocol could achieve earlier recovery of patients. However, postoperative fractures of the ischial ramus and posterior column of the pelvis were more frequently found in patients with the accelerated rehabilitation protocol (8/76) than in those with the standard rehabilitation protocol (1/80) (P = 0.013). The accelerated rehabilitation protocol seems to have advantages for early muscle recovery in patients undergoing PAO; however, postoperative pelvic fracture rates were unacceptably high in patients with this protocol.
Effect of Salt on the Metabolism of ‘Candidatus Accumulibacter’ Clade I and II
Wang, Zhongwei; Dunne, Aislinn; van Loosdrecht, Mark C. M.; Saikaly, Pascal
2018-01-01
Saline wastewater is known to affect the performance of phosphate-accumulating organisms (PAOs) in enhanced biological phosphorus removal (EBPR) process. However, studies comparing the effect of salinity on different PAO clades are lacking. In this study, 'Candidatus Accumulibacter phosphatis' Clade I and II (hereafter referred to as PAOI and PAOII) were highly enriched (~90% in relative abundance as determined by quantitative FISH) in the form of granules in two sequencing batch reactors. Anaerobic and aerobic batch experiments were conducted to evaluate the effect of salinity on the kinetics and stoichiometry of PAOI and PAOII. PAOI and PAOII communities showed different priority in using polyphosphate (poly-P) and glycogen to generate ATP in the anaerobic phase when exposed to salt, with PAOI depending more on intracellular poly-P degradation (e.g., the proportion of calculated ATP derived from poly-P increased by 5-6% at 0.256 mol/L NaCl or KCl) while PAOII on glycolysis of intracellularly stored glycogen (e.g., the proportion of calculated ATP derived from glycogen increased by 29-30% at 0.256 mol/L NaCl or KCl). In the aerobic phase, the loss of phosphate uptake capability was more pronounced in PAOII due to the higher energy cost to synthesize their larger glycogen pool compared to PAOI. For both PAOI and PAOII, aerobic conversion rates were more sensitive to salt than anaerobic conversion rates. Potassium (K) and sodium (Na) ions exhibited different effect regardless of the enriched PAO culture, suggesting that the composition of salt is an important factor to consider when studying the effect of salt on EBPR performance.
Optimization of enhanced biological phosphorus removal after periods of low loading.
Miyake, Haruo; Morgenroth, Eberhard
2005-01-01
Enhanced biological phosphorus removal is a well-established technology for the treatment of municipal wastewater. However, increased effluent phosphorus concentrations have been reported after periods (days) of low organic loading. The purpose of this study was to evaluate different operating strategies to prevent discharge of effluent after such low-loading periods. Mechanisms leading to these operational problems have been related to the reduction of polyphosphate-accumulating organisms (PAOs) and their storage compounds (polyhydroxy alkanoates [PHA]). Increased effluent phosphorus concentrations can be the result of an imbalance between influent loading and PAOs in the system and an imbalance between phosphorus release and uptake rates. The following operating conditions were tested in their ability to prevent a reduction of PHA and of overall biomass during low organic loading conditions: (a) unchanged operation, (b) reduced aeration time, (c) reduced sludge wastage, and (d) combination of reduced aeration time and reduced sludge wastage. Experiments were performed in a laboratory-scale anaerobic-aerobic sequencing batch reactor, using acetate as the carbon source. Without operational adjustments, phosphorus-release rates decreased during low-loading periods but recovered rapidly. Phosphorus-uptake rates also decreased, and the recovery typically required several days to increase to normal levels. The combination of reduced aeration time and reduced sludge wastage allowed the maintenance of constant levels of both PHA and overall biomass. A mathematical model was used to explain the influence of the tested operating conditions on PAO and PHA concentrations. While experimental results were in general agreement with model predictions, the kinetic expression for phosphorus uptake deviated significantly for the first 24 hours after low-loading conditions. Mechanisms leading to these deviations need to be further investigated.
Directory of Open Access Journals (Sweden)
Colin J Ingham
Full Text Available BACKGROUND: Acquired resistance to antifungal agents now supports the introduction of susceptibility testing for species-drug combinations for which this was previously thought unnecessary. For pathogenic yeasts, conventional phenotypic testing needs at least 24 h. Culture on a porous aluminum oxide (PAO support combined with microscopy offers a route to more rapid results. METHODS: Microcolonies of Candida species grown on PAO were stained with the fluorogenic dyes Fun-1 and Calcofluor White and then imaged by fluorescence microscopy. Images were captured by a charge-coupled device camera and processed by publicly available software. By this method, the growth of yeasts could be detected and quantified within 2 h. Microcolony imaging was then used to assess the susceptibility of the yeasts to amphotericin B, anidulafungin and caspofungin (3.5 h culture, and voriconazole and itraconazole (7 h culture. SIGNIFICANCE: Overall, the results showed good agreement with EUCAST (86.5% agreement; n = 170 and E-test (85.9% agreement; n = 170. The closest agreement to standard tests was found when testing susceptibility to amphotericin B and echinocandins (88.2 to 91.2% and the least good for the triazoles (79.4 to 82.4%. Furthermore, large datasets on population variation could be rapidly obtained. An analysis of microcolonies revealed subtle effects of antimycotics on resistant strains and below the MIC of sensitive strains, particularly an increase in population heterogeneity and cell density-dependent effects of triazoles. Additionally, the method could be adapted to strain identification via germ tube extension. We suggest PAO culture is a rapid and versatile method that may be usefully adapted to clinical mycology and has research applications.
Effect of Salt on the Metabolism of ‘Candidatus Accumulibacter’ Clade I and II
Directory of Open Access Journals (Sweden)
Zhongwei Wang
2018-03-01
Full Text Available Saline wastewater is known to affect the performance of phosphate-accumulating organisms (PAOs in enhanced biological phosphorus removal (EBPR process. However, studies comparing the effect of salinity on different PAO clades are lacking. In this study, ‘Candidatus Accumulibacter phosphatis’ Clade I and II (hereafter referred to as PAOI and PAOII were highly enriched (∼90% in relative abundance as determined by quantitative FISH in the form of granules in two sequencing batch reactors. Anaerobic and aerobic batch experiments were conducted to evaluate the effect of salinity on the kinetics and stoichiometry of PAOI and PAOII. PAOI and PAOII communities showed different priority in using polyphosphate (poly-P and glycogen to generate ATP in the anaerobic phase when exposed to salt, with PAOI depending more on intracellular poly-P degradation (e.g., the proportion of calculated ATP derived from poly-P increased by 5–6% at 0.256 mol/L NaCl or KCl while PAOII on glycolysis of intracellularly stored glycogen (e.g., the proportion of calculated ATP derived from glycogen increased by 29–30% at 0.256 mol/L NaCl or KCl. In the aerobic phase, the loss of phosphate uptake capability was more pronounced in PAOII due to the higher energy cost to synthesize their larger glycogen pool compared to PAOI. For both PAOI and PAOII, aerobic conversion rates were more sensitive to salt than anaerobic conversion rates. Potassium (K+ and sodium (Na+ ions exhibited different effect regardless of the enriched PAO culture, suggesting that the composition of salt is an important factor to consider when studying the effect of salt on EBPR performance.
Directory of Open Access Journals (Sweden)
Gaetan Blandin
2016-07-01
Full Text Available Forward osmosis (FO is a promising membrane technology to combine seawater desalination and water reuse. More specifically, in a FO-reverse osmosis (RO hybrid process, high quality water recovered from the wastewater stream is used to dilute seawater before RO treatment. As such, lower desalination energy needs and/or water augmentation can be obtained while delivering safe water for direct potable reuse thanks to the double dense membrane barrier protection. Typically, FO-RO hybrid can be a credible alternative to new desalination facilities or to implementation of stand-alone water reuse schemes. However, apart from the societal (public perception of water reuse for potable application and water management challenges (proximity of wastewater and desalination plants, FO-RO hybrid has to overcome technical limitation such as low FO permeation flux to become economically attractive. Recent developments (i.e., improved FO membranes, use of pressure assisted osmosis, PAO demonstrated significant improvement in water flux. However, flux improvement is associated with drawbacks, such as increased fouling behaviour, lower rejection of trace organic compounds (TrOCs in PAO operation, and limitation in FO membrane mechanical resistance, which need to be better considered. To support successful implementation of FO-RO hybrid in the industry, further work is required regarding up-scaling to apprehend full-scale challenges in term of mass transfer limitation, pressure drop, fouling and cleaning strategies on a module scale. In addition, refined economics assessment is expected to integrate fouling and other maintenance costs/savings of the FO/PAO-RO hybrid systems, as well as cost savings from any treatment step avoided in the water recycling.
Blandin, Gaetan; Verliefde, Arne R.D.; Comas, Joaquim; Rodriguez-Roda, Ignasi; Le-Clech, Pierre
2016-01-01
Forward osmosis (FO) is a promising membrane technology to combine seawater desalination and water reuse. More specifically, in a FO-reverse osmosis (RO) hybrid process, high quality water recovered from the wastewater stream is used to dilute seawater before RO treatment. As such, lower desalination energy needs and/or water augmentation can be obtained while delivering safe water for direct potable reuse thanks to the double dense membrane barrier protection. Typically, FO-RO hybrid can be a credible alternative to new desalination facilities or to implementation of stand-alone water reuse schemes. However, apart from the societal (public perception of water reuse for potable application) and water management challenges (proximity of wastewater and desalination plants), FO-RO hybrid has to overcome technical limitation such as low FO permeation flux to become economically attractive. Recent developments (i.e., improved FO membranes, use of pressure assisted osmosis, PAO) demonstrated significant improvement in water flux. However, flux improvement is associated with drawbacks, such as increased fouling behaviour, lower rejection of trace organic compounds (TrOCs) in PAO operation, and limitation in FO membrane mechanical resistance, which need to be better considered. To support successful implementation of FO-RO hybrid in the industry, further work is required regarding up-scaling to apprehend full-scale challenges in term of mass transfer limitation, pressure drop, fouling and cleaning strategies on a module scale. In addition, refined economics assessment is expected to integrate fouling and other maintenance costs/savings of the FO/PAO-RO hybrid systems, as well as cost savings from any treatment step avoided in the water recycling. PMID:27376337
Effect of Salt on the Metabolism of ‘Candidatus Accumulibacter’ Clade I and II
Wang, Zhongwei
2018-03-16
Saline wastewater is known to affect the performance of phosphate-accumulating organisms (PAOs) in enhanced biological phosphorus removal (EBPR) process. However, studies comparing the effect of salinity on different PAO clades are lacking. In this study, \\'Candidatus Accumulibacter phosphatis\\' Clade I and II (hereafter referred to as PAOI and PAOII) were highly enriched (~90% in relative abundance as determined by quantitative FISH) in the form of granules in two sequencing batch reactors. Anaerobic and aerobic batch experiments were conducted to evaluate the effect of salinity on the kinetics and stoichiometry of PAOI and PAOII. PAOI and PAOII communities showed different priority in using polyphosphate (poly-P) and glycogen to generate ATP in the anaerobic phase when exposed to salt, with PAOI depending more on intracellular poly-P degradation (e.g., the proportion of calculated ATP derived from poly-P increased by 5-6% at 0.256 mol/L NaCl or KCl) while PAOII on glycolysis of intracellularly stored glycogen (e.g., the proportion of calculated ATP derived from glycogen increased by 29-30% at 0.256 mol/L NaCl or KCl). In the aerobic phase, the loss of phosphate uptake capability was more pronounced in PAOII due to the higher energy cost to synthesize their larger glycogen pool compared to PAOI. For both PAOI and PAOII, aerobic conversion rates were more sensitive to salt than anaerobic conversion rates. Potassium (K) and sodium (Na) ions exhibited different effect regardless of the enriched PAO culture, suggesting that the composition of salt is an important factor to consider when studying the effect of salt on EBPR performance.
Coutu, Paige; Caulkett, Nigel; Pang, Daniel; Boysen, Søren
2015-09-01
Hypoxemia is common during equine field anesthesia. Our hypothesis was that oxygen therapy from a portable oxygen concentrator would increase PaO2 during field anesthesia compared with the breathing of ambient air. Prospective clinical study. Fifteen yearling (250 - 400 kg) horses during field castration. Horses were maintained in dorsal recumbency during anesthesia with an intravenous infusion of 2000 mg ketamine and 500 mg xylazine in 1 L of 5% guaifenesin. Arterial samples for blood gas analysis were collected immediately post-induction (PI), and at 15 and 30 minutes PI. The control group (n = 6) breathed ambient air. The treatment group (n = 9) were administered pulsed-flow oxygen (192 mL per bolus) by nasal insufflation during inspiration for 15 minutes PI, then breathed ambient air. The study was performed at 1300 m above sea level. One-way and two-way repeated-measures anova with post-hoc Bonferroni tests were used for within and between-group comparisons, respectively. Significance was set at p ≤ 0.05. Mean ± SD PaO2 in controls at 0, 15 and 30 minutes PI were 46 ± 7 mmHg (6.1 ± 0.9 kPa), 42 ± 9 mmHg (5.6 ± 1.1 kPa), and 48 ± 7 mmHg (6.4 ± 0.1 kPa), respectively (p = 0.4). In treatment animals, oxygen administration significantly increased PaO2 at 15 minutes PI to 60 ± 13 mmHg (8.0 ± 1.7 kPa), compared with baseline values of 46 ± 8 mmHg (6.1 ± 1 kPa) (p = 0.007), and 30 minute PI values of 48 ± 7 mmHg (6.5 ± 0.9 kPa) (p = 0.003). These data show that a pulsed-flow delivery of oxygen can increase PaO2 in dorsally recumbent horses during field anesthesia with ketamine-xylazine-guaifenesin. The portable oxygen concentrator may help combat hypoxemia during field anesthesia in horses. © 2015 Association of Veterinary Anaesthetists and the American College of Veterinary Anesthesia and Analgesia.
Directory of Open Access Journals (Sweden)
Abdelbaset M. Saleh
2014-10-01
Conclusions: Early diagnosis and ICU admission, a PaO2/FiO2 ratio maintained above 90, a GCS score above 9, a negative fluid balance, a serum creatinine level less than 1.5 mg/dl, and the prevention of HAP were factors associated with an improved outcome in ARDS.
Duffy, Joseph R.; Josephs, Keith A.
2012-01-01
Purpose: To discuss apraxia of speech (AOS) as it occurs in neurodegenerative disease (progressive AOS [PAOS]) and how its careful study may contribute to general concepts of AOS and help refine its diagnostic criteria. Method: The article summarizes our current understanding of the clinical features and neuroanatomical and pathologic correlates…
Spinal compression fractures due to pregnancy-associated osteoporosis
Directory of Open Access Journals (Sweden)
R Krishnakumar
2016-01-01
Conclusion: Vertebral fractures due to PAO should be considered as a differential diagnosis in patients with back pain who are in the third trimester of pregnancy or in postpartum. Early recognition and appropriate conservative management would be necessary to prevent complications such as new vertebral fractures and chronic back pain.
DEFF Research Database (Denmark)
Macià, María D.; Pérez, José L.; Molin, Søren
2011-01-01
tagged PAO1 and PAOMS (mutator [mutS] derivative) strains. Two-day-old biofilms were treated with ciprofloxacin (CIP) for 4 days (t4) at 2 µg/ml, which correlated with the mutant prevention concentration (MPC) and provided an AUC/MIC ratio of 384 that should predict therapeutic success. Biofilms were...
Synthesis of Few-Layer, Large Area Hexagonal-Boron Nitride by Pulsed Laser Deposition (POSTPRINT)
2014-09-01
invention that may relate to them. This report was cleared for public release by the USAF 88th Air Base Wing (88 ABW) Public Affairs Office (PAO) and...ered with a shutter. Depositions were performed in nitrogen background gas, where pressure was controlled by a butterfly valve to preset values within
Guam: U.S. Defense Deployments
2013-11-15
August 8, 2013; Ta Kung Pao, August 12, 2013. 22 Sam Kim, “N. Korea Deploys Medium-Range Missiles, Bolsters Special Forces,” Yonhap, Seoul, February 23...building up its submarine force (both nuclear-powered and diesel-electric). In November 2004, the PLA Navy sent a Han -class nuclear attack submarine
Regulación de la concentración de hemoglobina en la policitemia de altura: modelo matemático
Directory of Open Access Journals (Sweden)
1990-01-01
Full Text Available LA REGULATION DE LA CONCENTRATION DE LHEMOGLOBINE DANS LA POLYCYTHEMIE DALTITUDE: UN MODELE MATHEMATIQUE. Un modèle mathématique a été développé pour étudier la corrélation fonctionnelle entre la concentration dhémoglobine (Hb et la pression veineuse moyenne du O2 (PvO2 a différentes altitudes. Le modèle combine léquation de convection de Fick pour le transport du O2, avec léquation de Hill pour laffinité Hb-O2 et avec léquation empirique qui relie la Hb avec la pression artérielle de O2 (PaO2 chez les natifs andins. Le modèle prédit la fonction adaptative de Hb jusquà une altitude maximale de 3400 m une valeur adaptative limitée du flux sanguin en haute altitude que la régulation homéostatique de la Hb est à son maximum au niveau de la mer et diminue en altitude que la PvO2 rénale est plus sensible à une chute de la PaO2 que la PvO2 corporelle, ce qui correspond au rôle du rein dans la production dérithropoïétine. Le modèle a prouvé son utilité dans lenseignement de la physiologie du transport du O2 dans des conditions normoxiques et hypoxiques. Se ha desarrollado un modelo matemático para estudiar la correlación funcional entre la concentración de hemoglobina (HB y la presión venosa media de O2 (PvO2 a diferentes alturas. El modelo combina la ecuación de convección de Fick para el transporte de O2, con la ecuación de Hill para la afinidad de Hb-O2 y con una ecuación empírica que relaciona la HB con la presión de 02 arterial (PaO2 en nativos andinos. El modelo predice la función adaptativa de Hb hasta un máximo de 3400 m de altura el limitado valor adaptativo del flujo sanguíneo en las grandes alturas que la regulación homeostática de la HB es máxima a nivel del mar y disminuye en la altura que el PvO2 renal es más sensible a una caída del PaO2 que el PvO2 corporal, lo que coincide con el papel del riñón en la producción de eritropoyetina. El modelo ha probado su utilidad
2012-10-16
..., Attn: Public Affairs Office (CESPK-PAO), 1325 J Street, Sacramento, CA 95814. FOR FURTHER INFORMATION..., Sacramento, CA. October 15th, 2012, 4 p.m. to 7 p.m. and Folsom Community Center, 52 Natoma Street, Folsom.... SUMMARY: The U.S. Army Corps of Engineers, Sacramento District (USACE) intends to prepare a joint...
Chai, Xiao-Qing; Ma, Jun; Xie, Yan-Hu; Wang, Di; Chen, Kun-Zhou
2015-12-01
In the present study, we investigated whether flurbiprofen axetil (FA) alleviates hypoxemia during one-lung ventilation (OLV) by reducing the pulmonary shunt/total perfusion (Q s/Q t) ratio, and examined the relationship between the Q s/Q t ratio and the thromboxane B2 (TXB2)/6-keto-prostaglandin F1α (6-K-PGF1α) ratio. Sixty patients undergoing esophageal resection for carcinoma were randomly assigned to groups F and C (n = 30 for each group). FA and placebo were administered i.v. 15 min before skin incision in groups F and C, respectively. The partial pressure of arterial oxygen (PaO2) was measured and the Q s/Q t ratio was calculated. Serum TXB2, 6-K-PGF1α, and endothelin (ET) were measured by radioimmunoassay. The relationship between TXB2/6-K-PGF1α and Q s/Q t was investigated. Compared with group C, PaO2 was higher and the Q s/Q t ratio was lower during OLV in group F (P < 0.05). After treatment with FA, both serum TXB2 and 6-K-PGF1α decreased significantly (P < 0.05) but the TXB2/6-K-PGF1α ratio increased significantly (P < 0.01). Increases in the TXB2/6-K-PGF1α ratio were correlated with reductions in the Q s/Q t ratio during OLV in group F (r = -0.766, P < 0.01). There was no significant difference in serum ET between groups F and C. Treatment with FA reduced the Q s/Q t ratio and further increased the PaO2 level during OLV, possibly due to upregulation of the vasoactive agent TXB2/6-K-PGF1α ratio.
Botha, Hugo; Duffy, Joseph R; Whitwell, Jennifer L; Strand, Edythe A; Machulda, Mary M; Schwarz, Christopher G; Reid, Robert I; Spychalla, Anthony J; Senjem, Matthew L; Jones, David T; Lowe, Val; Jack, Clifford R; Josephs, Keith A
2015-08-01
The consensus criteria for the diagnosis and classification of primary progressive aphasia (PPA) have served as an important tool in studying this group of disorders. However, a large proportion of patients remain unclassifiable whilst others simultaneously meet criteria for multiple subtypes. We prospectively evaluated a large cohort of patients with degenerative aphasia and/or apraxia of speech using multidisciplinary clinical assessments and multimodal imaging. Blinded diagnoses were made using operational definitions with important differences compared to the consensus criteria. Of the 130 included patients, 40 were diagnosed with progressive apraxia of speech (PAOS), 12 with progressive agrammatic aphasia, 9 with semantic dementia, 52 with logopenic progressive aphasia, and 4 with progressive fluent aphasia, while 13 were unclassified. The PAOS and progressive fluent aphasia groups were least impaired. Performance on repetition and sentence comprehension was especially poor in the logopenic group. The semantic and progressive fluent aphasia groups had prominent anomia, but only semantic subjects had loss of word meaning and object knowledge. Distinct patterns of grey matter loss and white matter changes were found in all groups compared to controls. PAOS subjects had bilateral frontal grey matter loss, including the premotor and supplementary motor areas, and bilateral frontal white matter involvement. The agrammatic group had more widespread, predominantly left sided grey matter loss and white matter abnormalities. Semantic subjects had bitemporal grey matter loss and white matter changes, including the uncinate and inferior occipitofrontal fasciculi, whereas progressive fluent subjects only had left sided temporal involvement. Logopenic subjects had diffuse and bilateral grey matter loss and diffusion tensor abnormalities, maximal in the posterior temporal region. A diagnosis of logopenic aphasia was strongly associated with being amyloid positive (46
Directory of Open Access Journals (Sweden)
Saglam M
2015-02-01
Full Text Available Melda Saglam,1 Naciye Vardar-Yagli,1 Sema Savci,2 Deniz Inal-Ince,1 Ebru Calik Kutukcu,1 Hülya Arikan,1 Lutfi Coplu3 1Department of Physiotherapy and Rehabilitation, Faculty of Health Sciences, Hacettepe University, Ankara, Turkey; 2School of Physiotherapy and Rehabilitation, Dokuz Eylul University, Izmir, Turkey; 3Department of Chest Medicine, Faculty of Medicine, Hacettepe University, Ankara, Turkey Background: The risk of hypoxemia increases with the progression of chronic obstructive pulmonary disease (COPD and the deterioration of pulmonary function. The aim of this study was to compare functional capacity, physical activity, and quality of life in hypoxemic and non-hypoxemic patients with COPD.Methods: Thirty-nine COPD patients (mean age: 62.0±7.03 years were included in this study. Arterial blood gas tensions were measured, and patients were divided into two groups according to oxygen partial pressure (PaO2, the hypoxemic COPD (PaO2 <60 mmHg (n=18, and the control (PaO2 ≥60 mmHg (n=21 groups. Functional exercise capacity was evaluated using the 6-minute walk test (6MWT. Oxygen saturation, dyspnea, and fatigue perception were measured before and after the 6MWT. Physical activity was assessed using the International Physical Activity Questionnaire (IPAQ and an accelerometer. Quality of life was assessed using the St George’s Respiratory Questionnaire (SGRQ.Results: The number of emergency visits and hospitalizations were higher in hypoxemic patients (P<0.05. Lung function parameters, 6MWT distance, exercise oxygen saturation, IPAQ total score, and energy expenditure during daily life were significantly lower, but percentage of maximum heart rate reached during the 6MWT was significantly higher, in hypoxemic COPD patients than in controls (P<0.05.Conclusion: Hypoxemia has a profound effect on functional capacity and physical activity in patients with COPD. Keywords: COPD, hypoxemia, 6-minute walk test
Directory of Open Access Journals (Sweden)
Iqbal Ahmad
2017-04-01
Full Text Available Quorum sensing (QS is a global gene regulatory mechanism in bacteria for various traits including virulence factors. Disabling QS system with anti-infective agent is considered as a potential strategy to prevent bacterial infection. Mangifera indica L. (mango has been shown to possess various biological activities including anti-QS. This study investigates the efficacy of leaf extracts on QS-regulated virulence factors and biofilm formation in Gram negative pathogens. Mango leaf (ML extract was tested for QS inhibition and QS-regulated virulence factors using various indicator strains. It was further correlated with the biofilm inhibition and confirmed by electron microscopy. Phytochemical analysis was carried out using ultra performance liquid chromatography (UPLC and gas chromatography–mass spectrometry (GC-MS analysis. In vitro evaluation of anti-QS activity of ML extracts against Chromobacterium violaceum revealed promising dose-dependent interference in violacein production, by methanol extract. QS inhibitory activity is also demonstrated by reduction in elastase (76%, total protease (56%, pyocyanin (89%, chitinase (55%, exopolysaccharide production (58% and swarming motility (74% in Pseudomonas aeruginosa PAO1 at 800 μg/ml concentration. Biofilm formation by P. aeruginosa PAO1 and Aeromonas hydrophila WAF38 was reduced considerably (36–82% over control. The inhibition of biofilm was also observed by scanning electron microscopy. Moreover, ML extracts significantly reduced mortality of Caenorhabditis elegans pre-infected with PAO1 at the tested concentration. Phytochemical analysis of active extracts revealed very high content of phenolics in methanol extract and a total of 14 compounds were detected by GC-MS and UPLC. These findings suggest that phytochemicals from the ML could provide bioactive anti-infective and needs further investigation to isolate and uncover their therapeutic efficacy.
Directory of Open Access Journals (Sweden)
Heidi Mulcahy
2011-10-01
Full Text Available Pseudomonas aeruginosa is an opportunistic pathogen capable of causing both acute and chronic infections in susceptible hosts. Chronic P. aeruginosa infections are thought to be caused by bacterial biofilms. Biofilms are highly structured, multicellular, microbial communities encased in an extracellular matrix that enable long-term survival in the host. The aim of this research was to develop an animal model that would allow an in vivo study of P. aeruginosa biofilm infections in a Drosophila melanogaster host. At 24 h post oral infection of Drosophila, P. aeruginosa biofilms localized to and were visualized in dissected Drosophila crops. These biofilms had a characteristic aggregate structure and an extracellular matrix composed of DNA and exopolysaccharide. P. aeruginosa cells recovered from in vivo grown biofilms had increased antibiotic resistance relative to planktonically grown cells. In vivo, biofilm formation was dependent on expression of the pel exopolysaccharide genes, as a pelB::lux mutant failed to form biofilms. The pelB::lux mutant was significantly more virulent than PAO1, while a hyperbiofilm strain (PAZHI3 demonstrated significantly less virulence than PAO1, as indicated by survival of infected flies at day 14 postinfection. Biofilm formation, by strains PAO1 and PAZHI3, in the crop was associated with induction of diptericin, cecropin A1 and drosomycin antimicrobial peptide gene expression 24 h postinfection. In contrast, infection with the non-biofilm forming strain pelB::lux resulted in decreased AMP gene expression in the fly. In summary, these results provide novel insights into host-pathogen interactions during P. aeruginosa oral infection of Drosophila and highlight the use of Drosophila as an infection model that permits the study of P. aeruginosa biofilms in vivo.
Holban, Alina Maria; Bleotu, Coralia; Chifiriuc, Mariana Carmen; Lazar, Veronica
2017-01-01
The objective of this study was to investigate the effects of P. aeruginosa PAO1 cellular and soluble culture fractions on human mesenchymal stem cells (MSCs) death signaling pathways and cytokine profile. The bone marrow isolated MSCs, incubated for different periods of time with one of the three P. aeruginosa PAO1 culture fractions, i.e. low density whole cultures, heat inactivated bacterial cultures sediments and sterile supernatants, were submitted to the following assays: i) fluorescence microscopy evaluation of cellular morphology and viability; ii) bax, caspase 9, relA and bcl-2 genes expression analysis by qRT-PCR; and iii) quantification of the level of IL-1β, IL-6, IL-8 and IL-10 cytokines released in the MSCs supernatants determined by ELISA. Results were statistically analyzed using the GraphPad In Stat software. The PAO1 whole cultures exhibited the most relevant influences, impacting on MSCs morphology and viability, interfering with apoptotic pathways and significantly stimulating the production of IL-1β and IL-10, while decreasing the production of IL-6 and IL-8. The culture supernatants increased the production of IL-1β and reduced the secretion of all other tested cytokines, while heat-inactivated bacterial cells significantly stimulated both IL-1β and IL-10 production. These data could suggest that in vivo, the fate of P. aeruginosa infection depends on the proportion between different bacterial culture fractions (i.e. the number of viable bacterial cells, the number of dead cells and the amount of bacterial soluble products accumulated locally) that could be influenced by the initial infective dose, by the host defense mechanisms, and also by the administered antimicrobial treatment that may thus interfere with the evolution and magnitude of the induced lesions. Copyright© Bentham Science Publishers; For any queries, please email at epub@benthamscience.org.
International Nuclear Information System (INIS)
Farnum, M.F.; Klinman, J.P.
1986-01-01
Bovine plasma amine oxidase (PAO) has previously been shown to catalyze a nonstereospecific loss of tritium from [2(R)- 3 H]- and [2(S)- 3 H]dopamines, attributed to multiple, catalytically active binding sites for substrate. Analysis of products formed from incubation of dopamine with PAO in tritiated water indicates a stereospecific, pro-R, incorporation of label at C-2. Thus, tritium washout (random) and washin (pro-R) are not the microscopic reverse of one another. We conclude that the (enamine) intermediates leading to tritium washin are nonequivalently bound. The observation of pro-R incorporation has provided a straightforward synthetic route to [1(R)- 2 H,2(R)- 3 H]- and [1(S)- 2 H,2(R)- 3 H]dopamines, which upon oxidation with PAO are expected to be processed preferentially by 1S and 1R cleavage, respectively. From previously measured isotope effects, we predict the loss of tritium from the 1(R)-2H and 1(S)-2H samples to be 74:8 for a syn relationship between cleavage at C-1 and C-2 vs. 21:90 for an anti relationship. The observation of a 68:18 ratio at 100% conversion provides strong evidence for a syn cleavage. The data support a mechanism in which a single base catalyzes a 1,3-prototrophic shift of hydrogen from C-1 of the substrate to cofactor, followed by exchange from C-2. Additionally, the results confirm the presence of alternate binding modes for dopamine at the active site of bovine plasma amine oxidase. This interaction of dopamine with plasma amine oxidase is a rare example of mirror-image catalysis in which a single substrate has two functional binding orientations on an enzyme surface
Diguanylate cyclase activity of the Mycobacterium leprae T cell antigen ML1419c.
Rotcheewaphan, Suwatchareeporn; Belisle, John T; Webb, Kristofor J; Kim, Hee-Jin; Spencer, John S; Borlee, Bradley R
2016-09-01
The second messenger, bis-(3',5')-cyclic dimeric guanosine monophosphate (cyclic di-GMP), is involved in the control of multiple bacterial phenotypes, including those that impact host-pathogen interactions. Bioinformatics analyses predicted that Mycobacterium leprae, an obligate intracellular bacterium and the causative agent of leprosy, encodes three active diguanylate cyclases. In contrast, the related pathogen Mycobacterium tuberculosis encodes only a single diguanylate cyclase. One of the M. leprae unique diguanylate cyclases (ML1419c) was previously shown to be produced early during the course of leprosy. Thus, functional analysis of ML1419c was performed. The gene encoding ML1419c was cloned and expressed in Pseudomonas aeruginosa PAO1 to allow for assessment of cyclic di-GMP production and cyclic di-GMP-mediated phenotypes. Phenotypic studies revealed that ml1419c expression altered colony morphology, motility and biofilm formation of P. aeruginosa PAO1 in a manner consistent with increased cyclic di-GMP production. Direct measurement of cyclic di-GMP levels by liquid chromatography-mass spectrometry confirmed that ml1419c expression increased cyclic di-GMP production in P. aeruginosa PAO1 cultures in comparison to the vector control. The observed phenotypes and increased levels of cyclic di-GMP detected in P. aeruginosa expressing ml1419c could be abrogated by mutation of the active site in ML1419c. These studies demonstrated that ML1419c of M. leprae functions as diguanylate cyclase to synthesize cyclic di-GMP. Thus, this protein was renamed DgcA (Diguanylate cyclase A). These results also demonstrated the ability to use P. aeruginosa as a heterologous host for characterizing the function of proteins involved in the cyclic di-GMP pathway of a pathogen refractory to in vitro growth, M. leprae.
Directory of Open Access Journals (Sweden)
Jianhao Luo
2017-09-01
Full Text Available Centipedegrass (Eremochloa ophiuroides [Munro] Hack. is an important warm-season turfgrass species. Transgenic centipedgrass plants overexpressing S-adenosylmethionine decarboxylase from bermudagrass (CdSAMDC1 that was induced in response to cold were generated in this study. Higher levels of CdSAMDC1 transcript and sperimidine (Spd and spermin (Spm concentrations and enhanced freezing and chilling tolerance were observed in transgenic plants as compared with the wild type (WT. Transgenic plants had higher levels of polyamine oxidase (PAO activity and H2O2 than WT, which were blocked by pretreatment with methylglyoxal bis (guanylhydrazone or MGBG, inhibitor of SAMDC, indicating that the increased PAO and H2O2 were a result of expression of CdSAMDC1. In addition, transgenic plants had higher levels of nitrate reductase (NR activity and nitric oxide (NO concentration. The increased NR activity were blocked by pretreatment with MGBG and ascorbic acid (AsA, scavenger of H2O2, while the increased NO level was blocked by MGBG, AsA, and inhibitors of NR, indicating that the enhanced NR-derived NO was dependent upon H2O2, as a result of expression CdSAMDC1. Elevated superoxide dismutase (SOD and catalase (CAT activities were observed in transgenic plants than in WT, which were blocked by pretreatment with MGBG, AsA, inhibitors of NR and scavenger of NO, indicating that the increased activities of SOD and CAT depends on expression of CdSAMDC1, H2O2, and NR-derived NO. Our results suggest that the elevated cold tolerance was associated with PAO catalyzed production of H2O2, which in turn led to NR-derived NO production and induced antioxidant enzyme activities in transgenic plants.
Selected cardiopulmonary values and baroreceptor reflex in conscious green iguanas (Iguana iguana).
Hernandez, Sonia M; Schumacher, Juergen; Lewis, Stephen J; Odoi, Agricola; Divers, Stephen J
2011-11-01
To determine selected cardiopulmonary values and baroreceptor response in conscious green iguanas (Iguana iguana) and to evaluate the use of blood gas analysis and pulse oximetry in this species. 15 healthy juvenile green iguanas. Baseline cardiopulmonary values were determined in 15 conscious iguanas breathing room air. Effects of 100% O(2) inspiration were also measured (n = 6), and the baroreceptor reflex was characterized by exponential sigmoidal curve fitting analysis. Conscious iguanas had a mean ± SD resting heart rate of 52 ± 8 beats/min, respiratory rate of 28 ± 6 breaths/min, and systolic, mean, and diastolic arterial blood pressures of 69 ± 10 mm Hg, 62 ± 12 mm Hg, and 56 ± 13 mm Hg, respectively. Mean arterial pH at 37°C was 7.29 ± 0.11, PaO(2) was 81 ± 10 mm Hg, and PaCO(2) was 42 ± 9 mm Hg; corrected for a body temperature of 30°C, mean arterial pH at 37°C was 7.382 ±0.12, PaO(2) was 54 ± 15 mm Hg, and PaCO(2) was 32 ± 7 mm Hg. Inspiration of 100% O(2) did not change heart and respiratory rates but increased PaO(2) to 486 ± 105 mm Hg (corrected value, 437 ± 96 mm Hg). A baroreceptor reflex was evident, with mean heart rates ranging from 30 ± 3 beats/min to 63 ± 5 beats/min and mean arterial blood pressures ranging from 42 ± 3 mm Hg to 58 ± 3 mm Hg. This study provided needed information on cardiopulmonary values in healthy green iguanas, the application and limitation of arterial and venous blood gas analysis, and the accuracy of pulse oximetry.
Kim, Jung Eun; Phuntsho, Sherub; Ali, Syed Muztuza; Choi, Joon Young; Shon, Ho Kyong
2018-01-01
This study evaluates various options for full-scale modular configuration of forward osmosis (FO) process for osmotic dilution of seawater using wastewater for simultaneous desalination and water reuse through FO-reverse osmosis (RO) hybrid system. Empirical relationship obtained from one FO membrane element operation was used to simulate the operational performances of different FO module configurations. The main limiting criteria for module operation is to always maintain the feed pressure higher than the draw pressure throughout the housing module for safe operation without affecting membrane integrity. Experimental studies under the conditions tested in this study show that a single membrane housing cannot accommodate more than four elements as the draw pressure exceeds the feed pressure. This then indicates that a single stage housing with eight elements is not likely to be practical for safe FO operation. Hence, six different FO modular configurations were proposed and simulated. A two-stage FO configuration with multiple housings (in parallel) in the second stage using same or larger spacer thickness reduces draw pressure build-up as the draw flow rates are reduced to half in the second stage thereby allowing more than four elements in the second stage housing. The loss of feed pressure (pressure drop) and osmotic driving force in the second stage are compensated by operating under the pressure assisted osmosis (PAO) mode, which helps enhance permeate flux and maintains positive pressure differences between the feed and draw chamber. The PAO energy penalty is compensated by enhanced permeate throughput, reduced membrane area, and plant footprint. The contribution of FO/PAO to total energy consumption was not significant compared to post RO desalination (90%) indicating that the proposed two-stage FO modular configuration is one way of making the FO full-scale operation practical for FO-RO hybrid system. Copyright © 2017 Elsevier Ltd. All rights reserved.
Directory of Open Access Journals (Sweden)
James Chloe E
2012-09-01
Full Text Available Abstract Background Pseudomonas aeruginosa is the most common bacterial pathogen infecting the lungs of patients with cystic fibrosis (CF. The Liverpool Epidemic Strain (LES is transmissible, capable of superseding other P. aeruginosa populations and is associated with increased morbidity. Previously, multiple inducible prophages have been found to coexist in the LES chromosome and to constitute a major component of the accessory genome not found in other sequenced P. aerugionosa strains. LES phages confer a competitive advantage in a rat model of chronic lung infection and may, therefore underpin LES prevalence. Here the infective properties of three LES phages were characterised. Results This study focuses on three of the five active prophages (LESφ2, LESφ3 and LESφ4 that are members of the Siphoviridae. All were induced from LESB58 by norfloxacin. Lytic production of LESφ2 was considerably higher than that of LESφ3 and LESφ4. Each phage was capable of both lytic and lysogenic infection of the susceptible P. aeruginosa host, PAO1, producing phage-specific plaque morphologies. In the PAO1 host background, the LESφ2 prophage conferred immunity against LESφ3 infection and reduced susceptibility to LESφ4 infection. Each prophage was less stable in the PAO1 chromosome with substantially higher rates of spontaneous phage production than when residing in the native LESB58 host. We show that LES phages are capable of horizontal gene transfer by infecting P. aeruginosa strains from different sources and that type IV pili are required for infection by all three phages. Conclusions Multiple inducible prophages with diverse infection properties have been maintained in the LES genome. Our data suggest that LESφ2 is more sensitive to induction into the lytic cycle or has a more efficient replicative cycle than the other LES phages.
Luo, Jianhao; Liu, Mingxi; Zhang, Chendong; Zhang, Peipei; Chen, Jingjing; Guo, Zhenfei; Lu, Shaoyun
2017-01-01
Centipedegrass ( Eremochloa ophiuroides [Munro] Hack.) is an important warm-season turfgrass species. Transgenic centipedgrass plants overexpressing S-adenosylmethionine decarboxylase from bermudagrass ( CdSAMDC1 ) that was induced in response to cold were generated in this study. Higher levels of CdSAMDC1 transcript and sperimidine (Spd) and spermin (Spm) concentrations and enhanced freezing and chilling tolerance were observed in transgenic plants as compared with the wild type (WT). Transgenic plants had higher levels of polyamine oxidase (PAO) activity and H 2 O 2 than WT, which were blocked by pretreatment with methylglyoxal bis (guanylhydrazone) or MGBG, inhibitor of SAMDC, indicating that the increased PAO and H 2 O 2 were a result of expression of CdSAMDC1 . In addition, transgenic plants had higher levels of nitrate reductase (NR) activity and nitric oxide (NO) concentration. The increased NR activity were blocked by pretreatment with MGBG and ascorbic acid (AsA), scavenger of H 2 O 2 , while the increased NO level was blocked by MGBG, AsA, and inhibitors of NR, indicating that the enhanced NR-derived NO was dependent upon H 2 O 2 , as a result of expression CdSAMDC1 . Elevated superoxide dismutase (SOD) and catalase (CAT) activities were observed in transgenic plants than in WT, which were blocked by pretreatment with MGBG, AsA, inhibitors of NR and scavenger of NO, indicating that the increased activities of SOD and CAT depends on expression of CdSAMDC1 , H 2 O 2 , and NR-derived NO. Our results suggest that the elevated cold tolerance was associated with PAO catalyzed production of H 2 O 2 , which in turn led to NR-derived NO production and induced antioxidant enzyme activities in transgenic plants.
International Nuclear Information System (INIS)
Fu, Zhi-qiang; Wang, Cheng-biao; Zhang, Wei; Wang, Wei; Yue, Wen; Yu, Xiang; Peng, Zhi-jian; Lin, Song-sheng; Dai, Ming-jiang
2013-01-01
Highlights: • W-doped DLC coating with various W contents was fabricated. • Friction and wear of DLC coated sample was studied. • The lubricant additive was T307. • The influence of W content on friction under lubrication was unveiled. • The influence of W content on wear under lubrication was studied. - Abstract: The influence on tungsten content on the structure, mechanical properties and tribological performance of W-doped diamond-like carbon (DLC) coatings was studied by X-ray photoelectron spectroscopy, nano-indentation, scratch test, and ball-on-disk friction test. It was found that with increasing W content, the content of WC and free W in the coatings is increased while the content of sp 3 -C in the coatings is decreased. The effect of W content on the hardness and elastic modulus of the coatings is indistinctive, but there exists the highest critical load of scratch test of above 100 N when W content is 3.08 at.%. With the increase of W content, the friction coefficients of W-doped DLC coatings under dry friction conditions are increased while the friction coefficients of W-doped DLC coatings under polyalpha olefin (PAO) lubrication are decreased. With the increase of W content, the wear rates of the DLC-coated samples under dry friction conditions show a minimum value; under pure PAO lubrication, the influence of W content on the wear rates of the DLC-coated samples is indistinctive when the W content is below 10.73 at.% while the wear rates are increased with increasing W content from 10.73 at.% to 24.09 at.%; when lubricated by PAO + thiophosphoric acid amine (T307) salt, the samples coated with the undoped DLC or the W-doped DLC with high W content exhibit low wear rates
Nichols, Nicole L.; Dale, Erica A.
2012-01-01
Acute intermittent hypoxia [AIH; 3, 5-min episodes; 35–45 mmHg arterial Po2 (PaO2)] elicits serotonin-dependent phrenic long-term facilitation (pLTF), a form of phrenic motor facilitation (pMF) initiated by Gq protein-coupled metabotropic 5-HT2 receptors. An alternate pathway to pMF is induced by Gs protein-coupled metabotropic receptors, including adenosine A2A receptors. AIH-induced pLTF is dominated by the serotonin-dependent pathway and is actually restrained via inhibition from the adenosine-dependent pathway. Here, we hypothesized that severe AIH shifts pLTF from a serotonin-dependent to an adenosine-dependent form of pMF. pLTF induced by severe (25–30 mmHg PaO2) and moderate (45–55 mmHg PaO2) AIH were compared in anesthetized rats, with and without intrathecal (C4) spinal A2A (MSX-3, 130 ng/kg, 12 μl) or 5-HT receptor antagonist (methysergide, 300 μg/kg, 15 μl) injections. During severe, but not moderate AIH, progressive augmentation of the phrenic response during hypoxic episodes was observed. Severe AIH (78% ± 8% 90 min post-AIH, n = 6) elicited greater pLTF vs. moderate AIH (41% ± 12%, n = 8; P MSX-3 (28% ± 6%; n = 6; P 0.05). Thus severe AIH shifts pLTF from a serotonin-dependent to an adenosine-dependent mechanism; the adenosinergic pathway inhibits the serotonergic pathway following moderate AIH. Here we demonstrate a novel adenosine-dependent pathway to pLTF following severe AIH. Shifts in the mechanisms of respiratory plasticity provide the ventilatory control system greater flexibility as challenges that differ in severity are confronted. PMID:22403346
A plasmid-encoded UmuD homologue regulates expression of Pseudomonas aeruginosa SOS genes.
Díaz-Magaña, Amada; Alva-Murillo, Nayeli; Chávez-Moctezuma, Martha P; López-Meza, Joel E; Ramírez-Díaz, Martha I; Cervantes, Carlos
2015-07-01
The Pseudomonas aeruginosa plasmid pUM505 contains the umuDC operon that encodes proteins similar to error-prone repair DNA polymerase V. The umuC gene appears to be truncated and its product is probably not functional. The umuD gene, renamed umuDpR, possesses an SOS box overlapped with a Sigma factor 70 type promoter; accordingly, transcriptional fusions revealed that the umuDpR gene promoter is activated by mitomycin C. The predicted sequence of the UmuDpR protein displays 23 % identity with the Ps. aeruginosa SOS-response LexA repressor. The umuDpR gene caused increased MMC sensitivity when transferred to the Ps. aeruginosa PAO1 strain. As expected, PAO1-derived knockout lexA- mutant PW6037 showed resistance to MMC; however, when the umuDpR gene was transferred to PW6037, MMC resistance level was reduced. These data suggested that UmuDpR represses the expression of SOS genes, as LexA does. To test whether UmuDpR exerts regulatory functions, expression of PAO1 SOS genes was evaluated by reverse transcription quantitative PCR assays in the lexA- mutant with or without the pUC_umuD recombinant plasmid. Expression of lexA, imuA and recA genes increased 3.4-5.3 times in the lexA- mutant, relative to transcription of the corresponding genes in the lexA+ strain, but decreased significantly in the lexA- /umuDpR transformant. These results confirmed that the UmuDpR protein is a repressor of Ps. aeruginosa SOS genes controlled by LexA. Electrophoretic mobility shift assays, however, did not show binding of UmuDpR to 5' regions of SOS genes, suggesting an indirect mechanism of regulation.
Husain, Fohad M.; Ahmad, Iqbal; Al-thubiani, Abdullah S.; Abulreesh, Hussein H.; AlHazza, Ibrahim M.; Aqil, Farrukh
2017-01-01
Quorum sensing (QS) is a global gene regulatory mechanism in bacteria for various traits including virulence factors. Disabling QS system with anti-infective agent is considered as a potential strategy to prevent bacterial infection. Mangifera indica L. (mango) has been shown to possess various biological activities including anti-QS. This study investigates the efficacy of leaf extracts on QS-regulated virulence factors and biofilm formation in Gram negative pathogens. Mango leaf (ML) extract was tested for QS inhibition and QS-regulated virulence factors using various indicator strains. It was further correlated with the biofilm inhibition and confirmed by electron microscopy. Phytochemical analysis was carried out using ultra performance liquid chromatography (UPLC) and gas chromatography–mass spectrometry (GC-MS) analysis. In vitro evaluation of anti-QS activity of ML extracts against Chromobacterium violaceum revealed promising dose-dependent interference in violacein production, by methanol extract. QS inhibitory activity is also demonstrated by reduction in elastase (76%), total protease (56%), pyocyanin (89%), chitinase (55%), exopolysaccharide production (58%) and swarming motility (74%) in Pseudomonas aeruginosa PAO1 at 800 μg/ml concentration. Biofilm formation by P. aeruginosa PAO1 and Aeromonas hydrophila WAF38 was reduced considerably (36–82%) over control. The inhibition of biofilm was also observed by scanning electron microscopy. Moreover, ML extracts significantly reduced mortality of Caenorhabditis elegans pre-infected with PAO1 at the tested concentration. Phytochemical analysis of active extracts revealed very high content of phenolics in methanol extract and a total of 14 compounds were detected by GC-MS and UPLC. These findings suggest that phytochemicals from the ML could provide bioactive anti-infective and needs further investigation to isolate and uncover their therapeutic efficacy. PMID:28484444
Duckweed (Lemna minor) as a Model Plant System for the Study of Human Microbial Pathogenesis
Zhang, Yong; Hu, Yangbo; Yang, Baoyu; Ma, Fang; Lu, Pei; Li, Lamei; Wan, Chengsong; Rayner, Simon; Chen, Shiyun
2010-01-01
Background Plant infection models provide certain advantages over animal models in the study of pathogenesis. However, current plant models face some limitations, e.g., plant and pathogen cannot co-culture in a contained environment. Development of such a plant model is needed to better illustrate host-pathogen interactions. Methodology/Principal Findings We describe a novel model plant system for the study of human pathogenic bacterial infection on a large scale. This system was initiated by co-cultivation of axenic duckweed (Lemna minor) plants with pathogenic bacteria in 24-well polystyrene cell culture plate. Pathogenesis of bacteria to duckweed was demonstrated with Pseudomonas aeruginosa and Staphylococcus aureus as two model pathogens. P. aeruginosa PAO1 caused severe detriment to duckweed as judged from inhibition to frond multiplication and chlorophyll formation. Using a GFP-marked PAO1 strain, we demonstrated that bacteria colonized on both fronds and roots and formed biofilms. Virulence of PAO1 to duckweed was attenuated in its quorum sensing (QS) mutants and in recombinant strains overexpressing the QS quenching enzymes. RN4220, a virulent strain of S. aureus, caused severe toxicity to duckweed while an avirulent strain showed little effect. Using this system for antimicrobial chemical selection, green tea polyphenols exhibited inhibitory activity against S. aureus virulence. This system was further confirmed to be effective as a pathogenesis model using a number of pathogenic bacterial species. Conclusions/Significance Our results demonstrate that duckweed can be used as a fast, inexpensive and reproducible model plant system for the study of host-pathogen interactions, could serve as an alternative choice for the study of some virulence factors, and could also potentially be used in large-scale screening for the discovery of antimicrobial chemicals. PMID:21049039
Duckweed (Lemna minor as a model plant system for the study of human microbial pathogenesis.
Directory of Open Access Journals (Sweden)
Yong Zhang
Full Text Available BACKGROUND: Plant infection models provide certain advantages over animal models in the study of pathogenesis. However, current plant models face some limitations, e.g., plant and pathogen cannot co-culture in a contained environment. Development of such a plant model is needed to better illustrate host-pathogen interactions. METHODOLOGY/PRINCIPAL FINDINGS: We describe a novel model plant system for the study of human pathogenic bacterial infection on a large scale. This system was initiated by co-cultivation of axenic duckweed (Lemna minor plants with pathogenic bacteria in 24-well polystyrene cell culture plate. Pathogenesis of bacteria to duckweed was demonstrated with Pseudomonas aeruginosa and Staphylococcus aureus as two model pathogens. P. aeruginosa PAO1 caused severe detriment to duckweed as judged from inhibition to frond multiplication and chlorophyll formation. Using a GFP-marked PAO1 strain, we demonstrated that bacteria colonized on both fronds and roots and formed biofilms. Virulence of PAO1 to duckweed was attenuated in its quorum sensing (QS mutants and in recombinant strains overexpressing the QS quenching enzymes. RN4220, a virulent strain of S. aureus, caused severe toxicity to duckweed while an avirulent strain showed little effect. Using this system for antimicrobial chemical selection, green tea polyphenols exhibited inhibitory activity against S. aureus virulence. This system was further confirmed to be effective as a pathogenesis model using a number of pathogenic bacterial species. CONCLUSIONS/SIGNIFICANCE: Our results demonstrate that duckweed can be used as a fast, inexpensive and reproducible model plant system for the study of host-pathogen interactions, could serve as an alternative choice for the study of some virulence factors, and could also potentially be used in large-scale screening for the discovery of antimicrobial chemicals.
Kioupis, Loukas I.
2000-07-01
With the increased power of modern computers, molecular modeling has been used widely and proven to be a valuable tool for elucidating the physical processes important in many industrial and engineering problems. Of particular interest to us is the rheology and physical chemistry of complex fluids, such as hydrocarbon lubricants and polymers. The goal is to provide qualitative and quantitative molecular-level explanations for the behavior of such fluids, and provide guidance in the development of new improved materials. For example, during the production of poly-α-olefin (PAO) synthetic lubricants, the number of the isomer skeletal structures that can be obtained is staggering. Which of the countless PAO isomers produce a lubricant with superior performance properties? How does it behave under different operational conditions of temperature, pressure, and shear rate? A fundamental understanding of the effect that molecular structure has on the oil's rheological and lubricant performance is first needed, in order to answer these questions. To serve this purpose, we have developed efficient molecular dynamics (MD) simulation programs, which utilize multiple time step algorithms and parallel computational techniques. This enables us to conduct simulations of typical PAO isomers and compute the viscosity, as well as several other dynamic and static properties, as a function of temperature, pressure, and shear rate. The key molecular mechanisms that determine important macroscopic properties, such as viscosity index, viscosity-pressure coefficient, traction coefficient, and shear thinning behavior are discussed. Based on this analysis, lubricant and traction fluid structures that have a high likelihood of having desirable properties are proposed. In addition, studies on simple alkane mixtures are presented, in an attempt to understand the more complex polydisperse lubricant fluids, their blends, and their interaction with additives.
Jia, Xiangli; Yan, Ci; Xu, Sicheng; Gu, Xingli; Wan, Qiufeng; Hu, Xinying; Li, Jingwen; Liu, Guangming; Caikai, Shareli; Guo, Zhijin
2018-02-01
To evaluate the predictive factors for failure of non-invasive positive pressure ventilation (NIPPV) in immunosuppressed patients with acute respiratory failure (ARF). The clinical data of 118 immuno-deficient patients treated with NIPPV in the respiratory and intensive care unit (RICU) of the First Affiliated Hospital of Xinjiang Medical University from January 2012 to August 2017 were retrospectively analyzed. The patients were divided into a non-endotracheal intubation (ETI) group (n = 62) and ETI group (n = 56) according to whether ETI was performed during the hospitalization period or not. Each observed indicator was analyzed by univariate analysis, and factors leading to failure of NIPPV were further analyzed by Logistic regression. Receiver operating characteristic (ROC) curve was plotted to evaluate the predictive value of risk factors for failure of NIPPV in immunosuppressed patients with ARF. The non-intubation rate for NIPPV in immunosuppressed patients was 50.8% (60/118). Compared with the non-ETI group, the body temperature, pH value in the ETI group were significantly increased, the partial pressure of arterial carbon dioxide (PaCO 2 ) was significantly decreased, the ratio of oxygenation index (PaO 2 /FiO 2 ) failure of NIPPV. ROC curve analysis showed that the APACHE II score ≥ 20 and PaO 2 /FiO 2 failure of NIPPV, the area under ROC curve (AUC) of the APACHE II score ≥ 20 was 0.787, the sensitivity was 83.93%, the specificity was 69.35%, the positive predict value (PPV) was 71.21%, the negative predict value (NPV) was 82.69%, the positive likelihood ratio (PLR) was 2.74, the negative likelihood ratio (NLR) was 0.23, and Youden index was 0.53; the AUC of PaO 2 /FiO 2 failure of NIPPV in immunocompromised patients.
Hernu, R; Wallet, F; Thiollière, F; Martin, O; Richard, J C; Schmitt, Z; Wallon, G; Delannoy, B; Rimmelé, T; Démaret, C; Magnin, C; Vallin, H; Lepape, A; Baboi, L; Argaud, L; Piriou, V; Allaouchiche, B; Aubrun, F; Bastien, O; Lehot, J J; Ayzac, L; Guérin, C
2013-12-01
The Berlin definition for acute respiratory distress syndrome (ARDS) is a new proposal for changing the American-European consensus definition but has not been assessed prospectively as yet. In the present study, we aimed to determine (1) the prevalence and incidence of ARDS with both definitions, and (2) the initial characteristics of patients with ARDS and 28-day mortality with the Berlin definition. We performed a 6-month prospective observational study in the ten adult ICUs affiliated to the Public University Hospital in Lyon, France, from March to September 2012. Patients under invasive or noninvasive mechanical ventilation, with PaO2/FiO2 Conference and the Berlin definition criteria. The complete data set was measured at the time of inclusion. Patient outcome was measured at day 28 after inclusion. During the study period 3,504 patients were admitted and 278 fulfilled the American-European Consensus Conference criteria. Among them, 18 (6.5 %) did not comply with the Berlin criterion PEEP ≥ 5 cmH2O and 20 (7.2 %) had PaO2/FiO2 ratio ≤200 while on noninvasive ventilation. By using the Berlin definition in the remaining 240 patients (n = 42 mild, n = 123 moderate, n = 75 severe), the overall prevalence was 6.85 % and it was 1.20, 3.51, and 2.14 % for mild, moderate, and severe ARDS, respectively (P > 0.05 between the three groups). The incidence of ARDS amounted to 32 per 100,000 population per year, with values for mild, moderate, and severe ARDS of 5.6, 16.3, and 10 per 100,000 population per year, respectively (P Berlin definition of ARDS. Neither the stratification by severity nor the PaO2/FiO2 at study entry was independently associated with mortality.
Improvement of carbon usage for phosphorus recovery in EBPR-r and the shift in microbial community.
Wong, Pan Yu; Cheng, Ka Yu; Krishna, K C Bal; Kaksonen, Anna H; Sutton, David C; Ginige, Maneesha P
2018-07-15
Enhanced biological phosphorus removal and recovery (EBPR-r) is a biofilm process that makes use of polyphosphate accumulating organisms (PAOs) to remove and recover phosphorus (P) from wastewater. The original process was inefficient, as indicated by the low P-release to carbon (C)-uptake (P rel /C upt ) molar ratio of the biofilm. This study successfully validated a strategy to improve the P rel /C upt ratio by at least 3-fold. With an unchanged supply of carbon in the recovery stream, an increase in the hydraulic loading in stages I, II and III (7.2, 14.4 and 21.6 L, respectively) resulted in a 43% increase in the P rel /C upt ratio (0.069, 0.076 and 0.103, respectively). The ratio further increased by 150% (from 0.103 to 0.255) when the duration of the P uptake period was increased from 4 h (stage III) to 10 h (stage IV). Canonical correspondence analysis showed that, correlated to the 3-fold increase in the P rel /C upt ratio, there was an increase in the abundance of PAOs ("Candidatus Accumulibacter" Clade IIA) and a decrease in the occurrence of glycogen accumulating organisms (GAOs) (family Sinobacteraceae). However, the four stage operation impaired denitrification, resulting in a 5-fold reduction in the N den /P upt ratio. The decline in denitrification was consistent with a decrease in the abundance of denitrifiers including denitrifying PAOs (family Comamonadaceae and "Candidatus Accumulibacter" Clade IA). Overall, a strategy to facilitate more efficient use of carbon was validated, enabling a 3-fold carbon saving for P recovery. The new process enabled up to 80% of the wastewater P to be captured in a P-enriched stream (>90 mg/L) with a single uptake/release cycle of recovery. Copyright © 2018 Elsevier Ltd. All rights reserved.
Effects of Variety and Fungicidal Rate on Cercospora Leaf Spots ...
African Journals Online (AJOL)
Singh, V.R., Pandes, A.K., Reddy, P.M. and. Pao P.V. (1995). Resistance to Rust and Late leaf Spot of Groundnut. ICRISAT. Information Bulletin. No.47, Patancheru,. 502, 324, Andra Pradesh, India. P.24. Thapar, S., Bhusham, R. and Mathur, R.P.. (1995). Degradation of organophosphorus and carbamate pesticides in soils- ...
DEFF Research Database (Denmark)
Meinhold, Jens; Filipe, Carlos D.M.; Daigger, Glen T.
1999-01-01
fractions of PAO are performed and compared. This study extends on previously reported results (Kerrn-Jespersen and Henze, 1993) in that the pH was controlled to around pH 7 to assure that phosphate precipitation was minimal, and in the measurement of PHB and PHV. With regards to the latter, the paper also...
Translations of JEN-MIN JIH-PAO Articles on Sociological and Economic Subjects
1960-06-23
atmosphere filled, with fiery enthusiasm and the spirit of realism . kchie ver/ients At fcributabie_to_Poli^ios^SBjirning Taking for example the...but also gradually achieved good -quality. The stage play is different from the cinematic film. At the beginning of its performance, there might...forward the combination of revolutionary realism with revolutionary romaticism, &t-<x this is a creative method’which is in keeping with the spirt
Platelet labelled radioisotope studies with Tc-99m-HM-PAO - own experience
International Nuclear Information System (INIS)
Dobkowski, P.; Krolicki, L.; Serafin-Krol, M.; Kielin, Z.; Staszkiewicz, W.
1992-01-01
The protocol of platelet labelling and results of 28 examinations with Tc- 99m labelled thrombocytes have been presented. In 6 cases this method was the only one, which allowed to show thrombotic lesions in carotid arteries. (author). 2 figs, 1 tab
Brain single photon emission computed tomography in neonates
International Nuclear Information System (INIS)
Denays, R.; Van Pachterbeke, T.; Tondeur, M.
1989-01-01
This study was designed to rate the clinical value of [ 123 I]iodoamphetamine (IMP) or [ 99m Tc] hexamethyl propylene amine oxyme (HM-PAO) brain single photon emission computed tomography (SPECT) in neonates, especially in those likely to develop cerebral palsy. The results showed that SPECT abnormalities were congruent in most cases with structural lesions demonstrated by ultrasonography. However, mild bilateral ventricular dilatation and bilateral subependymal porencephalic cysts diagnosed by ultrasound were not associated with an abnormal SPECT finding. In contrast, some cortical periventricular and sylvian lesions and all the parasagittal lesions well visualized in SPECT studies were not diagnosed by ultrasound scans. In neonates with subependymal and/or intraventricular hemorrhage the existence of a parenchymal abnormality was only diagnosed by SPECT. These results indicate that [ 123 I]IMP or [ 99m Tc]HM-PAO brain SPECT shows a potential clinical value as the neurodevelopmental outcome is clearly related to the site, the extent, and the number of cerebral lesions. Long-term clinical follow-up is, however, mandatory in order to define which SPECT abnormality is associated with neurologic deficit
Internal Social Media at Marshall Space Flight Center - An Engineer's Snapshot
Scott, David W.
2013-01-01
In the brief span of about six years (2004-2010), social media radically enhanced people's ways of maintaining recreational friendships. Social media's impact on public affairs (PAO) and community engagement is equally striking: NASA has involved millions of non-NASA viewers in its activities via outward-facing social media, often in a very two-way street fashion. Use of social media as an internal working tool by NASA's tens of thousands of civil servants, onsite contractor employees, and external stakeholders is evolving more slowly. This paper examines, from an engineer's perspective, Marshall Space Flight Center s (MSFC) efforts to bring the power of social media to the daily working environment. Primary emphasis is on an internal Social Networking Service called Explornet that could be scaled Agency-wide. Other topics include MSFC use of other social media day-to-day for non-PAO purposes, some specialized uses of social techniques in space flight control operations, and how to help a community open up so it can discover and adopt what works well.
Energy Technology Data Exchange (ETDEWEB)
Mizukawa, Norihiko; Yano, Ichiro; Tenjin, Hiroshi (Kyoto Prefectural Univ. of Medicine (Japan)) (and others)
1989-02-01
Contemporaneous single photon emission computed tomography (SPECT) and positron emission tomography (PET) were performed in 10 patients with cerebrovascular accidents (CVA), whose ages ranged from 11 to 67 years. I-123-isopropyl-iodoamphetamine (IMP) and/or Tc-99m hexamethylpropyleneamine oxime (HM-PAO) were used for SPECT. Cerebral blood flow (CBF), oxygen extraction fraction (OEF), and cerebral metabolic rate for oxygen (CMRO{sub 2}) were measured by an O-15 labelled gas continuous-inhalation method. SPECT images were quite similar to CBF and CMRO{sub 2} during the chronic stage of CVA. Two patietns with vasospasm during the subacute stage had apparently low CBF and CMRO{sub 2} on PET, but did not have low perfusion on SPECT. Luxury perfusion areas were detected in 4 subacute stage patients and one chronic stage patient. A redistribution of IMP was detected in two patients with infarction during subacute stage. CMRO{sub 2} value in such an area was 2.0 ml/100 g/min. Low CBF and/or CMRO{sub 2} areas were well visualized by IMP rather than by HM-PAO SPECT. (N.K.).
The validation and the limits of SPECT for patients suffering from cerebrovascular accidents
International Nuclear Information System (INIS)
Mizukawa, Norihiko; Yano, Ichiro; Tenjin, Hiroshi
1989-01-01
Contemporaneous single photon emission computed tomography (SPECT) and positron emission tomography (PET) were performed in 10 patients with cerebrovascular accidents (CVA), whose ages ranged from 11 to 67 years. I-123-isopropyl-iodoamphetamine (IMP) and/or Tc-99m hexamethylpropyleneamine oxime (HM-PAO) were used for SPECT. Cerebral blood flow (CBF), oxygen extraction fraction (OEF), and cerebral metabolic rate for oxygen (CMRO 2 ) were measured by an O-15 labelled gas continuous-inhalation method. SPECT images were quite similar to CBF and CMRO 2 during the chronic stage of CVA. Two patietns with vasospasm during the subacute stage had apparently low CBF and CMRO 2 on PET, but did not have low perfusion on SPECT. Luxury perfusion areas were detected in 4 subacute stage patients and one chronic stage patient. A redistribution of IMP was detected in two patients with infarction during subacute stage. CMRO 2 value in such an area was 2.0 ml/100 g/min. Low CBF and/or CMRO 2 areas were well visualized by IMP rather than by HM-PAO SPECT. (N.K.)
DEFF Research Database (Denmark)
Bech, Rune D; Ovesen, Ole; Lindholm, Peter
2014-01-01
BACKGROUND AND PURPOSE: To our knowledge, there is no evidence to support the use of local infiltration analgesia (LIA) for postoperative pain relief after periacetabular osteotomy (PAO). We investigated the effect of wound infiltration with a long-acting local anesthetic (ropivacaine) for postop......BACKGROUND AND PURPOSE: To our knowledge, there is no evidence to support the use of local infiltration analgesia (LIA) for postoperative pain relief after periacetabular osteotomy (PAO). We investigated the effect of wound infiltration with a long-acting local anesthetic (ropivacaine...... subjects received intraoperative infiltration followed by 5 postoperative injections in 10-hour intervals through a multi-holed catheter placed at the surgical site. 26 patients received ropivacaine and 27 received saline. The intervention period was 2 days and the observational period was 4 days. All...... subjects received patient-controlled opioid analgesia without any restrictions on the total daily dose. Pain was assessed at specific postoperative time points and the daily opioid usage was registered. RESULTS: Infiltration with 75 mL (150 mg) of ropivacaine did not reduce postoperative pain or opioid...
The experimental study of oxygen contrast MR ventilation imaging
International Nuclear Information System (INIS)
Yang Jian; Guo Youmin; Wu Xiaoming; Xi Nong; Wang Jianguo; Zhu Li; Lei Xiaoyan; Xie Enyi
2003-01-01
Objective: To study the feasibility and basic technology of the oxygen contrast MR ventilation imaging in lung. Methods: Six canine lungs were scanned by using inversion recovery pulse sequence with turbo spin echo acquisition before and after inhalation of the 100% oxygen as T 1 contrast agent, and the T 1 values were measured. The contrast-to-noise ratio (CNR) for each inversion recovery time was compared and the relationship between arterial blood oxygen pressure (PaO 2 ) and T 1 relaxation rate was observed. Subtraction technique was employed in the postprocessing of pre- and post-oxygen conditions. Results: Molecular oxygen could shorten the pulmonary T 1 value (average 13.37%, t=2.683, P 1 value of pre- and post-oxygen conditions. The relaxtivity of T 1 resulted in excellent linear correlation (r 2 =0.9974) with PaO 2 . Through the subtraction of pre- and post-oxygen image, the oxygen contrast MR ventilation -image was obtained. Conclusion: The oxygen contrast MR ventilation imaging has the feasibility and clinical potential for the assessment of regional pulmonary function
Huang, Jing; Lin, Xin-Zhu; Zheng, Zhi
2016-11-01
To study the clinical effect and safety of high-frequency oscillatory ventilation (HFOV) combined with pulmonary surfactant (PS) in the treatment of neonatal severe meconium aspiration syndrome (MAS) complicated by neonatal pulmonary hemorrhage (NPH). A total of 48 children with severe MAS complicated by NPH were enrolled, and a retrospective analysis was performed for the clinical effects of HFOV+PS (trial group, 25 children) and HFOV alone (control group, 23 children). The blood gas parameters, oxygenation index (OI), PaO 2 /FiO 2 (P/F) value, duration of pulmonary hemorrhage, ventilation time, length of hospital stay, incidence of complications, and outcome were compared between the two groups. At 6, 12, 24, and 48 hours after treatment, the trial group had significantly better PaO 2 , OI, and P/F value than the control group (Phemorrhage (P0.05). HFOV combined with PS can better improve oxygenation function and shorten the duration of NPH and ventilation time. Meanwhile, it does not increase the incidence of adverse events. Therefore, it is a safe and effective therapy.
June Four: A Chronicle of the Chinese Democratic Uprising.
1989
This book presents more than 200 photographs along with a chronological record from the "Ming Pao News," covering the events in People's Republic of China from the death of Hu Yaobang on April 15, 1989, which precipitated the Chinese student democratic movement, to the crushing of the movement at Tiananmen Square by the Chinese army on…
1984-01-01
languages: Arabic , Chinese, French, German, Japanese, Russian, and Spanish. Students from both the basic (FL 131-132) and accelerated-basic (FL 141...gain some insight into just what the studentn are doing and how 19) WILL ANY DATA FRM FILES OR ARCHIVAL DATA BE USED? ElYES 5dNO. Porn PA-O34C (Rev. 7
Project Leninism -- The Powerful Weapon Against Modern Revisionism - Communist China
National Research Council Canada - National Science Library
1960-01-01
...) and the editorial department of the Jen-min Jih-pao. Being important documents on Marxism-Leninism, these three articles represent a powerful weapon for protecting Marxism-Leninism against modern revisionism. Based on Marxist-Leninist viewpoints and the theory of Mao Tse-tung, these articles give a penetrating analysis of some important problems in the present international communist movement.
14 CFR 1206.401 - Location of NASA Information Centers.
2010-01-01
... Locator (URL) addresses are as follows: (1) (HQ) http://www.hq.nasa.gov/office/pao/FOIA/; (2) (ARC) http://george.arc.nasa.gov/dx/FOIA/elec.html; (3) (DFRC) http://www.dfrc.nasa.gov/FOIA/readroom.html; (4) (GRC) http://www.grc.nasa.gov/WWW/FOIA/ReadingRm.htm; (5) (GSFC) http://genesis.gsfc.nasa.gov//foia/read-rm...
Cao, Huiluo
2017-06-12
Pseudomonas aeruginosa ATCC 27853 was isolated from a hospital blood specimen in 1971 and has been widely used as a model strain to survey antibiotics susceptibilities, biofilm development, and metabolic activities of Pseudomonas spp.. Although four draft genomes of P. aeruginosa ATCC 27853 have been sequenced, the complete genome of this strain is still lacking, hindering a comprehensive understanding of its physiology and functional genome.Here we sequenced and assembled the complete genome of P. aeruginosa ATCC 27853 using the Pacific Biosciences SMRT (PacBio) technology and Illumina sequencing platform. We found that accessory genes of ATCC 27853 including prophages and genomic islands (GIs) mainly contribute to the difference between P. aeruginosa ATCC 27853 and other P. aeruginosa strains. Seven prophages were identified within the genome of P. aeruginosa ATCC 27853. Of the predicted 25 GIs, three contain genes that encode monoxoygenases, dioxygenases and hydrolases that could be involved in the metabolism of aromatic compounds. Surveying virulence-related genes revealed that a series of genes that encode the B-band O-antigen of LPS are lacking in ATCC 27853. Distinctive SNPs in genes of cellular adhesion proteins such as type IV pili and flagella biosynthesis were also observed in this strain. Colony morphology analysis confirmed an enhanced biofilm formation capability of ATCC 27853 on solid agar surface compared to Pseudomonas aeruginosa PAO1. We then performed transcriptome analysis of ATCC 27853 and PAO1 using RNA-seq and compared the expression of orthologous genes to understand the functional genome and the genomic details underlying the distinctive colony morphogenesis. These analyses revealed an increased expression of genes involved in cellular adhesion and biofilm maturation such as type IV pili, exopolysaccharide and electron transport chain components in ATCC 27853 compared with PAO1. In addition, distinctive expression profiles of the
Relationship between retinal blood flow and arterial oxygen.
Cheng, Richard W; Yusof, Firdaus; Tsui, Edmund; Jong, Monica; Duffin, James; Flanagan, John G; Fisher, Joseph A; Hudson, Chris
2016-02-01
Vascular reactivity, the response of the vessels to a vasoactive stimulus such as hypoxia and hyperoxia, can be used to assess the vascular range of adjustment in which the vessels are able to compensate for changes in PO2. Previous studies in the retina have not accurately quantified retinal vascular responses and precisely targeted multiple PaO2 stimuli at the same time as controlling the level of carbon dioxide, thus precluding them from modelling the relationship between retinal blood flow and oxygen. The present study modelled the relationship between retinal blood flow and PaO2, showing them to be a combined linear and hyperbolic function. This model demonstrates that the resting tonus of the vessels is at the mid-point and that they have great vascular range of adjustment, compensating for decreases in oxygen above a PETCO2 of 32-37 mmHg but being limited below this threshold. Retinal blood flow (RBF) increases in response to a reduction in oxygen (hypoxia) but decreases in response to increased oxygen (hyperoxia). However, the relationship between blood flow and the arterial partial pressure of oxygen has not been quantified and modelled in the retina, particularly in the vascular reserve and resting tonus of the vessels. The present study aimed to determine the limitations of the retinal vasculature by modelling the relationship between RBF and oxygen. Retinal vascular responses were measured in 13 subjects for eight different blood gas conditions, with the end-tidal partial pressure of oxygen (PETCO2) ranging from 40-500 mmHg. Retinal vascular response measurements were repeated twice; using the Canon laser blood flowmeter (Canon Inc., Tokyo, Japan) during the first visit and using Doppler spectral domain optical coherence tomography during the second visit. We determined that the relationship between RBF and PaO2 can be modelled as a combination of hyperbolic and linear functions. We concluded that RBF compensated for decreases in arterial oxygen content
2017-07-01
contained streamwise-distributed arrays of pressure sensors well upstream of the one measuring station available on the previous model. The streamwise...P. Borg and Roger L. Kimmel Hypersonic Sciences Branch High Speed Systems Division JULY 2017 DISTRIBUTION STATEMENT A...PAO) and is available to the general public, including foreign nationals. Copies may be obtained from the Defense Technical Information Center
2017-12-05
Office (PAO) and is available to the general public, including foreign nationals. Copies may be obtained from the Defense Technical Information... Chief Acquisitions Systems Support Branch Acquisitions Systems Support Branch Systems Support Division Systems Support Division Materials and...Fort Hood, Joint Base Andrews and Joint Base McGuire-Dix- Lakehurst. V2G technologies provide financial and operational incentives to use PEVs beyond
Acute hypoxemic respiratory failure in immunocompromised patients
DEFF Research Database (Denmark)
Azoulay, Elie; Pickkers, Peter; Soares, Marcio
2017-01-01
BACKGROUND: In immunocompromised patients with acute hypoxemic respiratory failure (ARF), initial management aims primarily to avoid invasive mechanical ventilation (IMV). METHODS: To assess the impact of initial management on IMV and mortality rates, we performed a multinational observational.......54-0.87), day-1 SOFA excluding respiratory score (1.12/point, 1.08-1.16), PaO2/FiO2
Continuous oxygen therapy for hypoxic pulmonary disease
DEFF Research Database (Denmark)
Ringbaek, Thomas J
2005-01-01
Continuous oxygen therapy (COT) has become widely accepted in the last 20 years in patients with continuous hypoxemia. This review focuses on guidelines for COT, adherence to these guidelines, and the effect of COT on survival, hospitalization, and quality of life. Guidelines for COT are mainly b...... based on three randomized studies where documentation of hypoxemia (P(a)O2...
Harigae, M; Hirose, Y; Gamo, M; Hirose, M; Fujiwara, C; Matsuo, K
1999-03-01
We applied a continuous intra-arterial blood gas monitoring system (Paratrend 7) to a patient with pulmonary alveolar proteinosis during pulmonary lavage. Lavage was performed under general anesthesia with one lung ventilation. We inserted the sensor of Patatrend 7 through a 20 G catheter into the radial artery, and monitored pH, PaCO2 and PaO2 continuously throughout the procedure. SpO2 and EtCO2 were also monitored. Saline 1000-1500 ml was instilled and drained repeatedly by volume limited methods. PaO2 values by Paratrend 7 increased during instillation and decreased during drainage of the irrigating fluid. In contrast, PaCO2 value by Paratrend 7 decreased slightly during instillation and increased during drainage. The change of SpO2 was almost the same as that by Paratrend 7, but the response time of pulse oxymetry was a little quicker than Paratrend 7. During the lavage procedure, respiratory and circulatory condition changed very rapidly, and it is necessary to monitor blood gas change intensively. Paratrend 7 is useful as a perioperative monitoring system, but pulse oxymetry might be sufficient during pulmonary lavage considering its cost.
In-situ reduced silver nanoparticles on populus fiber and the catalytic application
Energy Technology Data Exchange (ETDEWEB)
Li, Miaomiao; Gong, Yumei, E-mail: ymgong@dlpu.edu.cn; Wang, Wenheng; Xu, Guangpeng; Liu, Yuanfa; Guo, Jing, E-mail: guojing8161@163.com
2017-02-01
Highlights: • A composite involved in in-situ chelating AgNPs on natural cellulose was prepared. • Polyamidoxime grafted from the cellulose adsorbed Ag+ which was reduced to AgNPs. • The composite exhibits excellent catalytic activity in reducing 4-nitrophenol. - Abstract: One kind of composites involved in silver nanoparticles (AgNPs) loading in-situ on natural populus fiber (PF) matrix was prepared by polyamidoxime (PAO) functionalized the cellulose fiber. In which PAO worked as trapping and stabilizing agents chelating silver ions and made it reduced in-situ to obtain AgNPs by borohydride at room temperature. The synthesized composites were characterized by X-ray diffraction (XRD), Fourier transform infrared spectroscopy (FT-IR), thermogravimetric analysis (TGA) and scanning electron microscopy (SEM). Moreover, the composites showed significant catalytic activity 1.87 s{sup −1} g{sup −1} and repeated usability more than 7 cycles in reducing 4-nitrophenol (4-NP) into 4-aminophenol (4-AP) detected by UV–vis spectrophotometer in aqueous solution due to the surface-enhanced immobility and large amount of AgNPs. The natural cellulose fiber provides a green platform to react and support other noble metals for wide catalytic reactions.
[Function in patients with chronic fibrocavernous tuberculosis].
Nefedov, V B; Popova, L A; Shergina, E A
2008-01-01
Vital capacity (VC), forced vital capacity (FVC), forced expiratory volume in 1 second (FEV1), FEV1/VC%, PEF, MEF25, MEF50, MEF75, TLC, TGV, residual volume (RV), R(aw), R(in), R(ex), DLCO-SB, DLCO-SS, PaO2, and PaCO2 were determined in 62 patients with chronic fibrocavernous tuberculosis. Lung dysfunctions were detected in 96.8% of the patients. Changes in lung volumes and capacities were found in 90.3%, impaired bronchial patency was in 90.3%, and pulmonary gas exchange dysfunction was in 79.0%. The lung volume and capacity changes appeared as decreased VC and FVC, decreased and increased TLC, TGV, RV; impaired bronchial patency presented as decreased PEF, MEF25, MEF50, MEF75, and FEV1/VC%; and increased R(aw), R(in), R(ex); pulmonary gas exchange dysfunction manifested itself as reduced DLCO-SB, DLCO-SS, PaO2, and decreased and increased PaCO2. The magnitude of the observed functional changes ranges from slight to significant and drastic with a predominance of considerable and drastic changes in lung volumes and capacities and mild impairments of bronchial patency and pulmonary gas exchange function.
[Pulmonary function in patients with infiltrative pulmonary tuberculosis].
Nefedov, V B; Popova, L A; Shergina, E A
2007-01-01
Vital capacity (VC), forced vital capacity (FVC), forced expiratory volume in 1 second (FEV1), FEV1/VC%, PEF, MEF25, MEF50, MEF75, TLC, TGV, pulmonary residual volume (PRV), R(aw), R(in),, R(ex), DLCO-SB, DLCO-SS, PaO2, and PaCO2 were determined in 103 patients with infiltrative pulmonary tuberculosis. Pulmonary dysfunction was detected in 83.5% of the patients. Changes were found in lung volumes and capacities in 63.1%, impaired bronchial patency and pulmonary gas exchange dysfunction were in 60.2 and 41.7%, respectively. The changes in pulmonary volumes and capacities appeared as increased PRV, decreased VC and FVC, and decreased and increased TGV and TLC; impaired bronchial patency presented as decreased PEF, MEF25, MEF50, MEF75, FEV1/VC% and increased R(aw) R(in), and R(ex); pulmonary gas exchange dysfunction manifested itself as reduced DLCO-SB, DLCO-SS, and PaO2 and decreased and increased PaCO2. The magnitude of the observed functional changes was generally slight. Significant disorders were observed rarely and very pronounced ones were exceptional.
[Pulmonary function in patients with disseminated pulmonary tuberculosis].
Nefedov, V B; Shergina, E A; Popova, L A
2007-01-01
Vital capacity (VC), forced vital capacity (FVC), forced expiratory volume in 1 second (FEV1), FEV1/VC%, PEF, MEF25%, MEF50%, MEF75%, TLS, TGV, pulmonary residual volume (PRV), Raw, Rin, Rex, DLCO-SB, DLCO-SS, PaO2, and PaCO2 were determined in 29 patients with disseminated pulmonary tuberculosis. Pulmonary dysfunction was detected in 93.1% of the patients. Changes were found in lung volumes and capacities in 65.5%, impaired bronchial patency and pulmonary gas exchange dysfunction were in 79.3 and 37.9%, respectively. The changes in pulmonary volumes and capacities appeared as increased PRV, decreased VC, FVC, and TLS, decreased and increased TGV; impaired bronchial patency presented as decreased PEF, MEF25%, MEF50%, MEF75%, and FEV1/VC% and increased Raw, Rin, and Rex; pulmonary gas exchange dysfunction manifested itself as reduced DLCO-SS and PaO2 and decreased and increased PaCO2. The observed functional changes varied from slight to significant and pronounced with a preponderance of small disorders, a lower detection rate of significant disorders, and rare detection of very pronounced ones.
Directory of Open Access Journals (Sweden)
Koh Iba
2017-05-01
Full Text Available Specific cellular components including products of phosphatidylinositol (PI metabolism play an important role as signaling molecules in stomatal responses to environmental signals. In this study, pharmacological inhibitors of a set of cellular components, including PI4-kinase (PI4K and PI3K, were used to investigate stomatal closure in response to CO2, darkness, and abscisic acid (ABA. Treatment with PAO, a specific inhibitor of PI4K, specifically inhibited the stomatal response to CO2 compared with that to darkness and ABA. In contrast, treatment with LY294002, a PI3K-specific inhibitor, specifically inhibited the stomatal response to darkness compared with that to CO2 and ABA. The specific inhibitory effects of PAO and LY294002 were also observed as changes in the spatial density of dot-like structures labeled by green fluorescent protein-tagged PATROL1, a protein that controls stomatal aperture possibly via regulation of H+-ATPase amount in guard cell plasma membranes. Our results suggest an important role for PI4K and PI3K in the CO2 and darkness signal transduction pathways, respectively, that mediate PATROL1 dynamics.
Grizzo, Felipe Merchan Ferraz; da Silva Martins, Janaina; Pinheiro, Marcelo M; Jorgetti, Vanda; Carvalho, Maria Dalva Barros; Pelloso, Sandra Marisa
2015-10-01
Pregnancy and lactation-associated osteoporosis (PAO) is a rare condition with little known pathophysiology. Most cases are diagnosed in the third trimester of pregnancy or in the first weeks postpartum, particularly in first pregnancies. Vertebral fractures are most commonly observed and characterised by prolonged severe pain, functional limitations and a loss of height. Measurements of bone mineral density and biochemical markers of bone remodelling are the clinical methods most commonly used for the management of these patients. However, a bone biopsy with histomorphometric analysis has been considered to be the gold-standard. Few studies have evaluated the histomorphometry in patients with this clinical condition and none of them performed the procedure at the beginning of the clinical assessment. In this study, we report a case of PAO in a 31-year-old postpartum patient who had undergone a twin pregnancy. We describe the clinical, laboratory tests and imaging features. Bone histomorphometry showed a high resorption rate and excellent evolution after 1 year of treatment with intravenous zoledronic acid. Our data suggest that osteoclastogenesis plays a central role in the pathophysiological processes of this disease.
Imaging of lesions in the posterior cranial fossa using single photon emission computed tomography
International Nuclear Information System (INIS)
Kawakami, Michiro; Uesugi, Yasuo; Higashikawa, Masahiko; Ochi, Mari; Makimoto, Kazuo; Takahashi, Hiroaki; Shin, Akinori; Utsunomiya, Keita; Akagi, Hiroaki
1988-01-01
Lesions in the posterior cranial fossa were visualized by single photon emission computed tomography (SPECT) with 123 I-IMP (N-isopropyl-p- 123 I-iodoamphetamine) and 99m Tc-HM-PAO ( 99m Tc-hexametylpropyleneamine oxime). It is generally held that these radiopharmaceuticals penetrate the walls of cerebral blood vessels and that their accumulations in the brain tissue may reflect the cerebral blood flow. Six patients with lesions in the central nervous system all showed wider areas of abnormality in SPECT than in X-ray CT, indicating a larger lesion of blood flow disturbance. In the next series of 11 patients with vertigo or dizziness of unknown etiology, eight had abnormal findings in the scan with 123 I-IMP as did four of the nine in the scan with 99m Tc-HM-PAO. Thus, most patients with dizziness of unknown etiology may have some vertebral blood flow disorder, which in some cases is not clearly diagnosed by conventional vestibular examinations or even by X-ray CT scan. The accuracy of the diagnostic measures for otoneurological problems awaits further studies of their sensitivity and specificity. (author)
Interhospital transfer of children in respiratory failure: a clinician interview qualitative study.
Odetola, Folafoluwa O; Anspach, Renee R; Han, Yong Y; Clark, Sarah J
2017-02-01
To investigate the decision making underlying transfer of children with respiratory failure from level II to level I pediatric intensive care unit care. Interviews with 19 eligible level II pediatric intensive care unit physicians about a hypothetical scenario of a 2-year-old girl in respiratory failure: RESULTS: At baseline, indices critical to management were as follows: OI (53%), partial pressure of oxygen in arterial blood (Pao 2 )/Fio 2 (32%), and inflation pressure (16%). Poor clinical response was signified by high OI, inflation pressure, and Fio 2 , and low Pao 2 /Fio 2 . At EP 1, 18 of 19 respondents would initiate high-frequency oscillatory ventilation, and 1 would transfer. At EP 2, 15 of 18 respondents would maintain high-frequency oscillatory ventilation, 9 of them calling to discuss transfer. All respondents would transfer if escalated therapies failed to reverse the patient's clinical deterioration. Interhospital transfer of children in respiratory failure is triggered by poor response to escalation of locally available care modalities. This finding provides new insight into decision making underlying interhospital transfer of children with respiratory failure. Copyright © 2016 Elsevier Inc. All rights reserved.
Directory of Open Access Journals (Sweden)
Jinwei Zhou
2017-05-01
Full Text Available This study reported the efficacy of the metabolites of Plectosphaerella cucumerina, one phyllosphere fungus from Orychophragmus violaceus, against Pseudomonas aeruginosa quorum sensing (QS and QS-regulated biofilms. The minimum inhibitory concentration (MIC of the ethyl acetate (EtOAc extract from P. cucumerina against P. aeruginosa PAO1 was 1.25 mg mL−1. At sub-MIC concentrations, P. cucumerina extract (0.25–1 mg mL−1 not only inhibited biofilm formation but also disrupted preformed biofilms of P. aeruginosa PAO1 without affecting its growth. Fluorescence and scanning electron microscope (SEM showed architectural disruption of the biofilms when treated with P. cucumerina metabolites. Further investigation demonstrated that metabolites in P. cucumerina attenuated the QS-dependent virulence factors. LC-MS/MS spectra coupled with experimentally standard samples suggested that patulin and emodin might act as the principal components possessing anti-biofilm and antivirulence activities. This is the first report of (1 the isolation of P. cucumerina from the phyllosphere of O. violaceus and (2 anti-biofilm, antivirulence, and biofilm disruption activities of this fungus. Thus, this study provides fascinating new pathways for screening antipathogenic agents.
An investigation of Pseudomonas aeruginosa biofilm growth on novel nanocellulose fibre dressings.
Powell, Lydia C; Khan, Saira; Chinga-Carrasco, Gary; Wright, Chris J; Hill, Katja E; Thomas, David W
2016-02-10
Nanocellulose from wood is a novel biomaterial, which is highly fibrillated at the nanoscale. This affords the material a number of advantages, including self-assembly, biodegradability and the ability to absorb and retain moisture, which highlights its potential usefulness in clinical wound-dressing applications. In these in vitro studies, the wound pathogen Pseudomonas aeruginosa PAO1 was used to assess the ability of two nanocellulose materials to impair bacterial growth (nanocelluloses had a relatively small fraction of residual fibres (nanocellulose films and increased cell death when compared to a commercial control wound dressing, Aquacel(®). Nanocellulose suspensions inhibited bacterial growth, whilst UV-vis spectrophotometry and laser profilometry also revealed the ability of nanocellulose to form smooth, translucent films. Atomic force microscopy studies of the surface properties of nanocellulose demonstrated that PAO1 exhibited markedly contrasting morphology when grown on the nanocellulose film surfaces compared to an Aquacel(®) control dressing (p<0.05). This study highlights the potential utility of these biodegradable materials, from a renewable source, for wound dressing applications in the prevention and treatment of biofilm development. Copyright © 2015 Elsevier Ltd. All rights reserved.
On the results of the Pierre Auger Observatory
Energy Technology Data Exchange (ETDEWEB)
Lemoine, Martin, E-mail: lemoine@iap.f [Institut d' Astrophysique de Paris, CNRS, UPMC, 98 bis boulevard Arago, F-75014 Paris (France)
2009-05-15
This paper discusses the correlation recently reported by the Pierre Auger Observatory (PAO) of the arrival directions of the highest energy cosmic rays with active galactic nuclei (AGN) located within 75 Mpc. It is argued that these correlating AGN do not have the power required to be the sources of those particles. It is further argued that the current PAO data disfavors giant radio-galaxies (both Fanaroff-Riley type I and II) as sources of ultra-high energy cosmic rays. The reported correlation with AGN should thus be understood as follows: the AGN trace the distribution of the local large scale structure, in which the actual sources of ultrahigh energy cosmic rays camouflage. The most promising theoretical candidates for these sources are then gamma-ray bursts and magnetars. One important consequence of the above is that one will not detect counterparts in gamma-rays, neutrinos or gravitational waves to the sources of these observed ultrahigh energy cosmic rays, since the cosmic rays are delayed by extragalactic magnetic fields on timescales approx10{sup 4}-10{sup 5} yrs much larger than the emission timescale of these sources.
On the results of the Pierre Auger Observatory
International Nuclear Information System (INIS)
Lemoine, Martin
2009-01-01
This paper discusses the correlation recently reported by the Pierre Auger Observatory (PAO) of the arrival directions of the highest energy cosmic rays with active galactic nuclei (AGN) located within 75 Mpc. It is argued that these correlating AGN do not have the power required to be the sources of those particles. It is further argued that the current PAO data disfavors giant radio-galaxies (both Fanaroff-Riley type I and II) as sources of ultra-high energy cosmic rays. The reported correlation with AGN should thus be understood as follows: the AGN trace the distribution of the local large scale structure, in which the actual sources of ultrahigh energy cosmic rays camouflage. The most promising theoretical candidates for these sources are then gamma-ray bursts and magnetars. One important consequence of the above is that one will not detect counterparts in gamma-rays, neutrinos or gravitational waves to the sources of these observed ultrahigh energy cosmic rays, since the cosmic rays are delayed by extragalactic magnetic fields on timescales ∼10 4 -10 5 yrs much larger than the emission timescale of these sources.
Masoumi, Arameh; Ghaemy, Mousa
2014-08-08
A new biosorbent was prepared by grafting polyacrylonitrile onto iranian tragacanth gum (ITG), a naturally and abundantly available polysaccharide, and subsequent amidoximation in the presence of hydroxylamine hydrochloride. This nanohydrogel with amidoxime functional groups [C(NH2)NOH], named polyamidoxime-g-tragacanth (ITG-g-PAO), was characterized and used for the removal of metal ions from aqueous solution. The effect of pH, agitation time, concentration of adsorbate and amount of adsorbent on the extent of adsorption was investigated. The experimental data were analyzed by four isotherms and kinetics equations, and the results were fitted well with the Temkin isotherm and pseudo-second-order model. The maximum adsorption capacities (Qm) of ITG-g-PAO as obtained from Langmuir adsorption isotherm were found to be 100.0, 76.92, 71.42 and 66.67 (mgg(-1)) for the adsorption of metal ions in order of Co(II)>Zn(II)>Cr(III)>Cd(II). The experimental results demonstrate that the above selective order of adsorption capacity is due to formation of stable chelating ring between the bidentate amidoxime ligand and metal ion. Copyright © 2014 Elsevier Ltd. All rights reserved.
Pavlov, V; Lin, P Kong Thoo; Rodilla, V
2002-04-01
The novel polyamine derivatives sulphonamido oxa-spermine (oxa-Spm) and sulphonamido oxa-spermidine (oxa-Spd) exhibited rapid cytotoxic action towards MCF-7 human breast cancer cells with IC50 values of 4.35 and 6.47 pM, respectively, after 24-h drug exposure. Neither compound is a substrate of serum amine oxidase. Both oxa-Spm and oxa-Spd caused cell shrinkage, as determined by phase-contrast microscopy. After incubation with 10 microM of either compound for 8 h, the cells underwent chromatin condensation and nuclear fragmentation. However, no clear DNA ladder was obtained by electrophoresis. The sulphonamido oxa-polyamine derivatives and especially oxa-Spd enhanced the activity of polyamine oxidase (PAO), an enzyme capable of oxidising N1-acetylated spermine and spermidine to spermidine and putrescine, respectively, generating cytotoxic H2O2 and 3-acetamidopropanal as by-products. The intracellular polyamine content was only marginally reduced in response to drug treatment. In conclusion, our data show that these novel sulphonamido oxa-polyamine derivatives possess high cytotoxic activity against MCF-7 cells and indicate that induction of PAO may mediate their cytotoxicity via apoptosis.
Xavier, Joao B; De Kreuk, Merle K; Picioreanu, Cristian; Van Loosdrecht, Mark C M
2007-09-15
Aerobic granular sludge is a novel compact biological wastewater treatment technology for integrated removal of COD (chemical oxygen demand), nitrogen, and phosphate charges. We present here a multiscale model of aerobic granular sludge sequencing batch reactors (GSBR) describing the complex dynamics of populations and nutrient removal. The macro scale describes bulk concentrations and effluent composition in six solutes (oxygen, acetate, ammonium, nitrite, nitrate, and phosphate). A finer scale, the scale of one granule (1.1 mm of diameter), describes the two-dimensional spatial arrangement of four bacterial groups--heterotrophs, ammonium oxidizers, nitrite oxidizers, and phosphate accumulating organisms (PAO)--using individual based modeling (IbM) with species-specific kinetic models. The model for PAO includes three internal storage compounds: polyhydroxyalkanoates (PHA), poly phosphate, and glycogen. Simulations of long-term reactor operation show how the microbial population and activity depends on the operating conditions. Short-term dynamics of solute bulk concentrations are also generated with results comparable to experimental data from lab scale reactors. Our results suggest that N-removal in GSBR occurs mostly via alternating nitrification/denitrification rather than simultaneous nitrification/denitrification, supporting an alternative strategy to improve N-removal in this promising wastewater treatment process.
Jørgensen, Karin Meinike; Wassermann, Tina; Jensen, Peter Østrup; Hengzuang, Wang; Molin, Søren; Høiby, Niels
2013-01-01
The dynamics of occurrence and the genetic basis of ciprofloxacin resistance were studied in a long-term evolution experiment (940 generations) in wild-type, reference strain (PAO1) and hypermutable (PAOΔmutS and PAOMY-Mgm) P. aeruginosa populations continuously exposed to sub-MICs (1/4) of ciprofloxacin. A rapid occurrence of ciprofloxacin-resistant mutants (MIC of ≥12 μg/ml, representing 100 times the MIC of the original population) were observed in all ciprofloxacin-exposed lineages of PAOΔmutS and PAOMY-Mgm populations after 100 and 170 generations, respectively, and in one of the PAO1 lineages after 240 generations. The genetic basis of resistance was mutations in gyrA (C248T and G259T) and gyrB (C1397A). Cross-resistance to beta-lactam antibiotics was observed in the bacterial populations that evolved during exposure to sublethal concentrations of ciprofloxacin. Our study shows that mutants with high-level ciprofloxacin resistance are selected in P. aeruginosa bacterial populations exposed to sub-MICs of ciprofloxacin. This can have implications for the long-term persistence of resistant bacteria and spread of antibiotic resistance by exposure of commensal bacterial flora to low antibiotic concentrations. PMID:23774442
Acute and Two-Week Inhalation Toxicity Studies in Rats for Polyalphaolefin (PAO) Fluid
2017-04-01
Institute for Science and Education (ORISE)); Antonio Brown (ORISE); Joseph B. Brune (Level One Personnel); Kathy A. Frondorf, Nathan M. Gargas... Nutrition , International, LLC, Brentwood MO) and reverse osmosis purified municipal tap water, ad libitum. Rats were randomly assigned to exposure...0.00 Red blood cells (# x 106/µL) 9.08 0.69 8.82 0.83 8.86 0.52 9.01 0.44 Hemoglobin (g/dL) 15.08 1.29 14.70 1.65 14.87 1.16 15.06 0.78 Hematocrit
Directory of Open Access Journals (Sweden)
Yasser Sadek Nassar
2013-01-01
Although the increase in cardiac markers are insignificant, yet they point to the potentially harmful role played by high PEEP, low PH and low PaO2/FiO2 ratio on the heart. Currently, no clinically relevant conclusion can be drawn apart from the recommendation to attempt to lower PEEP and shorten the duration of positive pressure ventilation, even in patients with structurally normal hearts.
The Forbidden World of Off the Record Negotiating for Successful Air Force Media Engagements
2012-02-15
OTR conversations seem common, is neglecting to train PAOs on OTR techniques akin to asking them to join in a high-stakes poker game after only...Report Submitted to the Faculty Air War College In Partial Fulfillment of the Graduation Requirements 15 February 2012...information into news stories with the proper context—that sometimes is impossible under on-the-record constraints. Few public affairs professionals or
Special Observance Planning Guide
2015-11-01
Day o Email/broadcast/installation newspaper o Installation marquee/kiosk • Art exhibit • Musical concert • Film festival at installation theater...historical and cultural site visits or staff rides • Cultural dance demonstration • Cultural food festival • Cultural education, training, or...Written invitation to speaker o Musical support (including coordination with the Color Guard) o Audio-visual support and materials for program o PAO
Directory of Open Access Journals (Sweden)
Staehr Anne K
2012-07-01
Full Text Available Abstract Background A high perioperative inspiratory oxygen fraction (FiO2 may reduce the frequency of surgical site infection. Perioperative atelectasis is caused by absorption, compression and reduced function of surfactant. It is well accepted, that ventilation with 100% oxygen for only a few minutes is associated with significant formation of atelectasis. However, it is still not clear if a longer period of 80% oxygen results in more atelectasis compared to a low FiO2. Our aim was to assess if a high FiO2 is associated with impaired oxygenation and decreased pulmonary functional residual capacity (FRC. Methods Thirty-five patients scheduled for laparotomy for ovarian cancer were randomized to receive either 30% oxygen (n = 15 or 80% oxygen (n = 20 during and for 2 h after surgery. The oxygenation index (PaO2/FiO2 was measured every 30 min during anesthesia and 90 min after extubation. FRC was measured the day before surgery and 2 h after extubation by a rebreathing method using the inert gas SF6. Results Five min after intubation, the median PaO2/FiO2 was 69 kPa [53-71] in the 30%-group vs. 60 kPa [47-69] in the 80%-group (P = 0.25. At the end of anesthesia, the PaO2/FiO2 was 58 kPa [40-70] vs. 57 kPa [46-67] in the 30%- and 80%-group, respectively (P = 0.10. The median FRC was 1993 mL [1610-2240] vs. 1875 mL [1545-2048] at baseline and 1615 mL [1375-2318] vs. 1633 mL [1343-1948] postoperatively in the 30%- and 80%-group, respectively (P = 0.70. Conclusion We found no significant difference in oxygenation index or functional residual capacity between patients given 80% and 30% oxygen for a period of approximately 5 hours. Trial registration ClinicalTrials.gov Identifier: NCT00637936.
Directory of Open Access Journals (Sweden)
Jian Zhang
2013-07-01
Full Text Available OBJECTIVES: This pilot study was designed to utilize stroke volume variation and cardiac index to ensure fluid optimization during one-lung ventilation in patients undergoing thoracoscopic lobectomies. METHODS: Eighty patients undergoing thoracoscopic lobectomy were randomized into either a goal-directed therapy group or a control group. In the goal-directed therapy group, the stroke volume variation was controlled at 10%±1%, and the cardiac index was controlled at a minimum of 2.5 L.min-1.m-2. In the control group, the MAP was maintained at between 65 mm Hg and 90 mm Hg, heart rate was maintained at between 60 BPM and 100 BPM, and urinary output was greater than 0.5 mL/kg-1/h-1. The hemodynamic variables, arterial blood gas analyses, total administered fluid volume and side effects were recorded. RESULTS: The PaO2/FiO2-ratio before the end of one-lung ventilation in the goal-directed therapy group was significantly higher than that of the control group, but there were no differences between the goal-directed therapy group and the control group for the PaO2/FiO2-ratio or other arterial blood gas analysis indices prior to anesthesia. The extubation time was significantly earlier in the goal-directed therapy group, but there was no difference in the length of hospital stay. Patients in the control group had greater urine volumes, and they were given greater colloid and overall fluid volumes. Nausea and vomiting were significantly reduced in the goal-directed therapy group. CONCLUSION: The results of this study demonstrated that an optimization protocol, based on stroke volume variation and cardiac index obtained with a FloTrac/Vigileo device, increased the PaO2/FiO2-ratio and reduced the overall fluid volume, intubation time and postoperative complications (nausea and vomiting in thoracic surgery patients requiring one-lung ventilation.
Schepens, Tom; Cammu, Guy; Saldien, Vera; De Neve, Nikolaas; Jorens, Philippe G; Foubert, Luc; Vercauteren, Marcel
2015-01-01
The use of neuromuscular blocking agents has been associated with severe postoperative respiratory morbidity. Complications can be attributed to inadequate reversal, and reversal agents may themselves have adverse effects. To compare the electromyographic activity of the diaphragm (EMGdi) during recovery from neuromuscular blockade using neostigmine and sugammadex. The hypothesis was that there would be better neuromuscular coupling of the diaphragm when sugammadex was used. A randomised, controlled, parallel-group, single-centre, double-blinded study. District general hospital in Belgium. Twelve healthy male volunteers. Individuals were anaesthetised with propofol and remifentanil. After rocuronium 0.6 mg kg, a transoesophageal electromyography (EMG) recorder was inserted. For reversal of neuromuscular blockade, volunteers received sugammadex 2 mg kg (n = 6) or neostigmine 70 μg kg (n = 6). EMGdi, airway pressure and flow were continuously measured during weaning from the ventilator until tracheal extubation. Arterial blood gas samples were obtained for PaO2 and PaCO2 analysis at the first spontaneous breathing attempt and after tracheal extubation. During weaning, 560 breaths were retained for analysis. The median (95% CI) peak EMGdi was 1.1 (0.9 to 1.5) μV in the neostigmine group and 1.6 (1.3 to 1.9) μV in the sugammadex group (P sugammadex group (P = 0.008). The median (95% CI) tidal volume was 287 (256 to 335) ml after neostigmine and 359 (313 to 398) ml after sugammadex (P = 0.013). The median (95% CI) PaO2 immediately after extubation was 30.5 (22.8 to 37.1) kPa after sugammadex vs. 20.7 (12.9 to 27.5) kPa after neostigmine (P = 0.03). EMGdi, tidal volume and PaO2 following tracheal extubation were increased after sugammadex compared with neostigmine, reflecting diaphragm-driven inspiration after sugammadex administration. Sugammadex may free more diaphragmatic acetylcholine receptors than neostigmine, which has an
In vitro and in vivo motility studies of radiolabelled sperm cells
International Nuclear Information System (INIS)
Balogh, L.; Szasz, F.; Janoki, Gy.A.; Toth, L.; Zoldag, L.; Huszenicza, Gy.
1994-01-01
A new method for radiolabelling of sperm cells with 99m Tc HM-PAO (hexamethyl-propylene-amine-oxide) - LEUCO-SCINT kit, is investigated. The labelling technique for fresh rabbit, bull, sheep and horse as well as frozen-thawed bull sperm was optimized. The optimum conditions for sperm cell labelling (incubation volume, incubation time, initial activity of 99m Tc HM-PAO, cell number) yielded a high labelling efficiency (70-80%) and survival rate (50-60%). The labelled sperm cells were used to study their motility in vitro. The migrating at 37 o C cells incubated capillary tubes containing bovine cervical mucus. The tubes were cut and the activity of the parts measured and valued. We compared the results of living and killed sperm cells and the label alone by the change of species and running time. Ten minutes after the labelling procedures the total activity of microtubes was 2-3 times higher and the activity distribution was different from the results obtained 3 hours after the labelling. The sperm migration in vivo in the living female animals using a non invasive technique was also visualized. The sperm flow was clearly demonstrated in 3 different animal model (rabbit, ewe, hen) under gamma camera. The comparison of the in vivo migration of rabbit and bull sperm cells showed that the homologous sperm migrated faster and farther. On study of bull sperm migration in the ewe genital tract the cornu uteri was clearly visualized. In the hen model the whole genital tract was demonstrated with considerable free activity in the cavum abdominal 24 hours after the artificial insemination. The new method is developed and manufactured by NRIRR, Budapest, originally designed for radiolabelling leucocytes. The 99m Tc HM-PAO Labelled sperm cells with their retained migration properties are suitable for in vitro motility assays and in vitro migration studies in both human and veterinary medicine. (author)
A multipurpose computing center with distributed resources
Chudoba, J.; Adam, M.; Adamová, D.; Kouba, T.; Mikula, A.; Říkal, V.; Švec, J.; Uhlířová, J.; Vokáč, P.; Svatoš, M.
2017-10-01
The Computing Center of the Institute of Physics (CC IoP) of the Czech Academy of Sciences serves a broad spectrum of users with various computing needs. It runs WLCG Tier-2 center for the ALICE and the ATLAS experiments; the same group of services is used by astroparticle physics projects the Pierre Auger Observatory (PAO) and the Cherenkov Telescope Array (CTA). OSG stack is installed for the NOvA experiment. Other groups of users use directly local batch system. Storage capacity is distributed to several locations. DPM servers used by the ATLAS and the PAO are all in the same server room, but several xrootd servers for the ALICE experiment are operated in the Nuclear Physics Institute in Řež, about 10 km away. The storage capacity for the ATLAS and the PAO is extended by resources of the CESNET - the Czech National Grid Initiative representative. Those resources are in Plzen and Jihlava, more than 100 km away from the CC IoP. Both distant sites use a hierarchical storage solution based on disks and tapes. They installed one common dCache instance, which is published in the CC IoP BDII. ATLAS users can use these resources using the standard ATLAS tools in the same way as the local storage without noticing this geographical distribution. Computing clusters LUNA and EXMAG dedicated to users mostly from the Solid State Physics departments offer resources for parallel computing. They are part of the Czech NGI infrastructure MetaCentrum with distributed batch system based on torque with a custom scheduler. Clusters are installed remotely by the MetaCentrum team and a local contact helps only when needed. Users from IoP have exclusive access only to a part of these two clusters and take advantage of higher priorities on the rest (1500 cores in total), which can also be used by any user of the MetaCentrum. IoP researchers can also use distant resources located in several towns of the Czech Republic with a capacity of more than 12000 cores in total.
Cabot, Gabriel; Rodríguez, Cristina; Roman, Elena; Tubau, Fe; Macia, María D.; Moya, Bartolomé; Zamorano, Laura; Suárez, Cristina; Peña, Carmen; Domínguez, María A.; Moncalián, Gabriel; Oliver, Antonio; Martínez-Martínez, Luis
2012-01-01
We investigated the presence of OprD mutations in 60 strains of metallo-ß-lactamase-negative Pseudomonas aeruginosa intermediately susceptible (IS [n = 12]; MIC = 8 μg/ml) or susceptible (S [n = 48]; MICs ≤ 1 to 4 μg/ml) to imipenem and/or meropenem that were isolated from patients with bacteremia in order to evaluate their impact on carbapenem susceptibility profiles. The presence of mutations in oprD was detected by sequencing analysis. OprD expression was assessed by both outer membrane protein (OMP) analysis and real-time PCR (RT-PCR). Fourteen (23%) isolates had an OprD identical to that of PAO1, and OprD modifications were detected in 46 isolates (77%). Isolates were classified as OprD “full-length types” (T1 [n = 40, including both wild-type OprD and variants showing several polymorphisms]) and OprD “deficient types” (T2 [n = 3 for OprD frameshift mutations] and T3 [n = 17 for premature stop codons in oprD]). RT-PCR showed that 5 OprD type T1 isolates presented reduced transcription of oprD (0.1- to 0.4-fold compared to PAO1), while oprD levels increased more than 2-fold over that seen with PAO1 in 4 OprD type T1 isolates. A total of 50% of the isolates belonging to OprD “deficient types” were susceptible to both carbapenems, and 40% were susceptible to meropenem and intermediately susceptible to imipenem. Only one isolate (5%) within this group was intermediately susceptible to both carbapenems, and one (5%) was susceptible to imipenem and intermediately susceptible to meropenem. We concluded that OprD inactivating mutations in clinical isolates of P. aeruginosa are not restricted only to carbapenem-resistant isolates but are also found in isolates with imipenem or meropenem MICs of only 0.06 to 4 μg/ml. PMID:22290967
Wang, Yayi; Zhou, Shuai; Ye, Liu; Wang, Hong; Stephenson, Tom; Jiang, Xuxin
2014-12-15
Nitrite-based phosphorus (P) removal could be useful for innovative biological P removal systems where energy and carbon savings are a priority. However, using nitrite for denitrification may cause nitrous oxide (N2O) accumulation and emissions. A denitrifying nitrite-fed P removal system [Formula: see text] was successfully set up in a sequencing batch reactor (SBR) and was run for 210 days. The maximum pulse addition of nitrite to [Formula: see text] was 11 mg NO2(-)-N/L in the bulk, and a total of 34 mg NO2(-)-N/L of nitrite was added over three additions. Fluorescent in situ hybridization results indicated that the P-accumulating organisms (PAOs) abundance was 75 ± 1.1% in [Formula: see text] , approximately 13.6% higher than that in a parallel P removal SBR using nitrate [Formula: see text] . Type II Accumulibacter (PAOII) (unable to use nitrate as an electron acceptor) was the main PAOs species in [Formula: see text] , contributing 72% to total PAOs. Compared with [Formula: see text] , [Formula: see text] biomass had enhanced nitrite/free nitrous acid (FNA) endurance, as demonstrated by its higher nitrite denitrification and P uptake rates. N2O accumulated temporarily in [Formula: see text] after each pulse of nitrite. Peak N2O concentrations in the bulk for [Formula: see text] were generally 6-11 times higher than that in [Formula: see text] ; these accumulations were rapidly denitrified to nitrogen gases. N2O concentration increased rapidly in nitrate-cultivated biomass when 5 or 10 mg NO2(-)-N/L per pulse was added. Whereas, N2O accumulation did not occur in nitrite-cultivated biomass until up to 30 mg NO2(-)-N/L per pulse was added. Long-term acclimation to nitrite and pulse addition of nitrite in [Formula: see text] reduced the risk of nitrite accumulation, and mitigated N2O accumulation and emissions from denitrifying P removal by nitrite. Copyright © 2014 Elsevier Ltd. All rights reserved.
Directory of Open Access Journals (Sweden)
M. Bush
2004-06-01
Full Text Available White rhinoceros anaesthetised with etorphine and azaperone combination develop adverse physiological changes including hypoxia, hypercapnia, acidosis, tachycardia and hypertension. These changes are more marked in field-anaesthetised rhinoceros. This study was designed to develop a technique to improve safety for field-anaesthetised white rhinoceros by tracheal intubation and oxygen insufflation. Twenty-five free-ranging white rhinoceros were anaesthetised with an etorphine and azaperone combination for translocation or placing microchips in their horns. Once anaesthetised the rhinoceros were monitored prior to crating for transportation or during microchip placement. Physiological measurements included heart and respiratory rate, blood pressure and arterial blood gas samples. Eighteen rhinoceros were intubated using an equine nasogastric tube passed nasally into the trachea and monitored before and after tracheal insufflation with oxygen. Seven rhinoceros were not intubated or insufflated with oxygen and served as controls. All anaesthetised rhinoceros were initially hypoxaemic (percentage arterial haemoglobin oxygen saturation (% O2Sa = 49 % + 16 (mean + SD and PaO2 = 4.666 + 1.200 kPa (35 + 9 mm Hg, hypercapnic (PaCO2 = 8.265 + 1.600 kPa (62 + 12 mm Hg and acidaemic (pHa = 7.171 + 0.073 . Base excess was -6.7 + 3.9 mmol/ℓ, indicating a mild to moderate metabolic acidosis. The rhinoceros were also hypertensive (systolic blood pressure = 21.861 + 5.465 kPa (164 + 41 mm Hg and tachycardic (HR = 107 + 31/min. Following nasal tracheal intubation and insufflation, the % O2Sa and PaO2 increased while blood pHa and PaCO2 remained unchanged.Tracheal intubation via the nose is not difficult, and when oxygen is insufflated, the PaO2 and the % O2Sa increases, markedly improving the safety of anaesthesia, but this technique does not correct the hypercapnoea or acidosis. After regaining their feet following reversal of the anaesthesia, the animals
Development of analytical methods for the determination of volatile fatty acids in wastewater
2013-01-01
M.Sc. (Chemistry) Volatile fatty acids (VFAs) play a pivotal in the process of nutrient removal by biological processes particularly the enhanced biological nutrient removal process with a side-stream elutriation process using activated sludge. These acids are said to act as intermediates which provide feed for the organisms in a biological phosphorus and nitrogen removal (BNPR) system, such as phosphorus-accumulating organisms (PAOs) and nitrate-accumulating bacteria (NABs). In wastewater...
1986-02-01
requirements) are presented in Table IT. The selected candidate base oil was a blend of commercially available neopentyl polyol esters. It was selected...engine validation consisted of: 1. a neopentyl polyol ester blend 2. a deposit inhibitor (Ref. 7) 3. a heterocyclic amine oxidation inhibitor 4...lutely required. The use of a glycol or a synthetic hydrocarbon (polyalphaolefin (PAO)l based fluid has been suggested as a possible basestock material for
Hunter, Carol Lu; Oei, Ju Lee; Lui, Kei; Schindler, Timothy
2017-07-01
To assess correlation between cerebral oxygenation (rScO 2 ), as measured by near-infrared spectroscopy (NIRS), and arterial oxygenation (PaO 2 ), as measured by arterial blood gases, in preterm neonates. Preterm neonates interpretation of NIRS values in neonatal intensive care, and further evaluation is needed to determine the applicability of NIRS to management of preterm infants. ©2017 Foundation Acta Paediatrica. Published by John Wiley & Sons Ltd.
Single-photon emission computed tomography (SPECT) in oediatric migraine
International Nuclear Information System (INIS)
Battistella, P.A.; Pitassi, I.; Ruffilli, R.; Boniver, C.; Suppiej, A.; Casara, G.
1989-01-01
Cerebral blood flow in pediatric patients suffering from different types of migraine is analyzed by SPECT with 99m Tc HM-PAO, during the pain free intervals. The results indicate that such studies may give further information toward the understanding of common and classic forms of migraine and the difference in the CBF patterns of these forms support the hypothesis of a possible different pathogenesis. (H.W.). 13 refs.; 1 tab
Collaboration in Performing Arts
Langeveld, Cees; Belme, D.; Koppenberg, T.
2014-01-01
markdownabstract__Abstract__ As a result of declining government support, performing arts organisations (PAOs) face increased challenges and difficulties in the sector. They attempt to develop new ways of generating income and seek new models of organising the production and presentation of performing arts. Hereby, we can think of collaboration and integration as horizontal and vertical within the production chain of performing arts. There are various reasons for cultural organisations to dec...
Directory of Open Access Journals (Sweden)
Laura Catón
2017-07-01
Full Text Available Fungi are strongly affected by their physical environment. Microfabrication offers the possibility of creating new culture environments and ecosystems with defined characteristics. Here, we report the isolation of a novel member of the fungal genus Acremonium using a microengineered cultivation chip. This isolate was unusual in that it organizes into macroscopic structures when initially cultivated within microwells with a porous aluminum oxide (PAO base. These “templated mycelial bundles” (TMB were formed from masses of parallel hyphae with side branching suppressed. TMB were highly hydrated, facilitating the passive movement of solutes along the bundle. By using a range of culture chips, it was deduced that the critical factors in triggering the TMB were growth in microwells from 50 to 300 μm in diameter with a PAO base. Cultivation experiments, using spores and pigments as tracking agents, indicate that bulk growth of the TMB occurs at the base. TMB morphology is highly coherent and is maintained after growing out of the microwells. TMB can explore their environment by developing unbundled lateral hyphae; TMB only followed if nutrients were available. Because of the ease of fabricating numerous microstructures, we suggest this is a productive approach for exploring morphology and growth in multicellular microorganisms and microbial communities.
Sakuraba, Yasuhito; Schelbert, Silvia; Park, So-Yon; Han, Su-Hyun; Lee, Byoung-Doo; Andrès, Céline Besagni; Kessler, Felix; Hörtensteiner, Stefan; Paek, Nam-Chon
2012-01-01
During leaf senescence, plants degrade chlorophyll to colorless linear tetrapyrroles that are stored in the vacuole of senescing cells. The early steps of chlorophyll breakdown occur in plastids. To date, five chlorophyll catabolic enzymes (CCEs), NONYELLOW COLORING1 (NYC1), NYC1-LIKE, pheophytinase, pheophorbide a oxygenase (PAO), and red chlorophyll catabolite reductase, have been identified; these enzymes catalyze the stepwise degradation of chlorophyll to a fluorescent intermediate, pFCC, which is then exported from the plastid. In addition, STAY-GREEN (SGR), Mendel’s green cotyledon gene encoding a chloroplast protein, is required for the initiation of chlorophyll breakdown in plastids. Senescence-induced SGR binds to light-harvesting complex II (LHCII), but its exact role remains elusive. Here, we show that all five CCEs also specifically interact with LHCII. In addition, SGR and CCEs interact directly or indirectly with each other at LHCII, and SGR is essential for recruiting CCEs in senescing chloroplasts. PAO, which had been attributed to the inner envelope, is found to localize in the thylakoid membrane. These data indicate a predominant role for the SGR-CCE-LHCII protein interaction in the breakdown of LHCII-located chlorophyll, likely to allow metabolic channeling of phototoxic chlorophyll breakdown intermediates upstream of nontoxic pFCC. PMID:22366162
Antibacterial properties of biosurfactants against selected Gram-positive and -negative bacteria.
Díaz De Rienzo, Mayri A; Stevenson, Paul; Marchant, Roger; Banat, Ibrahim M
2016-01-01
The antibacterial properties and ability to disrupt biofilms of biosurfactants (rhamnolipids, sophorolipids) and sodium dodecyl sulphate (SDS) in the presence and absence of selected organic acids were investigated. Pseudomonas aeruginosa PAO1 was inhibited by sophorolipids and SDS at concentrations >5% v/v, and the growth of Escherichia coli NCTC 10418 was also inhibited by sophorolipids and SDS at concentrations >5% and 0.1% v/v, respectively. Bacillus subtilis NCTC 10400 was inhibited by rhamnolipids, sophorolipids and SDS at concentrations >0.5% v/v of all three; the same effect was observed with Staphylococcus aureus ATCC 9144. The ability to attach to surfaces and biofilm formation of P. aeruginosa PAO1, E. coli NCTC 10418 and B. subtilis NCTC 10400 was inhibited by sophorolipids (1% v/v) in the presence of caprylic acid (0.8% v/v). In the case of S. aureus ATCC 9144, the best results were obtained using caprylic acid on its own. It was concluded that sophorolipids are promising compounds for the inhibition/disruption of biofilms formed by Gram-positive and Gram-negative microorganisms and this activity can be enhanced by the presence of booster compounds such as caprylic acid. © FEMS 2015. All rights reserved. For permissions, please e-mail: journals.permissions@oup.com.
International Nuclear Information System (INIS)
Denton, Peter B.; Weiler, Thomas J.
2015-01-01
Determining anisotropies in the arrival directions of cosmic rays at the highest energy is an important task in astrophysics. It is common and useful to partition the sky into spherical harmonics as a measure of anisotropy. The two lowest nontrivial spherical harmonics, the dipole and the quadrupole, are of particular interest, since these distributions encapsulate a dominant single source and a plane of sources, as well as offering relatively high statistics. The best experiments for the detection of ultra high energy cosmic rays currently are all ground-based, with highly nonuniform exposures on the sky resulting from the fixed experimental locations on the Earth. This nonuniform exposure increases the complexity and error in inferring anisotropies. It turns out that there is an optimal latitude for an experiment at which nonuniform exposure does not diminish the inference of the quadrupole moment. We derive the optimal latitude and find that (presumably by a fortuitous coincidence) this optimal latitude runs through the largest cosmic ray experiment, the Pierre Auger Observatory (PAO) in the Southern Hemisphere, and close to the largest cosmic ray experiment in the Northern Hemisphere, the Telescope Array (TA). Consequently, assuming a quadrupole distribution, PAO and TA can reconstruct the cosmic ray quadrupole distribution to a high precision without concern for their partial sky exposure
Canine chronic bronchitis: a pathophysiologic evaluation of 18 cases
International Nuclear Information System (INIS)
Padrid, P.A.; Hornof, W.J.; Kurpershoek, C.J.; Cross, C.E.
1990-01-01
Eighteen dogs with chronic bronchitis were studied using physiologic, radiologic, microbiologic, and pathologic techniques. Twelve of these dogs were evaluated before and after two weeks of oral bronchodilator administration. Thoracic radiographs, tidal breathing flow-volume loops, radioaerosol ventilation scans, airway appearance at bronchoscopy, and airway pathology were abnormal in the majority of dogs studied. There was a significant relationship between abnormal ventilation scans and abnormal results for PaO2 and end-tidal airflow. Bronchoscopy revealed excessive mucus and inflammation of airway mucosa in all 16 dogs undergoing this procedure. Endoscopically obtained aerobic bacterial cultures grew mixed bacterial flora in only three dogs. Increased numbers of neutrophils in 14 dogs were detected by airway lavage cytology. A large number of eosinophils were seen in airway lavages obtained from two dogs; these two dogs also had evidence for eosinophilic bronchitis on endobronchial biopsy. Oral bronchodilator administration resulted in clinical and expiratory airflow improvements in most dogs, but had no effect on PaO2 or on the radioaerosol-scan abnormalities. The presence of both the physiologic and pathologic airway abnormalities of chronic bronchitis in dogs presented to a veterinary hospital with chronic unexplained cough was confirmed, suggesting that aerobic bacteria do not play an etiologic role in most cases
Martín-González, Félix; González-Robledo, Javier; Sánchez-Hernández, Fernando; Moreno-García, María N
2016-05-17
This paper addresses the problem of decision-making in relation to the administration of noninvasive mechanical ventilation (NIMV) in intensive care units. Data mining methods were employed to find out the factors influencing the success/failure of NIMV and to predict its results in future patients. These artificial intelligence-based methods have not been applied in this field in spite of the good results obtained in other medical areas. Feature selection methods provided the most influential variables in the success/failure of NIMV, such as NIMV hours, PaCO2 at the start, PaO2 / FiO2 ratio at the start, hematocrit at the start or PaO2 / FiO2 ratio after two hours. These methods were also used in the preprocessing step with the aim of improving the results of the classifiers. The algorithms provided the best results when the dataset used as input was the one containing the attributes selected with the CFS method. Data mining methods can be successfully applied to determine the most influential factors in the success/failure of NIMV and also to predict NIMV results in future patients. The results provided by classifiers can be improved by preprocessing the data with feature selection techniques.
Directory of Open Access Journals (Sweden)
Hsu-Ching Kao
2013-01-01
Full Text Available Objective. To determine early predictors of outcomes of adult patients with severe acute respiratory failure. Method. 100 consecutive adult patients with severe acute respiratory failure were evaluated in this retrospective study. Data including comorbidities, Sequential Organ Failure Assessment (SOFA score, Acute Physiological Assessment and Chronic Health Evaluation II (APACHE II score, PaO2, FiO2, PaO2/FiO2, PEEP, mean airway pressure (mPaw, and oxygenation index (OI on the 1st and the 3rd day of mechanical ventilation, and change in OI within 3 days were recorded. Primary outcome was hospital mortality; secondary outcome measure was ventilator weaning failure. Results. 38 out of 100 (38% patients died within the study period. 48 patients (48% failed to wean from ventilator. Multivariate analysis showed day 3 OI ( and SOFA ( score were independent predictors of hospital mortality. Preexisting cerebrovascular accident (CVA ( was the predictor of weaning failure. Results from Kaplan-Meier method demonstrated that higher day 3 OI was associated with shorter survival time (log-Rank test, . Conclusion. Early OI (within 3 days and SOFA score were predictors of mortality in severe acute respiratory failure. In the future, prospective studies measuring serial OIs in a larger scale of study cohort is required to further consolidate our findings.
Ware, Lorraine B.; Landeck, Megan; Koyama, Tatsuki; Zhao, Zhiguo; Singer, Jonathan; Kern, Ryan; Neidlinger, Nikole; Nguyen, John; Johnson, Elizabeth; Janz, David R.; Bernard, Gordon R.; Lee, Jae W.; Matthay, Michael A.
2013-01-01
Donor lung utilization rates are persistently low primarily due to donor lung dysfunction. We hypothesized that a treatment that enhances the resolution of pulmonary edema by stimulating the rate of alveolar fluid clearance would improve donor oxygenation and increase donor lung utilization. We conducted a randomized, blinded, placebo-controlled trial of aerosolized albuterol (5 mg q4h) versus saline placebo during active donor management in 506 organ donors. The primary outcome was change in oxygenation (PaO2/FiO2) from enrollment to organ procurement. The albuterol (n=260) and placebo (n=246) groups were well matched for age, gender, ethnicity, smoking, and cause of brain death. The change in PaO2/FiO2 from enrollment to organ procurement did not differ between treatment groups (p=0.54) nor did donor lung utilization (albuterol 29% vs. placebo 32%, p=0.44). Donors in the albuterol vs. placebo group were more likely to have the study drug dose reduced (13% vs. 1%, pdonor management period did not improve donor oxygenation or increase donor lung utilization but did cause tachycardia. High dose aerosolized albuterol should not be used in donors to enhance the resolution of pulmonary edema. PMID:24730050
Directory of Open Access Journals (Sweden)
John Y. C. Tsang
2008-01-01
Full Text Available Previous studies reported that the degree of hypoxemia following acute pulmonary thromboembolism (APTE was highly variable and that its mechanism was mainly due to the creation of many high and low ventilation/perfusion (V/Q units, as a result of the heterogeneous regional blood flow (Q caused by embolic obstruction. We studied the effect of changing cardiac output (Q t on gas exchange after APTE in 5 embolized piglets (23 ± 3 Kg, using Dobutamine intermittently at approximately 20 μg/kg/min for 120 minutes. The distribution of ventilation (V and perfusion (Q at various times was mapped using fluorescent microspheres in 941 ± 60 lung regions. After APTE, increase in Q t by Dobutamine improved venous oxygen tension (PvO 2 but arterial PaO 2 did not change consistently. On the other hand, cluster analysis showed that the V/Q ratio of most lung regions was lowered due to increases in Q at the same time. We concluded that the effect of changing cardiac output on gas exchange following APTE was affected by the simultaneous and varying balance between the changing V/Q mismatch and the concomitantly changing PvO 2 , which might explain the unpredictability of PaO 2 in the clinical setting.
Menéndez García, R A; Franco Díez, F J
2009-01-01
An optimal nutritional diet, especially during the infancy and adolescence, is an important social objective, to create habits and behaviours that will maintain during the adult life of the present children. The objective of this study is to collect and evaluate the publicity of nutritional products and how this is directed to children, before the approval of the codex of regulation of the publicity of nutritional products as directed to minors, prevention of obesity and health (codex PAOS) and after the start of the codex. SETTING, MATERIALS AND METHODS: To watch and collect data from commercials of nutritional products, such as transmitted by television during the infant programs. The obtained results show a great discrepancy between the diet constituted by the commercials for nutritional products and a diet, normally recommended for children. Besides this, nos changes in the commercials were noticed after the start of the codex. The commercials for nutritional products with a very high caloric value are transmitted to children during the infant programs are not appropriate for an optimal diet. The start of the Codex PAOS did not have much effect in the amount and quality of the commercials of nutritional products, such as directed to the infant public.
Respiratory Support for Pharmacologically Induced Hypoxia in Neonatal Calves
Directory of Open Access Journals (Sweden)
C. G. Donnelly
2016-01-01
Full Text Available Practical methods to provide respiratory support to bovine neonates in a field setting are poorly characterised. This study evaluated the response of healthy neonatal calves with pharmacologically induced respiratory suppression to nasal oxygen insufflation and to continuous positive airway pressure (CPAP delivered via an off-the-shelf device. Ten calves were randomised to receive either nasal oxygen insufflation (Group 1, n=5 or CPAP (Group 2, n=5 as a first treatment after induction of respiratory depression by intravenous administration of xylazine, fentanyl, and diazepam. Calves received the alternate treatment after 10 minutes of breathing ambient air. Arterial blood gas samples were obtained prior to sedation, following sedation, following the first and second treatment, and after breathing ambient air before and after the second treatment. Oxygen insufflation significantly increased arterial oxygen partial pressure (PaO2 but was also associated with significant hypercapnia. When used as the first treatment, CPAP was associated with significantly decreased arterial partial pressure of carbon dioxide but did not increase PaO2. These results suggest that the use of CPAP may represent a practical method for correction of hypercapnia associated with inadequate ventilation in a field setting, and further research is required to characterise the use of CPAP with increased inspired oxygen concentrations.
Glass, M L; Soncini, R
1995-01-01
Extensive literature reports a negative delta pHa/delta t in ectothermic vertebrates, but data are scarce as to its consequences for O2 transport. In reptiles, the negative delta pHa/delta t results from an elevated lung gas PCO2 (PACO2) at higher temperatures, implying a corresponding fall of PAO2. In parallel, arterial PO2 rises with temperature, due to a combination of central vascular shunt and decreasing Hb.O2 affinity. As a result, the PO2 gradient between lung gas and blood (PA-aO2) becomes reduced at higher temperatures. In amphibians, the negative delta pHa/delta t results from combined cutaneous and pulmonary CO2 elimination. We propose that this leads to a rather temperature-independent lung gas PO2. Moreover, our calculations suggest that resting reptiles and amphibians maintain a relatively large PA-aO2 also at high temperatures. The negative delta pHa/delta t in teleost fish is generally considered to be a result of modulated plasma [HCO3-]. Recent data from our laboratory suggest that acute pH adjustments at high temperatures may involve alterations of PaCO2 through gill ventilation, leading to a decrease of PaO2 with rising temperature.
Amaral Gonçalves Fusatto, Helena; Castilho de Figueiredo, Luciana; Ragonete Dos Anjos Agostini, Ana Paula; Sibinelli, Melissa; Dragosavac, Desanka
2018-01-01
The aim of this study was to identify pulmonary dysfunction and factors associated with prolonged mechanical ventilation, hospital stay, weaning failure and mortality in patients undergoing coronary artery bypass grafting with use of intra-aortic balloon pump (IABP). This observational study analyzed respiratory, surgical, clinical and demographic variables and related them to outcomes. We analyzed 39 patients with a mean age of 61.2 years. Pulmonary dysfunction, characterized by mildly impaired gas exchange, was present from the immediate postoperative period to the third postoperative day. Mechanical ventilation time was influenced by the use of IABP and PaO2/FiO2, female gender and smoking. Intensive care unit (ICU) stay was influenced by APACHE II score and use of IABP. Mortality was strongly influenced by APACHE II score, followed by weaning failure. Pulmonary dysfunction was present from the first to the third postoperative day. Mechanical ventilation time was influenced by female gender, smoking, duration of IABP use and PaO2/FiO2 on the first postoperative day. ICU stay was influenced by APACHE II score and duration of IABP. Mortality was influenced by APACHE II score, followed by weaning failure. Copyright © 2017 Sociedade Portuguesa de Cardiologia. Publicado por Elsevier España, S.L.U. All rights reserved.