WorldWideScience

Sample records for hot-neptune gj 436b

  1. HIGH METALLICITY AND NON-EQUILIBRIUM CHEMISTRY IN THE DAYSIDE ATMOSPHERE OF HOT-NEPTUNE GJ 436b

    International Nuclear Information System (INIS)

    Madhusudhan, N.; Seager, S.

    2011-01-01

    We present a detailed analysis of the dayside atmosphere of the hot-Neptune GJ 436b, based on recent Spitzer observations. We report statistical constraints on the thermal and chemical properties of the planetary atmosphere, study correlations between the various molecular species, and discuss scenarios of equilibrium and non-equilibrium chemistry in GJ 436b. We model the atmosphere with a one-dimensional line-by-line radiative transfer code with parameterized molecular abundances and temperature structure. We explore the model parameter space with 10 6 models, using a Markov chain Monte Carlo scheme. Our results encompass previous findings, indicating a paucity of methane, an overabundance of CO and CO 2 , and a slight underabundance of H 2 O, as compared to equilibrium chemistry with solar metallicity. The concentrations of the species are highly correlated. Our best-fit, and most plausible, constraints require a CH 4 mixing ratio of 10 -7 to10 -6 , with CO ≥10 -3 , CO 2 ∼10 -6 to10 -4 , and H 2 O ≤10 -4 ; higher CH 4 would require much higher CO and CO 2 . Based on calculations of equilibrium and non-equilibrium chemistry, we find that the observed abundances can potentially be explained by a combination of high metallicity (∼10x solar) and vertical mixing with K zz ∼ 10 6 -10 7 cm 2 s -1 . The inferred metallicity is enhanced over that of the host star which is known to be consistent with solar metallicity. Our constraints rule out a dayside thermal inversion in GJ 436b. We emphasize that the constraints reported in this work depend crucially on the observations in the two Spitzer channels at 3.6 μm and 4.5 μm. Future observations with warm Spitzer and with the James Webb Space Telescope will be extremely important to improve upon the present constraints on the abundances of carbon species in the dayside atmosphere of GJ 436b.

  2. Benchmarking GJ436b for JWST

    Science.gov (United States)

    Parmentier, Vivien; Stevenson, Kevin; Crossfield, Ian; Morley, Caroline; Fortney, Jonathan; Showman, Adam; Lewis, Nikole; Line, Mike

    2017-10-01

    GJ436b is a slightly eccentric, Neptune size planet with an equilibrium temperature of approximately 770K, it is the only Neptune size planet with a thermal emission measurement. With the coming JWST GTO observations of it's emission spectrum, GJ436b will become a benchmark object of the population of Neptune-size planets that will be discovered by TESS and characterized by JWST in the coming years. The current set of 19 secondary eclipses observed by Spitzer points toward a metal-rich, well mixed, tidally heated atmosphere in disequilibrium chemistry. However, no self-consistent forward models are currently able to fit the dayside spectrum of the planet, whereas retrieval models lead to solutions that are inconsistent with the observed planet density. Clearly, some piece of the puzzle is missing to understand the atmospheric properties of this planet. Although the coming JWST observations will likely improve our understanding of this planet, it won't be able to break the degeneracies between metallicity, internal flux and energy redistribution. We propose to observe a full phase curve of GJ436b at 3.6 microns. We will obtain a measurement of the nightside flux of GJ436b at 3.6 microns. Combined with the already observed 8 microns phase curve, we will obtain the first low resolution spectrum of the nightside of a Neptune size exoplanet. By comparing the nightside flux at 3.6 and 8 microns, we will be able to place constraints on the tidal heating and the metallicity of GJ436b that will be complimentary to the the dayside spectrum that will be obtained with JWST. As seen with the example of hot Jupiters, for which much more data is available, measurements of the nightside spectrum is fundamental to understand the planet atmosphere as a whole and correctly interpret the dayside emission. As a consequence, the proposed observation is crucial for the interpretation of the coming JWST observations. As a secondary goal, our observation should be able to confirm the

  3. An HST/STIS Optical Transmission Spectrum of Warm Neptune GJ 436b

    Science.gov (United States)

    Lothringer, Joshua D.; Benneke, Björn; Crossfield, Ian J. M.; Henry, Gregory W.; Morley, Caroline; Dragomir, Diana; Barman, Travis; Knutson, Heather; Kempton, Eliza; Fortney, Jonathan; McCullough, Peter; Howard, Andrew W.

    2018-02-01

    GJ 436b is a prime target for understanding warm Neptune exoplanet atmospheres and a target for multiple James Webb Space Telescope (JWST) Guaranteed Time Observation programs. Here, we report the first space-based optical transmission spectrum of the planet using two Hubble Space Telescope (HST) Space Telescope Imaging Spectrograph (STIS) transit observations from 0.53 to 1.03 μm. We find no evidence for alkali absorption features, nor evidence of a scattering slope longward of 0.53 μm. The spectrum is indicative of moderate to high metallicity (∼100–1000× solar), while moderate-metallicity scenarios (∼100× solar) require aerosol opacity. The optical spectrum also rules out some highly scattering haze models. We find an increase in transit depth around 0.8 μm in the transmission spectra of three different sub-Jovian exoplanets (GJ 436b, HAT-P-26b, and GJ 1214b). While most of the data come from STIS, data from three other instruments may indicate this is not an instrumental effect. Only the transit spectrum of GJ 1214b is well fit by a model with stellar plages on the photosphere of the host star. Our photometric monitoring of the host star reveals a stellar rotation rate of 44.1 days and an activity cycle of 7.4 years. Intriguingly, GJ 436 does not become redder as it gets dimmer, which is expected if star spots were dominating the variability. These insights into the nature of the GJ 436 system help refine our expectations for future observations in the era of JWST, whose higher precision and broader wavelength coverage will shed light on the composition and structure of GJ 436b’s atmosphere.

  4. Orbital misalignment of the Neptune-mass exoplanet GJ 436b with the spin of its cool star

    Science.gov (United States)

    Bourrier, Vincent; Lovis, Christophe; Beust, Hervé; Ehrenreich, David; Henry, Gregory W.; Astudillo-Defru, Nicola; Allart, Romain; Bonfils, Xavier; Ségransan, Damien; Delfosse, Xavier; Cegla, Heather M.; Wyttenbach, Aurélien; Heng, Kevin; Lavie, Baptiste; Pepe, Francesco

    2018-01-01

    The angle between the spin of a star and the orbital planes of its planets traces the history of the planetary system. Exoplanets orbiting close to cool stars are expected to be on circular, aligned orbits because of strong tidal interactions with the stellar convective envelope. Spin–orbit alignment can be measured when the planet transits its star, but such ground-based spectroscopic measurements are challenging for cool, slowly rotating stars. Here we report the three-dimensional characterization of the trajectory of an exoplanet around an M dwarf star, derived by mapping the spectrum of the stellar photosphere along the chord transited by the planet. We find that the eccentric orbit of the Neptune-mass exoplanet GJ 436b is nearly perpendicular to the stellar equator. Both eccentricity and misalignment, surprising around a cool star, can result from dynamical interactions (via Kozai migration) with a yet-undetected outer companion. This inward migration of GJ 436b could have triggered the atmospheric escape that now sustains its giant exosphere.

  5. Microphysical Modeling of Mineral Clouds in GJ1214 b and GJ436 b: Predicting Upper Limits on the Cloud-top Height

    Science.gov (United States)

    Ohno, Kazumasa; Okuzumi, Satoshi

    2018-05-01

    The ubiquity of clouds in the atmospheres of exoplanets, especially of super-Earths, is one of the outstanding issues for the transmission spectra survey. Understanding the formation process of clouds in super-Earths is necessary to interpret the observed spectra correctly. In this study, we investigate the vertical distributions of particle size and mass density of mineral clouds in super-Earths using a microphysical model that takes into account the vertical transport and growth of cloud particles in a self-consistent manner. We demonstrate that the vertical profiles of mineral clouds significantly vary with the concentration of cloud condensation nuclei and atmospheric metallicity. We find that the height of the cloud top increases with increasing metallicity as long as the metallicity is lower than the threshold. If the metallicity is larger than the threshold, the cloud-top height no longer increases appreciably with metallicity because coalescence yields larger particles of higher settling velocities. We apply our cloud model to GJ1214 b and GJ436 b, for which recent transmission observations suggest the presence of high-altitude opaque clouds. For GJ436 b, we show that KCl particles can ascend high enough to explain the observation. For GJ1214 b, by contrast, the height of KCl clouds predicted from our model is too low to explain its flat transmission spectrum. Clouds made of highly porous KCl particles could explain the observations if the atmosphere is highly metal-rich, and hence the particle microstructure might be a key to interpret the flat spectrum of GJ1214 b.

  6. A SPITZER TRANSMISSION SPECTRUM FOR THE EXOPLANET GJ 436b, EVIDENCE FOR STELLAR VARIABILITY, AND CONSTRAINTS ON DAYSIDE FLUX VARIATIONS

    International Nuclear Information System (INIS)

    Knutson, Heather A.; Madhusudhan, Nikku; Cowan, Nicolas B.; Christiansen, Jessie L.; Agol, Eric; Deming, Drake; Desert, Jean-Michel; Charbonneau, David; Henry, Gregory W.; Homeier, Derek; Laughlin, Gregory; Langton, Jonathan; Seager, Sara

    2011-01-01

    In this paper, we describe a uniform analysis of eight transits and eleven secondary eclipses of the extrasolar planet GJ 436b obtained in the 3.6, 4.5, and 8.0 μm bands using the IRAC instrument on the Spitzer Space Telescope between UT 2007 June 29 and UT 2009 February 4. We find that the best-fit transit depths for visits in the same bandpass can vary by as much as 8% of the total (4.7σ significance) from one epoch to the next. Although we cannot entirely rule out residual detector effects or a time-varying, high-altitude cloud layer in the planet's atmosphere as the cause of these variations, we consider the occultation of active regions on the star in a subset of the transit observations to be the most likely explanation. We find that for the deepest 3.6 μm transit the in-transit data have a higher standard deviation than the out-of-transit data, as would be expected if the planet occulted a star spot. We also compare all published transit observations for this object and find that transits observed in the infrared typically have smaller timing offsets than those observed in visible light. In this case, the three deepest Spitzer transits are all measured within a period of five days, consistent with a single epoch of increased stellar activity. We reconcile the presence of magnetically active regions with the lack of significant visible or infrared flux variations from the star by proposing that the star's spin axis is tilted with respect to our line of sight and that the planet's orbit is therefore likely to be misaligned. In contrast to the results reported by Beaulieu et al., we find no convincing evidence for methane absorption in the planet's transmission spectrum. If we exclude the transits that we believe to be most affected by stellar activity, we find that we prefer models with enhanced CO and reduced methane, consistent with GJ 436b's dayside composition from Stevenson et al. It is also possible that all transits are significantly affected by this

  7. HELIUM ATMOSPHERES ON WARM NEPTUNE- AND SUB-NEPTUNE-SIZED EXOPLANETS AND APPLICATIONS TO GJ 436b

    Energy Technology Data Exchange (ETDEWEB)

    Hu, Renyu; Yung, Yuk L. [Jet Propulsion Laboratory, California Institute of Technology, Pasadena, CA 91109 (United States); Seager, Sara, E-mail: renyu.hu@jpl.nasa.gov [Department of Earth, Atmospheric and Planetary Sciences, Massachusetts Institute of Technology, Cambridge, MA 02139 (United States)

    2015-07-01

    Warm Neptune- and sub-Neptune-sized exoplanets in orbits smaller than Mercury’s are thought to have experienced extensive atmospheric evolution. Here we propose that a potential outcome of this atmospheric evolution is the formation of helium-dominated atmospheres. The hydrodynamic escape rates of Neptune- and sub-Neptune-sized exoplanets are comparable to the diffusion-limited escape rate of hydrogen, and therefore the escape is heavily affected by diffusive separation between hydrogen and helium. A helium atmosphere can thus be formed—from a primordial hydrogen–helium atmosphere—via atmospheric hydrodynamic escape from the planet. The helium atmosphere has very different abundances of major carbon and oxygen species from those of a hydrogen atmosphere, leading to distinctive transmission and thermal emission spectral features. In particular, the hypothesis of a helium-dominated atmosphere can explain the thermal emission spectrum of GJ 436b, a warm Neptune-sized exoplanet, while also being consistent with the transmission spectrum. This model atmosphere contains trace amounts of hydrogen, carbon, and oxygen, with the predominance of CO over CH{sub 4} as the main form of carbon. With our atmospheric evolution model, we find that if the mass of the initial atmosphere envelope is 10{sup −3} planetary mass, hydrodynamic escape can reduce the hydrogen abundance in the atmosphere by several orders of magnitude in ∼10 billion years. Observations of exoplanet transits may thus detect signatures of helium atmospheres and probe the evolutionary history of small exoplanets.

  8. HELIUM ATMOSPHERES ON WARM NEPTUNE- AND SUB-NEPTUNE-SIZED EXOPLANETS AND APPLICATIONS TO GJ 436b

    International Nuclear Information System (INIS)

    Hu, Renyu; Yung, Yuk L.; Seager, Sara

    2015-01-01

    Warm Neptune- and sub-Neptune-sized exoplanets in orbits smaller than Mercury’s are thought to have experienced extensive atmospheric evolution. Here we propose that a potential outcome of this atmospheric evolution is the formation of helium-dominated atmospheres. The hydrodynamic escape rates of Neptune- and sub-Neptune-sized exoplanets are comparable to the diffusion-limited escape rate of hydrogen, and therefore the escape is heavily affected by diffusive separation between hydrogen and helium. A helium atmosphere can thus be formed—from a primordial hydrogen–helium atmosphere—via atmospheric hydrodynamic escape from the planet. The helium atmosphere has very different abundances of major carbon and oxygen species from those of a hydrogen atmosphere, leading to distinctive transmission and thermal emission spectral features. In particular, the hypothesis of a helium-dominated atmosphere can explain the thermal emission spectrum of GJ 436b, a warm Neptune-sized exoplanet, while also being consistent with the transmission spectrum. This model atmosphere contains trace amounts of hydrogen, carbon, and oxygen, with the predominance of CO over CH 4 as the main form of carbon. With our atmospheric evolution model, we find that if the mass of the initial atmosphere envelope is 10 −3 planetary mass, hydrodynamic escape can reduce the hydrogen abundance in the atmosphere by several orders of magnitude in ∼10 billion years. Observations of exoplanet transits may thus detect signatures of helium atmospheres and probe the evolutionary history of small exoplanets

  9. FORWARD AND INVERSE MODELING OF THE EMISSION AND TRANSMISSION SPECTRUM OF GJ 436B: INVESTIGATING METAL ENRICHMENT, TIDAL HEATING, AND CLOUDS

    Energy Technology Data Exchange (ETDEWEB)

    Morley, Caroline V. [Department of Astronomy, Harvard University, 60 Garden Street, Cambridge, MA 02138 (United States); Knutson, Heather [Division of Geological and Planetary Sciences, California Institute of Technology, 1200 East California Boulevard, Pasadena, CA 91125 (United States); Line, Michael [School of Earth and Space Exploration, Arizona State University, 781 South Terrace Road, Tempe, AZ 85281 (United States); Fortney, Jonathan J.; Teal, Dillon [Department of Astronomy and Astrophysics, University of California, 1156 High Street, Santa Cruz, CA 95064 (United States); Thorngren, Daniel [Department of Physics, University of California, 1156 High Street, Santa Cruz, CA 95064 (United States); Marley, Mark S.; Lupu, Roxana, E-mail: caroline.morley@cfa.harvard.edu [NASA Ames Research Center, Moffett Field, CA 94035 (United States)

    2017-02-01

    The Neptune-mass GJ 436b is one of the most studied transiting exoplanets with repeated measurements of its thermal emission and transmission spectra. We build on previous studies to answer outstanding questions about this planet, including its potentially high metallicity and tidal heating of its interior. We present new observations of GJ 436b’s thermal emission at 3.6 and 4.5 μ m, which reduce uncertainties in estimates of GJ 436b’s flux at those wavelengths and demonstrate consistency between Spitzer observations spanning more than 7 yr. We analyze the Spitzer thermal emission photometry and Hubble WFC3 transmission spectrum. We use a dual-pronged modeling approach of both self-consistent and retrieval models. We vary the metallicity, intrinsic luminosity from tidal heating, disequilibrium chemistry, and heat redistribution. We also study clouds and photochemical hazes, but do not find strong evidence for either. The self-consistent and retrieval models combine to suggest that GJ 436b has a high atmospheric metallicity, with best fits at or above several hundred times solar metallicity, tidal heating warming its interior with best-fit intrinsic effective temperatures around 300–350 K, and disequilibrium chemistry. High metal enrichments (>600× solar) occur from the accretion of rocky, rather than icy, material. Assuming the interior temperature T {sub int} ∼ 300–350 K, we find a dissipation factor Q ′ ∼ 2 × 10{sup 5}–10{sup 6}, larger than Neptune’s Q ′, implying a long tidal circularization timescale for the orbit. We suggest that Neptune-mass planets may be more diverse than imagined, with metal enhancements spanning several orders of magnitude, to perhaps over 1000× solar metallicity. High-fidelity observations with instruments like the James Webb Space Telescope will be critical for characterizing this diversity.

  10. A SEARCH FOR ADDITIONAL PLANETS IN THE NASA EPOXI OBSERVATIONS OF THE EXOPLANET SYSTEM GJ 436

    International Nuclear Information System (INIS)

    Ballard, Sarah; Christiansen, Jessie L.; Charbonneau, David; Holman, Matthew J.; Fabrycky, Daniel; Deming, Drake; Barry, Richard K.; Kuchner, Marc J.; Livengood, Timothy A.; Hewagama, Tilak; A'Hearn, Michael F.; Wellnitz, Dennis D.; Sunshine, Jessica M.; Hampton, Don L.; Lisse, Carey M.; Seager, Sara; Veverka, Joseph F.

    2010-01-01

    We present time series photometry of the M dwarf transiting exoplanet system GJ 436 obtained with the Extrasolar Planet Observation and Characterization (EPOCh) component of the NASA EPOXI mission. We conduct a search of the high-precision time series for additional planets around GJ 436, which could be revealed either directly through their photometric transits or indirectly through the variations these second planets induce on the transits of the previously known planet. In the case of GJ 436, the presence of a second planet is perhaps indicated by the residual orbital eccentricity of the known hot Neptune companion. We find no candidate transits with significance higher than our detection limit. From Monte Carlo tests of the time series, we rule out transiting planets larger than 1.5 R + interior to GJ 436b with 95% confidence and larger than 1.25 R + with 80% confidence. Assuming coplanarity of additional planets with the orbit of GJ 436b, we cannot expect that putative planets with orbital periods longer than about 3.4 days will transit. However, if such a planet were to transit, we would rule out planets larger than 2.0 R + with orbital periods less than 8.5 days with 95% confidence. We also place dynamical constraints on additional bodies in the GJ 436 system, independent of radial velocity measurements. Our analysis should serve as a useful guide for similar analyses of transiting exoplanets for which radial velocity measurements are not available, such as those discovered by the Kepler mission. From the lack of observed secular perturbations, we set upper limits on the mass of a second planet as small as 10 M + in coplanar orbits and 1 M + in non-coplanar orbits close to GJ 436b. We present refined estimates of the system parameters for GJ 436. We find P = 2.64389579 ± 0.00000080 d, R * = 0.437 ± 0.016 R sun , and R p = 3.880 ± 0.147 R + . We also report a sinusoidal modulation in the GJ 436 light curve that we attribute to star spots. This signal is

  11. TWO NEARBY SUB-EARTH-SIZED EXOPLANET CANDIDATES IN THE GJ 436 SYSTEM

    International Nuclear Information System (INIS)

    Stevenson, Kevin B.; Harrington, Joseph; Lust, Nate B.; Blecic, Jasmina; Hardy, Ryan A.; Cubillos, Patricio; Campo, Christopher J.; Lewis, Nikole K.; Montagnier, Guillaume; Moses, Julianne I.; Visscher, Channon

    2012-01-01

    We report the detection of UCF-1.01, a strong exoplanet candidate with a radius 0.66 ± 0.04 times that of Earth (R ⊕ ). This sub-Earth-sized planet transits the nearby M-dwarf star GJ 436 with a period of 1.365862 ± 8 × 10 –6 days. We also report evidence of a 0.65 ± 0.06 R ⊕ exoplanet candidate (labeled UCF-1.02) orbiting the same star with an undetermined period. Using the Spitzer Space Telescope, we measure the dimming of light as the planets pass in front of their parent star to assess their sizes and orbital parameters. If confirmed today, UCF-1.01 and UCF-1.02 would be designated GJ 436c and GJ 436d, respectively, and would be part of the first multiple-transiting-planet system outside of the Kepler field. Assuming Earth-like densities of 5.515 g cm –3 , we predict both candidates to have similar masses (∼0.28 Earth-masses, M ⊕ , 2.6 Mars-masses) and surface gravities of ∼0.65 g (where g is the gravity on Earth). UCF-1.01's equilibrium temperature (T eq , where emitted and absorbed radiation balance for an equivalent blackbody) is 860 K, making the planet unlikely to harbor life as on Earth. Its weak gravitational field and close proximity to its host star imply that UCF-1.01 is unlikely to have retained its original atmosphere; however, a transient atmosphere is possible if recent impacts or tidal heating were to supply volatiles to the surface. We also present additional observations of GJ 436b during secondary eclipse. The 3.6 μm light curve shows indications of stellar activity, making a reliable secondary eclipse measurement impossible. A second non-detection at 4.5 μm supports our previous work in which we find a methane-deficient and carbon monoxide-rich dayside atmosphere.

  12. Two nearby Sub-Earth-sized Exoplanet Candidates in the GJ 436 System

    Science.gov (United States)

    Stevenson, Kevin B.; Harrington, Joseph; Lust, Nate B.; Lewis, Nikole K.; Montagnier, Guillaume; Moses, Julianne I.; Visscher, Channon; Blecic, Jasmina; Hardy, Ryan A.; Cubillos, Patricio; Campo, Christopher J.

    2012-08-01

    We report the detection of UCF-1.01, a strong exoplanet candidate with a radius 0.66 ± 0.04 times that of Earth (R ⊕). This sub-Earth-sized planet transits the nearby M-dwarf star GJ 436 with a period of 1.365862 ± 8 × 10-6 days. We also report evidence of a 0.65 ± 0.06 R ⊕ exoplanet candidate (labeled UCF-1.02) orbiting the same star with an undetermined period. Using the Spitzer Space Telescope, we measure the dimming of light as the planets pass in front of their parent star to assess their sizes and orbital parameters. If confirmed today, UCF-1.01 and UCF-1.02 would be designated GJ 436c and GJ 436d, respectively, and would be part of the first multiple-transiting-planet system outside of the Kepler field. Assuming Earth-like densities of 5.515 g cm-3, we predict both candidates to have similar masses (~0.28 Earth-masses, M ⊕, 2.6 Mars-masses) and surface gravities of ~0.65 g (where g is the gravity on Earth). UCF-1.01's equilibrium temperature (T eq, where emitted and absorbed radiation balance for an equivalent blackbody) is 860 K, making the planet unlikely to harbor life as on Earth. Its weak gravitational field and close proximity to its host star imply that UCF-1.01 is unlikely to have retained its original atmosphere; however, a transient atmosphere is possible if recent impacts or tidal heating were to supply volatiles to the surface. We also present additional observations of GJ 436b during secondary eclipse. The 3.6 μm light curve shows indications of stellar activity, making a reliable secondary eclipse measurement impossible. A second non-detection at 4.5 μm supports our previous work in which we find a methane-deficient and carbon monoxide-rich dayside atmosphere.

  13. SPITZER OBSERVATIONS OF GJ 3470 b: A VERY LOW-DENSITY NEPTUNE-SIZE PLANET ORBITING A METAL-RICH M DWARF

    Energy Technology Data Exchange (ETDEWEB)

    Demory, Brice-Olivier; Seager, Sara [Department of Earth, Atmospheric and Planetary Sciences, Massachusetts Institute of Technology, 77 Massachusetts Ave., Cambridge, MA 02139 (United States); Torres, Guillermo [Harvard-Smithsonian Center for Astrophysics, 60 Garden St., Cambridge, MA 02138 (United States); Neves, Vasco; Santos, Nuno [Centro de Astrofisica, Universidade do Porto, Rua das Estrelas, 4150-762 Porto (Portugal); Rogers, Leslie [Department of Astrophysics, California Institute of Technology, MC 249-17, Pasadena, CA 91125 (United States); Gillon, Michaeel [Institut d' Astrophysique et de Geophysique, Universite de Liege, Allee du 6 Aout, 17, Bat. B5C, Liege 1 (Belgium); Horch, Elliott [Department of Physics, 501 Crescent Street, Southern Connecticut State University, New Haven, CT 06515 (United States); Sullivan, Peter [Department of Physics and Kavli Institute for Astrophysics and Space Research, MIT, 77 Massachusetts Avenue, Cambridge, MA 02138 (United States); Bonfils, Xavier; Delfosse, Xavier; Forveille, Thierry [UJF-Grenoble 1/CNRS-INSU, Institut de Planetologie et d' Astrophysique de Grenoble (IPAG) UMR 5274, Grenoble, F-38041 (France); Lovis, Christophe; Mayor, Michel; Udry, Stephane [Observatoire de Geneve, Universite de Geneve, 51 ch. des Maillettes, CH-1290 Versoix (Switzerland); Smalley, Barry, E-mail: demory@mit.edu [Astrophysics Group, Keele University, Staffordshire, ST55BG (United Kingdom)

    2013-05-10

    We present Spitzer/IRAC 4.5 {mu}m transit photometry of GJ 3470 b, a Neptune-size planet orbiting an M1.5 dwarf star with a 3.3 day period recently discovered in the course of the HARPS M-dwarf survey. We refine the stellar parameters by employing purely empirical mass-luminosity and surface brightness relations constrained by our updated value for the mean stellar density, and additional information from new near-infrared spectroscopic observations. We derive a stellar mass of M{sub *}= 0.539{sup +0.047}{sub -0.043} M{sub sun} and a radius of R{sub *}= 0.568{sup +0.037}{sub -0.031} R{sub sun}. We determine the host star of GJ 3470 b to be metal-rich, with a metallicity of [Fe/H] = +0.20 {+-} 0.10 and an effective temperature of T{sub eff} = 3600 {+-} 100 K. The revised stellar parameters yield a planetary radius R{sub p}= 4.83{sub -0.21}{sup +0.22} R{sub Circled-Plus} that is 13% larger than the value previously reported in the literature. We find a planetary mass M{sub p}= 13.9{sup +1.5}{sub -1.4} M{sub Circled-Plus} that translates to a very low planetary density, {rho}{sub p}= 0.72{sup +0.13}{sub -0.12} g cm{sup -3}, which is 33% smaller than the original value. With a mean density half of that of GJ 436 b, GJ 3470 b is an example of a very low-density low-mass planet, similar to Kepler-11 d, Kepler-11 e, and Kepler-18 c, but orbiting a much brighter nearby star that is more conducive to follow-up studies.

  14. SPITZER OBSERVATIONS OF GJ 3470 b: A VERY LOW-DENSITY NEPTUNE-SIZE PLANET ORBITING A METAL-RICH M DWARF

    International Nuclear Information System (INIS)

    Demory, Brice-Olivier; Seager, Sara; Torres, Guillermo; Neves, Vasco; Santos, Nuno; Rogers, Leslie; Gillon, Michaël; Horch, Elliott; Sullivan, Peter; Bonfils, Xavier; Delfosse, Xavier; Forveille, Thierry; Lovis, Christophe; Mayor, Michel; Udry, Stephane; Smalley, Barry

    2013-01-01

    We present Spitzer/IRAC 4.5 μm transit photometry of GJ 3470 b, a Neptune-size planet orbiting an M1.5 dwarf star with a 3.3 day period recently discovered in the course of the HARPS M-dwarf survey. We refine the stellar parameters by employing purely empirical mass-luminosity and surface brightness relations constrained by our updated value for the mean stellar density, and additional information from new near-infrared spectroscopic observations. We derive a stellar mass of M * = 0.539 +0.047 -0.043 M sun and a radius of R * = 0.568 +0.037 -0.031 R sun . We determine the host star of GJ 3470 b to be metal-rich, with a metallicity of [Fe/H] = +0.20 ± 0.10 and an effective temperature of T eff = 3600 ± 100 K. The revised stellar parameters yield a planetary radius R p = 4.83 -0.21 +0.22 R ⊕ that is 13% larger than the value previously reported in the literature. We find a planetary mass M p = 13.9 +1.5 -1.4 M ⊕ that translates to a very low planetary density, ρ p = 0.72 +0.13 -0.12 g cm –3 , which is 33% smaller than the original value. With a mean density half of that of GJ 436 b, GJ 3470 b is an example of a very low-density low-mass planet, similar to Kepler-11 d, Kepler-11 e, and Kepler-18 c, but orbiting a much brighter nearby star that is more conducive to follow-up studies.

  15. Konverents Gjøvikis tuleb juunis / Sirje Virkus

    Index Scriptorium Estoniae

    Virkus, Sirje, 1956-

    1999-01-01

    1.-4. maini toimus Gjøvikis rahvusvahelise konverentsi "Telecommunication in Education and Training : TET 99" ettevalmistuskomisjoni koosolek, mille tööst võttis osa konverentsi programmikomitee liige Sirje Virkus

  16. NARROW-K-BAND OBSERVATIONS OF THE GJ 1214 SYSTEM

    Energy Technology Data Exchange (ETDEWEB)

    Colón, Knicole D.; Gaidos, Eric, E-mail: colonk@hawaii.edu [Department of Geology and Geophysics, University of Hawaii at Manoa, Honolulu, HI 96822 (United States)

    2013-10-10

    GJ 1214 is a nearby M dwarf star that hosts a transiting super-Earth-size planet, making this system an excellent target for atmospheric studies. Most studies find that the transmission spectrum of GJ 1214b is flat, which favors either a high mean molecular weight or cloudy/hazy hydrogen (H) rich atmosphere model. Photometry at short wavelengths (<0.7 μm) and in the K band can discriminate the most between these different atmosphere models for GJ 1214b, but current observations do not have sufficiently high precision. We present photometry of seven transits of GJ 1214b through a narrow K-band (2.141 μm) filter with the Wide Field Camera on the 3.8 m United Kingdom Infrared Telescope. Our photometric precision is typically 1.7 × 10{sup –3} (for a single transit), comparable with other ground-based observations of GJ 1214b. We measure a planet-star radius ratio of 0.1158 ± 0.0013, which, along with other studies, also supports a flat transmission spectrum for GJ 1214b. Since this does not exclude a scenario where GJ 1214b has an H-rich envelope with heavy elements that are sequestered below a cloud/haze layer, we compare K-band observations with models of H{sub 2} collision-induced absorption in an atmosphere for a range of temperatures. While we find no evidence for deviation from a flat spectrum (slope s = 0.0016 ± 0.0038), an H{sub 2}-dominated upper atmosphere (<60 mbar) cannot be excluded. More precise observations at <0.7 μm and in the K band, as well as a uniform analysis of all published data, would be useful for establishing more robust limits on atmosphere models for GJ 1214b.

  17. Introduction. G.J. Hoogewerff, Explorer in Art History

    NARCIS (Netherlands)

    Krul, Wessel; van Egmond, Anna-Maria; Chavannes-Mazel, Claudine A.

    2014-01-01

    G.J. Hoogewerff (1884-1963) was director of the Netherlands Historical Institute in Rome, professor at the University of Utrecht, and director of the Netherlands Art Historical Institute in Florence. In 2012, it was the 75th anniversary of the publication of his five-volume history of medieval

  18. Chaotic Excitation and Tidal Damping in the GJ 876 System

    Science.gov (United States)

    Puranam, Abhijit; Batygin, Konstantin

    2018-04-01

    The M-dwarf GJ 876 is the closest known star to harbor a multi-planetary system. With three outer planets locked in a chaotic Laplace-type resonance and an appreciably eccentric short-period super-Earth, this system represents a unique exposition of extrasolar planetary dynamics. A key question that concerns the long-term evolution of this system, and the fate of close-in planets in general, is how the significant eccentricity of the inner-most planet is maintained against tidal circularization on timescales comparable to the age of the universe. Here, we employ stochastic secular perturbation theory and N-body simulations to show that the orbit of the inner-most planet is shaped by a delicate balance between extrinsic chaotic forcing and tidal dissipation. As such, the planet’s orbital eccentricity represents an indirect measure of its tidal quality factor. Based on the system’s present-day architecture, we estimate that the extrasolar super-Earth GJ 876 d has a tidal Q ∼ 104–105, a value characteristic of solar system gas giants.

  19. Interlock system of electron beam machine GJ-2

    International Nuclear Information System (INIS)

    Marnada, Nada

    1999-01-01

    As an irradiation installation facility, the electron beam machine (EBM) irradiation facility which use radionuclide as radiation source. There are three safety aspects to be considered in the facility i.e the safeties for human, machines, and samples to be irradiated. The safety aspect for human is to the radiation hazard and the safety aspect for machine and sample is to the damage as the result of operating failure. In the EBM GJ-2 (made in China) twelve interlock system parameter are installed to keep all of the safety aspects. Each interlock system consist transducer that controls a certain switch, a magnetic relay, and visible and audible interlock indicators to improve the reliability of interlock systems a method called redundancy method is applied to the systems of operation of high voltage. (author)

  20. Gj 832c: A super-Earth in the habitable zone

    Energy Technology Data Exchange (ETDEWEB)

    Wittenmyer, Robert A.; Horner, Jonathan; Tinney, C. G.; Marshall, J. P.; Bailey, J.; Salter, G. S.; Wright, D. [School of Physics, UNSW Australia, Sydney, NSW 2052 (Australia); Tuomi, Mikko; Jones, H. R. A. [Centre for Astrophysics Research, Science and Technology Research Institute, University of Hertfordshire, College Lane, Hatfield AL10 9AB (United Kingdom); Butler, R. P.; Arriagada, P. [Department of Terrestrial Magnetism, Carnegie Institution of Washington, 5241 Broad Branch Road, NW, Washington, DC 20015-1305 (United States); Anglada-Escudé, Guillem [Astronomy Unit, School of Mathematical Sciences, Queen Mary, University of London, London (United Kingdom); Carter, B. D. [Computational Engineering and Science Research Centre, University of Southern Queensland, Toowoomba, Queensland 4350 (Australia); O' Toole, S. J. [Australian Astronomical Observatory, P.O. Box 915, North Ryde, NSW 1670 (Australia); Crane, J. D.; Schectman, S. A.; Thompson, I. [The Observatories of the Carnegie Institution of Washington, 813 Santa Barbara Street, Pasadena, CA 91101 (United States); Minniti, D. [Institute of Astrophysics, Pontificia Universidad Catolica de Chile, Casilla 306, Santiago 22 (Chile); Jenkins, J. S.; Diaz, M., E-mail: rob@phys.unsw.edu.au [Departamento de Astronomía, Universidad de Chile, Camino el Observatorio 1515, Casilla 36-D, Las Condes, Santiago (Chile)

    2014-08-20

    We report the detection of GJ 832c, a super-Earth orbiting near the inner edge of the habitable zone of GJ 832, an M dwarf previously known to host a Jupiter analog in a nearly circular 9.4 yr orbit. The combination of precise radial-velocity measurements from three telescopes reveals the presence of a planet with a period of 35.68 ± 0.03 days and minimum mass (m sin i) of 5.4 ± 1.0 Earth masses. GJ 832c moves on a low-eccentricity orbit (e = 0.18 ± 0.13) toward the inner edge of the habitable zone. However, given the large mass of the planet, it seems likely that it would possess a massive atmosphere, which may well render the planet inhospitable. Indeed, it is perhaps more likely that GJ 832c is a 'super-Venus', featuring significant greenhouse forcing. With an outer giant planet and an interior, potentially rocky planet, the GJ 832 planetary system can be thought of as a miniature version of our own solar system.

  1. Precise Masses & Radii of the Planets Orbiting K2-3 and GJ3470

    Science.gov (United States)

    Kosiarek, Molly; Crossfield, Ian; Hardegree-Ullman, Kevin; Livingston, John; Howard, Andrew; Fulton, Benjamin; Hirsch, Lea; Isaacson, Howard; Petigura, Erik; Sinukoff, Evan; Weiss, Lauren; Knutson, Heather; Bonfils, Xavier; Benneke, Björn; Beichman, Charles; Dressing, Courtney

    2018-01-01

    We report improved masses, radii, and densities for two planetary systems, K2-3 and GJ3470, derived from a combination of new radial velocity and transit observations. Both stars are nearby, early M dwarfs. K2-3 hosts three super-Earth planets between 1.5 and 2 Earth-radii at orbital periods between 10 and 45 days, while GJ 3470 hosts one 4 Earth-radii planet with a period of 3.3 days. Furthermore, we confirmed GJ3470's rotation period through multi-year ground-based photometry; RV analysis must account for this rotation signature. Due to the planets' low densities (all stars, they are among the best candidates for transmission spectroscopy with JWST and HST in order to characterize their atmospheric compositions.

  2. Lande gJ factors for even-parity electronic levels in the holmium atom

    Science.gov (United States)

    Stefanska, D.; Werbowy, S.; Krzykowski, A.; Furmann, B.

    2018-05-01

    In this work the hyperfine structure of the Zeeman splitting for 18 even-parity levels in the holmium atom was investigated. The experimental method applied was laser induced fluorescence in a hollow cathode discharge lamp. 20 spectral lines were investigated involving odd-parity levels from the ground multiplet, for which Lande gJ factors are known with high precision, as the lower levels; this greatly facilitated the evaluation of gJ factors for the upper levels. The gJ values for the even-parity levels considered are reported for the first time. They proved to compare fairly well with the values obtained recently in a semi-empirical analysis for the even-parity level system of Ho I.

  3. SECRETLY ECCENTRIC: THE GIANT PLANET AND ACTIVITY CYCLE OF GJ 328

    International Nuclear Information System (INIS)

    Robertson, Paul; Endl, Michael; Cochran, William D.; MacQueen, Phillip J.; Boss, Alan P.

    2013-01-01

    We announce the discovery of a ∼2 Jupiter-mass planet in an eccentric 11 yr orbit around the K7/M0 dwarf GJ 328. Our result is based on 10 years of radial velocity (RV) data from the Hobby-Eberly and Harlan J. Smith telescopes at McDonald Observatory, and from the Keck Telescope at Mauna Kea. Our analysis of GJ 328's magnetic activity via the Na I D features reveals a long-period stellar activity cycle, which creates an additional signal in the star's RV curve with amplitude 6-10 m s –1 . After correcting for this stellar RV contribution, we see that the orbit of the planet is more eccentric than suggested by the raw RV data. GJ 328b is currently the most massive, longest-period planet discovered around a low-mass dwarf

  4. ASTROPHYSICAL PARAMETERS AND HABITABLE ZONE OF THE EXOPLANET HOSTING STAR GJ 581

    International Nuclear Information System (INIS)

    Von Braun, Kaspar; Kane, Stephen R.; Ciardi, David R.; Boyajian, Tabetha S.; McAlister, Harold A.; Henry, Todd J.; Jao, Wei-Chun; Riedel, Adric R.; Van Belle, Gerard T.; Lopez-Morales, Mercedes; Subasavage, John P.; Schaefer, Gail; Ten Brummelaar, Theo A.; Sturmann, Laszlo; Sturmann, Judit; Mazingue, Jude; Turner, Nils H.; Farrington, Chris; Goldfinger, P. J.; Ridgway, Stephen

    2011-01-01

    GJ 581 is an M dwarf host of a multiplanet system. We use long-baseline interferometric measurements from the CHARA Array, coupled with trigonometric parallax information, to directly determine its physical radius to be 0.299 ± 0.010 R sun . Literature photometry data are used to perform spectral energy distribution fitting in order to determine GJ 581's effective surface temperature T EFF = 3498 ± 56 K and its luminosity L = 0.01205 ± 0.00024 L sun . From these measurements, we recompute the location and extent of the system's habitable zone and conclude that two of the planets orbiting GJ 581, planets d and g, spend all or part of their orbit within or just on the edge of the habitable zone.

  5. SPITZER TRANSITS OF THE SUPER-EARTH GJ1214b AND IMPLICATIONS FOR ITS ATMOSPHERE

    Energy Technology Data Exchange (ETDEWEB)

    Fraine, Jonathan D.; Deming, Drake [Department of Astronomy, University of Maryland, College Park, MD 20742 (United States); Gillon, Michaeel; Jehin, Emmanueel [Institute d' Astrophysique et de Geophysique, Universite de Liege, Liege (Belgium); Demory, Brice-Olivier; Benneke, Bjoern; Seager, Sara [Department of Earth, Atmospheric and Planetary Sciences, and Department of Physics, Massachusetts Institute of Technology, Cambridge, MA 02139 (United States); Lewis, Nikole K. [Department of Planetary Sciences and Lunar and Planetary Laboratory, University of Arizona, Tucson, AZ 85721 (United States); Knutson, Heather [Division of Geological and Planetary Sciences, California Institute of Technology, Pasadena, CA 91125 (United States); Desert, Jean-Michel, E-mail: jfraine@astro.umd.edu [Harvard-Smithsonian Center for Astrophysics, 60 Garden St., Cambridge, MA 02138 (United States)

    2013-03-10

    We observed the transiting super-Earth exoplanet GJ1214b using warm Spitzer at 4.5 {mu}m wavelength during a 20 day quasi-continuous sequence in 2011 May. The goals of our long observation were to accurately define the infrared transit radius of this nearby super-Earth, to search for the secondary eclipse, and to search for other transiting planets in the habitable zone of GJ1214. We here report results from the transit monitoring of GJ1214b, including a reanalysis of previous transit observations by Desert et al. In total, we analyze 14 transits of GJ1214b at 4.5 {mu}m, 3 transits at 3.6 {mu}m, and 7 new ground-based transits in the I+z band. Our new Spitzer data by themselves eliminate cloudless solar composition atmospheres for GJ1214b, and methane-rich models from Howe and Burrows. Using our new Spitzer measurements to anchor the observed transit radii of GJ1214b at long wavelengths, and adding new measurements in I+z, we evaluate models from Benneke and Seager and Howe and Burrows using a {chi}{sup 2} analysis. We find that the best-fit model exhibits an increase in transit radius at short wavelengths due to Rayleigh scattering. Pure water atmospheres are also possible. However, a flat line (no atmosphere detected) remains among the best of the statistically acceptable models, and better than pure water atmospheres. We explore the effect of systematic differences among results from different observational groups, and we find that the Howe and Burrows tholin-haze model remains the best fit, even when systematic differences among observers are considered.

  6. Vekst, metabolisme og ølbrygging med melkesyrebakterier og gjær

    OpenAIRE

    Kvam, Guro

    2017-01-01

    Ølbrygging er et håndverk forbundet med lange tradisjoner, med røtter tilbake til det 12. århundrets Europa. Før dagens mikrobiologiske teknikker ble oppfunnet var all øl spontangjæret med en kompleks sammensetning av ulike gjær- og bakteriestammer. I dag produseres fremdeles enkelte av disse ølsortene under navn som lambic, geuze eller Berliner weisse, og interessen for slike ølsorter har økt betraktelig de siste årene. Mange bryggerier benytter i dag kjente kulturer av gjær og melkesyrebakt...

  7. Astrophysical Parameters and Habitable Zone of the Exoplanet Hosting Star GJ 581

    OpenAIRE

    von Braun, Kaspar; Boyajian, Tabetha S.; Kane, Stephen R.; van Belle, Gerard T.; Ciardi, David R.; Lόpez-Morales, Mercedes; McAlister, Harold A.; Henry, Todd J.; Jao, Wei-Chun; Riedel, Adric R.; Subasavage, John P.; Schaefer, Gail; ten Brummelaar, Theo A.; Ridgway, Stephen; Sturmann, Laszlo

    2011-01-01

    GJ 581 is an M dwarf host of a multiplanet system. We use long-baseline interferometric measurements from the CHARA Array, coupled with trigonometric parallax information, to directly determine its physical radius to be $0.299 \\pm 0.010 R_{\\odot}$. Literature photometry data are used to perform spectral energy distribution fitting in order to determine GJ 581's effective surface temperature $T_{\\rm EFF}=3498 \\pm 56$ K and its luminosity $L=0.01205 \\pm 0.00024 L_{\\odot}$. From these measuremen...

  8. High-Contrast 3.8 Micron Imaging of the Brown Dwarf/Planet-Mass Companion to GJ 758

    Science.gov (United States)

    Currie, Thayne M.; Bailey, Vanessa; Fabrycky, Daniel; Murray-Clay, Ruth; Rodigas, Timothy; Hinz, Phil

    2011-01-01

    We present L' band (3.8 Micron) MMT/Clio high-contrast imaging data for the nearby star GJ 758, which was recently reported by Thalmann et al. (2009) to have one - possibly two - faint comoving companions (GJ 7588 and "C", respectively). GJ 758B is detected in two distinct datasets. Additionally, we report a \\textit{possible} detection of the object identified by Thalmann et al as "GJ 758C" in our more sensitive dataset, though it is likely a residual speckle. However, if it is the same object as that reported by Thalmann et al. it cannot be a companion in a bound orbit. GJ 7588 has a H-L' color redder than nearly all known L-T8 dwarfs. 8ased on comparisons with the COND evolutionary models, GJ 7588 has Te approx. 560 K (+150 K, -90 K) and a mass ranging from approx.10-20 Mj if it is approx.1 Gyr old to approx. 25-40 Mj if it is 8.7 Gyr old. GJ 7588 is likely in a highly eccentric orbit, e approx. 0.73 (+0.12,-0.21), with a semimajor axis of approx. 44 AU (+32 AU, -14 AU). Though GJ 7588 is sometimes discussed within the context of exoplanet direct imaging, its mass is likely greater than the deuterium-burning limit and its formation may resemble that of binary stars rather than that of jovian-mass planets.

  9. Step-parent adoption gone wrong: GT v CT [2015] 3 ALL SA 631 (GJ ...

    African Journals Online (AJOL)

    Because of the immense impact on a child, the rescission of an adoption order has to be handled with kid gloves. In GT v CT [2015] 3 ALL SA 631 (GJ) two children had been legally adopted by their stepfather while the Child Care Act was in operation. After the implementation of the Children's Act 38 of 2005, however, ...

  10. The role of the Cx43 C-terminus in GJ plaque formation and internalization

    International Nuclear Information System (INIS)

    Wayakanon, Praween; Bhattacharjee, Rajib; Nakahama, Ken-ichi; Morita, Ikuo

    2012-01-01

    Highlights: ► Cx43-GFP or -DsRed fusion proteins were expressed in HeLa cells. ► Roles of C-terminus were examined using various mutants. ► Gap junction plaque size was dependent on the length of C-terminus. ► C-terminus dependent gap junction plaque internalization was observed. -- Abstract: Connexin 43 (Cx43) is a major gap junction (GJ) protein found in many mammalian cell types. The C-terminal (CT) domain of Cx43 has unique characteristics in terms of amino acid (aa) sequence and its length differs from other connexins. This CT domain can be associated with protein partners to regulate GJ assembly and degradation, which results in the direct control of gap junction intercellular communication (GJIC). However, the essential roles of the CT regions involved in these mechanisms have not been fully elucidated. In this study, we aimed to investigate the specific regions of Cx43CT involved in GJ formation and internalization. Wild type Cx43 (382aa) and 10 CT truncated mutants were stably expressed in HeLa cells as GFP or DsRed tagged proteins. First, we found that the deletion of 235–382aa from Cx43 resulted in failure to make GJ and establish GJIC. Second, the Cx43 with 242–382aa CT deletion could form functional GJs and be internalized as annular gap junctions (AGJs). However, the plaques consisting of Cx43 with CT deletions (Δ242–382aa to Δ271–382aa) were longer than the plaques consisting of Cx43 with CT deletions (Δ302–382aa). Third, co-culture experiments of cells expressing wild type Cx43 (382) with cells expressing Cx43CT mutants revealed that the directions of GJ internalization were dependent on the length of the respective CT. Moreover, a specific region, 325–342aa residues of Cx43, played an important role in the direction of GJ internalization. These results showed the important roles of the Cx43 C-terminus in GJ expression and its turnover.

  11. Dosimetry measurements during the commissioning of the GJ-2 electron accelerator

    DEFF Research Database (Denmark)

    Chosdu, R.; Hilmy, N.; Tobing, R.

    1995-01-01

    The GJ-2 electron accelerator (made in China, Sanghai) was put into operation at the Centre for Application of Isotopes and Radiation in Jakarta, Indonesia. In the course of the commissioning of the machine its main technical parameters were measured under different operating conditions. The elec......The GJ-2 electron accelerator (made in China, Sanghai) was put into operation at the Centre for Application of Isotopes and Radiation in Jakarta, Indonesia. In the course of the commissioning of the machine its main technical parameters were measured under different operating conditions......, ethanol-chlorobenzene dosimeter solution and FWT-60 film dosimeters. The applicability of polystyrene calorimeters designed for low electron energies at Ris phi National Laboratory was also tested for nominal dose determination....

  12. VizieR Online Data Catalog: Transiting planet GJ 1132 (Southworth+, 2017)

    Science.gov (United States)

    Southworth, J.; Mancini, L.; Madhusudhan, N.; Molliere, P.; Ciceri, S.; Henning, T.

    2018-05-01

    Light curves of 10 transits of the extrasolar planetary system GJ 1132 are presented. The data were obtained using the MPG 2.2m telescope with GROND imager, and observed simultaneously in the g, r, i, z, J, H and K passbands. The errorbars for each transit have been scaled so the best-fitting model (obtained using the JKTEBOP code) has a reduced chi-squared value of 1.0. (1 data file).

  13. The impact of red noise in radial velocity planet searches: only three planets orbiting GJ 581?

    Science.gov (United States)

    Baluev, Roman V.

    2013-03-01

    We perform a detailed analysis of the latest HARPS and Keck radial velocity data for the planet-hosting red dwarf GJ 581, which attracted a lot of attention in recent time. We show that these data contain important correlated noise component (`red noise') with the correlation time-scale of the order of 10 d. This red noise imposes a lot of misleading effects while we work in the traditional white-noise model. To eliminate these misleading effects, we propose a maximum-likelihood algorithm equipped by an extended model of the noise structure. We treat the red noise as a Gaussian random process with an exponentially decaying correlation function. Using this method we prove that (i) planets b and c do exist in this system, since they can be independently detected in the HARPS and Keck data, and regardless of the assumed noise models; (ii) planet e can also be confirmed independently by both the data sets, although to reveal it in the Keck data it is mandatory to take the red noise into account; (iii) the recently announced putative planets f and g are likely just illusions of the red noise; (iv) the reality of the planet candidate GJ 581 d is questionable, because it cannot be detected from the Keck data, and its statistical significance in the HARPS data (as well as in the combined data set) drops to a marginal level of ˜2σ, when the red noise is taken into account. Therefore, the current data for GJ 581 really support the existence of no more than four (or maybe even only three) orbiting exoplanets. The planet candidate GJ 581 d requests serious observational verification.

  14. RAYLEIGH SCATTERING IN THE ATMOSPHERE OF THE WARM EXO-NEPTUNE GJ 3470B

    Energy Technology Data Exchange (ETDEWEB)

    Dragomir, Diana [Las Cumbres Observatory Global Telescope Network, 6740 Cortona Drive Suite 102, Goleta, CA 93117 (United States); Benneke, Björn [Division of Geological and Planetary Sciences, California Institute of Technology, Pasadena, CA 91125 (United States); Pearson, Kyle A. [Department of Physics and Astronomy, Northern Arizona University, Flagstaff, AZ 86001 (United States); Crossfield, Ian J. M.; Barman, Travis [Department of Planetary Sciences, Lunar and Planetary Laboratory, University of Arizona, Tucson, AZ 85721 (United States); Eastman, Jason [Harvard-Smithsonian Center for Astrophysics, Cambridge, MA 02138 (United States); Biddle, Lauren I., E-mail: diana@oddjob.uchicago.edu [Gemini Observatory, Northern Operations Center, 670 N. Aohoku Place, Hilo, HI 96720 (United States)

    2015-12-01

    GJ 3470b is a warm Neptune-size planet transiting an M dwarf star. Like the handful of other small exoplanets for which transmission spectroscopy has been obtained, GJ 3470b exhibits a flat spectrum in the near- and mid-infrared. Recently, a tentative detection of Rayleigh scattering in its atmosphere has been reported. This signal manifests itself as an observed increase of the planetary radius as a function of decreasing wavelength in the visible. We set out to verify this detection and observed several transits of this planet with the LCOGT network and the Kuiper telescope in four different bands (Sloan g, Sloan i, Harris B, and Harris V). Our analysis reveals a strong Rayleigh scattering slope, thus confirming previous results. This makes GJ 3470b the smallest known exoplanet with a detection of Rayleigh scattering. We find that the most plausible scenario is a hydrogen/helium-dominated atmosphere covered by clouds which obscure absorption features in the infrared and hazes which give rise to scattering in the visible. Our results demonstrate the feasibility of exoplanet atmospheric characterization from the ground, even with meter-class telescopes.

  15. RAYLEIGH SCATTERING IN THE ATMOSPHERE OF THE WARM EXO-NEPTUNE GJ 3470B

    International Nuclear Information System (INIS)

    Dragomir, Diana; Benneke, Björn; Pearson, Kyle A.; Crossfield, Ian J. M.; Barman, Travis; Eastman, Jason; Biddle, Lauren I.

    2015-01-01

    GJ 3470b is a warm Neptune-size planet transiting an M dwarf star. Like the handful of other small exoplanets for which transmission spectroscopy has been obtained, GJ 3470b exhibits a flat spectrum in the near- and mid-infrared. Recently, a tentative detection of Rayleigh scattering in its atmosphere has been reported. This signal manifests itself as an observed increase of the planetary radius as a function of decreasing wavelength in the visible. We set out to verify this detection and observed several transits of this planet with the LCOGT network and the Kuiper telescope in four different bands (Sloan g, Sloan i, Harris B, and Harris V). Our analysis reveals a strong Rayleigh scattering slope, thus confirming previous results. This makes GJ 3470b the smallest known exoplanet with a detection of Rayleigh scattering. We find that the most plausible scenario is a hydrogen/helium-dominated atmosphere covered by clouds which obscure absorption features in the infrared and hazes which give rise to scattering in the visible. Our results demonstrate the feasibility of exoplanet atmospheric characterization from the ground, even with meter-class telescopes

  16. GJ 1214: Rotation period, starspots, and uncertainty on the optical slope of the transmission spectrum

    Science.gov (United States)

    Mallonn, M.; Herrero, E.; Juvan, I. G.; Essen, C. von; Rosich, A.; Ribas, I.; Granzer, T.; Alexoudi, X.; Strassmeier, K. G.

    2018-06-01

    Aims: Brightness inhomogeneities in the stellar photosphere (dark spots or bright regions) affect the measurements of the planetary transmission spectrum. To investigate the star spots of the M dwarf GJ 1214, we conducted a multicolor photometric monitoring from 2012 to 2016. Methods: The time-series photometry was analyzed with the light curve inversion tool StarSim. Using the derived stellar surface properties from the light curve inversion, we modeled the impact of the star spots when unocculted by the transiting planet. We compared the photometric variability of GJ 1214 to published results of mid- to late M dwarfs from the MEarth sample. Results: The measured variability shows a periodicity of 125 ± 5 days, which we interpret as the signature of the stellar rotation period. This value overrules previous suggestions of a significantly shorter stellar rotation period. A light curve inversion of the monitoring data yields an estimation of the flux dimming of a permanent spot filling factor not contributing to the photometric variability, a temperature contrast of the spots of 370 K and persistent active longitudes. The derived surface maps over all five seasons were used to estimate the influence of the star spots on the transmission spectrum of the planet from 400 to 2000 nm. The monitoring data presented here do not support a recent interpretation of a measured transmission spectrum of GJ 1214b as to be caused by bright regions in the stellar photosphere. Instead, we list arguments as to why the effect of dark spots likely dominated over bright regions in the period of our monitoring. Furthermore, our photometry proves an increase in variability over at least four years, indicative for a cyclic activity behavior. The age of GJ 1214 is likely between 6 and 10 Gyr. Conclusions: The long-term photometry allows for a correction of unocculted spots. For an active star such as GJ 1214, there remains a degeneracy between occulted spots and the transit parameters used

  17. The multicomponent (2+1)-dimensional Glachette–Johnson (GJ) equation hierarchy and its super-integrable coupling system

    International Nuclear Information System (INIS)

    Yu Fajun; Zhang Hongqing

    2008-01-01

    This paper presents a set of multicomponent matrix Lie algebra, which is used to construct a new loop algebra à M . By using the Tu scheme, a Liouville integrable multicomponent equation hierarchy is generated, which possesses the Hamiltonian structure. As its reduction cases, the multicomponent (2+1)-dimensional Glachette–Johnson (GJ) hierarchy is given. Finally, the super-integrable coupling system of multicomponent (2+1)-dimensional GJ hierarchy is established through enlarging the spectral problem

  18. ASTROMETRY AND RADIAL VELOCITIES OF THE PLANET HOST M DWARF GJ 317: NEW TRIGONOMETRIC DISTANCE, METALLICITY, AND UPPER LIMIT TO THE MASS OF GJ 317b

    International Nuclear Information System (INIS)

    Anglada-Escudé, Guillem; Boss, Alan P.; Weinberger, Alycia J.; Butler, R. Paul; Thompson, Ian B.; Vogt, Steven S.; Rivera, Eugenio J.

    2012-01-01

    We have obtained precision astrometry of the planet host M dwarf GJ 317 in the framework of the Carnegie Astrometric Planet Search project. The new astrometric measurements give a distance determination of 15.3 pc, 65% further than previous estimates. The resulting absolute magnitudes suggest that it is metal-rich and more massive than previously assumed. This result strengthens the correlation between high metallicity and the presence of gas giants around low-mass stars. At 15.3 pc, the minimal astrometric amplitude for planet candidate GJ 317b is 0.3 mas (edge-on orbit), just below our astrometric sensitivity. However, given the relatively large number of observations and good astrometric precision, a Bayesian Monte Carlo Markov Chain analysis indicates that the mass of planet b has to be smaller than twice the minimum mass with a 99% confidence level, with a most likely value of 2.5 M Jup . Additional radial velocity (RV) measurements obtained with Keck by the Lick-Carnegie Planet search program confirm the presence of an additional very long period planet candidate, with a period of 20 years or more. Even though such an object will imprint a large astrometric wobble on the star, its curvature is yet not evident in the astrometry. Given high metallicity, and the trend indicating that multiple systems are rich in low-mass companions, this system is likely to host additional low-mass planets in its habitable zone that can be readily detected with state-of-the-art optical and near-infrared RV measurements.

  19. ASTROMETRY AND RADIAL VELOCITIES OF THE PLANET HOST M DWARF GJ 317: NEW TRIGONOMETRIC DISTANCE, METALLICITY, AND UPPER LIMIT TO THE MASS OF GJ 317b

    Energy Technology Data Exchange (ETDEWEB)

    Anglada-Escude, Guillem; Boss, Alan P.; Weinberger, Alycia J.; Butler, R. Paul [Department of Terrestrial Magnetism, Carnegie Institution for Science, 5241 Broad Branch Road NW, Washington, DC 20015 (United States); Thompson, Ian B. [Carnegie Observatories, 813 Santa Barbara Street, Pasadena, CA 91101 (United States); Vogt, Steven S.; Rivera, Eugenio J., E-mail: anglada@dtm.ciw.edu [UCO/Lick Observatory, University of California, Santa Cruz, CA 95064 (United States)

    2012-02-10

    We have obtained precision astrometry of the planet host M dwarf GJ 317 in the framework of the Carnegie Astrometric Planet Search project. The new astrometric measurements give a distance determination of 15.3 pc, 65% further than previous estimates. The resulting absolute magnitudes suggest that it is metal-rich and more massive than previously assumed. This result strengthens the correlation between high metallicity and the presence of gas giants around low-mass stars. At 15.3 pc, the minimal astrometric amplitude for planet candidate GJ 317b is 0.3 mas (edge-on orbit), just below our astrometric sensitivity. However, given the relatively large number of observations and good astrometric precision, a Bayesian Monte Carlo Markov Chain analysis indicates that the mass of planet b has to be smaller than twice the minimum mass with a 99% confidence level, with a most likely value of 2.5 M{sub Jup}. Additional radial velocity (RV) measurements obtained with Keck by the Lick-Carnegie Planet search program confirm the presence of an additional very long period planet candidate, with a period of 20 years or more. Even though such an object will imprint a large astrometric wobble on the star, its curvature is yet not evident in the astrometry. Given high metallicity, and the trend indicating that multiple systems are rich in low-mass companions, this system is likely to host additional low-mass planets in its habitable zone that can be readily detected with state-of-the-art optical and near-infrared RV measurements.

  20. A System of Three Super Earths Transiting the Late K-Dwarf GJ 9827 at 30 pc

    Science.gov (United States)

    Rodriguez, Joseph E.; Vanderburg, Andrew; Eastman, Jason D.; Mann, Andrew W.; Crossfield, Ian J. M.; Ciardi, David R.; Latham, David W.; Quinn, Samuel N.

    2018-02-01

    We report the discovery of three small transiting planets orbiting GJ 9827, a bright (K = 7.2) nearby late K-type dwarf star. GJ 9827 hosts a 1.62 ± 0.11 {R}\\oplus super Earth on a 1.2 day period, a {1.269}-0.089+0.087 {R}\\oplus super Earth on a 3.6 day period, and a 2.07 ± 0.14 {R}\\oplus super Earth on a 6.2 day period. The radii of the planets transiting GJ 9827 span the transition between predominantly rocky and gaseous planets, and GJ 9827 b and c fall in or close to the known gap in the radius distribution of small planets between these populations. At a distance of 30 pc, GJ 9827 is the closest exoplanet host discovered by K2 to date, making these planets well-suited for atmospheric studies with the upcoming James Webb Space Telescope. The GJ 9827 system provides a valuable opportunity to characterize interior structure and atmospheric properties of coeval planets spanning the rocky to gaseous transition.

  1. QUANTITATIVELY ASSESSING THE ROLE OF CLOUDS IN THE TRANSMISSION SPECTRUM OF GJ 1214b

    Energy Technology Data Exchange (ETDEWEB)

    Morley, Caroline V.; Fortney, Jonathan J. [Department of Astronomy and Astrophysics, University of California, Santa Cruz, CA 95064 (United States); Kempton, Eliza M.-R. [Department of Physics, Grinnell College, Grinnell, IA 50112 (United States); Marley, Mark S.; Zahnle, Kevin [NASA Ames Research Center, 245-3, Moffett Field, CA 94035 (United States); Vissher, Channon, E-mail: cmorley@ucolick.org [Southwest Research Institute, Boulder, CO 80302 (United States)

    2013-09-20

    Recent observations of the super-Earth GJ 1214b show that it has a relatively featureless transmission spectrum. One suggestion is that these observations indicate that the planet's atmosphere is vertically compact, perhaps due to a water-rich composition that yields a large mean molecular weight. Another suggestion is that the atmosphere is hydrogen/helium-rich with clouds that obscure predicted absorption features. Previous models that incorporate clouds have included their effect without a strong physical motivation for their existence. Here, we present model atmospheres of GJ 1214b that include physically motivated clouds of two types. We model the clouds that are present in chemical equilibrium, as has been suggested to occur on brown dwarfs, which include KCl and ZnS for this planet. We also include clouds that form as a result of photochemistry, forming a hydrocarbon haze layer. We use a photochemical kinetics model to understand the vertical distribution and available mass of haze-forming molecules. We model both solar and enhanced-metallicity cloudy models and determine the cloud properties necessary to match observations. In enhanced-metallicity atmospheres, we find that the equilibrium clouds can match the observations of GJ 1214b if they are lofted high into the atmosphere and have a low sedimentation efficiency (f{sub sed} = 0.1). We find that models with a variety of hydrocarbon haze properties can match the observations. Particle sizes from 0.01 to 0.25 μm can match the transmission spectrum with haze-forming efficiencies as low as 1%-5%.

  2. SEARCH FOR RAYLEIGH SCATTERING IN THE ATMOSPHERE OF GJ1214b

    International Nuclear Information System (INIS)

    De Mooij, E. J. W.; Jayawardhana, R.; Brogi, M.; Snellen, I. A. G.; Hoekstra, H.; Otten, G. P. P. L.; Bekkers, D. H.; Haffert, S. Y.; Van Houdt, J. J.; De Kok, R. J.; Croll, B.

    2013-01-01

    We investigate the atmosphere of GJ1214b, a transiting super-Earth planet with a low mean density, by measuring its transit depth as a function of wavelength in the blue optical portion of the spectrum. It is thought that this planet is either a mini-Neptune, consisting of a rocky core with a thick, hydrogen-rich atmosphere, or a planet with a composition dominated by water. Most observations favor a water-dominated atmosphere with a small scale-height, however, some observations indicate that GJ1214b could have an extended atmosphere with a cloud layer muting the molecular features. In an atmosphere with a large scale-height, Rayleigh scattering at blue wavelengths is likely to cause a measurable increase in the apparent size of the planet toward the blue. We observed the transit of GJ1214b in the B band with the FOcal Reducing Spectrograph at the Very Large Telescope and in the g band with both ACAM on the William Herschel Telescope (WHT) and the Wide Field Camera at the Isaac Newton Telescope (INT). We find a planet-to-star radius ratio in the B band of 0.1162 ± 0.0017, and in the g band 0.1180 ± 0.0009 and 0.1174 ± 0.0017 for the WHT and INT observations, respectively. These optical data do not show significant deviations from previous measurements at longer wavelengths. In fact, a flat transmission spectrum across all wavelengths best describes the combined observations. When atmospheric models are considered, a small scale-height water-dominated model fits the data best.

  3. Lyman-alpha transit observations of the warm rocky exoplanet GJ1132b

    Science.gov (United States)

    Waalkes, William; Berta-Thompson, Zachory K.; Charbonneau, David; Irwin, Jonathan; Newton, Elisabeth; Dittmann, Jason; Bourrier, Vincent; Ehrenreich, David; Kempton, Eliza; Will

    2018-06-01

    GJ1132b is one of the few known Earth-sized planets, and at 12pc away it is also one of the closest known transiting planets. With an equilibrium temperature of 500 K, this planet is too hot to be habitable but we can use it to learn about the presence and volatile content of rocky planet atmospheres around M dwarf stars. Using Hubble STIS spectra obtained during primary transit, we search for a Lyman-α transit. If we were to observe a deep Lyman-α transit, that would indicate the presence of a neutral hydrogen envelope flowing from GJ1132b. On the other hand, ruling out deep absorption from neutral hydrogen may indicate that this planet has either retained its volatiles or lost them very early in the star’s life. We carry out this analysis by extracting 1D spectra from the STIS pipeline, splitting the time-tagged spectra into higher resolution samples, and producing light curves of the red and blue wings of the Lyman-α line. We fit for the baseline stellar flux and transit depths in order to constrain the characteristics of the cloud of neutral hydrogen gas that may surround the planet. We do not conclusively detect a transit but the results provide an upper limit for the transit depth. We also analyze the stellar variability and Lyman-α spectrum of GJ1132, a slowly-rotating 0.18 solar mass M dwarf with previously uncharacterized UV activity. Understanding the role that UV variability plays in planetary atmospheres and volatile retention is crucial to assess atmospheric evolution and the habitability of cooler rocky planets.

  4. Framing the Arctic: Reconsidering Roald Amundsen’s Gjøa Expedition Imagery

    Directory of Open Access Journals (Sweden)

    Ingeborg Høvik

    2015-04-01

    Full Text Available In 1906 Roald Amundsen’s Gjøa Expedition returned to Norway after three years in the Arctic. The first to complete a Northwest Passage by sea, the expedition also brought back a substantial amount of ethnographic material concerning the Netsilik Inuit, with whom Amundsen and his crew had been in sustained contact during their stay on King William Island in Nunavut between 1903 and 1905. This material included a large number of photographs, forty-two of which were included as illustrations in his expedition narrative, titled Nordvest-passagen and first released in Norwegian in 1907. Focusing on a selection of published and unpublished photographs from Amundsen’s voyage and their interrelationships, this article examines the degree to which the Gjøa Expedition’s use of photography formed part of a planned project that intersected with anthropological concerns and practices of its time. My purpose is further to demonstrate that there is a discernible change in the representation of indigeneity that occurs when particular photographs were selected and then contextually reframed as illustrations in Nordvest-passagen. On the one hand, the extensive body of photographs taken in the field elaborates the close interaction between crew and Inuit recorded in Amundsen’s personal diary and published narrative, testifying to the existence of an active and dynamic contact zone. In this regard, the original photographs could arguably be read as a dialogic portrayal of the unique individuals Amundsen’s crew met while in the Arctic. On the other hand, a peculiar distancing seems to have taken place as the Gjøa Expedition’s photographs were selected and reproduced as illustrations for Amundsen’s expedition narrative. Likely connected to a desire to match his expedition narrative to existing scientific visual and literary conventions, this shift suggests Amundsen’s attempts through textual and visual means to deny the Netsilik Inuit

  5. Angucycline Glycosides from Mangrove-Derived Streptomyces diastaticus subsp. SCSIO GJ056

    Directory of Open Access Journals (Sweden)

    Chun Gui

    2018-05-01

    Full Text Available Nine new angucycline glycosides designated urdamycins N1–N9 (1–9, together with two known congener urdamycins A (10 and B (11, were obtained from a mangrove-derived Streptomyces diastaticus subsp. SCSIO GJ056. The structures of new compounds were elucidated on the basis of extensive spectroscopic data analysis. The absolute configurations of 6–9 were assigned by electronic circular dichroism calculation method. Urdamycins N6 (6 and N9 (9 represent the first naturally occurring (5R, 6R-angucycline glycosides, which are diastereomers of urdamycins N7 (7 and N8 (8, respectively.

  6. THEORETICAL TRANSIT SPECTRA FOR GJ 1214b AND OTHER 'SUPER-EARTHS'

    Energy Technology Data Exchange (ETDEWEB)

    Howe, Alex R.; Burrows, Adam S., E-mail: arhowe@astro.princeton.edu, E-mail: burrows@astro.princeton.edu [Department of Astrophysical Sciences, Peyton Hall, Princeton University, Princeton, NJ 08544 (United States)

    2012-09-10

    We present new calculations of transit spectra of super-Earths that allow for atmospheres with arbitrary proportions of common molecular species and haze. We test this method with generic spectra, reproducing the expected systematics and absorption features, then apply it to the nearby super-Earth GJ 1214b, which has produced conflicting observational data, leaving the questions of a hydrogen-rich versus hydrogen-poor atmosphere and the water content of the atmosphere ambiguous. We present representative transit spectra for a range of classes of atmosphere models for GJ 1214b. Our analysis supports a hydrogen-rich atmosphere with a cloud or haze layer, although a hydrogen-poor model with {approx}<10% water is not ruled out. Several classes of models are ruled out, however, including hydrogen-rich atmospheres with no haze, hydrogen-rich atmospheres with a haze of {approx}0.01 {mu}m tholin particles, and hydrogen-poor atmospheres with major sources of absorption other than water. We propose an observational test to distinguish hydrogen-rich from hydrogen-poor atmospheres. Finally, we provide a library of theoretical transit spectra for super-Earths with a broad range of parameters to facilitate future comparison with anticipated data.

  7. GJ 3236: A NEW BRIGHT, VERY LOW MASS ECLIPSING BINARY SYSTEM DISCOVERED BY THE MEARTH OBSERVATORY

    International Nuclear Information System (INIS)

    Irwin, Jonathan; Charbonneau, David; Berta, Zachory K.; Quinn, Samuel N.; Latham, David W.; Torres, Guillermo; Blake, Cullen H.; Burke, Christopher J.; Esquerdo, Gilbert A.; Fueresz, Gabor; Mink, Douglas J.; Nutzman, Philip; Szentgyorgyi, Andrew H.; Calkins, Michael L.; Falco, Emilio E.; Bloom, Joshua S.; Starr, Dan L.

    2009-01-01

    We report the detection of eclipses in GJ 3236, a bright (I = 11.6), very low mass binary system with an orbital period of 0.77 days. Analysis of light and radial velocity curves of the system yielded component masses of 0.38 ± 0.02 M sun and 0.28 ± 0.02 M sun . The central values for the stellar radii are larger than the theoretical models predict for these masses, in agreement with the results for existing eclipsing binaries, although the present 5% observational uncertainties limit the significance of the larger radii to approximately 1σ. Degeneracies in the light curve models resulting from the unknown configuration of surface spots on the components of GJ 3236 currently dominate the uncertainties in the radii, and could be reduced by obtaining precise, multiband photometry covering the full orbital period. The system appears to be tidally synchronized and shows signs of high activity levels as expected for such a short orbital period, evidenced by strong Hα emission lines in the spectra of both components. These observations probe an important region of mass-radius parameter space around the predicted transition to fully convective stellar interiors, where there are a limited number of precise measurements available in the literature.

  8. The atmospheric circulation of the super Earth GJ 1214b: Dependence on composition and metallicity

    Energy Technology Data Exchange (ETDEWEB)

    Kataria, T.; Showman, A. P. [Department of Planetary Sciences and Lunar and Planetary Laboratory, The University of Arizona, Tucson, AZ 85721 (United States); Fortney, J. J. [Department of Astronomy and Astrophysics, University of California, Santa Cruz, CA 95064 (United States); Marley, M. S.; Freedman, R. S., E-mail: tkataria@lpl.arizona.edu [NASA Ames Research Center 245-3, Moffett Field, CA 94035 (United States)

    2014-04-20

    We present three-dimensional atmospheric circulation models of GJ 1214b, a 2.7 Earth-radius, 6.5 Earth-mass super Earth detected by the MEarth survey. Here we explore the planet's circulation as a function of atmospheric metallicity and atmospheric composition, modeling atmospheres with a low mean molecular weight (MMW; i.e., H{sub 2}-dominated) and a high MMW (i.e., water- and CO{sub 2}-dominated). We find that atmospheres with a low MMW have strong day-night temperature variations at pressures above the infrared photosphere that lead to equatorial superrotation. For these atmospheres, the enhancement of atmospheric opacities with increasing metallicity lead to shallower atmospheric heating, larger day-night temperature variations, and hence stronger superrotation. In comparison, atmospheres with a high MMW have larger day-night and equator-to-pole temperature variations than low MMW atmospheres, but differences in opacity structure and energy budget lead to differences in jet structure. The circulation of a water-dominated atmosphere is dominated by equatorial superrotation, while the circulation of a CO{sub 2}-dominated atmosphere is instead dominated by high-latitude jets. By comparing emergent flux spectra and light curves for 50× solar and water-dominated compositions, we show that observations in emission can break the degeneracy in determining the atmospheric composition of GJ 1214b. The variation in opacity with wavelength for the water-dominated atmosphere leads to large phase variations within water bands and small phase variations outside of water bands. The 50× solar atmosphere, however, yields small variations within water bands and large phase variations at other characteristic wavelengths. These observations would be much less sensitive to clouds, condensates, and hazes than transit observations.

  9. Time-Resolved Ultraviolet Spectroscopy of The M-Dwarf GJ 876 Exoplanetary System

    Science.gov (United States)

    France, Kevin; Linsky, Jeffrey L.; Tian, Feng; Froning, Cynthia S.; Roberge, Aki

    2012-01-01

    Extrasolar planets orbiting M-stars may represent our best chance to discover habitable worlds in the coming decade. The ultraviolet spectrum incident upon both Earth-like and Jovian planets is critically important for proper modeling of their atmospheric heating and chemistry. In order to provide more realistic inputs for atmospheric models of planets orbiting low-mass stars, we present new near- and far-ultraviolet (NUV and FUV) spectroscopy of the M-dwarf exoplanet host GJ 876 (M4V). Using the COS and STIS spectrographs on board the Hubble Space Telescope, we have measured the 1150-3140 A spectrum of GJ 876. We have reconstructed the stellar H1 Ly alpha emission line profile, and find that the integrated Ly alpha flux is roughly equal to the rest of the integrated flux (1150-1210 A + 1220-3140 A) in the entire ultraviolet bandpass (F(Ly alpha)/F(FUV+NUV) equals approximately 0.7). This ratio is approximately 2500x greater than the solar value. We describe the ultraviolet line spectrum and report surprisingly strong fluorescent emission from hot H2 (T(H2) greater than 2000 K). We show the light curve of a chromospheric + transition region flare observed in several far-UV emission lines, with flare/quiescent flux ratios greater than or equal to 10. The strong FUV radiation field of an M-star (and specifically Ly alpha) is important for determining the abundance of O2--and the formation of biomarkers-in the lower atmospheres of Earth-like planets in the habitable zones of low-mass stars.

  10. TIME-RESOLVED ULTRAVIOLET SPECTROSCOPY OF THE M-DWARF GJ 876 EXOPLANETARY SYSTEM

    International Nuclear Information System (INIS)

    France, Kevin; Froning, Cynthia S.; Linsky, Jeffrey L.; Tian, Feng; Roberge, Aki

    2012-01-01

    Extrasolar planets orbiting M-stars may represent our best chance to discover habitable worlds in the coming decade. The ultraviolet spectrum incident upon both Earth-like and Jovian planets is critically important for proper modeling of their atmospheric heating and chemistry. In order to provide more realistic inputs for atmospheric models of planets orbiting low-mass stars, we present new near- and far-ultraviolet (NUV and FUV) spectroscopy of the M-dwarf exoplanet host GJ 876 (M4V). Using the COS and STIS spectrographs on board the Hubble Space Telescope, we have measured the 1150-3140 Å spectrum of GJ 876. We have reconstructed the stellar H I Lyα emission line profile, and find that the integrated Lyα flux is roughly equal to the rest of the integrated flux (1150-1210 Å + 1220-3140 Å) in the entire ultraviolet bandpass (F(Lyα)/F(FUV+NUV) ≈ 0.7). This ratio is ∼2500× greater than the solar value. We describe the ultraviolet line spectrum and report surprisingly strong fluorescent emission from hot H 2 (T(H 2 ) > 2000 K). We show the light curve of a chromospheric + transition region flare observed in several far-UV emission lines, with flare/quiescent flux ratios ≥10. The strong FUV radiation field of an M-star (and specifically Lyα) is important for determining the abundance of O 2 —and the formation of biomarkers—in the lower atmospheres of Earth-like planets in the habitable zones of low-mass stars.

  11. THE LEECH EXOPLANET IMAGING SURVEY: CHARACTERIZATION OF THE COLDEST DIRECTLY IMAGED EXOPLANET, GJ 504 b, AND EVIDENCE FOR SUPERSTELLAR METALLICITY

    Energy Technology Data Exchange (ETDEWEB)

    Skemer, Andrew J.; Leisenring, Jarron; Bailey, Vanessa; Hinz, Philip; Defrére, Denis; Apai, Dániel; Close, Laird; Eisner, Josh [Steward Observatory, University of Arizona, 933 North Cherry Ave. Tucson, AZ 85721 (United States); Morley, Caroline V.; Fortney, Jonathan [University of California, Santa Cruz, 1156 High St. Santa Cruz, CA 95064 (United States); Zimmerman, Neil T.; Buenzli, Esther; Bonnefoy, Mickael; Biller, Beth; Brandner, Wolfgang [Max Planck Institute for Astronomy, Königstuhl 17, 69117 Heidelberg (Germany); Skrutskie, Michael F. [University of Virginia, 530 McCormick Rd., Charlottesville, VA 22904 (United States); Esposito, Simone [Istituto Nazionale di Astrofisica-Arcetri Astrophysical Observatory, Largo Enrico Fermi 5, 50125, Florence (Italy); Crepp, Justin R. [Notre Dame University, 225 Nieuwland Science Hall, Notre Dame, IN 46556 (United States); De Rosa, Robert J. [Arizona State University, 781 South Terrace Rd, Tempe, AZ 85281 (United States); Desidera, Silvano [Istituto Nazionale di Astrofisica-Padova Astronomical Observatory, Vicolo dell’Osservatorio 5, 35122 Padova (Italy); and others

    2016-02-01

    As gas giant planets and brown dwarfs radiate away the residual heat from their formation, they cool through a spectral type transition from L to T, which encompasses the dissipation of cloud opacity and the appearance of strong methane absorption. While there are hundreds of known T-type brown dwarfs, the first generation of directly imaged exoplanets were all L type. Recently, Kuzuhara et al. announced the discovery of GJ 504 b, the first T dwarf exoplanet. GJ 504 b provides a unique opportunity to study the atmosphere of a new type of exoplanet with a ∼500 K temperature that bridges the gap between the first directly imaged planets (∼1000 K) and our own solar system's Jupiter (∼130 K). We observed GJ 504 b in three narrow L-band filters (3.71, 3.88, and 4.00 μm), spanning the red end of the broad methane fundamental absorption feature (3.3 μm) as part of the LBTI Exozodi Exoplanet Common Hunt (LEECH) exoplanet imaging survey. By comparing our new photometry and literature photometry with a grid of custom model atmospheres, we were able to fit GJ 504 b's unusual spectral energy distribution for the first time. We find that GJ 504 b is well fit by models with the following parameters: T{sub eff} = 544 ± 10 K, g < 600 m s{sup −2}, [M/H] = 0.60 ± 0.12, cloud opacity parameter of f{sub sed} = 2–5, R = 0.96 ± 0.07 R{sub Jup}, and log(L) = −6.13 ± 0.03 L{sub ⊙}, implying a hot start mass of 3–30 M{sub jup} for a conservative age range of 0.1–6.5 Gyr. Of particular interest, our model fits suggest that GJ 504 b has a superstellar metallicity. Since planet formation can create objects with nonstellar metallicities, while binary star formation cannot, this result suggests that GJ 504 b formed like a planet, not like a binary companion.

  12. The LEECH Exoplanet Imaging Survey: Characterization of the Coldest Directly Imaged Exoplanet, GJ 504 b, and Evidence for Superstellar Metallicity

    Science.gov (United States)

    Skemer, Andrew J.; Morley, Caroline V.; Zimmerman, Neil T.; Skrutskie, Michael F.; Leisenring, Jarron; Buenzli, Esther; Bonnefoy, Mickael; Bailey, Vanessa; Hinz, Philip; Defrére, Denis; Esposito, Simone; Apai, Dániel; Biller, Beth; Brandner, Wolfgang; Close, Laird; Crepp, Justin R.; De Rosa, Robert J.; Desidera, Silvano; Eisner, Josh; Fortney, Jonathan; Freedman, Richard; Henning, Thomas; Hofmann, Karl-Heinz; Kopytova, Taisiya; Lupu, Roxana; Maire, Anne-Lise; Males, Jared R.; Marley, Mark; Morzinski, Katie; Oza, Apurva; Patience, Jenny; Rajan, Abhijith; Rieke, George; Schertl, Dieter; Schlieder, Joshua; Stone, Jordan; Su, Kate; Vaz, Amali; Visscher, Channon; Ward-Duong, Kimberly; Weigelt, Gerd; Woodward, Charles E.

    2016-02-01

    As gas giant planets and brown dwarfs radiate away the residual heat from their formation, they cool through a spectral type transition from L to T, which encompasses the dissipation of cloud opacity and the appearance of strong methane absorption. While there are hundreds of known T-type brown dwarfs, the first generation of directly imaged exoplanets were all L type. Recently, Kuzuhara et al. announced the discovery of GJ 504 b, the first T dwarf exoplanet. GJ 504 b provides a unique opportunity to study the atmosphere of a new type of exoplanet with a ˜500 K temperature that bridges the gap between the first directly imaged planets (˜1000 K) and our own solar system's Jupiter (˜130 K). We observed GJ 504 b in three narrow L-band filters (3.71, 3.88, and 4.00 μm), spanning the red end of the broad methane fundamental absorption feature (3.3 μm) as part of the LBTI Exozodi Exoplanet Common Hunt (LEECH) exoplanet imaging survey. By comparing our new photometry and literature photometry with a grid of custom model atmospheres, we were able to fit GJ 504 b's unusual spectral energy distribution for the first time. We find that GJ 504 b is well fit by models with the following parameters: Teff = 544 ± 10 K, g Germany. LBT Corporation partners are the University of Arizona on behalf of the Arizona university system; Istituto Nazionale di Astrophisica, Italy; LBT Beteiligungsgesellschaft, Germany, representing the Max-Planck Society, the Astrophysical Institute Potsdam, and Heidelberg University; The Ohio State University, and the Research Corporation, on behalf of the University of Notre Dame, University of Minnesota, and University of Virginia.

  13. PWR type overpower tests at 1620 GJ/KGU (18,800 MWD/MTU)

    International Nuclear Information System (INIS)

    Knudsen, P.; Bagger, C.; Carlsen, H.

    1979-01-01

    Three PWR type test fuel pins accumulated a burnup of 1620 GJ/kgU at heat loads decreasing from 45 to 28 kW/m (avg. test levels). One pin was ramped to 43 kW/m at 31 W/m/s; after 15 ks the power was increased to 45 kW/m and held constant for 1.9 Ms without failure indication. The other two pins were ramped to 44 kW/m at 23 W/m/s and then to 49 kW/m in a further 1.2 ks; both failed after max. 360 s. The post-irradiation examination revealed large stress-corrosion (SCC) type cladding cracks. Other cracks, down to a few μm deep, were probably early stages of large SCC cracks. Fission gas release in the intact pin was as high as 42% and estimated to be much lower for the two failed pins

  14. KEPLER FLARES. II. THE TEMPORAL MORPHOLOGY OF WHITE-LIGHT FLARES ON GJ 1243

    Energy Technology Data Exchange (ETDEWEB)

    Davenport, James R. A.; Hawley, Suzanne L.; Johnson, Emily C.; Peraza, Jesus; Jansen, Tiffany C.; Larsen, Daniel M. [Department of Astronomy, University of Washington, P.O. Box 351580, Seattle, WA 98195 (United States); Hebb, Leslie [Department of Physics, Hobart and William Smith Colleges, 300 Pulteney Street, Geneva, NY 14456 (United States); Wisniewski, John P.; Malatesta, Michael; Keil, Marcus; Silverberg, Steven M.; Scheffler, Matthew S.; Berdis, Jodi R. [HL Dodge Department of Physics and Astronomy, University of Oklahoma, 440 W Brooks Street, Norman, OK 73019 (United States); Kowalski, Adam F. [NASA Goddard Space Flight Center, Code 671, Greenbelt, MD 20771 (United States); Hilton, Eric J., E-mail: jrad@astro.washington.edu [Universe Sandbox, 911 E. Pike Street #333, Seattle, WA 98122 (United States)

    2014-12-20

    We present the largest sample of flares ever compiled for a single M dwarf, the active M4 star GJ 1243. Over 6100 individual flare events, with energies ranging from 10{sup 29} to 10{sup 33} erg, are found in 11 months of 1 minute cadence data from Kepler. This sample is unique for its completeness and dynamic range. We have developed automated tools for finding flares in short-cadence Kepler light curves, and performed extensive validation and classification of the sample by eye. From this pristine sample of flares we generate a median flare template. This template shows that two exponential cooling phases are present during the white-light flare decay, providing fundamental constraints for models of flare physics. The template is also used as a basis function to decompose complex multi-peaked flares, allowing us to study the energy distribution of these events. Only a small number of flare events are not well fit by our template. We find that complex, multi-peaked flares occur in over 80% of flares with a duration of 50 minutes or greater. The underlying distribution of flare durations for events 10 minutes and longer appears to follow a broken power law. Our results support the idea that sympathetic flaring may be responsible for some complex flare events.

  15. KEPLER FLARES. II. THE TEMPORAL MORPHOLOGY OF WHITE-LIGHT FLARES ON GJ 1243

    International Nuclear Information System (INIS)

    Davenport, James R. A.; Hawley, Suzanne L.; Johnson, Emily C.; Peraza, Jesus; Jansen, Tiffany C.; Larsen, Daniel M.; Hebb, Leslie; Wisniewski, John P.; Malatesta, Michael; Keil, Marcus; Silverberg, Steven M.; Scheffler, Matthew S.; Berdis, Jodi R.; Kowalski, Adam F.; Hilton, Eric J.

    2014-01-01

    We present the largest sample of flares ever compiled for a single M dwarf, the active M4 star GJ 1243. Over 6100 individual flare events, with energies ranging from 10 29 to 10 33 erg, are found in 11 months of 1 minute cadence data from Kepler. This sample is unique for its completeness and dynamic range. We have developed automated tools for finding flares in short-cadence Kepler light curves, and performed extensive validation and classification of the sample by eye. From this pristine sample of flares we generate a median flare template. This template shows that two exponential cooling phases are present during the white-light flare decay, providing fundamental constraints for models of flare physics. The template is also used as a basis function to decompose complex multi-peaked flares, allowing us to study the energy distribution of these events. Only a small number of flare events are not well fit by our template. We find that complex, multi-peaked flares occur in over 80% of flares with a duration of 50 minutes or greater. The underlying distribution of flare durations for events 10 minutes and longer appears to follow a broken power law. Our results support the idea that sympathetic flaring may be responsible for some complex flare events

  16. Determination of Lande gJ - factors of La I levels using laser spectroscopic methods: Complementary investigations

    Science.gov (United States)

    Sobolewski, Ł. M.; Windholz, L.; Kwela, J.

    2017-11-01

    Laser Induced Fluorescence Spectroscopy (LIF) and Optogalvanic Spectroscopy (OG) were used for the investigation of the Zeeman hyperfine structures of 26 spectral lines of La I in the wavelength range between 569.7 and 665.4 nm. As a source of free La atoms a hollow cathode discharge lamp was used. The spectra were recorded in the presence of a magnetic field of about 800G produced by a permanent magnet for two linear polarizations of the exciting laser light. As a result of the study, we determined for the first time the Landé gJ- factors of 20 levels of La I. For several other levels the Landé gJ- factors were re-investigated and determined with higher precision.

  17. 3D MODELING OF GJ1214b's ATMOSPHERE: FORMATION OF INHOMOGENEOUS HIGH CLOUDS AND OBSERVATIONAL IMPLICATIONS

    Energy Technology Data Exchange (ETDEWEB)

    Charnay, B.; Meadows, V.; Misra, A.; Arney, G. [Astronomy Department, University of Washington, Seattle, WA 98125 (United States); Leconte, J., E-mail: bcharnay@uw.edu [Canadian Institute for Theoretical Astrophysics, 60 St George Street, University of Toronto, Toronto, ON M5S 3H8 (Canada)

    2015-11-01

    The warm sub-Neptune GJ1214b has a featureless transit spectrum that may be due to the presence of high and thick clouds or haze. Here, we simulate the atmosphere of GJ1214b with a 3D General Circulation Model for cloudy hydrogen-dominated atmospheres, including cloud radiative effects. We show that the atmospheric circulation is strong enough to transport micrometric cloud particles to the upper atmosphere and generally leads to a minimum of cloud at the equator. By scattering stellar light, clouds increase the planetary albedo to 0.4–0.6 and cool the atmosphere below 1 mbar. However, the heating by ZnS clouds leads to the formation of a stratospheric thermal inversion above 10 mbar, with temperatures potentially high enough on the dayside to evaporate KCl clouds. We show that flat transit spectra consistent with Hubble Space Telescope observations are possible if cloud particle radii are around 0.5 μm, and that such clouds should be optically thin at wavelengths >3 μm. Using simulated cloudy atmospheres that fit the observed spectra we generate transit, emission, and reflection spectra and phase curves for GJ1214b. We show that a stratospheric thermal inversion would be readily accessible in near- and mid-infrared atmospheric spectral windows. We find that the amplitude of the thermal phase curves is strongly dependent on metallicity, but only slightly impacted by clouds. Our results suggest that primary and secondary eclipses and phase curves observed by the James Webb Space Telescope in the near- to mid-infrared should provide strong constraints on the nature of GJ1214b's atmosphere and clouds.

  18. Bayesian analysis of radial velocity data of GJ667C with correlated noise: evidence for only two planets

    Science.gov (United States)

    Feroz, F.; Hobson, M. P.

    2014-02-01

    GJ667C is the least massive component of a triple star system which lies at a distance of about 6.8 pc (22.1 light-year) from the Earth. GJ667C has received much attention recently due to the claims that it hosts up to seven planets including three super-Earths inside the habitable zone. We present a Bayesian technique for the analysis of radial velocity (RV) data sets in the presence of correlated noise component (`red noise'), with unknown parameters. We also introduce hyper-parameters in our model in order to deal statistically with under- or overestimated error bars on measured RVs as well as inconsistencies between different data sets. By applying this method to the RV data set of GJ667C, we show that this data set contains a significant correlated (red) noise component with correlation time-scale for HARPS data of the order of 9 d. Our analysis shows that the data only provide strong evidence for the presence of two planets: GJ667Cb and c with periods 7.19 and 28.13 d, respectively, with some hints towards the presence of a third signal with period 91 d. The planetary nature of this third signal is not clear and additional RV observations are required for its confirmation. Previous claims of the detection of additional planets in this system are due the erroneous assumption of white noise. Using the standard white noise assumption, our method leads to the detection of up to five signals in this system. We also find that with the red noise model, the measurement uncertainties from HARPS for this system are underestimated at the level of ˜50 per cent.

  19. Constraints on Neutral Hydrogen Outflow from the Warm Rocky Planet GJ1132b using Lyman-alpha Transit Observations

    Science.gov (United States)

    Waalkes, William; Berta-Thompson, Zachory; Charbonneau, David; Irwin, Jonathan; Newton, Elisabeth; Dittmann, Jason; Bourrier, Vincent; Ehrenreich, David; Kempton, Eliza

    2018-01-01

    GJ1132b is one of the few known Earth-sized planets, and at 12 pc away it is also one of the closest known transiting planets. With an equilibrium temperature of 500 K, this planet is too hot to be habitable but we can use it to learn about the presence and volatile content of rocky planet atmospheres around M dwarf stars. Using Hubble STIS spectra during primary transit, we explore the potential for UV transit detections of GJ1132b. If we were to observe a deep Lyman-α transit, that would indicate the presence of a neutral hydrogen envelope flowing from GJ1132b. On the other hand, ruling out deep absorption from neutral hydrogen may indicate that this planet has either retained its volatiles or lost them very early in the star’s life. We carry out this analysis by extracting 1D spectra from the STIS pipeline, splitting the time-tagged spectra into higher resolution samples, and producing light curves of the red and blue wings of the Lyman-α line. We fit for the baseline stellar flux and transit depths in order to constrain the characteristics of the cloud of neutral hydrogen gas that may surround the planet. Our work extends beyond the transit study into an analysis of the stellar variability and Lyman-α spectrum of GJ1132, a slowly-rotating 0.18 MSun M dwarf with previously uncharacterized UV activity. Understanding the role that UV variability plays in planetary atmospheres and volatile retention is crucial to assess atmospheric evolution and the habitability of cooler rocky planets.

  20. Direct Imaging of a Cold Jovian Exoplanet in Orbit around the Sun-Like Star GJ 504

    Science.gov (United States)

    Kuzuhara, M.; Tamura, M.; Kudo, T.; Janson, M; Kandori, R.; Brandt, T. D.; Thalmann, C.; Spiegel, D.; Biller, B.; Carson, J.; hide

    2013-01-01

    Several exoplanets have recently been imaged at wide separations of >10 AU from their parent stars. These span a limited range of ages ( 0.5 mag), implying thick cloud covers. Furthermore, substantial model uncertainties exist at these young ages due to the unknown initial conditions at formation, which can lead to an order of magnitude of uncertainty in the modeled planet mass. Here, we report the direct imaging discovery of a Jovian exoplanet around the Sun-like star GJ 504, detected as part of the SEEDS survey. The system is older than all other known directly-imaged planets; as a result, its estimated mass remains in the planetary regime independent of uncertainties related to choices of initial conditions in the exoplanet modeling. Using the most common exoplanet cooling model, and given the system age of 160(+350/-60) Myr, GJ 504 b has an estimated mass of 4(+4.5/-1.0) Jupiter masses, among the lowest of directly imaged planets. Its projected separation of 43.5 AU exceeds the typical outer boundary of approx.. 30 AU predicted for the core accretion mechanism. GJ 504 b is also significantly cooler (510(+30/-20) K)) and has a bluer color (J - H = -0.23 mag) than previously imaged exoplanets, suggesting a largely cloud-free atmosphere accessible to spectroscopic characterization. Thus, it has the potential of providing novel insights into the origins of giant planets, as well as their atmospheric properties.

  1. Study of the early signal perturbations due to GJ and Elves using the LWPC code

    Science.gov (United States)

    Nait Amor, Samir; Ghalila, Hassen; Bouderba, Yasmina

    2015-04-01

    Early events are a Very Low Frequencies (VLF) signal perturbations recorded during a lightning activity. The properties of these signal perturbations and their association to the lightning peak current and/or Transient Luminous Events (TLEs) were widely studied. In a recently analysis a new early signal perturbations whose recovery time persists for several minutes were discovered. The underlying cause of these events is still unclear. In a recently published work, these events were attributed to the lightning peak current and the type of associated TLE. In others, and newly published papers, analyzes were done where all kind of early events were considered. Statistical results showed that the occurrence of long recovery events is independent of the lightning current amplitude and/or TLEs type. To understand which is the main cause of these events, we analyzed two types of early signal perturbations: One was a typical event (~200s time duration) in association with a Gigantic Jet and the second was a long recovery event in association with an elve recorded on December 12 2009 during the EuroSprite campaign. In addition to the VLF signal analysis, we used the Long Wave Propagation Capability (LWPC) code to simulate the unperturbed and perturbed signal parameters (amplitude and phase), to determine the signal modes attenuation coefficient and then to infer the electron density increases in the disturbed region. The results showed that the reference height was reduced from its ambient value (87km) to 66.4 km in the case of the GJ and 74.3 km for the elve. These reference heights decreases affected the propagating signal at the disturbed region by increasing the modes attenuation coefficient. Effectively, the number of modes was reduced from 28 at ambient condition to 9 modes (in the case of GJ) and 17 (in the case of elve). This high attenuation of modes leads to the appearance of null signal perturbations positions due to the interferences. Between two null positions

  2. Surprisingly different star-spot distributions on the near equal-mass equal-rotation-rate stars in the M dwarf binary GJ 65 AB

    Science.gov (United States)

    Barnes, J. R.; Jeffers, S. V.; Haswell, C. A.; Jones, H. R. A.; Shulyak, D.; Pavlenko, Ya. V.; Jenkins, J. S.

    2017-10-01

    We aim to understand how stellar parameters such as mass and rotation impact the distribution of star-spots on the stellar surface. To this purpose, we have used Doppler imaging to reconstruct the surface brightness distributions of three fully convective M dwarfs with similar rotation rates. We secured high cadence spectral time series observations of the 5.5 au separation binary GJ 65, comprising GJ 65A (M5.5V, Prot = 0.24 d) and GJ 65B (M6V, Prot = 0.23 d). We also present new observations of GJ 791.2A (M4.5V, Prot = 0.31 d). Observations of each star were made on two nights with UVES, covering a wavelength range from 0.64 - 1.03μm. The time series spectra reveal multiple line distortions that we interpret as cool star-spots and which are persistent on both nights suggesting stability on the time-scale of 3 d. Spots are recovered with resolutions down to 8.3° at the equator. The global spot distributions for GJ 791.2A are similar to observations made a year earlier. Similar high latitude and circumpolar spot structure is seen on GJ 791.2A and GJ 65A. However, they are surprisingly absent on GJ 65B, which instead reveals more extensive, larger, spots concentrated at intermediate latitudes. All three stars show small amplitude latitude-dependent rotation that is consistent with solid body rotation. We compare our measurements of differential rotation with previous Doppler imaging studies and discuss the results in the wider context of other observational estimates and recent theoretical predictions.

  3. Characterization of starter kimchi fermented with Leuconostoc kimchii GJ2 and its cholesterol-lowering effects in rats fed a high-fat and high-cholesterol diet.

    Science.gov (United States)

    Jo, Se Yeon; Choi, Eun A; Lee, Jae Joon; Chang, Hae Choon

    2015-10-01

    The hypocholesterolemic effects of lactic acid bacteria and kimchi have been demonstrated previously. However, the kimchi fermentation process still relies on naturally present microorganisms. To obtain functional kimchi with consistent quality, we validated the capacity of Leuconostoc kimchii GJ2 as a starter culture to control kimchi fermentation. Moreover, cholesterol-lowering effects of starter kimchi as a health-promoting product were explored. Bacteriocin production by Lc. kimchii GJ2 was highly enhanced in the presence of 5% Lactobacillus sakei NJ1 cell fractions. When kimchi was fermented with bacteriocin-enhanced Lc. kimchii GJ2, Lc. kimchii GJ2 became overwhelmingly predominant (98.3%) at the end of fermentation and maintained its dominance (up to 82%) for 84 days. Growing as well as dead cells of Lc. kimchii GJ2 showed high cholesterol assimilation (in vitro). Rats were fed a high-fat and high-cholesterol diet supplemented with starter kimchi. The results showed that feeding of starter kimchi significantly reduced serum total cholesterol, triglyceride and low-density lipoprotein cholesterol levels. Additionally, atherogenic index, cardiac risk factor and triglyceride and total cholesterol levels in liver and epididymal adipose tissue decreased significantly in rats fed starter kimchi. Kimchi fermented with Lc. kimchii GJ2 as a starter culture has efficient cholesterol-lowering effects. © 2014 Society of Chemical Industry.

  4. Spectroscopic characterization of extrasolar planets from ground-, space- and airborne-based observatories

    Science.gov (United States)

    Angerhausen, Daniel

    2010-11-01

    This thesis deals with techniques and results of observations of exoplanets from several platforms. In this work I present and then attempt solutions to particular issues and problems connected to ground- and space-based approaches to spectroscopic characterization of extrasolar planets. Furthermore, I present the future prospects of the airborne observatory, SOFIA, in this field of astronomy. The first part of this thesis covers results of an exploratory study to use near-infrared integral-field-spectroscopy to observe transiting extrasolar planets. I demonstrate how adaptive-optics assisted integral field spectroscopy compares with other spectroscopic techniques currently applied, foremost being slit spectroscopy. An advanced reduction method using elements of a spectral-differential decorrelation and optimized observation strategies is discussed. This concept was tested with K-Band time series observations of secondary eclipses of HD 209458b and HD 189733b obtained with the SINFONI at the Very Large Telescope (VLT), at spectral resolution of R~3000. In ground-based near infrared (NIR) observations, there is considerable likelihood of confusion between telluric absorption features and spectral features in the targeted object. I describe a detailed method that can cope with such confusion by a forward modelling approach employing Earth transmission models. In space-based transit spectroscopy with Hubble's NICMOS instrument, the main source of systematic noise is the perturbation in the instrument's configuration due to the near Earth orbital motion of the spacecraft. I present an extension to a pre-existing data analysis sequence that has allowed me to extract a NIR transmission spectrum of the hot-Neptune class planet GJ 436b from a data set that was highly corrupted by the above mentioned effects. Satisfyingly, I was able to obtain statistical consistency in spectra (acquired over a broad wavelength grid) over two distinct observing visits by HST. Earlier

  5. HAT-P-11b: A SUPER-NEPTUNE PLANET TRANSITING A BRIGHT K STAR IN THE KEPLER FIELD

    International Nuclear Information System (INIS)

    Bakos, G. A.; Torres, G.; Pal, A.; Hartman, J.; Noyes, R. W.; Latham, D. W.; Sasselov, D. D.; Sipocz, B.; Esquerdo, G. A.; Kovacs, Gabor; Fernandez, J.; Kovacs, Geza; Moor, A.; Fischer, D. A.; Isaacson, H.; Johnson, J. A.; Marcy, G. W.; Howard, A.; Butler, R. P.; Vogt, S.

    2010-01-01

    We report on the discovery of HAT-P-11b, the smallest radius transiting extrasolar planet (TEP) discovered from the ground, and the first hot Neptune discovered to date by transit searches. HAT-P-11b orbits the bright (V = 9.587) and metal rich ([Fe/H] = +0.31 ± 0.05) K4 dwarf star GSC 03561-02092 with P = 4.8878162 ± 0.0000071 days and produces a transit signal with depth of 4.2 mmag, the shallowest found by transit searches that is due to a confirmed planet. We present a global analysis of the available photometric and radial velocity (RV) data that result in stellar and planetary parameters, with simultaneous treatment of systematic variations. The planet, like its near-twin GJ 436b, is somewhat larger than Neptune (17 M + , 3.8 R + ) both in mass M p = 0.081 ± 0.009 M J (25.8 ± 2.9 M + ) and radius R p = 0.422 ± 0.014 R J (4.73 ± 0.16 R + ). HAT-P-11b orbits in an eccentric orbit with e = 0.198 ± 0.046 and ω = 355. 0 2 ± 17. 0 3, causing a reflex motion of its parent star with amplitude 11.6 ± 1.2 m s -1 , a challenging detection due to the high level of chromospheric activity of the parent star. Our ephemeris for the transit events is T c = 2454605.89132 ± 0.00032 (BJD), with duration 0.0957 ± 0.0012 days, and secondary eclipse epoch of 2454608.96 ± 0.15 days (BJD). The basic stellar parameters of the host star are M * = 0.809 +0.020 -0.027 M sun , R * = 0.752 ± 0.021 R sun , and T eff* = 4780 ± 50 K. Importantly, HAT-P-11 will lie on one of the detectors of the forthcoming Kepler mission; this should make possible fruitful investigations of the detailed physical characteristic of both the planet and its parent star at unprecedented precision. We discuss an interesting constraint on the eccentricity of the system by the transit light curve and stellar parameters. This will be particularly useful for eccentric TEPs with low-amplitude RV variations in Kepler's field. We also present a blend analysis, that for the first time treats the case of a

  6. WARM SPITZER PHOTOMETRY OF THREE HOT JUPITERS: HAT-P-3b, HAT-P-4b AND HAT-P-12b

    Energy Technology Data Exchange (ETDEWEB)

    Todorov, Kamen O. [Department of Astronomy and Astrophysics, Pennsylvania State University, University Park, PA 16802 (United States); Deming, Drake [Department of Astronomy, University of Maryland at College Park, College Park, MD 20742 (United States); Knutson, Heather A. [Division of Geological and Planetary Sciences, California Institute of Technology, Pasadena, CA 91125 (United States); Burrows, Adam [Department of Astrophysical Sciences, Princeton University, Princeton, NJ 08544 (United States); Fortney, Jonathan J.; Laughlin, Gregory [Department of Astronomy and Astrophysics, University of California at Santa Cruz, Santa Cruz, CA 95064 (United States); Lewis, Nikole K. [Department of Earth, Atmospheric, and Planetary Sciences, Massachusetts Institute of Technology, Cambridge, MA 02139 (United States); Cowan, Nicolas B. [Department of Physics and Astronomy, Northwestern University, Evanston, IL 60208 (United States); Agol, Eric [Department of Astronomy, University of Washington, Box 351580, Seattle, WA 98195 (United States); Desert, Jean-Michel [Astronomy Department, California Institute of Technology, Pasadena, CA 91125 (United States); Sada, Pedro V. [Department of Physics and Mathematics, University of Monterrey, Monterrey (Mexico); Charbonneau, David [Harvard-Smithsonian Center for Astrophysics, Cambridge, MA 02138 (United States); Langton, Jonathan [Department of Physics, Principia College, Elsah, IL 62028 (United States); Showman, Adam P. [Lunar and Planetary Laboratory, University of Arizona, Tucson, AZ 85721 (United States)

    2013-06-20

    We present Warm Spitzer/IRAC secondary eclipse time series photometry of three short-period transiting exoplanets, HAT-P-3b, HAT-P-4b and HAT-P-12b, in both the available 3.6 and 4.5 {mu}m bands. HAT-P-3b and HAT-P-4b are Jupiter-mass objects orbiting an early K and an early G dwarf star, respectively. For HAT-P-3b we find eclipse depths of 0.112%+0.015%-0.030% (3.6 micron) and 0.094%+0.016%-0.009% (4.5 {mu}m). The HAT-P-4b values are 0.142%+0.014%-0.016% (3.6 micron) and 0.122%+0.012%-0.014% 4.5 {mu}m). The two planets' photometry is consistent with inefficient heat redistribution from their day to night sides (and low albedos), but it is inconclusive about possible temperature inversions in their atmospheres. HAT-P-12b is a Saturn-mass planet and is one of the coolest planets ever observed during secondary eclipse, along with the hot Neptune GJ 436b and the hot Saturn WASP-29b. We are able to place 3{sigma} upper limits on the secondary eclipse depth of HAT-P-12b in both wavelengths: <0.042% (3.6 {mu}m) and <0.085% (4.5 {mu}m). We discuss these results in the context of the Spitzer secondary eclipse measurements of GJ 436b and WASP-29b. It is possible that we do not detect the eclipses of HAT-P-12b due to high eccentricity, but find that weak planetary emission in these wavelengths is a more likely explanation. We place 3{sigma} upper limits on the |e cos {omega}| quantity (where e is eccentricity and {omega} is the argument of periapsis) for HAT-P-3b (<0.0081) and HAT-P-4b (<0.0042), based on the secondary eclipse timings.

  7. DIRECT IMAGING OF A COLD JOVIAN EXOPLANET IN ORBIT AROUND THE SUN-LIKE STAR GJ 504

    Energy Technology Data Exchange (ETDEWEB)

    Kuzuhara, M. [Department of Earth and Planetary Science, The University of Tokyo, 7-3-1 Hongo, Bunkyo-ku, Tokyo 113-0033 (Japan); Tamura, M.; Kandori, R.; Hori, Y.; Suzuki, R.; Suenaga, T.; Takahashi, Y. H.; Kwon, J. [National Astronomical Observatory of Japan, 2-21-1 Osawa, Mitaka, Tokyo 181-8588 (Japan); Kudo, T. [Subaru Telescope, National Astronomical Observatory of Japan, 650 North A' ohoku Place, Hilo, HI 96720 (United States); Janson, M.; Brandt, T. D.; Spiegel, D.; Burrows, A.; Turner, E. L.; Moro-Martin, A. [Department of Astrophysical Sciences, Princeton University, Peyton Hall, Ivy Lane, Princeton, NJ 08544 (United States); Thalmann, C. [Astronomical Institute ' ' Anton Pannekoek' ' , University of Amsterdam, Postbus 94249, 1090 GE, Amsterdam (Netherlands); Biller, B.; Henning, T. [Max Planck Institute for Astronomy, Koenigstuhl 17, D-69117 Heidelberg (Germany); Carson, J. [Department of Physics and Astronomy, College of Charleston, 58 Coming Street, Charleston, SC 29424 (United States); McElwain, M. W., E-mail: m.kuzuhara@nao.ac.jp [Exoplanets and Stellar Astrophysics Laboratory, Code 667, Goddard Space Flight Center, Greenbelt, MD 20771 (United States); and others

    2013-09-01

    Several exoplanets have recently been imaged at wide separations of >10 AU from their parent stars. These span a limited range of ages (<50 Myr) and atmospheric properties, with temperatures of 800-1800 K and very red colors (J - H > 0.5 mag), implying thick cloud covers. Furthermore, substantial model uncertainties exist at these young ages due to the unknown initial conditions at formation, which can lead to an order of magnitude of uncertainty in the modeled planet mass. Here, we report the direct-imaging discovery of a Jovian exoplanet around the Sun-like star GJ 504, detected as part of the SEEDS survey. The system is older than all other known directly imaged planets; as a result, its estimated mass remains in the planetary regime independent of uncertainties related to choices of initial conditions in the exoplanet modeling. Using the most common exoplanet cooling model, and given the system age of 160{sup +350}{sub -60} Myr, GJ 504b has an estimated mass of 4{sup +4.5}{sub -1.0} Jupiter masses, among the lowest of directly imaged planets. Its projected separation of 43.5 AU exceeds the typical outer boundary of {approx}30 AU predicted for the core accretion mechanism. GJ 504b is also significantly cooler (510{sup +30}{sub -20} K) and has a bluer color (J - H = -0.23 mag) than previously imaged exoplanets, suggesting a largely cloud-free atmosphere accessible to spectroscopic characterization. Thus, it has the potential of providing novel insights into the origins of giant planets as well as their atmospheric properties.

  8. Holocene glacier activity reconstructed from proglacial lake Gjøavatnet on Amsterdamøya, NW Svalbard

    Science.gov (United States)

    de Wet, Gregory A.; Balascio, Nicholas L.; D'Andrea, William J.; Bakke, Jostein; Bradley, Raymond S.; Perren, Bianca

    2018-03-01

    Well-dated and highly resolved paleoclimate records from high latitudes allow for a better understanding of past climate change. Lake sediments are excellent archives of environmental change, and can record processes occurring within the catchment, such as the growth or demise of an upstream glacier. Here we present a Holocene-length, multi-proxy lake sediment record from proglacial lake Gjøavatnet on the island of Amsterdamøya, northwest Svalbard. Today, Gjøavatnet receives meltwater from the Annabreen glacier and contains a record of changes in glacier activity linked to regional climate conditions. We measured changes in organic matter content, dry bulk density, bulk carbon isotopes, elemental concentrations via Itrax core-scanning, and diatom community composition to reconstruct variability in glacier extent back through time. Our reconstruction indicates that glacially derived sedimentation in the lake decreased markedly at ∼11.1 cal kyr BP, although a glacier likely persisted in the catchment until ∼8.4 cal kyr BP. During the mid-Holocene (∼8.4-1.0 cal kyr BP) there was significantly limited glacial influence in the catchment and enhanced deposition of organic-rich sediment in the lake. The deposition of organic rich sediments during this time was interrupted by at least three multi-centennial intervals of reduced organic matter accumulation (∼5.9-5.0, 2.7-2.0, and 1.7-1.5 cal kyr BP). Considering our chronological information and a sedimentological comparison with intervals of enhanced glacier input, we interpret these intervals not as glacial advances, but rather as cold/dry episodes that inhibited organic matter production in the lake and surrounding catchment. At ∼1.0 cal kyr BP, input of glacially derived sediment to Gjøavatnet abruptly increased, representing the rapid expansion of the Annabreen glacier.

  9. The Transiting System GJ1214: High-Precision Defocused Transit Observations and a Search for Evidence of Transit Timing Variation

    DEFF Research Database (Denmark)

    Harpsøe, Kennet Bomann West; Hardis, S.; Hinse, T. C.

    2012-01-01

    Aims: We present 11 high-precision photometric transit observations of the transiting super-Earth planet GJ1214b. Combining these data with observations from other authors, we investigate the ephemeris for possible signs of transit timing variations (TTVs) using a Bayesian approach. Methods......: The observations were obtained using telescope-defocusing techniques, and achieve a high precision with random errors in the photometry as low as 1mmag per point. To investigate the possibility of TTVs in the light curve, we calculate the overall probability of a TTV signal using Bayesian methods. Results...

  10. The Global and Small-scale Magnetic Fields of Fully Convective, Rapidly Spinning M Dwarf Pair GJ65 A and B

    Energy Technology Data Exchange (ETDEWEB)

    Kochukhov, Oleg; Lavail, Alexis [Department of Physics and Astronomy, Uppsala University, Box 516, Uppsala SE-75120 (Sweden)

    2017-01-20

    The nearby M dwarf binary GJ65 AB, also known as BL Cet and UV Cet, is a unique benchmark for investigation of dynamo-driven activity of low-mass stars. Magnetic activity of GJ65 was repeatedly assessed by indirect means, such as studies of flares, photometric variability, X-ray, and radio emission. Here, we present a direct analysis of large-scale and local surface magnetic fields in both components. Interpreting high-resolution circular polarization spectra (sensitive to a large-scale field geometry) we uncovered a remarkable difference of the global stellar field topologies. Despite nearly identical masses and rotation rates, the secondary exhibits an axisymmetric, dipolar-like global field with an average strength of 1.3 kG while the primary has a much weaker, more complex, and non-axisymmetric 0.3 kG field. On the other hand, an analysis of the differential Zeeman intensification (sensitive to the total magnetic flux) shows the two stars having similar magnetic fluxes of 5.2 and 6.7 kG for GJ65 A and B, respectively, although there is evidence that the field strength distribution in GJ65 B is shifted toward a higher field strength compared to GJ65 A. Based on these complementary magnetic field diagnostic results, we suggest that the dissimilar radio and X-ray variability of GJ65 A and B is linked to their different global magnetic field topologies. However, this difference appears to be restricted to the upper atmospheric layers but does not encompass the bulk of the stars and has no influence on the fundamental stellar properties.

  11. Characterization of the haloacid dehalogenase from Xanthobacter autotrophicus GJ10 and sequencing of the dhlB gene

    DEFF Research Database (Denmark)

    van der Ploeg, J; Van Hall, Gerrit; Janssen, D B

    1991-01-01

    B) was cloned and could be allocated to a 6.5-kb EcoRI-BglII fragment. Part of this fragment was sequenced, and the dhlB open reading frame was identified by comparison with the N-terminal amino acid sequence of the protein. The gene was found to encode a protein of 27,433 Da that showed considerable homology...... chromatography. The enzyme was active with 2-halogenated carboxylic acids and converted only the L-isomer of 2-chloropropionic acid with inversion of configuration to produce D-lactate. The activity of the enzyme was not readily influenced by thiol reagents. The gene encoding the haloacid dehalogenase (dhl...... (60.5 and 61.0% similarity) with the two other haloacid dehalogenases sequenced to date but not with the haloalkane dehalogenase from X. autotrophicus GJ10....

  12. THE LICK-CARNEGIE EXOPLANET SURVEY: A URANUS-MASS FOURTH PLANET FOR GJ 876 IN AN EXTRASOLAR LAPLACE CONFIGURATION

    International Nuclear Information System (INIS)

    Rivera, Eugenio J.; Laughlin, Gregory; Vogt, Steven S.; Meschiari, Stefano; Butler, R. Paul; Haghighipour, Nader

    2010-01-01

    Continued radial velocity (RV) monitoring of the nearby M4V red dwarf star GJ 876 with Keck/High Resolution Echelle Spectrograph has revealed the presence of a Uranus-mass fourth planetary companion in the system. The new planet has a mean period of P e = 126.6 days (over the 12.6-year baseline of the RV observations), and a minimum mass of m e sin i e = 12.9 ± 1.7 M + . The detection of the new planet has been enabled by significant improvements to our RV data set for GJ 876. The data have been augmented by 36 new high-precision measurements taken over the past five years. In addition, the precision of all of the Doppler measurements have been significantly improved by the incorporation of a high signal-to-noise template spectrum for GJ 876 into the analysis pipeline. Implementation of the new template spectrum improves the internal rms errors for the velocity measurements taken during 1998-2005 from 4.1 m s -1 to 2.5 m s -1 . Self-consistent, N-body fits to the RV data set show that the four-planet system has an invariable plane with an inclination relative to the plane of the sky of i = 59. 0 5. The fit is not significantly improved by the introduction of a mutual inclination between the planets 'b' and 'c', but the new data do confirm a non-zero eccentricity, e d = 0.207 ± 0.055 for the innermost planet, 'd'. In our best-fit coplanar model, the mass of the new component is m e = 14.6 ± 1.7 M + . Our best-fitting model places the new planet in a three-body resonance with the previously known giant planets (which have mean periods of P c = 30.4 and P b = 61.1 days). The critical argument, ψ Laplace = λ c - 3λ b + 2λ e , for the Laplace resonance librates with an amplitude of Δψ Laplace = 40 0 ± 13 0 about ψ Laplace = 0 0 . Numerical integration indicates that the four-planet system is stable for at least a billion years (at least for the coplanar cases). This resonant configuration of three giant planets orbiting an M dwarf primary differs from the

  13. DYNAMICAL EVOLUTION AND SPIN–ORBIT RESONANCES OF POTENTIALLY HABITABLE EXOPLANETS: THE CASE OF GJ 581d

    International Nuclear Information System (INIS)

    Makarov, Valeri V.; Berghea, Ciprian; Efroimsky, Michael

    2012-01-01

    GJ 581d is a potentially habitable super-Earth in the multiple system of exoplanets orbiting a nearby M dwarf. We investigate this planet's long-term dynamics with an emphasis on its probable final rotation states acquired via tidal interaction with the host. The published radial velocities for the star are re-analyzed with a benchmark planet detection algorithm to confirm that there is no evidence for the recently proposed two additional planets (f and g). Limiting the scope to the four originally detected planets, we assess the dynamical stability of the system and find bounded chaos in the orbital motion. For the planet d, the characteristic Lyapunov time is 38 yr. Long-term numerical integration reveals that the system of four planets is stable, with the eccentricity of the planet d changing quasi-periodically in a tight range around 0.27, and with its semimajor axis varying only a little. The spin-orbit interaction of GJ 581d with its host star is dominated by the tides exerted by the star on the planet. We model this interaction, assuming a terrestrial composition of the mantle. Besides the triaxiality-caused torque and the secular part of the tidal torque, which are conventionally included in the equation of motion, we also include the tidal torques' oscillating components. It turns out that, depending on the mantle temperature, the planet gets trapped into the 2:1 or an even higher spin-orbit resonance. It is very improbable that the planet could have reached the 1:1 resonance. This improves the possibility of the planet being suitable for sustained life.

  14. Cloning of 1,2-Dichloroethane Degradation Genes of Xanthobacter autotrophicus GJ10 and Expression and Sequencing of the dhlA Gene

    NARCIS (Netherlands)

    Janssen, Dick B.; Pries, Frens; Ploeg, Jan van der; Kazemier, Bert; Terpstra, Peter; Witholt, Bernard

    1989-01-01

    A gene bank from the chlorinated hydrocarbon-degrading bacterium Xanthobacter autotrophicus GJ10 was prepared in the broad-host-range cosmid vector pLAFR1. By using mutants impaired in dichloroethane utilization and strains lacking dehalogenase activities, several genes involved in

  15. TWO PLANETARY COMPANIONS AROUND THE K7 DWARF GJ 221: A HOT SUPER-EARTH AND A CANDIDATE IN THE SUB-SATURN DESERT RANGE

    Energy Technology Data Exchange (ETDEWEB)

    Arriagada, Pamela; Minniti, Dante [Department of Astronomy, Pontificia Universidad Catolica de Chile, Casilla 306, Santiago 22 (Chile); Anglada-Escude, Guillem; Butler, R. Paul [Department of Terrestrial Magnetism, Carnegie Institution of Washington, 5241 Broad Branch Road NW, Washington, DC 20015-1305 (United States); Crane, Jeffrey D.; Shectman, Stephen A.; Thompson, Ian [The Observatories of the Carnegie Institution of Washington, 813 Santa Barbara Street, Pasadena, CA 91101 (United States); Wende, Sebastian, E-mail: parriaga@astro.puc.cl [Institut fuer Astrophysik, Universitaet Goettingen, Friedrich-Hund-Platz 1, D-37077 Goettingen (Germany)

    2013-07-01

    We report two low-mass companions orbiting the nearby K7 dwarf GJ 221 that have emerged from reanalyzing 4.4 yr of publicly available HARPS spectra complemented with 2 years of high-precision Doppler measurements with Magellan/PFS. The HARPS measurements alone contain the clear signal of a low-mass companion with a period of 125 days and a minimum mass of 53.2 M{sub Circled-Plus} (GJ 221b), falling in a mass range where very few planet candidates have been found (sub-Saturn desert). The addition of 17 PFS observations allows the confident detection of a second low-mass companion (6.5 M{sub Circled-Plus }) in a hot orbit (3.87 day period, GJ 221c). Spectroscopic and photometric calibrations suggest that GJ 221 is slightly depleted ([Fe/H] {approx} -0.1) compared to the Sun, so the presence of two low-mass companions in the system confirms the trend that slightly reduced stellar metallicity does not prevent the formation of planets in the super-Earth to sub-Saturn mass regime.

  16. THE FLAT TRANSMISSION SPECTRUM OF THE SUPER-EARTH GJ1214b FROM WIDE FIELD CAMERA 3 ON THE HUBBLE SPACE TELESCOPE

    International Nuclear Information System (INIS)

    Berta, Zachory K.; Charbonneau, David; Désert, Jean-Michel; Irwin, Jonathan; Miller-Ricci Kempton, Eliza; Fortney, Jonathan J.; Nutzman, Philip; McCullough, Peter R.; Burke, Christopher J.; Homeier, Derek

    2012-01-01

    Capitalizing on the observational advantage offered by its tiny M dwarf host, we present Hubble Space Telescope/Wide Field Camera 3 (WFC3) grism measurements of the transmission spectrum of the super-Earth exoplanet GJ1214b. These are the first published WFC3 observations of a transiting exoplanet atmosphere. After correcting for a ramp-like instrumental systematic, we achieve nearly photon-limited precision in these observations, finding the transmission spectrum of GJ1214b to be flat between 1.1 and 1.7 μm. Inconsistent with a cloud-free solar composition atmosphere at 8.2σ, the measured achromatic transit depth most likely implies a large mean molecular weight for GJ1214b's outer envelope. A dense atmosphere rules out bulk compositions for GJ1214b that explain its large radius by the presence of a very low density gas layer surrounding the planet. High-altitude clouds can alternatively explain the flat transmission spectrum, but they would need to be optically thick up to 10 mbar or consist of particles with a range of sizes approaching 1 μm in diameter.

  17. Kepler-4b: A Hot Neptune-Like Planet of a G0 Star Near Main-Sequence Turnoff

    Science.gov (United States)

    2010-04-20

    events using the procedures described by Jenkins et al. (2010) and by Batalha et al. (2010). One of the transiting planet candidates identified by the...Tillinghast Reflector at the Whipple Obser- vatory showed a velocity variation of less than 150 m s−1 over 5 days. Accordingly, we obtained RV measurements with

  18. HADES RV Programme with HARPS-N at TNG. VI. GJ 3942 b behind dominant activity signals

    Science.gov (United States)

    Perger, M.; Ribas, I.; Damasso, M.; Morales, J. C.; Affer, L.; Suárez Mascareño, A.; Micela, G.; Maldonado, J.; González Hernández, J. I.; Rebolo, R.; Scandariato, G.; Leto, G.; Zanmar Sanchez, R.; Benatti, S.; Bignamini, A.; Borsa, F.; Carbognani, A.; Claudi, R.; Desidera, S.; Esposito, M.; Lafarga, M.; Martinez Fiorenzano, A. F.; Herrero, E.; Molinari, E.; Nascimbeni, V.; Pagano, I.; Pedani, M.; Poretti, E.; Rainer, M.; Rosich, A.; Sozzetti, A.; Toledo-Padrón, B.

    2017-12-01

    Context. Short- to mid-term magnetic phenomena on the stellar surface of M-type stars can resemble the effects of planets in radial velocity data, and may also hide them. Aims: We analyze 145 spectroscopic HARPS-N observations of GJ 3942 taken over the past five years and additional photometry in order to disentangle stellar activity effects from genuine Doppler signals as a result of the orbital motion of the star around the common barycenter with its planet. Methods: To achieve this, we use the common methods of pre-whitening, and treat the correlated red noise by a first-order moving average term and by Gaussian-process regression following an MCMC analysis. Results: We identify the rotational period of the star at 16.3 days and discover a new super-Earth, GJ 3942 b, with an orbital period of 6.9 days and a minimum mass of 7.1 M⊕. An additional signal in the periodogram of the residuals is present, but at this point we cannot claim with sufficient significance that it is related to a second planet. If confirmed, this planet candidate would have a minimum mass of 6.3 M⊕ and a period of 10.4 days, which might indicate a 3:2 mean-motion resonance with the inner planet. Based on observations made with the Italian Telescopio Nazionale Galileo (TNG), operated on the island of La Palma by the INAF - Fundación Galileo Galilei at the Roque de los Muchachos Observatory of the Instituto de Astrofísica de Canarias (IAC); photometric observations from the APACHE array located at the Astronomical Observatory of the Aosta Valley; photometric observations made with the robotic APT2 (within the EXORAP program) located at Serra La Nave on Mt. Etna.Table 9 is only available at the CDS via anonymous ftp to http://cdsarc.u-strasbg.fr (http://130.79.128.5) or via http://cdsarc.u-strasbg.fr/viz-bin/qcat?J/A+A/608/A63

  19. submitter Quench Protection of Very Large, 50-GJ-Class, and High-Temperature-Superconductor-Based Detector Magnets

    CERN Document Server

    Mentink, Matthias; Mulder, Tim; Van Nugteren, Jeroen; ten Kate, Herman

    2016-01-01

    An investigation is performed on the quench behavior of a conceptual 50-GJ 8-T high-temperature-superconductor-based solenoid. In this design, a 50-kA conductor-on-round-core cable-in-conduit conductor utilizing ReBCO technology is envisioned, operating at 40 K. Various properties such as resistivity, thermal conductivity, and heat capacity are very different at this temperature, which affects the quench behavior. It is found that the envisioned conductor is very stable with a minimum quench energy of about 2 kJ. However, the quench propagation velocity is typically about 20 mm/s, so that creating a wide-spread normal zone throughout the coil is very challenging. Moreover, an extraction voltage exceeding 20 kV would be required to ensure a hot-spot temperature below 100 K once a thermal runaway occurs. A novel concept dubbed “rapid quench transformation” is proposed whereby the superconducting conductor is co-wound with a normal conductor to achieve a high degree of inductive coupling. This geometry allow...

  20. SEMI-EMPIRICAL MODELING OF THE PHOTOSPHERE, CHROMOPSHERE, TRANSITION REGION, AND CORONA OF THE M-DWARF HOST STAR GJ 832

    Energy Technology Data Exchange (ETDEWEB)

    Fontenla, J. M. [NorthWest Research Associates, Boulder, CO 80301 (United States); Linsky, Jeffrey L. [JILA, University of Colorado and NIST, Boulder, CO 80309-0440 (United States); Witbrod, Jesse [University of Colorado Boulder, CO 80309 (United States); France, Kevin [LASP, University of Colorado Boulder, CO 80309-0600 (United States); Buccino, A.; Mauas, Pablo; Vieytes, Mariela [Instituto de Astronomía y Física del Espacio (CONICET-UBA), C.C. 67, Sucursal 28, C1428EHA, Buenos Aires (Argentina); Walkowicz, Lucianne M., E-mail: johnf@digidyna.com, E-mail: jlinsky@jila.colorado.edu, E-mail: jesse.witbrod@colorado.edu, E-mail: kevin.france@lasp.colorado.edu, E-mail: abuccino@iafe.uba.ar, E-mail: pablo@iafe.uba.ar, E-mail: mariela@iafe.uba.ar, E-mail: LWalkowicz@adlerplanetarium.org [The Adler Planetarium, Chicago, IL 60605 (United States)

    2016-10-20

    Stellar radiation from X-rays to the visible provides the energy that controls the photochemistry and mass loss from exoplanet atmospheres. The important extreme ultraviolet (EUV) region (10–91.2 nm) is inaccessible and should be computed from a reliable stellar model. It is essential to understand the formation regions and physical processes responsible for the various stellar emission features to predict how the spectral energy distribution varies with age and activity levels. We compute a state-of-the-art semi-empirical atmospheric model and the emergent high-resolution synthetic spectrum of the moderately active M2 V star GJ 832 as the first of a series of models for stars with different activity levels. We construct a one-dimensional simple model for the physical structure of the star’s chromosphere, chromosphere-corona transition region, and corona using non-LTE radiative transfer techniques and many molecular lines. The synthesized spectrum for this model fits the continuum and lines across the UV-to-optical spectrum. Particular emphasis is given to the emission lines at wavelengths that are shorter than 300 nm observed with the Hubble Space Telescope , which have important effects on the photochemistry of the exoplanet atmospheres. The FUV line ratios indicate that the transition region of GJ 832 is more biased to hotter material than that of the quiet Sun. The excellent agreement of our computed EUV luminosity with that obtained by two other techniques indicates that our model predicts reliable EUV emission from GJ 832. We find that the unobserved EUV flux of GJ 832, which heats the outer atmospheres of exoplanets and drives their mass loss, is comparable to the active Sun.

  1. GICLAS 112-29 (=NLTT 18149), A VERY WIDE COMPANION TO GJ 282 AB WITH COMMON PROPER MOTION, COMMON PARALLAX, COMMON RADIAL VELOCITY AND COMMON AGE

    OpenAIRE

    A. Poveda; A. Hernández-Alcántara; R. Costero; J. Echevarría

    2008-01-01

    En una búsqueda de compa~neras con movimiento propio común para las binarias separadas de la vecindad solar encontramos que GJ 282AB tiene una compañera distante (NLTT 18149), a una separaci on de s = 1:09°. Las paralajes trigonométricas (Hipparcos), velocidades radiales y edades son similares, y sugieren que éste es un sistema físico.

  2. PLANETS AROUND LOW-MASS STARS (PALMS). II. A LOW-MASS COMPANION TO THE YOUNG M DWARF GJ 3629 SEPARATED BY 0.''2

    Energy Technology Data Exchange (ETDEWEB)

    Bowler, Brendan P.; Liu, Michael C. [Institute for Astronomy, University of Hawai' i, 2680 Woodlawn Drive, Honolulu, HI 96822 (United States); Shkolnik, Evgenya L. [Lowell Observatory, 1400 W. Mars Hill Road, Flagstaff, AZ 86001 (United States); Tamura, Motohide, E-mail: bpbowler@ifa.hawaii.edu [National Astronomical Observatory of Japan, 2-21-1 Osawa, Mitaka, Tokyo 181-8588 (Japan)

    2012-09-01

    We present the discovery of a 0.''2 companion to the young M dwarf GJ 3629 as part of our high-contrast adaptive optics imaging search for giant planets around low-mass stars with the Keck-II and Subaru telescopes. Two epochs of imaging confirm that the pair is comoving and reveal signs of orbital motion. The primary exhibits saturated X-ray emission which, together with its UV photometry from GALEX, points to an age younger than {approx}300 Myr. At these ages the companion lies below the hydrogen burning limit with a model-dependent mass of 46 {+-} 16 M{sub Jup} based on the system's photometric distance of 22 {+-} 3 pc. Resolved YJHK photometry of the pair indicates a spectral type of M7 {+-} 2 for GJ 3629 B. With a projected separation of 4.4 {+-} 0.6 AU and an estimated orbital period of 21 {+-} 5 yr, GJ 3629 AB is likely to yield a dynamical mass in the next several years, making it one of only a handful of brown dwarfs to have a measured mass and an age constrained from the stellar primary.

  3. Emergent Exoplanet Flux: Review of the Spitzer Results

    OpenAIRE

    Deming, Drake

    2008-01-01

    Observations using the Spitzer Space Telescope provided the first detections of photons from extrasolar planets. Spitzer observations are allowing us to infer the temperature structure, composition, and dynamics of exoplanet atmospheres. The Spitzer studies extend from many hot Jupiters, to the hot Neptune orbiting GJ436. Here I review the current status of Spitzer secondary eclipse observations, and summarize the results from the viewpoint of what is robust, what needs more work, and what th...

  4. Cost effective purification of intein based syntetic cationic antimicrobial peptide expressed in cold shock expression system using salt inducible E. coli GJ1158

    Directory of Open Access Journals (Sweden)

    Seetha Ram Kotra

    2014-03-01

    Full Text Available Objective:Synthetic cationic antimicrobial peptide (SC-AMP is an important and upcoming therapeutic molecule against onventional antibiotics. In this study, an attempt was made to purify the SC-AMP without the enzymatic cleavage of the affinity tag, by using an intein-based system. Methods:The intein sequence was amplified from pTYB11 vector using PCR methodologies and the N-terminal of intein was ligated with SC-AMP. The designed construct, intein-SC-AMP was cloned into MCS region of cold shock expression vector, pCOLDI and the recombinant peptide was purified on a chitin affinity column by cleaving intein with 50 mM DTT without applying enzymatic cleavage. Later the peptide was quantified and its antibacterial activity of the purified peptide was studied using well diffusion method. Results: Initially, intein-SC-AMP was expressed as a fusion protein in both IPTG inducible E. coli BL21(DE3 and salt inducible E. coli GJ1158. Single step purification using CBD (chitin binding domain - intein tag in salt inducible E. coli GJ1158, yields the SC-AMP in the soluble form at a oncentration of 208 mg/L. The antibacterial activity and minimal inhibitory concentration (MIC of the purified SC-AMP was studied against both Gram positive and Gram negative microorganisms. Conclusion: For the first time, single step purification of soluble SC-AMP was carried out using chitin-binding domain affinity tag in salt inducible E. coli GJ1158 without an application of enzymatic cleavage. J Microbiol Infect Dis 2014;4(1:13-19

  5. A PLANETARY SYSTEM AROUND THE NEARBY M DWARF GJ 667C WITH AT LEAST ONE SUPER-EARTH IN ITS HABITABLE ZONE

    Energy Technology Data Exchange (ETDEWEB)

    Anglada-Escude, Guillem; Butler, R. Paul [Carnegie Institution of Washington, Department of Terrestrial Magnetism, 5241 Broad Branch Rd. NW, Washington, DC 20015 (United States); Arriagada, Pamela; Minniti, Dante [Department of Astronomy, Pontificia Universidad Catolica de Chile, Casilla 306, Santiago 22 (Chile); Vogt, Steven S.; Rivera, Eugenio J. [UCO/Lick Observatory, University of California, Santa Cruz, CA 95064 (United States); Crane, Jeffrey D.; Shectman, Stephen A.; Thompson, Ian B. [Carnegie Observatories, 813 Santa Barbara St., Pasadena, CA 91101-1292 (United States); Haghighipour, Nader [Institute for Astronomy and NASA Astrobiology Institute, University of Hawaii-Monoa, 2680 Woodlawn Drive, Honolulu, HI 96822 (United States); Carter, Brad D. [Faculty of Sciences, University of Southern Queensland, Toowoomba 4350 (Australia); Tinney, C. G.; Wittenmyer, Robert A.; Bailey, Jeremy A. [Department of Astrophysics, School of Physics, University of New South Wales, Sydney 2052 (Australia); O' Toole, Simon J. [Australian Astronomical Observatory, P.O. Box 296, Epping 1710 (Australia); Jones, Hugh R. A. [Centre for Astrophysics Research, University of Hertfordshire, College Lane, Hatfield, Herts, AL10 9AB (United Kingdom); Jenkins, James S., E-mail: anglada@dtm.ciw.edu [Departamento de Astronomia, Universidad de Chile, Camino El Observatorio 1515, Las Condes, Santiago (Chile)

    2012-05-20

    We re-analyze 4 years of HARPS spectra of the nearby M1.5 dwarf GJ 667C available through the European Southern Observatory public archive. The new radial velocity (RV) measurements were obtained using a new data analysis technique that derives the Doppler measurement and other instrumental effects using a least-squares approach. Combining these new 143 measurements with 41 additional RVs from the Magellan/Planet Finder Spectrograph and Keck/High Resolution Echelle Spectrometer spectrometers reveals three additional signals beyond the previously reported 7.2 day candidate, with periods of 28 days, 75 days, and a secular trend consistent with the presence of a gas giant (period {approx}10 years). The 28 day signal implies a planet candidate with a minimum mass of 4.5 M{sub Circled-Plus} orbiting well within the canonical definition of the star's liquid water habitable zone (HZ), that is, the region around the star at which an Earth-like planet could sustain liquid water on its surface. Still, the ultimate water supporting capability of this candidate depends on properties that are unknown such as its albedo, atmospheric composition, and interior dynamics. The 75 day signal is less certain, being significantly affected by aliasing interactions among a potential 91 day signal, and the likely rotation period of the star at 105 days detected in two activity indices. GJ 667C is the common proper motion companion to the GJ 667AB binary, which is metal-poor compared to the Sun. The presence of a super-Earth in the HZ of a metal-poor M dwarf in a triple star system supports the evidence that such worlds should be ubiquitous in the Galaxy.

  6. A PLANETARY SYSTEM AROUND THE NEARBY M DWARF GJ 667C WITH AT LEAST ONE SUPER-EARTH IN ITS HABITABLE ZONE

    International Nuclear Information System (INIS)

    Anglada-Escudé, Guillem; Butler, R. Paul; Arriagada, Pamela; Minniti, Dante; Vogt, Steven S.; Rivera, Eugenio J.; Crane, Jeffrey D.; Shectman, Stephen A.; Thompson, Ian B.; Haghighipour, Nader; Carter, Brad D.; Tinney, C. G.; Wittenmyer, Robert A.; Bailey, Jeremy A.; O'Toole, Simon J.; Jones, Hugh R. A.; Jenkins, James S.

    2012-01-01

    We re-analyze 4 years of HARPS spectra of the nearby M1.5 dwarf GJ 667C available through the European Southern Observatory public archive. The new radial velocity (RV) measurements were obtained using a new data analysis technique that derives the Doppler measurement and other instrumental effects using a least-squares approach. Combining these new 143 measurements with 41 additional RVs from the Magellan/Planet Finder Spectrograph and Keck/High Resolution Echelle Spectrometer spectrometers reveals three additional signals beyond the previously reported 7.2 day candidate, with periods of 28 days, 75 days, and a secular trend consistent with the presence of a gas giant (period ∼10 years). The 28 day signal implies a planet candidate with a minimum mass of 4.5 M ⊕ orbiting well within the canonical definition of the star's liquid water habitable zone (HZ), that is, the region around the star at which an Earth-like planet could sustain liquid water on its surface. Still, the ultimate water supporting capability of this candidate depends on properties that are unknown such as its albedo, atmospheric composition, and interior dynamics. The 75 day signal is less certain, being significantly affected by aliasing interactions among a potential 91 day signal, and the likely rotation period of the star at 105 days detected in two activity indices. GJ 667C is the common proper motion companion to the GJ 667AB binary, which is metal-poor compared to the Sun. The presence of a super-Earth in the HZ of a metal-poor M dwarf in a triple star system supports the evidence that such worlds should be ubiquitous in the Galaxy.

  7. Magellan/PFS Radial Velocities of GJ 9827, a Late K dwarf at 30 pc with Three Transiting Super-Earths

    Science.gov (United States)

    Teske, Johanna K.; Wang, Sharon; Wolfgang, Angie; Dai, Fei; Shectman, Stephen A.; Butler, R. Paul; Crane, Jeffrey D.; Thompson, Ian B.

    2018-04-01

    The Kepler mission showed us that planets with sizes between that of Earth and Neptune appear to be the most common type in our Galaxy. These “super-Earths” continue to be of great interest for exoplanet formation, evolution, and composition studies. However, the number of super-Earths with well-constrained mass and radius measurements remains small (40 planets with σ mass Earth planets were detected by the K2 mission around the nearby star GJ 9827/HIP 115752, at only 30 pc away. The radii of the planets span the “radius gap” detected by Fulton et al. (2017), and all orbit within ∼6.5 days, easing follow-up observations. Here, we report radial velocity (RV) observations of GJ 9827, taken between 2010 and 2016 with the Planet Finder Spectrograph on the Magellan II Telescope. We employ two different RV analysis packages, SYSTEMIC and RADVEL, to derive masses and thus densities of the GJ 9827 planets. We also test a Gaussian Process regression analysis but find the correlated stellar noise is not well constrained by the PFS data and that the GP tends to over-fit the RV semi-amplitudes resulting in a lower K value. Our RV observations are not able to place strong mass constraints on the two outer planets (c and d) but do indicate that planet b, at 1.64 R ⊕ and ∼8 M ⊕, is one of the most massive (and dense) super-Earth planets detected to date.

  8. Adaptation of Xanthobacter autotrophicus GJ10 to bromoacetate due to activation and mobilization of the haloacetate dehalogenase gene by insertion element IS1247

    DEFF Research Database (Denmark)

    van der Ploeg, J; Willemsen, M; Van Hall, Gerrit

    1995-01-01

    B gene. In mutant GJ10M50, a DNA fragment (designated IS1247) had copied itself from a position on the chromosome that was not linked to the dhlB region to a site immediately upstream of dhlB, resulting in a 1,672-bp insertion. IS1247 was found to encode an open reading frame corresponding to 464 amino...... acids which showed similarity to putative transposases from two other insertion elements. In most of the other MBA-resistant mutants of GJ10, IS1247 was also present in one more copy than in the wild type, which had two copies located within 20 kb. After insertion to a site proximal to dhlB, IS1247...... was able to transpose itself together with the dhlB gene to a plasmid, without the requirement of a second insertion element being present downstream of dhlB. The results show that IS1247 causes bromoacetate resistance by overexpression and mobilization of the haloacid dehalogenase gene, which mimics steps...

  9. Optical to near-infrared transit observations of super-Earth GJ 1214b: water-world or mini-Neptune?

    Science.gov (United States)

    de Mooij, E. J. W.; Brogi, M.; de Kok, R. J.; Koppenhoefer, J.; Nefs, S. V.; Snellen, I. A. G.; Greiner, J.; Hanse, J.; Heinsbroek, R. C.; Lee, C. H.; van der Werf, P. P.

    2012-02-01

    Context. GJ 1214b, the 6.55 Earth-mass transiting planet recently discovered by the MEarth team, has a mean density of ~35% of that of the Earth. It is thought that this planet is either a mini-Neptune, consisting of a rocky core with a thick, hydrogen-rich atmosphere, or a planet with a composition dominated by water. Aims: In the case of a hydrogen-rich atmosphere, molecular absorption and scattering processes may result in detectable radius variations as a function of wavelength. The aim of this paper is to measure these variations. Methods: We have obtained observations of the transit of GJ 1214b in the r- and I-band with the Isaac Newton Telescope (INT), in the g-, r-, i- and z-bands with the 2.2 m MPI/ESO telescope, in the Ks-band with the Nordic Optical Telescope (NOT), and in the Kc-band with the William Herschel Telescope (WHT). By comparing the transit depth between the the different bands, which is a measure for the planet-to-star size ratio, the atmosphere is investigated. Results: We do not detect clearly significant variations in the planet-to-star size ratio as function of wavelength. Although the ratio at the shortest measured wavelength, in g-band, is 2σ larger than in the other bands. The uncertainties in the Ks and Kc bands are large, due to systematic features in the light curves. Conclusions: The tentative increase in the planet-to-star size ratio at the shortest wavelength could be a sign of an increase in the effective planet-size due to Rayleigh scattering, which would require GJ 1214b to have a hydrogen-rich atmosphere. If true, then the atmosphere has to have both clouds, to suppress planet-size variations at red optical wavelengths, as well as a sub-solar metallicity, to suppress strong molecular features in the near- and mid-infrared. However, star spots, which are known to be present on the host-star's surface, can (partly) cancel out the expected variations in planet-to-star size ratio, because the lower surface temperature of the

  10. THE OPTICAL AND NEAR-INFRARED TRANSMISSION SPECTRUM OF THE SUPER-EARTH GJ 1214b: FURTHER EVIDENCE FOR A METAL-RICH ATMOSPHERE

    International Nuclear Information System (INIS)

    Bean, Jacob L.; Désert, Jean-Michel; Stalder, Brian; Berta, Zachory K.; Kabath, Petr; Seager, Sara; Miller-Ricci Kempton, Eliza; Homeier, Derek; Walsh, Shane; Seifahrt, Andreas

    2011-01-01

    We present an investigation of the transmission spectrum of the 6.5 M ⊕ planet GJ 1214b based on new ground-based observations of transits of the planet in the optical and near-infrared, and on previously published data. Observations with the VLT + FORS and Magellan + MMIRS using the technique of multi-object spectroscopy with wide slits yielded new measurements of the planet's transmission spectrum from 0.61 to 0.85 μm, and in the J, H, and K atmospheric windows. We also present a new measurement based on narrow-band photometry centered at 2.09 μm with the VLT + HAWKI. We combined these data with results from a reanalysis of previously published FORS data from 0.78 to 1.00 μm using an improved data reduction algorithm, and previously reported values based on Spitzer data at 3.6 and 4.5 μm. All of the data are consistent with a featureless transmission spectrum for the planet. Our K-band data are inconsistent with the detection of spectral features at these wavelengths reported by Croll and collaborators at the level of 4.1σ. The planet's atmosphere must either have at least 70% H 2 O by mass or optically thick high-altitude clouds or haze to be consistent with the data.

  11. Three decades after Gjönnaess's laparoscopic ovarian drilling for treatment of PCOS; what do we know? An evidence-based approach.

    Science.gov (United States)

    Abu Hashim, Hatem; Al-Inany, Hesham; De Vos, Michel; Tournaye, Herman

    2013-08-01

    The introduction of laparoscopic ovarian drilling (LOD) by Gjönnaess in 1984 as a substitute for ovarian wedge resection created opportunities for extensive research given its worldwide application for ovulation induction in women with polycystic ovary syndrome (PCOS). To critically evaluate and summarize the current body of literature regarding the role of LOD for the management of PCOS entailing its different preoperative, operative and postoperative aspects. In addition, long-term efficacy, cost-effectiveness, patient preference and health-related quality of life issues will be evaluated together with other available alternatives of ovulation induction treatments. A PubMed search was conducted looking for the different trials, reviews and various guidelines relating to the role of LOD in the management of PCOS. LOD whether unilateral or bilateral is a beneficial second-line treatment in infertile women with clomiphene citrate (CC)-resistant PCOS. It is as effective as gonadotrophin treatment but without the risk of multiple pregnancy or ovarian hyperstimulation and does not require intensive monitoring. Increased responsiveness of the ovary to CC especially in patients who remain anovulatory following LOD is another advantage. Recent evidence suggests that relatively novel oral methods of ovulation induction, e.g. CC plus metformin, CC plus tamoxifen, rosiglitazone plus CC and aromatase inhibitors represent a successful alternative to LOD in CC-resistant PCOS. Meanwhile current evidence does not support LOD as a first-line approach in PCOS-related anovulation or before IVF. LOD is currently recommended as a successful and economical second-line treatment for ovulation induction in women with CC-resistant PCOS.

  12. HADES RV Programme with HARPS-N at TNG. V. A super-Earth on the inner edge of the habitable zone of the nearby M dwarf GJ 625

    Science.gov (United States)

    Suárez Mascareño, A.; González Hernández, J. I.; Rebolo, R.; Velasco, S.; Toledo-Padrón, B.; Affer, L.; Perger, M.; Micela, G.; Ribas, I.; Maldonado, J.; Leto, G.; Zanmar Sanchez, R.; Scandariato, G.; Damasso, M.; Sozzetti, A.; Esposito, M.; Covino, E.; Maggio, A.; Lanza, A. F.; Desidera, S.; Rosich, A.; Bignamini, A.; Claudi, R.; Benatti, S.; Borsa, F.; Pedani, M.; Molinari, E.; Morales, J. C.; Herrero, E.; Lafarga, M.

    2017-09-01

    We report the discovery of a super-Earth orbiting at the inner edge of the habitable zone of the star GJ 625 based on the analysis of the radial-velocity (RV) time series from the HARPS-N spectrograph, consisting of 151 HARPS-N measurements taken over 3.5 yr. GJ 625 b is a planet with a minimum mass Msini of 2.82 ± 0.51 M⊕ with an orbital period of 14.628 ± 0.013 days at a distance of 0.078 AU from its parent star. The host star is the quiet M2 V star GJ 625, located at 6.5 pc from the Sun. We find the presence of a second radial-velocity signal in the range 74-85 days that we relate to stellar rotation after analysing the time series of Ca II H&K and Hα spectroscopic indicators, the variations of the FWHM of the CCF, and the APT2 photometric light curves. We find no evidence linking the short-period radial-velocity signal to any activity proxy. Based on observations made with the Italian Telescopio Nazionale Galileo (TNG), operated on the island of La Palma by the INAF - Fundación Galileo Galilei at the Roche de Los Muchachos Observatory of the Instituto de Astrofísica de Canarias (IAC); photometric observations made with the robotic telescope APT2 (within the EXORAP programme) located at Serra La Nave on Mt. Etna; and lucky imaging observations made with the Telescopio Carlos Sánchez operated on the island of Tenerife by the Instituto de Astrofísica de Canarias in the Spanish Observatorio del Teide.Tables A.1-A.5 are only available at the CDS via anonymous ftp to http://cdsarc.u-strasbg.fr (http://130.79.128.5) or via http://cdsarc.u-strasbg.fr/viz-bin/qcat?J/A+A/605/A92

  13. The 16th P and GJ 500 report

    International Nuclear Information System (INIS)

    Share, J.

    1996-01-01

    Pipeline and Gas Journal is pleased to present its 16th annual 500 Report--a comprehensive listing of the nation's energy pipelines. The list comprises the leading 300 natural gas distribution utilities; top 100 gas transmission pipelines and top 100 liquids pipelines. The wealth of statistics includes pipeline mileage; total throughput of gas and barrels of crude oil and refined products; operating revenue; employees; and in the case of the gas distributors their number of customers. Just as important as the numbers are the trends they reveal of an energy industry continuing to undergo dramatic change. The gas industry in particular has faced a massive reorganization caused in large part by Federal Energy Regulatory Commission Order 636

  14. MODELS OF NEPTUNE-MASS EXOPLANETS: EMERGENT FLUXES AND ALBEDOS

    International Nuclear Information System (INIS)

    Spiegel, David S.; Burrows, Adam; Ibgui, Laurent; Hubeny, Ivan; Milsom, John A.

    2010-01-01

    There are now many known exoplanets with Msin i within a factor of 2 of Neptune's, including the transiting planets GJ 436b and HAT-P-11b. Planets in this mass range are different from their more massive cousins in several ways that are relevant to their radiative properties and thermal structures. By analogy with Neptune and Uranus, they are likely to have metal abundances that are an order of magnitude or more greater than those of larger, more massive planets. This increases their opacity, decreases Rayleigh scattering, and changes their equation of state. Furthermore, their smaller radii mean that fluxes from these planets are roughly an order of magnitude lower than those of otherwise identical gas giant planets. Here, we compute a range of plausible radiative equilibrium models of GJ 436b and HAT-P-11b. In addition, we explore the dependence of generic Neptune-mass planets on a range of physical properties, including their distance from their host stars, their metallicity, the spectral type of their stars, the redistribution of heat in their atmospheres, and the possible presence of additional optical opacity in their upper atmospheres.

  15. Super-Earths, Warm Neptunes, and Hot Jupiters: Transmission Spectroscopy for Comparative Planetology

    Science.gov (United States)

    Fraine, Jonathan D.; Deming, Drake; Jordan, Andres; Knutson, Heather

    2015-01-01

    The detections and non-detections of molecular species in transiting planets-- such as water, methane, and carbon monoxide-- lead to greater understanding of planet formation and evolution. Recent significant advances in both theoretical and observational discoveries from planets like HD189733b, HD209458b, GJ436b, as well as our own work with HAT-P-11b and GJ1214b, have shown that the range of measurable atmospheric properties spans from clear, molecular absorption dominated worlds to opaque worlds, with cloudy, hazy, or high mean molecular weight atmospheres. Characterization of significant non-detections allowed us to infer the existence of opaque cloud layers at very high altitudes or mean molecular weights upwards of ~1000x solar. The prevalence of these atmospheres was unexpected from extrapolations of solar system analogs. I will present our published results from GJ1214b and HAT-P-11b, as well as our recent work using both Spitzer and Magellan. Our results, combined with transmission spectra obtained for other similar planets, connect to develop a better understanding about the nature of these distant and alien worlds

  16. Kepler planet-detection mission: introduction and first results.

    Science.gov (United States)

    Borucki, William J; Koch, David; Basri, Gibor; Batalha, Natalie; Brown, Timothy; Caldwell, Douglas; Caldwell, John; Christensen-Dalsgaard, Jørgen; Cochran, William D; DeVore, Edna; Dunham, Edward W; Dupree, Andrea K; Gautier, Thomas N; Geary, John C; Gilliland, Ronald; Gould, Alan; Howell, Steve B; Jenkins, Jon M; Kondo, Yoji; Latham, David W; Marcy, Geoffrey W; Meibom, Søren; Kjeldsen, Hans; Lissauer, Jack J; Monet, David G; Morrison, David; Sasselov, Dimitar; Tarter, Jill; Boss, Alan; Brownlee, Don; Owen, Toby; Buzasi, Derek; Charbonneau, David; Doyle, Laurance; Fortney, Jonathan; Ford, Eric B; Holman, Matthew J; Seager, Sara; Steffen, Jason H; Welsh, William F; Rowe, Jason; Anderson, Howard; Buchhave, Lars; Ciardi, David; Walkowicz, Lucianne; Sherry, William; Horch, Elliott; Isaacson, Howard; Everett, Mark E; Fischer, Debra; Torres, Guillermo; Johnson, John Asher; Endl, Michael; MacQueen, Phillip; Bryson, Stephen T; Dotson, Jessie; Haas, Michael; Kolodziejczak, Jeffrey; Van Cleve, Jeffrey; Chandrasekaran, Hema; Twicken, Joseph D; Quintana, Elisa V; Clarke, Bruce D; Allen, Christopher; Li, Jie; Wu, Haley; Tenenbaum, Peter; Verner, Ekaterina; Bruhweiler, Frederick; Barnes, Jason; Prsa, Andrej

    2010-02-19

    The Kepler mission was designed to determine the frequency of Earth-sized planets in and near the habitable zone of Sun-like stars. The habitable zone is the region where planetary temperatures are suitable for water to exist on a planet's surface. During the first 6 weeks of observations, Kepler monitored 156,000 stars, and five new exoplanets with sizes between 0.37 and 1.6 Jupiter radii and orbital periods from 3.2 to 4.9 days were discovered. The density of the Neptune-sized Kepler-4b is similar to that of Neptune and GJ 436b, even though the irradiation level is 800,000 times higher. Kepler-7b is one of the lowest-density planets (approximately 0.17 gram per cubic centimeter) yet detected. Kepler-5b, -6b, and -8b confirm the existence of planets with densities lower than those predicted for gas giant planets.

  17. Simultaneous multicolour optical and near-IR transit photometry of GJ 1214b with SOFIA

    Czech Academy of Sciences Publication Activity Database

    Angerhausen, D.; Dreyer, L. L.; Placek, B.; Csizmadia, Sz.; Eigmueller, Ph.; Godolt, M.; Kitzmann, D.; Mallonn, M.; Becklin, E. E.; Collins, P.; Dunham, D.; Grenfell, J.L.; Hamilton, R. T.; Kabáth, Petr; Logsdon, J. M.; Mandell, A.; Mandushev, G.; McElwain, M.; McLean, I.S.; Pfueller, E.; Rauer, H.; Savage, M.; Shenoy, S.; Vacca, W. D.; Van Cleve, J. E.; Wiedemann, M.; Wolf, J.

    2017-01-01

    Roč. 608, December (2017), A120/1-A120/12 E-ISSN 1432-0746 Institutional support: RVO:67985815 Keywords : hubble- space -telescope * light curves * transmission spectrum Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics OBOR OECD: Astronomy (including astrophysics, space science) Impact factor: 5.014, year: 2016

  18. J.B. van Wyk,* G.J. Erasmus and K.V. Konstantinov

    African Journals Online (AJOL)

    closed population of finite size. ... separately identified throughout the course of the project. Individual ... analysis, records of stillborn lambs and of years 1941 and ... djj is the diagonal element of the ith animal in Wright's num- .... The first step.

  19. "Gjálvar í tvíningi alt sum er til"

    DEFF Research Database (Denmark)

    Moberg, Bergur Rønne

    2009-01-01

    En beskrivelse af Karsten Hoydals lyriske elementunivers i form af vand-, luft,- ild- og jordmotiver med afsæt i Gaston Bachelards elementpoetik. Der gøres også rede for forfatterskabets litteraturhistoriske placering.......En beskrivelse af Karsten Hoydals lyriske elementunivers i form af vand-, luft,- ild- og jordmotiver med afsæt i Gaston Bachelards elementpoetik. Der gøres også rede for forfatterskabets litteraturhistoriske placering....

  20. Dynamical Evolution and Spin-Orbit Resonances of Potentially Habitable Exoplanets. The Case of GJ 667C

    Science.gov (United States)

    2014-01-10

    on habitability and atmosphere properties. The major planets of the solar system, with the notable exception of Venus and Mercury , rotate at...energy. The lat- ter kind of librations is expected to damp relatively quickly for Mercury -like planets (Peale 2005), with a characteristic damp- ing...is even shorter than that for Mercury . The planet is certain to be in one of the low-order resonances, that is, its current rotation with respect to

  1. Herbert Fröhlich: A Physicist Ahead of His Time, by G.J. Hyland [Book Review

    Energy Technology Data Exchange (ETDEWEB)

    Devanathan, Ram [Pacific Northwest National Lab. (PNNL), Richland, WA (United States)

    2016-02-01

    This authoritative biography of Herbert Fröhlich (1905-1991), a well-known theoretical physicist, paints an intimate portrait of a pioneering scientist who made seminal contributions to condensed matter physics and left his mark on other domains such as biology over a 60-year career. From his vantage point as the last graduate student of this eminent physicist, Gerard Hyland has produced an account that weaves the personal experiences and travails of Fröhlich with detailed discussion of the theory of dielectrics. The political upheavals in Europe during the 20th century provide a dramatic backdrop for the narrative.

  2. J.e. Greeff* and A.S. Faure G.J. Minnaar S.J. Schoeman

    African Journals Online (AJOL)

    the fashion market. This market requires an attractive product of exceptional quality which, to a large extent, is determined by quality of hair and the excellence of pattern. Pattern and hair quality are both complex traits under poli- genic control (Nel, 1966). To increase accuracy of selection, it is important that any non-genetic ...

  3. "Dem vil at barna skal ha noe å gjøre" : En casestudie av Habbo.no

    OpenAIRE

    Kvaale, Torkel

    2012-01-01

    Denne oppgaven er en kvalitativ casestudie av Habbo.no, en virtuell verden der hovedgruppen av brukere er barn og unge. Det kvalitative forskningsintervju representerer metodeverktøyet som er brukt for innsamlingen av data, og datamaterialet består av 10 intervjuer med tilsammen 13 brukere av Habbo.no, i alderen 10-12 år. Habbo ble skapt av det finske selskapet Sulake i 2000 som hevder at denne er verdens største virtuelle verden for tenåringer. Habbo.no er kun én av til sammen 35 unike H...

  4. How to distinguish between cloudy mini-Neptunes and water/volatile-dominated super-Earths

    Energy Technology Data Exchange (ETDEWEB)

    Benneke, Björn; Seager, Sara, E-mail: bbenneke@mit.edu [Department of Earth, Atmospheric, and Planetary Sciences, Massachusetts Institute of Technology, Cambridge, MA 02139 (United States)

    2013-12-01

    One of the most profound questions about the newly discovered class of low-density super-Earths is whether these exoplanets are predominately H{sub 2}-dominated mini-Neptunes or volatile-rich worlds with gas envelopes dominated by H{sub 2}O, CO{sub 2}, CO, CH{sub 4}, or N{sub 2}. Transit observations of the super-Earth GJ 1214b rule out cloud-free H{sub 2}-dominated scenarios, but are not able to determine whether the lack of deep spectral features is due to high-altitude clouds or the presence of a high mean molecular mass atmosphere. Here, we demonstrate that one can unambiguously distinguish between cloudy mini-Neptunes and volatile-dominated worlds based on wing steepness and relative depths of absorption features in moderate-resolution near-infrared transmission spectra (R ∼ 100). In a numerical retrieval study, we show for GJ 1214b that an unambiguous distinction between a cloudy H{sub 2}-dominated atmosphere and cloud-free H{sub 2}O atmosphere will be possible if the uncertainties in the spectral transit depth measurements can be reduced by a factor of ∼3 compared to the published Hubble Space Telescope Wide-Field Camera 3 and Very Large Telescope transit observations by Berta et al. and Bean et al. We argue that the required precision for the distinction may be achievable with currently available instrumentation by stacking 10-15 repeated transit observations. We provide a scaling law that scales our quantitative results to other transiting super-Earths and Neptunes such as HD 97658b, 55 Cnc e, GJ 3470b and GJ 436b. The analysis in this work is performed using an improved version of our Bayesian atmospheric retrieval framework. The new framework not only constrains the gas composition and cloud/haze parameters, but also determines our confidence in having detected molecules and cloud/haze species through Bayesian model comparison. Using the Bayesian tool, we demonstrate quantitatively that the subtle transit depth variation in the Berta et al. data is

  5. A New Window into Escaping Exoplanet Atmospheres: 10830 Å Line of Helium

    Science.gov (United States)

    Oklopčić, Antonija; Hirata, Christopher M.

    2018-03-01

    Observational evidence for escaping exoplanet atmospheres has been obtained for a few exoplanets to date. It comes from strong transit signals detected in the ultraviolet, most notably in the wings of the hydrogen Lyα (Lyα) line. However, the core of the Lyα line is often heavily affected by interstellar absorption and geocoronal emission, limiting the information about the atmosphere that can be extracted from that part of the spectrum. Transit observations in atomic lines that are (a) sensitive enough to trace the rarefied gas in the planetary wind and (b) do not suffer from significant extinction by the interstellar medium could enable more detailed observations, and thus provide better constraints on theoretical models of escaping atmospheres. The absorption line of a metastable state of helium at 10830 Å could satisfy both of these conditions for some exoplanets. We develop a simple 1D model of escaping planetary atmospheres containing hydrogen and helium. We use it to calculate the density profile of helium in the 23S metastable excited state and the expected in-transit absorption at 10830 Å for two exoplanets known to have escaping atmospheres. Our results indicate that exoplanets similar to GJ 436b and HD 209458b should exhibit enhanced transit depths at 10830 Å, with ∼8% and ∼2% excess absorption in the line core, respectively.

  6. Comment on 'evaluation of dechlorination mechanisms during anaerobic fermentation of blached kraft mill effluent by W.J. Parker, E.R. Hall and G.J. Farquhar'

    Digital Repository Service at National Institute of Oceanography (India)

    Sarkar, A.

    Comment on "Evaluation of dechlorination mechanisms during anaerobic fermentation of bleached kraft mill effluent", is put forth. The data reproduced in Table 1 does not seem to be authentic as the method of preprationo of the chlorinated organic...

  7. Ted (G.J.) Kloosterman: on intrauterine growth. The significance of prenatal care. Studies on birth weight, placental weight and placental index.

    Science.gov (United States)

    Bleker, O P; Buimer, M; van der Post, J A M; van der Veen, F

    2006-01-01

    In the last century, there was a heated debate on whether fetal growth retardation is caused by a small placenta or whether a placenta is small because the baby is small. One of the active participants in this debate was Kloosterman who studied 80,000 birth weights, and 30,000 placental weights, in relation to gestational age at birth, fetal sex, maternal parity, and perinatal mortality. He found that pregnancies related to heavier placentas last longer. He also found that, from about 32 weeks of gestation onwards, children from primiparous women as compared to those from multiparous women, like twin children as compared to singleton children, are relatively growth retarded, most likely related to prior relatively poor placental growth. He concluded that poor fetal growth is not the cause, but the result of poor placental growth. The clinical implication of all these is that future early detection of poor placental growth may prospect poor fetal growth, and may even allow for early interventions to improve fetal outcome.

  8. Ted (G.J.) Kloosterman: on intrauterine growth. The significance of prenatal care. Studies on birth weight, placental weight and placental index

    NARCIS (Netherlands)

    Bleker, O. P.; Buimer, M.; van der Post, J. A. M.; van der Veen, F.

    2006-01-01

    In the last century, there was a heated debate on whether fetal growth retardation is caused by a small placenta or whether a placenta is small because the baby is small. One of the active participants in this debate was Kloosterman who studied 80,000 birth weights, and 30,000 placental weights, in

  9. THE STATISTICS OF ALBEDO AND HEAT RECIRCULATION ON HOT EXOPLANETS

    International Nuclear Information System (INIS)

    Cowan, Nicolas B.; Agol, Eric

    2011-01-01

    If both the day-side and night-side effective temperatures of a planet can be measured, it is possible to estimate its Bond albedo, 0 B 0 , and associated uncertainty. We then use a simple model-independent technique to estimate a planet's effective temperature from planet/star flux ratios. We use thermal secondary eclipse measurements-those obtained at λ>0.8 μm-to estimate day-side effective temperatures, T d , and thermal phase variations-when available-to estimate night-side effective temperature. We strongly rule out the 'null hypothesis' of a single A B and ε for all 24 planets. If we allow each planet to have different parameters, we find that low Bond albedos are favored (A B 0 , the day-side effective temperatures of the 24 planets describe a uni-modal distribution. The two biggest outliers are GJ 436b (abnormally hot) and HD 80606b (abnormally cool), and these are the only eccentric planets in our sample. The dimensionless quantity T d /T 0 exhibits no trend with the presence or absence of stratospheric inversions. There is also no clear trend between T d /T 0 and T 0 . That said, the six planets with the greatest sub-stellar equilibrium temperatures (T > 2400 K) have low ε, as opposed to the 18 cooler planets, which show a variety of recirculation efficiencies. This hints that the very hottest transiting giant planets are qualitatively different from the merely hot Jupiters. We propose an explanation of this trend based on how a planet's radiative and advective times scale with temperature: both timescales are expected to be shorter for hotter planets, but the temperature dependence of the radiative timescale is stronger, leading to decreased heat recirculation efficiency.

  10. DOPPLER SIGNATURES OF THE ATMOSPHERIC CIRCULATION ON HOT JUPITERS

    International Nuclear Information System (INIS)

    Showman, Adam P.; Lewis, Nikole K.; Fortney, Jonathan J.; Shabram, Megan

    2013-01-01

    The meteorology of hot Jupiters has been characterized primarily with thermal measurements, but recent observations suggest the possibility of directly detecting the winds by observing the Doppler shift of spectral lines seen during transit. Motivated by these observations, we show how Doppler measurements can place powerful constraints on the meteorology. We show that the atmospheric circulation—and Doppler signature—of hot Jupiters splits into two regimes. Under weak stellar insolation, the day-night thermal forcing generates fast zonal jet streams from the interaction of atmospheric waves with the mean flow. In this regime, air along the terminator (as seen during transit) flows toward Earth in some regions and away from Earth in others, leading to a Doppler signature exhibiting superposed blueshifted and redshifted components. Under intense stellar insolation, however, the strong thermal forcing damps these planetary-scale waves, inhibiting their ability to generate jets. Strong frictional drag likewise damps these waves and inhibits jet formation. As a result, this second regime exhibits a circulation dominated by high-altitude, day-to-night airflow, leading to a predominantly blueshifted Doppler signature during transit. We present state-of-the-art circulation models including non-gray radiative transfer to quantify this regime shift and the resulting Doppler signatures; these models suggest that cool planets like GJ 436b lie in the first regime, HD 189733b is transitional, while planets hotter than HD 209458b lie in the second regime. Moreover, we show how the amplitude of the Doppler shifts constrains the strength of frictional drag in the upper atmospheres of hot Jupiters. If due to winds, the ∼2 km s –1 blueshift inferred on HD 209458b may require drag time constants as short as 10 4 -10 6 s, possibly the result of Lorentz-force braking on this planet's hot dayside.

  11. THE INFLUENCE OF THE EXTREME ULTRAVIOLET SPECTRAL ENERGY DISTRIBUTION ON THE STRUCTURE AND COMPOSITION OF THE UPPER ATMOSPHERE OF EXOPLANETS

    Energy Technology Data Exchange (ETDEWEB)

    Guo, J. H. [Yunnan Observatories, Chinese Academy of Sciences, P.O. Box 110, Kunming 650011 (China); Ben-Jaffel, Lotfi, E-mail: guojh@ynao.ac.cn, E-mail: bjaffel@iap.fr [Sorbonne Universités, UPMC Univ. Paris 6 et CNRS, UMR 7095, Institut Astrophysique de Paris, F-75014 Paris (France)

    2016-02-20

    By varying the profiles of stellar extreme ultraviolet (EUV) spectral energy distributions (SEDs), we tested the influences of stellar EUV SEDs on the physical and chemical properties of an escaping atmosphere. We apply our model to study four exoplanets: HD 189733b, HD 209458b, GJ 436b, and Kepler-11b. We find that the total mass loss rates of an exoplanet, which are determined mainly by the integrated fluxes, are moderately affected by the profiles of the EUV SED, but the composition and species distributions in the atmosphere can be dramatically modified by the different profiles of the EUV SED. For exoplanets with a high hydrodynamic escape parameter (λ), the amount of atomic hydrogen produced by photoionization at different altitudes can vary by one to two orders of magnitude with the variation of stellar EUV SEDs. The effect of photoionization of H is prominent when the EUV SED is dominated by the low-energy spectral region (400–900 Å), which pushes the transition of H/H{sup +} to low altitudes. In contrast, the transition of H/H{sup +} moves to higher altitudes when most photons are concentrated in the high-energy spectral region (50–400 Å). For exoplanets with a low λ, the lower temperatures of the atmosphere make many chemical reactions so important that photoionization alone can no longer determine the composition of the escaping atmosphere. For HD 189733b, it is possible to explain the time variability of Lyα between 2010 and 2011 by a change in the EUV SED of the host K-type star, yet invoking only thermal H i in the atmosphere.

  12. No hydrogen exosphere detected around the super-Earth HD 97658 b

    Science.gov (United States)

    Bourrier, V.; Ehrenreich, D.; King, G.; Lecavelier des Etangs, A.; Wheatley, P. J.; Vidal-Madjar, A.; Pepe, F.; Udry, S.

    2017-01-01

    The exoplanet HD 97658 b provides a rare opportunity to probe the atmospheric composition and evolution of moderately irradiated super-Earths. It transits a bright K star at a moderate orbital distance of 0.08 au. Its low density is compatible with a massive steam envelope that could photodissociate at high altitudes and become observable as escaping neutral hydrogen. Our analysis of three transits with HST/STIS at Lyman-α reveals no such signature, suggesting that the thermosphere of HD 97658 b is not hydrodynamically expanding and is subjected to a low escape of neutral hydrogen (soft X-ray source with signs of chromospheric variability in the Lyman-α line core. We determine an average reference for the intrinsic Lyman-α line and X-EUV (XUV) spectrum of the star, and show that HD 97658 b is in mild conditions of irradiation compared to other known evaporating exoplanets with an XUV irradiation about three times lower than the evaporating warm Neptune GJ436 b. This could be the reason why the thermosphere of HD 97658 b is not expanding: the low XUV irradiation prevents an efficient photodissociation of any putative steam envelope. Alternatively, it could be linked to a low hydrogen content or inefficient conversion of the stellar energy input. The HD 97658 system provides clues for understanding the stability of low-mass planet atmospheres in terms of composition, planetary density, and irradiation. Our study of HD 97658 b can be seen as a control experiment of our methodology, confirming that it does not bias detections of atmospheric escape and underlining its strength and reliability. Our results show that stellar activity can be efficiently discriminated from absorption signatures by a transiting exospheric cloud. They also highlight the potential of observing the upper atmosphere of small transiting planets to probe their physical and chemical properties.

  13. Kepler and Ground-Based Transits of the exo-Neptune HAT-P-11b

    Science.gov (United States)

    Deming, Drake; Sada, Pedro V.; Jackson, Brian; Peterson, Steven W.; Agol, Eric; Knutson, Heather A.; Jennings, Donald E.; Haase, Plynn; Bays, Kevin

    2011-01-01

    We analyze 26 archival Kepler transits of the exo-Neptune HAT-P-11b, supplemented by ground-based transits observed in the blue (B band) and near-IR (J band). Both the planet and host star are smaller than previously believed; our analysis yields Rp = 4.31 R xor 0.06 R xor and Rs = 0.683 R solar mass 0.009 R solar mass, both about 3 sigma smaller than the discovery values. Our ground-based transit data at wavelengths bracketing the Kepler bandpass serve to check the wavelength dependence of stellar limb darkening, and the J-band transit provides a precise and independent constraint on the transit duration. Both the limb darkening and transit duration from our ground-based data are consistent with the new Kepler values for the system parameters. Our smaller radius for the planet implies that its gaseous envelope can be less extensive than previously believed, being very similar to the H-He envelope of GJ 436b and Kepler-4b. HAT-P-11 is an active star, and signatures of star spot crossings are ubiquitous in the Kepler transit data. We develop and apply a methodology to correct the planetary radius for the presence of both crossed and uncrossed star spots. Star spot crossings are concentrated at phases 0.002 and +0.006. This is consistent with inferences from Rossiter-McLaughlin measurements that the planet transits nearly perpendicular to the stellar equator. We identify the dominant phases of star spot crossings with active latitudes on the star, and infer that the stellar rotational pole is inclined at about 12 deg 5 deg to the plane of the sky. We point out that precise transit measurements over long durations could in principle allow us to construct a stellar Butterfly diagram to probe the cyclic evolution of magnetic activity on this active K-dwarf star.

  14. The Statistics of Albedo and Heat Recirculation on Hot Exoplanets

    Science.gov (United States)

    Cowan, Nicolas B.; Agol, Eric

    2011-03-01

    If both the day-side and night-side effective temperatures of a planet can be measured, it is possible to estimate its Bond albedo, 0 calculate a sub-stellar equilibrium temperature, T 0, and associated uncertainty. We then use a simple model-independent technique to estimate a planet's effective temperature from planet/star flux ratios. We use thermal secondary eclipse measurements—those obtained at λ>0.8 μm—to estimate day-side effective temperatures, T d, and thermal phase variations—when available—to estimate night-side effective temperature. We strongly rule out the "null hypothesis" of a single AB and ɛ for all 24 planets. If we allow each planet to have different parameters, we find that low Bond albedos are favored (AB outliers are GJ 436b (abnormally hot) and HD 80606b (abnormally cool), and these are the only eccentric planets in our sample. The dimensionless quantity T d/T 0 exhibits no trend with the presence or absence of stratospheric inversions. There is also no clear trend between T d/T 0 and T 0. That said, the six planets with the greatest sub-stellar equilibrium temperatures (T > 2400 K) have low ɛ, as opposed to the 18 cooler planets, which show a variety of recirculation efficiencies. This hints that the very hottest transiting giant planets are qualitatively different from the merely hot Jupiters. We propose an explanation of this trend based on how a planet's radiative and advective times scale with temperature: both timescales are expected to be shorter for hotter planets, but the temperature dependence of the radiative timescale is stronger, leading to decreased heat recirculation efficiency.

  15. Testing connections between exo-atmospheres and their host stars. GEMINI-N/GMOS ground-based transmission spectrum of Qatar-1b

    Science.gov (United States)

    von Essen, C.; Cellone, S.; Mallonn, M.; Albrecht, S.; Miculán, R.; Müller, H. M.

    2017-07-01

    Till date, only a handful exo-atmospheres have been well characterized, mostly by means of the transit method. Some classic examples are HD 209458b, HD 189733b, GJ-436b, and GJ-1214b. Data show exoplanet atmospheres to be diverse. However, this is based on a small number of cases. Here we focus our study on the exo-atmosphere of Qatar-1b, an exoplanet that looks much like HD 189733b regarding its host star's activity level, their surface gravity, scale height, equilibrium temperature and transit parameters. Thus, our motivation relied on carrying out a comparative study of their atmospheres, and assess if these are regulated by their environment. In this work we present one primary transit of Qatar-1b obtained during September, 2014, using the 8.1 m GEMINI North telescope. The observations were performed using the GMOS-N instrument in multi-object spectroscopic mode. We collected fluxes of Qatar-1 and six more reference stars, covering the wavelength range between 460 and 746 nm. The achieved photometric precision of 0.18 parts-per-thousand in the white light curve, at a cadence of 165 s, makes this one of the most precise datasets obtained from the ground. We created 12 chromatic transit light curves that we computed by integrating fluxes in wavelength bins of different sizes, ranging between 3.5 and 20 nm. Although the data are of excellent quality, the wavelength coverage and the precision of the transmission spectrum are not sufficient to neither rule out or to favor classic atmospheric models. Nonetheless, simple statistical analysis favors the clear atmosphere scenario. A larger wavelength coverage or space-based data is required to characterize the constituents of Qatar-1b's atmosphere and to compare it to the well known HD 189733b. On top of the similarities of the orbital and physical parameters of both exoplanets, from a long Hα photometric follow-up of Qatar-1, presented in this work, we find Qatar-1 to be as active as HD 189733. The white light curve

  16. Book review: The success of policy analysis studies: an actor perspective, a search for success definitions based on cases in the field of transport and infrastructure in The Netherlands / by Patricia G.J. Twaalfhoven. - Eburon, Delft, 1999

    NARCIS (Netherlands)

    Klok, Pieter J.

    2001-01-01

    This doctoral dissertation is an attempt to formulate a theory on how different actors define the success of a policy analysis study and on the factors that underlie the various definitions of success. The choice for an actor perspective is motivated by the fact that many actors play different roles

  17. Personal attributes of authors and reviewers, social bias and the outcomes of peer review: a case study [v2; ref status: indexed, http://f1000r.es/5gj

    Directory of Open Access Journals (Sweden)

    Richard Walker

    2015-06-01

    Full Text Available Peer review is the "gold standard" for evaluating journal and conference papers, research proposals, on-going projects and university departments. However, it is widely believed that current systems are expensive, conservative and prone to various forms of bias. One form of bias identified in the literature is “social bias” linked to the personal attributes of authors and reviewers. To quantify the importance of this form of bias in modern peer review, we analyze three datasets providing information on the attributes of authors and reviewers and review outcomes: one from Frontiers - an open access publishing house with a novel interactive review process, and two from Spanish and international computer science conferences, which use traditional peer review. We use a random intercept model in which review outcome is the dependent variable, author and reviewer attributes are the independent variables and bias is defined by the interaction between author and reviewer attributes. We find no evidence of bias in terms of gender, or the language or prestige of author and reviewer institutions in any of the three datasets, but some weak evidence of regional bias in all three. Reviewer gender and the language and prestige of reviewer institutions appear to have little effect on review outcomes, but author gender, and the characteristics of author institutions have moderate to large effects. The methodology used cannot determine whether these are due to objective differences in scientific merit or entrenched biases shared by all reviewers.

  18. Planetary populations in the mass-period diagram: A statistical treatment of exoplanet formation and the role of planet traps

    Energy Technology Data Exchange (ETDEWEB)

    Hasegawa, Yasuhiro [Currently EACOA Fellow at Institute of Astronomy and Astrophysics, Academia Sinica (ASIAA), Taipei 10641, Taiwan. (China); Pudritz, Ralph E., E-mail: yasu@asiaa.sinica.edu.tw, E-mail: pudritz@physics.mcmaster.ca [Also at Origins Institute, McMaster University, Hamilton, ON L8S 4M1, Canada. (Canada)

    2013-11-20

    The rapid growth of observed exoplanets has revealed the existence of several distinct planetary populations in the mass-period diagram. Two of the most surprising are (1) the concentration of gas giants around 1 AU and (2) the accumulation of a large number of low-mass planets with tight orbits, also known as super-Earths and hot Neptunes. We have recently shown that protoplanetary disks have multiple planet traps that are characterized by orbital radii in the disks and halt rapid type I planetary migration. By coupling planet traps with the standard core accretion scenario, we showed that one can account for the positions of planets in the mass-period diagram. In this paper, we demonstrate quantitatively that most gas giants formed at planet traps tend to end up around 1 AU, with most of these being contributed by dead zones and ice lines. We also show that a large fraction of super-Earths and hot Neptunes are formed as 'failed' cores of gas giants—this population being constituted by comparable contributions from dead zone and heat transition traps. Our results are based on the evolution of forming planets in an ensemble of disks where we vary only the lifetimes of disks and their mass accretion rates onto the host star. We show that a statistical treatment of the evolution of a large population of planetary cores caught in planet traps accounts for the existence of three distinct exoplanetary populations—the hot Jupiters, the more massive planets around r = 1 AU, and the short-period super-Earths and hot Neptunes. There are very few populations that feed into the large orbital radii characteristic of the imaged Jovian planet, which agrees with recent surveys. Finally, we find that low-mass planets in tight orbits become the dominant planetary population for low-mass stars (M {sub *} ≤ 0.7 M {sub ☉}).

  19. Planetary populations in the mass-period diagram: A statistical treatment of exoplanet formation and the role of planet traps

    International Nuclear Information System (INIS)

    Hasegawa, Yasuhiro; Pudritz, Ralph E.

    2013-01-01

    The rapid growth of observed exoplanets has revealed the existence of several distinct planetary populations in the mass-period diagram. Two of the most surprising are (1) the concentration of gas giants around 1 AU and (2) the accumulation of a large number of low-mass planets with tight orbits, also known as super-Earths and hot Neptunes. We have recently shown that protoplanetary disks have multiple planet traps that are characterized by orbital radii in the disks and halt rapid type I planetary migration. By coupling planet traps with the standard core accretion scenario, we showed that one can account for the positions of planets in the mass-period diagram. In this paper, we demonstrate quantitatively that most gas giants formed at planet traps tend to end up around 1 AU, with most of these being contributed by dead zones and ice lines. We also show that a large fraction of super-Earths and hot Neptunes are formed as 'failed' cores of gas giants—this population being constituted by comparable contributions from dead zone and heat transition traps. Our results are based on the evolution of forming planets in an ensemble of disks where we vary only the lifetimes of disks and their mass accretion rates onto the host star. We show that a statistical treatment of the evolution of a large population of planetary cores caught in planet traps accounts for the existence of three distinct exoplanetary populations—the hot Jupiters, the more massive planets around r = 1 AU, and the short-period super-Earths and hot Neptunes. There are very few populations that feed into the large orbital radii characteristic of the imaged Jovian planet, which agrees with recent surveys. Finally, we find that low-mass planets in tight orbits become the dominant planetary population for low-mass stars (M * ≤ 0.7 M ☉ ).

  20. MIGRATION THEN ASSEMBLY: FORMATION OF NEPTUNE-MASS PLANETS INSIDE 1 AU

    International Nuclear Information System (INIS)

    Hansen, Brad M. S.; Murray, Norm

    2012-01-01

    We demonstrate that the observed distribution of 'hot Neptune'/'super-Earth' systems is well reproduced by a model in which planet assembly occurs in situ, with no significant migration post-assembly. This is achieved only if the amount of mass in rocky material is ∼50-100 M ⊕ interior to 1 AU. Such a reservoir of material implies that significant radial migration of solid material takes place, and that it occurs before the stage of final planet assembly. The model not only reproduces the general distribution of mass versus period but also the detailed statistics of multiple planet systems in the sample. We furthermore demonstrate that cores of this size are also likely to meet the criterion to gravitationally capture gas from the nebula, although accretion is rapidly limited by the opening of gaps in the gas disk. If the mass growth is limited by this tidal truncation, then the scenario sketched here naturally produces Neptune-mass objects with substantial components of both rock and gas, as is observed. The quantitative expectations of this scenario are that most planets in the 'hot Neptune/super-Earth' class inhabit multiple-planet systems, with characteristic orbital spacings. The model also provides a natural division into gas-rich (hot Neptune) and gas-poor (super-Earth) classes at fixed period. The dividing mass ranges from ∼3 M ⊕ at 10 day orbital periods to ∼10 M ⊕ at 100 day orbital periods. For orbital periods <10 days, the division is less clear because a gas atmosphere may be significantly eroded by stellar radiation.

  1. MIGRATION THEN ASSEMBLY: FORMATION OF NEPTUNE-MASS PLANETS INSIDE 1 AU

    Energy Technology Data Exchange (ETDEWEB)

    Hansen, Brad M. S. [Department of Physics and Astronomy and Institute of Geophysics and Planetary Physics, University of California Los Angeles, Los Angeles, CA 90095 (United States); Murray, Norm, E-mail: hansen@astro.ucla.edu [Canadian Institute for Theoretical Astrophysics, 60 St. George Street, Toronto, Ontario (Canada)

    2012-06-01

    We demonstrate that the observed distribution of 'hot Neptune'/'super-Earth' systems is well reproduced by a model in which planet assembly occurs in situ, with no significant migration post-assembly. This is achieved only if the amount of mass in rocky material is {approx}50-100 M{sub Circled-Plus} interior to 1 AU. Such a reservoir of material implies that significant radial migration of solid material takes place, and that it occurs before the stage of final planet assembly. The model not only reproduces the general distribution of mass versus period but also the detailed statistics of multiple planet systems in the sample. We furthermore demonstrate that cores of this size are also likely to meet the criterion to gravitationally capture gas from the nebula, although accretion is rapidly limited by the opening of gaps in the gas disk. If the mass growth is limited by this tidal truncation, then the scenario sketched here naturally produces Neptune-mass objects with substantial components of both rock and gas, as is observed. The quantitative expectations of this scenario are that most planets in the 'hot Neptune/super-Earth' class inhabit multiple-planet systems, with characteristic orbital spacings. The model also provides a natural division into gas-rich (hot Neptune) and gas-poor (super-Earth) classes at fixed period. The dividing mass ranges from {approx}3 M{sub Circled-Plus} at 10 day orbital periods to {approx}10 M{sub Circled-Plus} at 100 day orbital periods. For orbital periods <10 days, the division is less clear because a gas atmosphere may be significantly eroded by stellar radiation.

  2. Survival of a planet in short-period Neptunian desert under effect of photoevaporation

    Science.gov (United States)

    Ionov, Dmitry E.; Pavlyuchenkov, Yaroslav N.; Shematovich, Valery I.

    2018-06-01

    Despite the identification of a great number of Jupiter-like and Earth-like planets at close-in orbits, the number of `hot Neptunes' - the planets with 0.6-18 times of Neptune mass and orbital periods less than 3 d - turned out to be very small. The corresponding region in the mass-period distribution was assigned as the `short-period Neptunian desert'. The common explanation of this fact is that the gaseous planet with few Neptune masses would not survive in the vicinity of host star due to intensive atmosphere outflow induced by heating from stellar radiation. To check this hypothesis, we performed numerical simulations of atmosphere dynamics for a hot Neptune. We adopt the previously developed self-consistent 1D model of hydrogen-helium atmosphere with suprathermal electrons accounted. The mass-loss rates as a function of orbital distances and stellar ages are presented. We conclude that the desert of short-period Neptunes could not be entirely explained by evaporation of planet atmosphere caused by the radiation from a host star. For the less massive Neptune-like planet, the estimated upper limits of the mass-loss may be consistent with the photoevaporation scenario, while the heavier Neptune-like planets could not lose the significant mass through this mechanism. We also found the significant differences between our numerical results and widely used approximate estimates of the mass-loss.

  3. Pre-treatment technologies, and their effect on international bioenergy supply chain logistics. Techno-economic evaluation of torrefaction, fast pyrolysis and pelletisation

    International Nuclear Information System (INIS)

    Uslu, Ayla; Faaij, Andre P.C.; Bergman, P.C.A.

    2008-01-01

    The pre-treatment step has a significant influence on the performance of bioenergy chains, especially on logistics. Torrefaction, pelletisation and pyrolysis technologies can convert biomass at modest scales into dense energy carriers that ease transportation and handling. Torrefaction is a very promising technology due to its high process efficiency (94%) compared to pelletisation (84%) and pyrolysis (64%). When torrefaction is combined with pelletisation, the product (TOP) energy content is as high as 20.4-22.7 GJ/ton. The primary energy requirement for TOP delivery from Latin America to Rotterdam harbour can be as low as 0.05 GJ/GJ, in contrast to 0.12 GJ/GJ for pellets and 0.08 GJ/GJ HHV for pyrolysis oil. TOP can be delivered to Europe at over 74 EUR/ton (3.3 EUR/GJ) and electricity could be produced as cheap as 4.4 EURcent/kWh e from an existing co-firing plant. Fisher Tropisch fuel costs 6 EUR/GJ HHV for TOP, 7 EUR/GJ for conventional pellets and 9.5 EUR/GJ HHV for pyrolysis oil. Consequently, fuel production from TOP and conventional pellets is comparable to the current gasoline production cost ranging from 3 to 7 EUR/GJ HHV and diesel from 2 to 7 EUR/GJ HHV , depending on the oil market. Thus, well designed supply chains make international trade of biomass feasible from energy efficiency and economic perspective. (author)

  4. Origin of three Red-crowned Cranes Grus japonensis found in northeast Honshu and west Hokkaido, Japan, from 2008 to 2012.

    Science.gov (United States)

    Miura, Yoshiaki; Shiraishi, Junya; Shiomi, Akira; Kitazawa, Takio; Hiraga, Takeo; Matsumoto, Fumio; Teraoka, Hiroki; Masatomi, Hiroyuki

    2013-01-01

    The Red-crowned Crane Grus japonensis is an endangered species that has two separate breeding populations, one in the Amur River basin and the other in north and east Hokkaido, Japan. So far, only two (Gj1 and Gj2) and seven (Gj3-Gj9) haplotypes in D-loop of mtDNA were identified in Japan and in the continent, respectively. We obtained feathers from three cranes found in northeast Honshu. The crane in Akita in 2008, which also arrived at west Hokkaido, had a novel haplotype (Gj10). Another crane in Akita in 2009 showed a heteroplasmy (Gj7 and a novel type, Gj12). The third crane in Miyagi in 2010 also showed another type, Gj11. These results suggest that three Red-crowned Cranes appeared in Honshu and west Hokkaido were from the continent.

  5. Kepler constraints on planets near hot Jupiters

    Science.gov (United States)

    Steffen, Jason H.; Ragozzine, Darin; Fabrycky, Daniel C.; Carter, Joshua A.; Ford, Eric B.; Holman, Matthew J.; Rowe, Jason F.; Welsh, William F.; Borucki, William J.; Boss, Alan P.; Ciardi, David R.; Quinn, Samuel N.

    2012-01-01

    We present the results of a search for planetary companions orbiting near hot Jupiter planet candidates (Jupiter-size candidates with orbital periods near 3 d) identified in the Kepler data through its sixth quarter of science operations. Special emphasis is given to companions between the 2∶1 interior and exterior mean-motion resonances. A photometric transit search excludes companions with sizes ranging from roughly two-thirds to five times the size of the Earth, depending upon the noise properties of the target star. A search for dynamically induced deviations from a constant period (transit timing variations) also shows no significant signals. In contrast, comparison studies of warm Jupiters (with slightly larger orbits) and hot Neptune-size candidates do exhibit signatures of additional companions with these same tests. These differences between hot Jupiters and other planetary systems denote a distinctly different formation or dynamical history. PMID:22566651

  6. Kepler constraints on planets near hot Jupiters.

    Science.gov (United States)

    Steffen, Jason H; Ragozzine, Darin; Fabrycky, Daniel C; Carter, Joshua A; Ford, Eric B; Holman, Matthew J; Rowe, Jason F; Welsh, William F; Borucki, William J; Boss, Alan P; Ciardi, David R; Quinn, Samuel N

    2012-05-22

    We present the results of a search for planetary companions orbiting near hot Jupiter planet candidates (Jupiter-size candidates with orbital periods near 3 d) identified in the Kepler data through its sixth quarter of science operations. Special emphasis is given to companions between the 21 interior and exterior mean-motion resonances. A photometric transit search excludes companions with sizes ranging from roughly two-thirds to five times the size of the Earth, depending upon the noise properties of the target star. A search for dynamically induced deviations from a constant period (transit timing variations) also shows no significant signals. In contrast, comparison studies of warm Jupiters (with slightly larger orbits) and hot Neptune-size candidates do exhibit signatures of additional companions with these same tests. These differences between hot Jupiters and other planetary systems denote a distinctly different formation or dynamical history.

  7. Exoplanet Characterization With Spitzer Eclipses

    Science.gov (United States)

    Harrington, Joseph

    We will analyze our existing Spitzer eclipse data for 11 exoplanets (GJ 436b, WASP-8b, WASP-29b, WASP-11b, TrES-1, WASP-34b, WASP-43b, HD 209458b, HAT-P-30b, HAT-P-13b, and WASP-12b) along with all other Spitzer eclipse and transit data for these systems (723 hours of total data). In combination with transit results, these measurements reveal the surface fluxes emitted by the planets' atmospheres in the six Spitzer bandpasses (3.6, 4.5, 5.8, 8.0, 16, and 24 1-4m), as well as orbital eccentricity and in a few cases possibly even precession rate. The fluxes, in turn, can constrain atmospheric composition and thermal profiles. We propose here to analyze data for these planets using Monte Carlo-driven, radiative-transfer, model-fitting codes; to conduct aggregate analyses; and to develop and share statistical modeling tools. Secondary eclipses provide us with a unique way to characterize exoplanetary atmospheres. Since other techniques like spectroscopy divide the planetary signal into many channels, they require very high signal-to-noise ratio (S/N) and are only possible for a few planets. Broadband eclipse photometry is thus the only technique that can measure dozens of atmospheres and identify the mechanisms that cause planets at a given irradiation level to behave so differently from one another. Until JWST becomes available, the broad variety of Spitzer data that we already have in hand, along with observations from the Hubble Space Telescope and possibly SOFIA, are our best way to understand the wide diversity of exoplanetary atmospheres. Since 2010, the team has produced six papers from a new, highly modular pipeline that implements optimal methods for analysis of Spitzer photometric time series, and our efficiency is increasing. The sensitivity needed for these measurements is up to 100 times better than Spitzer's design criteria, so careful treatment of systematic error is critically important and first-order approximations rarely work. The new pipeline

  8. CCS. Coal's biggest challenge

    Energy Technology Data Exchange (ETDEWEB)

    Zheng, Ligang [CanmentENERGY, Ottawa, ON (Canada)

    2013-07-01

    Coal, next to oil, is the second most important energy source due to wide distribution and large quantity. Coal is a very economical fuel about $0.50/GJ-$2.50/GJ (NG usually is $6/GJ-$12/GJ. Currently it is $4.03/GJ for July, 2011 delivery). It is the largest fuel source for power generation: 40% world electricity is generated by coal; its shares are about 80% in China and 50% in the U.S. An extensive coal based energy infrastructure has been built up over the years and is in good service.

  9. „Tenke det, ønske det, ville det med – men gjøre det! ...”. Opposisjonsinnlegg ved Steen Buscks disputatsforsvar ved Aarhus Universitet 25. november 2011 med avhandlingen Et landbosamfund i opbrud. Sundby Mors 1660-1800, 2011.

    Directory of Open Access Journals (Sweden)

    Finn-Einar Eliassen

    2012-05-01

    Full Text Available English summary Steen Busck’s doctoral dissertation, Et landbosamfund i opbrud (A Rural Community Breaking etc., is a detailed and  well-documented study of the parish of Sundby Mors in Northern Jutland in the period 1660-1800. The author analyses all aspects of this small, rural community of some 200 inhabitants in the late eighteenth century – landscape, demography, social structure, economy, administration, culture and mentality, drawing on his wide knowledge and reading, as well as nearly all available sources in public archives, to produce a very solid local history of Sundby Mors in two volumes, with nearly 1200 pages. It is a monumental work, in more than one sense. According to Busck himself, the study should be a total history, local history, microhistory and a case study of an early modern agricultural community. Although overlapping to a certain extent, these labels point in different directions, but the author does not make an effort to distinguish between them. Claiming that his purpose is to find ”typical” elements in a local society which he claims is unique, and using methods which are not comparative or synthetic, but rather descriptive and individualistic, he gets into difficulties when he tries to draw general conclusions. Steen Busck’s main question is whether the parish of Sundby Mors underwent any "modernisation” dusring the studied period. However, his definitions of a "traditional” and a "modern” society represent extreme models, which would be hard to find in the real world, and so he concludes that Sundby Mors failed to modernise, although he finds changes and developments in many different fields, which seem to warrant a more nuanced conclusion. Also, his sources, which are mainly official records, are heavily weighted in favour of traditional agriculture and resident population, more likely to show stabilty than change.  And although Steen Busck draws on other local studies in  analysing the different aspects of the local society and economy, he does not attempt any general comparisons, which might indicate whether Sundby Mors was more or less ”modern” than other contemporary local societies, in Denmark or elsewhere. Admittedly, Busck faces "the pioneer’s dilemma”: the more original the study, the more unique it is, the less scope for comparisons. At present, and probably also in the future, Steen Busck’s monumental study stands alone in its thoroughness and totality. And ”the taste is the proof of the pudding”. Notwithstanding the critical comments presented above, Steen Busck has written a very solid, many-facetted, interesting and readable local history of a rural parish under absolutism, demonstrating, more than anything, the growth of the state’s power in a local community. Future historians will appreciate, use and refer to his study with respect and admiration.

  10. „Tenke det, ønske det, ville det med – men gjøre det! ...”. Opposisjonsinnlegg ved Steen Buscks disputatsforsvar ved Aarhus Universitet 25. november 2011 med avhandlingen Et landbosamfund i opbrud. Sundby Mors 1660-1800, 2011.

    Directory of Open Access Journals (Sweden)

    Finn-Einar Eliassen

    2012-05-01

    Full Text Available English summarySteen Busck’s doctoral dissertation, Et landbosamfund i opbrud (A Rural Community Breaking etc., is a detailed and  well-documented study of the parish of Sundby Mors in Northern Jutland in the period 1660-1800. The author analyses all aspects of this small, rural community of some 200 inhabitants in the late eighteenth century – landscape, demography, social structure, economy, administration, culture and mentality, drawing on his wide knowledge and reading, as well as nearly all available sources in public archives, to produce a very solid local history of Sundby Mors in two volumes, with nearly 1200 pages. It is a monumental work, in more than one sense. According to Busck himself, the study should be a total history, local history, microhistory and a case study of an early modern agricultural community. Although overlapping to a certain extent, these labels point in different directions, but the author does not make an effort to distinguish between them. Claiming that his purpose is to find ”typical” elements in a local society which he claims is unique, and using methods which are not comparative or synthetic, but rather descriptive and individualistic, he gets into difficulties when he tries to draw general conclusions.Steen Busck’s main question is whether the parish of Sundby Mors underwent any "modernisation” dusring the studied period. However, his definitions of a "traditional” and a "modern” society represent extreme models, which would be hard to find in the real world, and so he concludes that Sundby Mors failed to modernise, although he finds changes and developments in many different fields, which seem to warrant a more nuanced conclusion. Also, his sources, which are mainly official records, are heavily weighted in favour of traditional agriculture and resident population, more likely to show stabilty than change.  And although Steen Busck draws on other local studies in  analysing the different aspects of the local society and economy, he does not attempt any general comparisons, which might indicate whether Sundby Mors was more or less ”modern” than other contemporary local societies, in Denmark or elsewhere. Admittedly, Busck faces "the pioneer’s dilemma”: the more original the study, the more unique it is, the less scope for comparisons. At present, and probably also in the future, Steen Busck’s monumental study stands alone in its thoroughness and totality.And ”the taste is the proof of the pudding”. Notwithstanding the critical comments presented above, Steen Busck has written a very solid, many-facetted, interesting and readable local history of a rural parish under absolutism, demonstrating, more than anything, the growth of the state’s power in a local community. Future historians will appreciate, use and refer to his study with respect and admiration.

  11. Biomass and energy dynamics in a tribal village ecosystem of Orissa, India

    International Nuclear Information System (INIS)

    Nayak, S.P.; Nisanka, S.K.; Misra, M.K.

    1993-01-01

    Biomass energy production and consumption patterns were investigated in Bhogibandha, a small tribal village ecosystem in the Eastern Ghats of India. The land area was 116.7 ha with 0.18 forest area per capita. Human population was 76 in 21 families. The livestock population in the village was low. Annual crop yield was 19.1 t on 13.9 ha of land. Annual collection of minor forest produce was 9.74 t. Annual energy consumption in terms of food was 278.4 GJ, fodder 929.6 GJ, liquor 20.9 GJ and fuelwood 636.5 GJ (excluding camp fire). Energy expenditure for agricultural, domestic and other daily activities in the village ecosystems was 122 GJ by human and 124 GJ by draught animals. The energy-flow pattern in the ecosystem shows annual production of 2062 GJ, consumption of 1917 GJ, out-flow (export) of 97 GJ and in-flow (import) of 235 GJ. Based on the energy-flow and large dependence on forest and forest products (mainly firewood for sale along with minor products), the village Bhogibanda was concluded to be an open, forest-dependent based village ecosystem. An energy-flow model was developed for the village ecosystem. (Author)

  12. A biomass energy flow chart for Kenya

    International Nuclear Information System (INIS)

    Senelwa, K.A.; Hall, D.O.

    1993-01-01

    Terrestrial (above ground) biomass production and its utilization in Kenya was analyzed for the 1980s. Total biomass energy production was estimated at 2574 x 10 6 GJ per year, most of which (86.7%) is produced on land classified as agricultural. Of the total production, agriculture and forrestry operations resulted in the harvesting of 1138 x 10 6 GJ (44.2% of total production), half of which (602 x 10 6 GJ) was harvested for use as fuel. Only 80 x 10 6 GJ was harvested for food and 63 x 10 6 GJ for industrial (agricultural and forestry) plus other miscellaneous purposes. About 85% of Kenya's energy is from biomass, with a per capita consumption of 18.6 GJ (0.44 toe, tonne oil equivalent) compared to less than 0.1 toe of commercial energy. Use of the biomass resource was found to be extensive involving bulk harvesting but with low utilization efficiencies; as a result the overall losses were quite high. Only 534 x 10 6 GJ (46.9% of harvested biomass) was useful energy. 480 x 10 6 GJ was left unused, as residues and dung, all which was either burnt or left to decompose in the fields. 124 x 10 6 GJ was lost during charcoal manufacture. Intensified use of the harvested biomass at higher efficiencies in order to minimize wastes would decrease the stress on the biomass resource base. (Author)

  13. Gigantic Jet Environments: A Meteorological Evaluation Using Reanalysis Data Sets

    Science.gov (United States)

    Splitt, M. E.; Lazarus, S. M.

    2017-12-01

    The meteorological conditions of gigantic jet (GJ) producing thunderstorms tend to be connected to maritime tropical environments. In particular, they have an affinity toward tropical disturbances including those with moderate values of upper tropospheric environmental wind shear. Wind shear related effects (including turbulence) in association with deep convection in these environments have been proposed as mechanisms for the arrangement of GJ favorable charge structures. This study focuses on a climatological evaluation in an effort to assess whether the proposed ingredients are consistent with observed GJ event regions. The Climate System Forecast System - Version 2 (CFSR V2) is used here to test for the proposed GJ conditions.

  14. Autism spectrum disorder - Asperger syndrome

    Science.gov (United States)

    ... part of the larger developmental disorder category of autism spectrum disorder . ... American Psychiatric Association. Autism spectrum disorder. ... VA: American Psychiatric Publishing: 2013;50-59. Raviola GJ, ...

  15. Autism spectrum disorder - childhood disintegrative disorder

    Science.gov (United States)

    ... part of the larger developmental disorder category of autism spectrum disorder . ... American Psychiatric Association. Autism spectrum disorder. ... VA: American Psychiatric Publishing: 2013;50-59. Raviola GJ, ...

  16. The use of TiO2 nanoparticles to reduce refrigerator ir-reversibility

    International Nuclear Information System (INIS)

    Padmanabhan, Venkataramana Murthy V.; Palanisamy, Senthilkumar

    2012-01-01

    Highlights: ► COP of hydrocarbons mixture VCRSs increases less when compared to R134a. ► Compressor ir-reversibility of VCRSs decreases by 33% (R134a), 14% (R436A and R436B). ► Total ir-reversibility of selected VCRSs decreases. ► Exergy efficiency of R134a is exceptionally low at lower reference temperature. ► Exergy efficiency of selected VCRSs increases. - Abstract: The ir-reversibility at the process of a vapour-compression refrigeration system (VCRS) with nanoparticles in the working fluid was investigated experimentally. Mineral oil (MO) with 0.1 g L −1 TiO 2 nanoparticles mixture were used as the lubricant instead of Polyol-ester (POE) oil in the R134a, R436A (R290/R600a-56/44-wt.%) and R436B (R290/R600a-52/48-wt.%)VCRSs. The VCRS ir-reversibility at the process with the nanoparticles was investigated using second law of thermodynamics. The results indicate that R134a, R436A and R436B and MO with TiO 2 nanoparticles work normally and safely in the VCRS. The VCRSs total ir-reversibility (529, 588 and 570 W) at different process was better than the R134a, R436A and R436B and POE oil system (777, 697 and 683 W). The same tests with Al 2 O 3 nanoparticles showed that the different nanoparticles properties have little effect on the VCRS ir-reversibility. Thus, TiO 2 nanoparticles can be used in VCRS with reciprocating compressor to considerably reduce ir-reversibility at the process.

  17. Rapid Antidepressant Activity of Ethanol Extract of Gardenia jasminoides Ellis Is Associated with Upregulation of BDNF Expression in the Hippocampus

    Directory of Open Access Journals (Sweden)

    Hailou Zhang

    2015-01-01

    Full Text Available Ethanol extract of Yueju pill, a Traditional Chinese Medicine herbal formula widely used to treat mood disorders, demonstrates rapid antidepressant effects similar to ketamine, likely via instant enhancement of brain-derived neurotrophic factor (BDNF expression in the hippocampus. Here we investigated ethanol extracts of the constituent herbs of Yueju responsible for rapid antidepressant effects. Screening with tail suspension test in Kunming mice at 24 hours after a single administration of five individual constituent herbs of Yueju, we found that only Gardenia jasminoides Ellis (GJ showed a significant effect. The antidepressant response started at 2 hours after GJ administration. Similar to Yueju and ketamine, a single administration of GJ significantly reduced the number of escape failures in the learned helplessness test. Furthermore, GJ decreased latency of food consumption in the novelty suppressed-feeding test. Additionally, starting from 2 hours and continuing for over 20 hours after GJ administration, BDNF expression in the hippocampus was upregulated, temporally linked with the antidepressant response. These findings suggest that GJ has rapid antidepressant effects, which are associated with the elevated expression of BDNF in the hippocampus. In Yueju formula, Yue represents GJ, as thus our study demonstrates the primary role of GJ in rapid antidepressant efficacy of Yueju.

  18. Dynamic trafficking and delivery of connexons to the plasma membrane and accretion to gap junctions in living cells

    NARCIS (Netherlands)

    Lauf, Undine; Giepmans, Ben N G; Lopez, Patricia; Braconnot, Sebastien; Chen, Shu-Chih; Falk, Matthias M

    2002-01-01

    Certain membrane channels including acetylcholine receptors, gap junction (GJ) channels, and aquaporins arrange into large clusters in the plasma membrane (PM). However, how these channels are recruited to the clusters is unknown. To address this question, we have investigated delivery of GJ channel

  19. The energy efficiency of oil sands extraction: Energy return ratios from 1970 to 2010

    International Nuclear Information System (INIS)

    Brandt, Adam R.; Englander, Jacob; Bharadwaj, Sharad

    2013-01-01

    It has been argued that the oil sands industry is not energy efficient: comparatively large energy inputs are required per unit of energy output from oil sands operations. Unfortunately, quantitative work to date in this area has suffered from poor data availability and uncertain methods. We apply a new methodology and new dataset to compute ERRs (energy return ratios) for the oil sands industry. We collected monthly oil sands energy consumption and output data from 1970 to 2010. Current oil sands operations have mine mouth NERs (net energy returns) of about 6 GJ output per GJ of energy consumed and point of use energy returns of about 3 GJ/GJ. Long-term trends show oil sands operations becoming significantly more efficient: point of use NER increased from about 1 GJ/GJ in 1970 to 3 GJ/GJ in 2010. These energy returns are lower than those observed in historical conventional oil operations, but low energy returns are not likely to hinder development of oil sands operations due to the large resource in place and the ability for largely self-fueled pathways to return significant amounts of energy to society for every unit of external energy supplied. - Highlights: • Oil sands operations have become significantly more energy efficient over the history of the industry. • Oil sands production is largely fueled with energy from the bitumen resource itself, making external energy returns high. • Oil sands production is still significantly less efficient than conventional oil production

  20. A Gigantic Jet Observed Over an Mesoscale Convective System in Midlatitude Region

    Science.gov (United States)

    Yang, Jing; Sato, Mitsuteru; Liu, Ningyu; Lu, Gaopeng; Wang, Yu; Wang, Zhichao

    2018-01-01

    Gigantic jets (GJs) are mostly observed over summer tropical or tropical-like thunderstorms. This study reports observation of a GJ over a mesoscale convective system (MCS) in the midlatitude region in eastern China. The GJ is observed over a relatively weak radar reflectivity region ahead of the leading line, and the maximum radar echo top along the GJ azimuth was lower than the tropopause in the same region, significantly different from past studies that indicate summer GJs are usually associated with convective surges or overshooting tops. Also different from most of previous observations showing GJ-producing summer thunderstorms only produced GJ type of transient luminous events during their life cycles, two sprites were also captured in a time window of 15 min containing the GJ, indicating that the MCS provides favorable conditions not only for the GJ but also for the sprites. The balloon-borne soundings of the MCS show that there were large wind shears in the middle and upper levels of the thundercloud, which may have played important roles for the GJ production.

  1. Assessment of a novel alder biorefinery concept to meet demands of economics feasibility, energy production and long term environmental sustainability

    DEFF Research Database (Denmark)

    Thomsen, Tobias; Ahrenfeldt, Jesper; Thomsen, Sune Tjalfe

    2012-01-01

    system Energy Return on energy Invested 4.4, total system Exergy Return on exergy Invested 3.5, Net Energy Output 78 GJ/ha/year, Net Exergy Output 50 GJ/ha/year, Net carbon sequestration 0.8 ton CO2-eq/ha/year, Total product value 2030 euro/ha/year and Net Dry Matter Removal 90%....

  2. First report on Aonchotheca annulosa Dujardin, 1845 (Nematoda, Capillariidae) in a Hamadryas baboon (Papio hamadryas) from a zoo in northern Turkey

    Czech Academy of Sciences Publication Activity Database

    Umur, S.; Moravec, František; Gurler, A.; Bolukbas, C.; Acici, M.

    2012-01-01

    Roč. 41, č. 6 (2012), s. 384-387 ISSN 0047-2565 Institutional support: RVO:60077344 Keywords : Aonchotheca annulosa * baboon * Capillariidae * Turkey * zoo Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine; GJ - Animal Vermins ; Diseases, Veterinary Medicine (BC-A) Impact factor: 1.106, year: 2012 http://onlinelibrary.wiley.com/doi/10.1111/jmp.12020/abstract

  3. Factors influencing the price of greasy fleece wool in South Africa ...

    African Journals Online (AJOL)

    Factors influencing the price of greasy fleece wool in South Africa. G.J. Erasmus, G.J. Delport. Abstract. No Abstract. Full Text: EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT · AJOL African Journals Online. HOW TO USE AJOL... for Researchers · for Librarians ...

  4. Presence of inbreeding during a selection experiment with Merino ...

    African Journals Online (AJOL)

    Presence of inbreeding during a selection experiment with Merino sheep. GJ Erasmus, AO de Lange, GJ Delport, JJ Olivier. Abstract. No Abstract. Full Text: EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT · AJOL African Journals Online. HOW TO USE AJOL.

  5. Laparoscopic gastrojejunostomy versus duodenal stenting in unresectable gastric cancer with gastric outlet obstruction.

    Science.gov (United States)

    Min, Sa-Hong; Son, Sang-Yong; Jung, Do-Hyun; Lee, Chang-Min; Ahn, Sang-Hoon; Park, Do Joong; Kim, Hyung-Ho

    2017-09-01

    To compare the outcome between laparoscopic gastrojejunostomy (LapGJ) and duodenal stenting (DS) in terms of oral intake, nutritional status, patency duration, effect on chemotherapy and survival. Medical records of 115 patients, who had LapGJ or duodenal stent placement between July 2005 and September 2015 in Seoul National University Bundang Hospital, have been reviewed retrospectively. Oral intake was measured with Gastric Outlet Obstruction Scoring System. Serum albumin and body weight was measured as indicators of nutritional status. The duration of patency was measured until the date of reintervention. Chemotherapy effect was calculated after the procedures. Survival period and oral intake was analyzed by propensity score matching age, sex, T-stage, comorbidities, and chemotherapy status. Forty-three LapGJ patients and 58 DS patients were enrolled. Improvement in oral intake was shown in LapGJ group versus DS group (88% vs. 59%, P = 0.011). Serum albumin showed slight but significant increase after LapGJ (+0.75 mg/dL vs. -0.15 mg/dL, P = 0.002); however, there was no difference in their body weight (+5.1 kg vs. -1.0 kg, P = 0.670). Patients tolerated chemotherapy longer without dosage reduction after LapGJ (243 days vs . 74 days, P = 0.006) and maintained the entire chemotherapy regimen after the procedure longer in LapGJ group (247 days vs. 137 days, P = 0.042). LapGJ showed significantly longer survival than DS (220 vs. 114 days, P = 0.004). DS can provide faster symptom relief but LapGJ can provide improved oral intake, better compliance to chemotherapy, and longer survival. Therefore, LapGJ should be the first choice in gastric outlet obstruction patients for long-term and better quality of life.

  6. An extrasolar planetary system with three Neptune-mass planets.

    Science.gov (United States)

    Lovis, Christophe; Mayor, Michel; Pepe, Francesco; Alibert, Yann; Benz, Willy; Bouchy, François; Correia, Alexandre C M; Laskar, Jacques; Mordasini, Christoph; Queloz, Didier; Santos, Nuno C; Udry, Stéphane; Bertaux, Jean-Loup; Sivan, Jean-Pierre

    2006-05-18

    Over the past two years, the search for low-mass extrasolar planets has led to the detection of seven so-called 'hot Neptunes' or 'super-Earths' around Sun-like stars. These planets have masses 5-20 times larger than the Earth and are mainly found on close-in orbits with periods of 2-15 days. Here we report a system of three Neptune-mass planets with periods of 8.67, 31.6 and 197 days, orbiting the nearby star HD 69830. This star was already known to show an infrared excess possibly caused by an asteroid belt within 1 au (the Sun-Earth distance). Simulations show that the system is in a dynamically stable configuration. Theoretical calculations favour a mainly rocky composition for both inner planets, while the outer planet probably has a significant gaseous envelope surrounding its rocky/icy core; the outer planet orbits within the habitable zone of this star.

  7. TWO EXOPLANETS DISCOVERED AT KECK OBSERVATORY

    International Nuclear Information System (INIS)

    Valenti, Jeff A.; Fischer, Debra; Giguere, Matt; Isaacson, Howard; Marcy, Geoffrey W.; Howard, Andrew W.; Johnson, John A.; Henry, Gregory W.; Wright, Jason T.

    2009-01-01

    We present two exoplanets detected at Keck Observatory. HD 179079 is a G5 subgiant that hosts a hot Neptune planet with M sin i = 27.5 M + in a 14.48 days, low-eccentricity orbit. The stellar reflex velocity induced by this planet has a semiamplitude of K = 6.6 m s -1 . HD 73534 is a G5 subgiant with a Jupiter-like planet of M sin i = 1.1 M Jup and K = 16 m s -1 in a nearly circular 4.85 yr orbit. Both stars are chromospherically inactive and metal-rich. We discuss a known, classical bias in measuring eccentricities for orbits with velocity semiamplitudes, K, comparable to the radial velocity uncertainties. For exoplanets with periods longer than 10 days, the observed exoplanet eccentricity distribution is nearly flat for large amplitude systems (K > 80 m s -1 ), but rises linearly toward low eccentricity for lower amplitude systems (K > 20 m s -1 ).

  8. Probing planetary interiors: Shock compression of water to 700 GPa and 3.8 g/cc, and recent high precision Hugoniot measurements of deuterium

    Science.gov (United States)

    Knudson, Marcus

    2013-06-01

    The past several years have seen tremendous increase in the number of identified extra-solar planetary systems. Our understanding of the formation of these systems is tied to our understanding of the internal structure of these exoplanets, which in turn rely upon equations of state of light elements and compounds such as water and hydrogen. Here we present shock compression data for water with unprecedented accuracy that shows commonly used models for water in planetary modeling significantly overestimate the compressibility at conditions relevant to planetary interiors. Furthermore, we show that its behavior at these conditions, including reflectivity and isentropic response, is well described by a recent first-principles based equation of state. These findings advocate the use of this model as the standard for modeling Neptune, Uranus, and ``hot Neptune'' exoplanets, and should contribute to improved understanding of the interior structure of these planets, and perhaps improved understanding of formation mechanisms of planetary systems. We also present very recent experiments on deuterium that have taken advantage of continued improvements in both experimental configuration and the understanding of the quartz shock standard to obtain Hugoniot data with a significant increase in precision. These data will prove to provide a stringent test for the equation of state of hydrogen and its isotopes. Sandia is a multiprogram laboratory managed and operated by Sandia Corporation, a wholly owned subsidiary of Lockheed Martin Company, for the US Department of Energy's National Nuclear Security Administration under Contract No. DE-ACO4-94AL85000.

  9. FROM HOT JUPITERS TO SUPER-EARTHS VIA ROCHE LOBE OVERFLOW

    Energy Technology Data Exchange (ETDEWEB)

    Valsecchi, Francesca; Rasio, Frederic A.; Steffen, Jason H. [Center for Interdisciplinary Exploration and Research in Astrophysics (CIERA) and Department of Physics and Astronomy, Northwestern University, 2145 Sheridan Road, Evanston, IL 60208 (United States)

    2014-09-20

    Through tidal dissipation in a slowly spinning host star, the orbits of many hot Jupiters may decay down to the Roche limit. We expect that the ensuing mass transfer will be stable in most cases. Using detailed numerical calculations, we find that this evolution is quite rapid, potentially leading to the complete removal of the gaseous envelope in a few gigayears, and leaving behind an exposed rocky core (a {sup h}ot super-Earth{sup )}. Final orbital periods are quite sensitive to the details of the planet's mass-radius relation and to the effects of irradiation and photo-evaporation, but could be as short as a few hours or as long as several days. Our scenario predicts the existence of planets with intermediate masses ({sup h}ot Neptunes{sup )} that should be found precisely at their Roche limit and in the process of losing mass through Roche lobe overflow. The observed excess of small single-planet candidate systems observed by Kepler may also be the result of this process. If so, the properties of their host stars should track those of the hot Jupiters. Moreover, the number of systems that produced hot Jupiters could be two to three times larger than one would infer from contemporary observations.

  10. STABILITY OF ADDITIONAL PLANETS IN AND AROUND THE HABITABLE ZONE OF THE HD 47186 PLANETARY SYSTEM

    International Nuclear Information System (INIS)

    Kopparapu, Ravi Kumar; Raymond, Sean N.; Barnes, Rory

    2009-01-01

    We study the dynamical stability of an additional, potentially habitable planet in the HD 47186 planetary system. Two planets are currently known in this system: a 'hot Neptune' with a period of 4.08 days and a Saturn-mass planet with a period of 3.7 years. Here we consider the possibility that one or more undetected planets exist between the two known planets and possibly within the habitable zone (HZ) in this system. Given the relatively low masses of the known planets, additional planets could have masses ∼ + , and hence be terrestrial-like and further improving potential habitability. We perform N-body simulations to identify the stable zone between planets b and c and find that much of the inner HZ can harbor a 10 M + planet. With the current radial velocity threshold of ∼1 m s -1 , an additional planet should be detectable if it lies at the inner edge of the habitable zone at 0.8 AU. We also show that the stable zone could contain two additional planets of 10 M + each if their eccentricities are lower than ∼0.3.

  11. Marginal ulcer perforation: a single center experience.

    Science.gov (United States)

    Natarajan, S K; Chua, D; Anbalakan, K; Shelat, V G

    2017-10-01

    Marginal ulcer (MU) is defined as ulcer on the jejunal side of the gastrojejunostomy (GJ) anastomosis. Most MUs are managed medically but those with complications like bleeding or perforation require intervention. It is recommended that GJ anastomosis be revised in patients with MU perforation (MUP). The aim of this case series is to study the clinical presentation and management of MUP. Three hundred and thirty-two patients who underwent emergency surgery for perforated peptic ulcer at a single center were studied over a period of 5 years. Nine patients (2.7 %) presented with MUP. GJ was previously done for either complicated peptic ulcer (n = 4) or for suspected gastric malignancy (n = 5). Two patients had previously completed H. pylori therapy. None of the patients presented with septic shock. MU was on the jejunal side of GJ in all patients. The median MUP size was 10 mm. Four patients (44.4 %) had omental patch repair, three (33.3 %) had primary closure, and one each had revision of GJ and jejunal serosal patch repair. There were no leaks, intra-abdominal abscess or reoperation and no malignancies. MUP patients do not present with septic shock. Omental patch repair or primary closure is sufficient enough. Revision of Billroth-II-GJ into Roux-en-Y-GJ is not mandatory.

  12. AB Dor Moving Group Stars Resolved with the CHARA Array

    Science.gov (United States)

    Schaefer, G. H.; White, R. J.; Baines, E. K.; Boyajian, T. S.; ten Brummelaar, T. A.; Farrington, C. D.; Sturmann, J.; Sturmann, L.; Turner, N. H.

    2018-05-01

    We present interferometric measurements obtained with the CHARA Array of 13 adolescent-age stars in nearby moving groups. The motivation was to spatially resolve the largest stars and to search for binary companions. Nine stars have diameters smaller than the resolution limit and no evidence for companions within 0.5–50 mas and ΔH group, and former member HD 89744 (0.556 ± 0.032 mas). Combining the angular diameters with their distances and bolometric fluxes, we measured radii and effective temperatures. The temperatures of GJ 159 (6286 ± 123 K) and GJ 393 (3515 ± 68 K) are consistent with spectroscopic measurements. Comparisons with evolutionary models show that HD 89744 has evolved off the main sequence. GJ 159 and GJ 393 lie within 1.5σ of the zero-age main sequence, complicating their age estimates because it is unclear whether the stars are contracting or expanding. GJ 159 has a mass of 1.2 ± 0.1 {M}ȯ with an age spanning 0.021–3.0 Gyr. Its debris disk and lithium abundance favor a young age. GJ 393 has a mass of 0.42 ± 0.03 {M}ȯ and a lower limit on its age 0.06 Gyr. This overlaps with the age of the moving group; however, an older age would be more consistent with its slow rotation, low activity, and luminosity, suggesting that GJ 393 is a kinematic interloper.

  13. Changes in homologous and heterologous gap junction contacts during maturation-inducing hormone-dependent meiotic resumption in ovarian follicles of Atlantic croaker

    Science.gov (United States)

    Bolamba, D.; Patino, R.; Yoshizaki, G.; Thomas, P.

    2003-01-01

    Homologous (granulosa cell-granulosa cell) gap junction (GJ) contacts increase in ovarian follicles of Atlantic croaker (Micropogonias undulatus) during the early (first) stage of maturation, but their profile during the second stage [i.e., during maturation-inducing hormone (MIH)-mediated meiotic resumption] is unknown. The profile of homologous GJ contacts during the second stage of maturation in croaker follicles was examined in this study and compared to that of heterologous (granulosa cell-oocyte) GJ, for which changes have been previously documented. Follicles were incubated with human chorionic gonadotropin to induce maturational competence (first stage), and then with MIH to induce meiotic resumption. The follicles were collected for examination immediately before and after different durations of MIH exposure until the oocyte had reached the stage of germinal vesicle breakdown (GVBD; index of meiotic resumption). Ultrathin sections were observed by transmission electron microscopy, and homologous and heterologous GJ contacts were quantified along a 100-??m segment of granulosa cell-zona radiata complex per follicle (three follicles/time/fish, n=3 fish). Relatively high numbers of both types of GJ were observed before and after the first few hours of MIH exposure (up to the stage of oil droplet coalescence). GJ numbers declined during partial yolk globule coalescence (at or near GVBD) and were just under 50% of starting values after the completion of GVBD (P<0.05). These results confirm earlier observations that GVBD temporally correlates with declining heterologous GJ contacts, and for the first time in teleosts show that there is a parallel decline in homologous GJ. The significance of the changes in homologous and heterologous GJ is uncertain and deserves further study. ?? 2003 Elsevier Science (USA). All rights reserved.

  14. The closest M-dwarf quadruple system to the Sun

    International Nuclear Information System (INIS)

    Davison, Cassy L.; White, R. J.; Jao, W.-C.; Henry, T. J.; Quinn, S. N.; Cantrell, J. R.; Winters, J. G.; Bailey, J. I. III; Riedel, A. R.; Subasavage, J. P.; Crockett, C. J.

    2014-01-01

    We report new infrared radial velocity measurements obtained with CSHELL at NASA's Infrared Telescope Facility that reveal the M3.5 dwarf GJ 867B to be a single-lined spectroscopic binary with a period of 1.795 ± 0.017 days. Its velocity semi-amplitude of 21.4 ± 0.5 km s –1 corresponds to a minimum mass of 61 ± 7 M JUP ; the new companion, which we call GJ 867D, could be a brown dwarf. Stable astrometric measurements of GJ 867BD obtained with CTIO's 0.9 m telescope over the last decade exclude the presence of any massive planetary companions (7-18 M JUP ) with longer orbital periods (2-10 yr) for the majority of orientations. These complementary observations are also used to determine the trigonometric distance and proper motion of GJ 867BD; the measurements are consistent with the HIPPARCOS measured values of the M2 dwarf GJ 867AC, which is itself a 4.1 day double-lined spectroscopic binary at a projected separation of 24.''5 (216 AU) from GJ 867BD. These new measurements strengthen the case that GJ 867AC and GJ 867BD are physically associated, making the GJ 867 system one of only four quadruple systems within 10 pc of the Sun (d = 8.82 ± 0.08 pc) and the only among these with all M-dwarf (or cooler) components.

  15. 40Ar/39Ar age and thermal history of the Kirin chondrite

    International Nuclear Information System (INIS)

    Wang, S.; McDougall, I.; Tetley, N.; Harrison, T.M.

    1980-01-01

    The Kirin meteorite, a large (> 2800 kg) H5 chondrite, fell in Kirin Province, China in 1976. A sample from each of the two largest fragments (K-1. K-2) yield 40 Ar/ 39 Ar total fusion ages of 3.63 +- 0.02 b.y. and 2.78 +- 0.02 b.y. respectively. 40 Ar/ 40 Ar age spectra show typical diffusional argon loss profiles. Maximum apparent ages of 4.36 b.y. (K-1) and approx. 4.0 b.y. (K-2) are interpreted as possible minimum estimates for the age of crystallization of the parent body. (orig./ME)

  16. Analysis of a deletion in the nephronophthisis 4 gene in different dog breeds

    Czech Academy of Sciences Publication Activity Database

    Palánová, Anna; Schröffelová, D.; Přibáňová, M.; Dvořáková, Věra; Stratil, Antonín

    2014-01-01

    Roč. 17, č. 1 (2014), s. 76-78 ISSN 1463-5216 Institutional support: RVO:67985904 Keywords : blindness * cone * Dachshund Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 1.062, year: 2014

  17. Full Leng th R ese arch A rtic le Anticonvulsant and sedative ...

    African Journals Online (AJOL)

    Chinenye Ugwah-Oguejiofor

    Available online at http://www.ajol.info/index.php/njbas/index. Nigerian Journal of ... complementary/alternative medicine in the treatment ... Food and water were provided ad libitum. .... Amabeoku, G.J., Green, I. and Kabatende, J. (2007).

  18. Digital compilation bedrock geologic map of the Warren quadrangle, Vermont

    Data.gov (United States)

    Vermont Center for Geographic Information — Digital Data from VG95-4A Walsh, GJ, Haydock, S, Prewitt, J, Kraus, J, Lapp, E, O'Loughlin, S, and Stanley, RS, 1995, Digital compilation bedrock geologic map of the...

  19. Browse Title Index

    African Journals Online (AJOL)

    Items 151 - 200 of 204 ... ... note on the distribution and relative importance of bean Bruchid species Aconthoscelides obtectus (Say.) ... DE Mushi, LA Mtenga, LO Eik ... MC Kalumuna, ST Ikerra, GJ Ley, B Kiwambo, JA Kamasho, RR Weil.

  20. Dirofilaria repens microfilariae in Aedes vexans mosquitoes in Slovakia

    Czech Academy of Sciences Publication Activity Database

    Bocková, E.; Rudolf, Ivo; Kočišová, A.; Betášová, Lenka; Venclíková, Kristýna; Mendel, Jan; Hubálek, Zdeněk

    2013-01-01

    Roč. 112, č. 10 (2013), s. 3465-3470 ISSN 0932-0113 Institutional support: RVO:68081766 Keywords : Dirofilaria * mosquitoes * Aedes vexans Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 2.327, year: 2013

  1. Un cas d’infection à Dracunculoidea en Polynésie française

    Czech Academy of Sciences Publication Activity Database

    Bercion, R.; Heaulme, M.; Viant, E.; Moravec, František; Bain, O.

    2010-01-01

    Roč. 70, č. 2 (2010), s. 198-198 ISSN 0025-682X Institutional research plan: CEZ:AV0Z60220518 Keywords : Dracunculoidea * acute arthritis * French Polynesia Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine

  2. Cytauxzoon Infections in Wild Felids from Carpathian-Danubian-Pontic Space: Further Evidence for a Different Cytauxzoon Species in European Felids

    Czech Academy of Sciences Publication Activity Database

    Gallusová, M.; Jirsová, D.; Mihalca, A. D.; Gherman, C.M.; D’Amico, G.; Qablan, M. A.; Modrý, David

    2016-01-01

    Roč. 102, č. 3 (2016), s. 377-380 ISSN 0022-3395 Institutional support: RVO:60077344 Keywords : Lynx * domestic cats * molecular characterization Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 1.326, year: 2016

  3. Osteomyelitis - children

    Science.gov (United States)

    ... 13th ed. Philadelphia, PA: Elsevier; 2017:chap 21. Kaplan SL. Osteomyelitis. In: Kliegman RM, Stanton BF, St. ... Krogstad P. Osteomyelitis. In: Cherry JD, Harrison GJ, Kaplan SL, Steinbach WJ, Hotez PJ, eds. Feigin and ...

  4. Common Laundry Detergent Ingredient May Help Preserve Muscle Tissue After Severe Injury

    Science.gov (United States)

    ... Yoo JJ, Harrison BS, Christ GJ. Oxygen Generating Biomaterials Preserve Skeletal Muscle Homeostasis under Hypoxic and Ischemic ... scientific news and resources on diseases of the bones, joints, muscles, and skin from the NIAMS. Click ...

  5. EST Table: FS796464 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available ar to putative lysosomal glucocerebrosidase [Tribolium castaneum] 10/09/09 32 %/334 aa FBpp0237202|DvirGJ227...milar to putative lysosomal glucocerebrosidase [Tribolium castaneum] FS796494 ffbm ...

  6. Potential of energetic utilization of grains residual biomass; Potencial de utilizacao energetica de biomassa residual de graos

    Energy Technology Data Exchange (ETDEWEB)

    Mourad, Anna L. [Instituto de Tecnologia de Alimentos (ITAL), Campinas, SP (Brazil). Centro de Tecnologia de Embalagem], e-mail: anna@ital.sp.gov.br; Ambrogi, Vinicius S.; Guerra, Sinclair M.G. [Universidade Estadual de Campinas (UNICAMP), SP (Brazil). Fac. de Engenharia Mecanica], e-mail: ambrogi@fem.unicamp.br, e-mail: sguerra@fem.unicamp.br

    2004-07-01

    The biomass resulting from the rejected parts of grains, as straw and peel of rice, corn, wheat, soy, all great cultivations in the country, has potential to be takes advantage as energy. It was considered that the contribution of this residual biomass is near of 167,8 million GJ/year, value that could be added to the use already established of the cane bagasse for energy purpose (658 million GJ, in 2001). This energy can be used for drying of these same grains (energy expense estimate of 67 million GJ), currently obtained from oil. It can also substitute the fuel oil used in the agricultural section, in the industries of food and beverage, ceramic and textile (sections that consumed 67.822 GJ in 2001). In Sao Paulo state the regions with greater potential to install biomass plants are located in Assis, Avare and Itapeva EDR (regional development office). (author)

  7. Laser surgery - skin

    Science.gov (United States)

    ... Bleeding Problem not going away Infection Pain Scarring Skin color changes Some laser surgery is done when you are asleep and ... TG, Elston DM, eds. Andrews' Diseases of the Skin: Clinical ... lasers, lights, and tissue interactions. In: Hruza GJ, Avram ...

  8. Exoplanet detection. Stellar activity masquerading as planets in the habitable zone of the M dwarf Gliese 581.

    Science.gov (United States)

    Robertson, Paul; Mahadevan, Suvrath; Endl, Michael; Roy, Arpita

    2014-07-25

    The M dwarf star Gliese 581 is believed to host four planets, including one (GJ 581d) near the habitable zone that could possibly support liquid water on its surface if it is a rocky planet. The detection of another habitable-zone planet--GJ 581g--is disputed, as its significance depends on the eccentricity assumed for d. Analyzing stellar activity using the Hα line, we measure a stellar rotation period of 130 ± 2 days and a correlation for Hα modulation with radial velocity. Correcting for activity greatly diminishes the signal of GJ 581d (to 1.5 standard deviations) while significantly boosting the signals of the other known super-Earth planets. GJ 581d does not exist, but is an artifact of stellar activity which, when incompletely corrected, causes the false detection of planet g. Copyright © 2014, American Association for the Advancement of Science.

  9. First record of Philometra katsuwoni (Nematoda, Philometridae), a parasite of skipjack tuna Katsuwonus pelamis (Perciformes, Scombridae), off South American Atlantic coast

    Czech Academy of Sciences Publication Activity Database

    Cárdenas, M. Q.; Moravec, František; Kohn, A.

    2009-01-01

    Roč. 9, č. 2 (2009), s. 263-266 ISSN 1676-0611 Institutional research plan: CEZ:AV0Z60220518 Keywords : Philometra * Katsuwonus * Brazil Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine

  10. More than a rabbit's tale e Encephalitozoon spp. in wild mammals and birds

    Czech Academy of Sciences Publication Activity Database

    Hinney, B.; Sak, Bohumil; Joachim, A.; Kváč, Martin

    2016-01-01

    Roč. 5, č. 1 (2016), s. 76-87 ISSN 2213-2244 Institutional support: RVO:60077344 Keywords : Encephalitozoon cuniculi * Encephalitzoon hellem * Encephalitozoon intestinalis * Genotype * Zoonosis * Reservoir Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine

  11. Cattle tick vaccine researchers join forces in CATVAC

    Czech Academy of Sciences Publication Activity Database

    Schetters, T.P.; Bishop, R.; Crampton, M.; Kopáček, Petr; Lew-Tabor, A.; Maritz-Olivier, C.; Miller, R.; Mosqueda, J.; Patarroyo, J.; Rodriguez-Valle, M.; Scoles, G.A.; de la Fuente, J.

    2016-01-01

    Roč. 9, FEB 24 (2016), s. 105 ISSN 1756-3305 Institutional support: RVO:60077344 Keywords : CATVAC * vaccine * cattle * tick * Rhipicephalus microplus Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 3.080, year: 2016

  12. Effect of increased urea levels on mouse preimplantation embryos develop in vivo and in vitro

    Czech Academy of Sciences Publication Activity Database

    Bystriansky, J.; Burkuš, J.; Juhás, Štefan; Fabian, D.; Koppel, J.

    2012-01-01

    Roč. 56, č. 2 (2012), s. 211-216 ISSN 0042-4870 Institutional support: RVO:67985904 Keywords : mouse * preimplantation embryo * urea Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 0.377, year: 2012

  13. Energy consumption in the manufacture of sawn goods and wood-based panel products

    Energy Technology Data Exchange (ETDEWEB)

    Usenius, A.

    1983-01-01

    A study was made of energy consumption in 1979 and the possibilities of saving energy in the sawmill, plywood, particle board, fibreboard, joinery, wooden houses, glulam, and wood preservation industries. The energy consumption per product unit is minimum in sawmilling, 1.38 GJ/cubic meters and maximum in fibreboard manufacturing, 9.98 GJ/t. In plywood production, the energy consumption (6.95 GJ/cubic meters) is about double that in particleboard production (3.40 GJ/cubic meters). The main part of the energy (70-85%) is heat. In the drying process about 70-85% of total energy is used in individual processes. Over half (53.9%) of the total energy consumption is in the sawmill industry, 19.2% in the plywood industry, 12.2% in the particleboard industry, and 7.2% in the fibreboard industry.

  14. Amniotic fluid

    Science.gov (United States)

    Burton GJ, Sibley CP, Jauniaux ERM. Placental anatomy and physiology. In: Gabbe SG, Niebyl JR, Simpson JL, et al, eds. Obstetrics: Normal and Problem Pregnancies . 7th ed. Philadelphia, PA: Elsevier; 2017:chap 1. ...

  15. Sheehan syndrome

    Science.gov (United States)

    Burton GJ, Sibley CP, Jauniaux ERM. Placental anatomy and physiology. In: Gabbe SG, Niebyl JR, Simpson JL, et al, eds. Obstetrics: Normal and Problem Pregnancies . 7th ed. Philadelphia, PA: Elsevier; 2017:chap 1. ...

  16. A Cloudy View of Exoplanets

    Science.gov (United States)

    Deming, Drake

    2010-01-01

    The lack of absorption features in the transmission spectrum of exoplanet GJ1214b rules out a hydrogen-rich atmosphere for the planet. It is consistent with an atmosphere rich in water vapour or abundant in clouds.

  17. The CARMENES search for exoplanets around M dwarfs . First visual-channel radial-velocity measurements and orbital parameter updates of seven M-dwarf planetary systems

    Science.gov (United States)

    Trifonov, T.; Kürster, M.; Zechmeister, M.; Tal-Or, L.; Caballero, J. A.; Quirrenbach, A.; Amado, P. J.; Ribas, I.; Reiners, A.; Reffert, S.; Dreizler, S.; Hatzes, A. P.; Kaminski, A.; Launhardt, R.; Henning, Th.; Montes, D.; Béjar, V. J. S.; Mundt, R.; Pavlov, A.; Schmitt, J. H. M. M.; Seifert, W.; Morales, J. C.; Nowak, G.; Jeffers, S. V.; Rodríguez-López, C.; del Burgo, C.; Anglada-Escudé, G.; López-Santiago, J.; Mathar, R. J.; Ammler-von Eiff, M.; Guenther, E. W.; Barrado, D.; González Hernández, J. I.; Mancini, L.; Stürmer, J.; Abril, M.; Aceituno, J.; Alonso-Floriano, F. J.; Antona, R.; Anwand-Heerwart, H.; Arroyo-Torres, B.; Azzaro, M.; Baroch, D.; Bauer, F. F.; Becerril, S.; Benítez, D.; Berdiñas, Z. M.; Bergond, G.; Blümcke, M.; Brinkmöller, M.; Cano, J.; Cárdenas Vázquez, M. C.; Casal, E.; Cifuentes, C.; Claret, A.; Colomé, J.; Cortés-Contreras, M.; Czesla, S.; Díez-Alonso, E.; Feiz, C.; Fernández, M.; Ferro, I. M.; Fuhrmeister, B.; Galadí-Enríquez, D.; Garcia-Piquer, A.; García Vargas, M. L.; Gesa, L.; Gómez Galera, V.; González-Peinado, R.; Grözinger, U.; Grohnert, S.; Guàrdia, J.; Guijarro, A.; de Guindos, E.; Gutiérrez-Soto, J.; Hagen, H.-J.; Hauschildt, P. H.; Hedrosa, R. P.; Helmling, J.; Hermelo, I.; Hernández Arabí, R.; Hernández Castaño, L.; Hernández Hernando, F.; Herrero, E.; Huber, A.; Huke, P.; Johnson, E.; de Juan, E.; Kim, M.; Klein, R.; Klüter, J.; Klutsch, A.; Lafarga, M.; Lampón, M.; Lara, L. M.; Laun, W.; Lemke, U.; Lenzen, R.; López del Fresno, M.; López-González, M. J.; López-Puertas, M.; López Salas, J. F.; Luque, R.; Magán Madinabeitia, H.; Mall, U.; Mandel, H.; Marfil, E.; Marín Molina, J. A.; Maroto Fernández, D.; Martín, E. L.; Martín-Ruiz, S.; Marvin, C. J.; Mirabet, E.; Moya, A.; Moreno-Raya, M. E.; Nagel, E.; Naranjo, V.; Nortmann, L.; Ofir, A.; Oreiro, R.; Pallé, E.; Panduro, J.; Pascual, J.; Passegger, V. M.; Pedraz, S.; Pérez-Calpena, A.; Pérez Medialdea, D.; Perger, M.; Perryman, M. A. C.; Pluto, M.; Rabaza, O.; Ramón, A.; Rebolo, R.; Redondo, P.; Reinhardt, S.; Rhode, P.; Rix, H.-W.; Rodler, F.; Rodríguez, E.; Rodríguez Trinidad, A.; Rohloff, R.-R.; Rosich, A.; Sadegi, S.; Sánchez-Blanco, E.; Sánchez Carrasco, M. A.; Sánchez-López, A.; Sanz-Forcada, J.; Sarkis, P.; Sarmiento, L. F.; Schäfer, S.; Schiller, J.; Schöfer, P.; Schweitzer, A.; Solano, E.; Stahl, O.; Strachan, J. B. P.; Suárez, J. C.; Tabernero, H. M.; Tala, M.; Tulloch, S. M.; Veredas, G.; Vico Linares, J. I.; Vilardell, F.; Wagner, K.; Winkler, J.; Wolthoff, V.; Xu, W.; Yan, F.; Zapatero Osorio, M. R.

    2018-02-01

    Context. The main goal of the CARMENES survey is to find Earth-mass planets around nearby M-dwarf stars. Seven M dwarfs included in the CARMENES sample had been observed before with HIRES and HARPS and either were reported to have one short period planetary companion (GJ 15 A, GJ 176, GJ 436, GJ 536 and GJ 1148) or are multiple planetary systems (GJ 581 and GJ 876). Aims: We aim to report new precise optical radial velocity measurements for these planet hosts and test the overall capabilities of CARMENES. Methods: We combined our CARMENES precise Doppler measurements with those available from HIRES and HARPS and derived new orbital parameters for the systems. Bona-fide single planet systems were fitted with a Keplerian model. The multiple planet systems were analyzed using a self-consistent dynamical model and their best fit orbits were tested for long-term stability. Results: We confirm or provide supportive arguments for planets around all the investigated stars except for GJ 15 A, for which we find that the post-discovery HIRES data and our CARMENES data do not show a signal at 11.4 days. Although we cannot confirm the super-Earth planet GJ 15 Ab, we show evidence for a possible long-period (Pc = 7030-630+970 d) Saturn-mass (mcsini = 51.8M⊕) planet around GJ 15 A. In addition, based on our CARMENES and HIRES data we discover a second planet around GJ 1148, for which we estimate a period Pc = 532.6 days, eccentricity ec = 0.342 and minimum mass mcsini = 68.1M⊕. Conclusions: The CARMENES optical radial velocities have similar precision and overall scatter when compared to the Doppler measurements conducted with HARPS and HIRES. We conclude that CARMENES is an instrument that is up to the challenge of discovering rocky planets around low-mass stars. Based on observations collected at the European Organisation for Astronomical Research in the Southern Hemisphere under ESO programmes 072.C-0488, 072.C-0513, 074.C-0012, 074.C-0364, 075.D-0614, 076.C-0878, 077.C

  18. Histiocytoid Sweet Syndrome Diagnosed with Concurrent Myelodysplastic Syndrome with t(1;3) on Bone Marrow Examination

    Science.gov (United States)

    2017-10-08

    Affairs (59 MDW/PA) for review and then forward you a final letter of approval or disapproval. g, Once your manuscript, poster or presentation has been...CHANGES: [gj NO 0 YES If yes. give date. 29. COMMENTS [gJ APPROVED D DISAPPROVED The poster presentation is approved. 30. PRINTED NAME. RANK/GRADE...FROM: 59 MDW/SGVU SUBJECT: Professional Presentation Approval 27 JULY 2017 1. Your paper, entitled Histiocytoid Sweet Syndrome Diagnosed with

  19. Radioactive decay properties of CANDU fuel. Volume 1: the natural uranium fuel cycle

    International Nuclear Information System (INIS)

    Clegg, L.J.; Coady, J.R.

    1977-01-01

    The computer code CANIGEN was used to obtain the mass, activity, decay heat and toxicity of CANDU fuel and its component isotopes. Data are also presented on gamma spectra and neutron emissions. Part 1 presents these data for unirradiated fuel, uranium ore and uranium mill tailings. In Part 2 they have been computed for fuel irradiated to levels of burnup ranging from 140 GJ/kg U to 1150 GJ/kg U. (author)

  20. Immunohistochemistry of connexin 43 throughout anterior pituitary gland in a transgenic rat with green fluorescent protein-expressing folliculo-stellate cells.

    Science.gov (United States)

    Horiguchi, Kotaro; Fujiwara, Ken; Kouki, Tom; Kikuchi, Motoshi; Yashiro, Takashi

    2008-12-01

    Folliculo-stellate (FS) cells in the anterior pituitary gland have been speculated to possess multifunctional properties. Because gap junctions (GJ) have been identified between FS cells, FS cells may be interconnected electrophysiologically by GJ and serve as signal transmission networks to modulate hormone release in the anterior pituitary gland. But whether GJ are localized among FS cells from the pars tuberalis through the pars distalis is unclear. The S100b-GFP transgenic rat has recently been generated, which expresses green fluorescent protein (GFP) specifically in FS cells in the anterior pituitary. This model is expected to be a powerful tool for studies of FS cells. The purpose of the present paper was therefore to examine the localization of GJ on connexin 43 immunohistochemistry throughout the anterior pituitary gland of S100b-GFP rats under confocal laser microscopy. The localization patterns of FS cells was also observed in primary culture of anterior pituitary cells and the question of whether GJ between FS cells are reconstructed in vitro was investigated. In vivo studies showed that GJ were present specifically between FS cells from the pars tuberalis to the pars distalis in the anterior pituitary gland. The appearance of FS cells was distinguished into two types, with localization of GJ differing between types. In vitro, it was observed for the first time that FS cells in primary culture could be categorized into two types. In vivo localization of GJ between FS cells was reconstructed in vitro. These morphological observations are consistent with the hypothesis that FS cells form an electrophysiological network throughout the anterior pituitary for signal transmission.

  1. Synthetic Beta-Lactam Antibiotics as a Selective Breast Cancer Cell Apoptosis Inducer: Significance in Breast Cancer Prevention and Treatment

    Science.gov (United States)

    2007-03-01

    References 1. Labbe S, Thiele DJ: Pipes and wiring: the regulation of copper uptake and distribution in yeast . Trends Microbiol 1999, 7:500-505. 2. Aggett...inhibitors. New agents in cancer therapy. Drugs Aging 2000, 17:249-255. 8. Brewer GJ: Copper control as an antiangiogenic anticancer therapy: lessons... Brewer GJ, Dick RD, Grover DK, LeClaire V, Tseng M, Wicha M, Pienta K, Redman BG, Jahan T, Sondak VK, et al.: Treatment of metastatic cancer with

  2. Concept of a Machine Protection System for the High-Energy LHC

    CERN Document Server

    Raginel, Vivien; Wollmann, Daniel

    2018-01-01

    The High-Energy LHC (HE-LHC) is setting new precedents in stored energy in both, the superconducting magnet system (∼ 20 GJ) and the beams (1.34 GJ) as compared to LHC and the LHC upgrade to increase the luminosity (HL-LHC). Therefore, the requirements and performance of the existing machine protection systems have to be reviewed and adapted to the new HE-LHC beam parameters, failure cases and machine availability requirements.

  3. Detection of Plasmodium spp. in Human Feces

    Czech Academy of Sciences Publication Activity Database

    Jirků, Milan; Pomajbíková, K.; Petrželková, Klára Judita; Hůzová, Z.; Modrý, David; Lukeš, Julius

    2012-01-01

    Roč. 18, č. 4 (2012), s. 634-636 ISSN 1080-6040 R&D Projects: GA ČR GA206/09/0927 Institutional research plan: CEZ:AV0Z60220518; CEZ:AV0Z60930519 Keywords : great apes * faecal samples * PCR Subject RIV: GJ - Animal Vermins ; Diseases , Veterinary Medicine; GJ - Animal Vermins ; Diseases , Veterinary Medicine (UBO-W) Impact factor: 5.993, year: 2012

  4. Clarification of the technic of intrinsic factor radioimmunoassay for the cat and the rat

    International Nuclear Information System (INIS)

    Perrin, M.O.; Nicolas, J.P.; Dubrasquet, M.

    1983-01-01

    Cats and rats secrete very small quantities of gastric juice (GJ). In order to measure the Intrinsic Factor (IF) in GJ of animals certain modifications are necessary. It is very important to select with great care pernicious anemia sera which will be used to cross react with the animals' IF to determine their IF level by radioimmunoassay. The technic described here enables the dosage of low quantities of IF with a 7 per cent coefficient of variation [fr

  5. HiG størst på CERN

    CERN Multimedia

    Pettersen, Tor Erik

    2008-01-01

    No other Norwegian university colleagues has as many students at CERN as Gjøvik University College. This given, there are still more students from Gjøvik who wants to spend a year at CERN contributing to solve the technical and scientific challenges the organization is facing with the startup of the LHC. Rector Jørn Wroldsen, who has worked at CERN himself, is proud to have students at the laboratory.

  6. AcEST: DK953187 [AcEST

    Lifescience Database Archive (English)

    Full Text Available URK 30S ribosomal protein S1 OS=Limnobacter s... 35 2.7 tr|Q47GJ9|Q47GJ9_DECAR SSU ribosomal protein S1P OS=...Sbjct: 371 DFSRNFKKGDK--LQGAIKSITDFGVFIGLPGGIDGLVHLSDLSWS 414 >tr|A6GU99|A6GU99_9BURK 30S ribosomal protein S1 OS=Limnobacter

  7. Effects of maturation-inducing hormone on heterologous gap junctional coupling in ovarian follicles of Atlantic croaker

    Science.gov (United States)

    Yoshizaki, G.; Patino, R.; Thomas, P.; Bolamba, D.; Chang, Xiaotian

    2001-01-01

    A previous ultrastructural study of heterologous (granulosa cell-oocyte) gap junction (GJ) contacts in ovarian follicles of Atlantic croaker suggested that these contacts disappear late during the process of resumption of oocyte meiosis. This observation suggested that, unlike scenarios proposed for a number of other species, uncoupling of GJ is not necessary for the onset of meiotic resumption in croaker follicles. However, the functionality of heterologous GJ contacts and the temporal association between maturation-inducing hormone (MIH)-induced changes in heterologous coupling and resumption of oocyte meiosis have not been examined in Atlantic croaker. These questions were addressed with a cell-cell coupling assay that is based on the transfer of a GJ marker, Lucifer Yellow, from oocytes to granulosa cells. Follicle-enclosed oocytes injected with Lucifer Yellow allowed transfer of the dye into the follicle cell layer, thus confirming that there is functional heterologous coupling between the oocyte and the granulosa cells. Dye transfer was observed in vitellogenic, full-grown/maturation-incompetent, and full-grown /maturation-competent follicles. Treatment of maturation-competent follicles with MIH caused a time-dependent decline in the number of follicles transferring dye. However, although GJ uncoupling in some of the follicles was observed before germinal vesicle breakdown (GVBD, index of meiotic resumption), about 50% of the follicles maintained the ability to transfer dye even after GVBD had occurred. Further, a known GJ inhibitor (phorbol 12-myristate 13-acetate) blocked heterologous GJ within a time frame similar to that seen with MIH but without inducing any of the morphological changes (including GVBD) associated with follicular maturation. In conclusion, uncoupling of heterologous GJ seems insufficient and unnecessary for the onset of meiotic resumption in ovarian follicles of Atlantic croaker. ?? 2001 Elsevier Science.

  8. Historia del Corazón

    DEFF Research Database (Denmark)

    Høystad, Ole Martin

    Boken gjør rede for hvordan hjertet er blitt oppfattet og repræsenteret billedligt i ulike kulturer til ulike tider, med særlig vekt på europeisk kultur i 2. del av boken.......Boken gjør rede for hvordan hjertet er blitt oppfattet og repræsenteret billedligt i ulike kulturer til ulike tider, med særlig vekt på europeisk kultur i 2. del av boken....

  9. Greenhouse energy consumption

    Science.gov (United States)

    Eric van Steenis

    2009-01-01

    Depending on location and luck, natural gas rates have gone from less that CAN$ 3.00 to more than CAN$ 20.00/gigajoule (Gj). Natural gas rates are currently around CAN$ 13.00/Gj, although industry "analysts" predict an increase. A gigajoule is equivalent to the energy released by the combustion of approximately 30 L (8 gal) of gasoline. It is also equivalent...

  10. AcEST: DK961879 [AcEST

    Lifescience Database Archive (English)

    Full Text Available tr|B4LTS3|B4LTS3_DROVI GJ17201 OS=Drosophila virilis GN=GJ17201 ... 39 0.33 tr|A9ULP0|A9ULP0_XENTR Expressed in T-cells and eosinophi...ls in a... 39 0.43 tr|B7FQE3|B7FQE3_PHATR Predicted protein OS=Phaeodactylum tricor

  11. Histone deacetylase inhibition reduces cardiac Connexin43 expression and gap junction communication

    Directory of Open Access Journals (Sweden)

    Qin eXu

    2013-04-01

    Full Text Available Histone deactylase (HDAC inhibitors are being investigated as novel therapies for cancer, inflammation, neurodegeneration, and heart failure. The effects of HDAC inhibitors on the functional expression of cardiac gap junctions (GJ are essentially unknown. The purpose of this study was to determine the effects of trichostatin A (TSA and vorinostat (VOR on functional GJ expression in ventricular cardiomyocytes. The effects of HDAC inhibition on connexin43 (Cx43 expression and functional GJ assembly were examined in primary cultured neonatal mouse ventricular myocytes. TSA and VOR reduced Cx43 mRNA, protein expression, and immunolocalized Cx43 GJ plaque area within ventricular myocyte monolayer cultures in a dose-dependent manner. Chromatin-immunoprecipitation experiments revealed altered protein interactions with the Cx43 promoter. VOR also altered the phosphorylation state of several key regulatory Cx43 phospho-serine sites. Patch clamp analysis revealed reduced electrical coupling between isolated ventricular myocyte pairs, altered transjunctional voltage-dependent inactivation kinetics, and steady state junctional conductance inactivation and recovery relationships. Single GJ channel conductance was reduced to 54 pS only by maximum inhibitory doses of TSA (>= 100 nM. These two hydroxamate pan-HDAC inhibitors exert multiple levels of regulation on ventricular GJ communication by altering Cx43 expression, GJ area, post-translational modifications (e.g. phosphorylation, acetylation, gating, and channel conductance. Although a 50% downregulation of Cx43 GJ communication alone may not be sufficient to slow ventricular conduction or induce arrhythmias, the development of class-selective HDAC inhibitors may help avoid the potential negative cardiovascular effects of pan-HDACI.

  12. Energy and greenhouse gas emissions of Australian cotton : from field to fabric

    Energy Technology Data Exchange (ETDEWEB)

    Khabbaz, B.G.; Chen, G.; Baillie, C. [Southern Queensland Univ., Toowoomba, QLD (Australia). Faculty of Engineering and Surveying, National Centre for Engineering in Agriculture

    2010-07-01

    This paper reported on a study in which a life cycle assessment (LCA) of cotton production in Australia was conducted to evaluate energy use and greenhouse gas (GHG) emissions from tillage to export shipping. The study showed that on-farm indirect cotton-farming is the most energy consuming component, consuming nearly 32.36 GJ/ha of energy. On-farm indirect cotton-farming is the most GHG emitting component, emitting about 1.64 tonne of carbon dioxide (CO{sub 2})/ha. Energy use and the emissions by off-farm direct cotton-farming were calculated as 5.09 GJ/ha and 0.14 tonne CO{sub 2}/ha respectively. Energy consumed by off-farm indirect farming was found to be 0.036 GJ/ha or 0.002 tonne CO{sub 2}/ha. The total energy usage and greenhouse gas emissions in the Australian cotton farming system were estimated to be 46.43 GJ/ha and 2.42 tonnes CO{sub 2}/ha for on-farm, and 5.13 GJ/ha and 0.145 tonne CO{sub 2}/ha for the off-farm sections. In total, after including emissions caused by nitrogen based fertilizers, 51.57 GJ/ha of energy is used and 2.86 tonnes CO{sub 2}/ha is emitted by a typical Australian cotton farming system from tillage to export shipping.

  13. Heterocellular interaction enhances recruitment of α and β-catenins and ZO-2 into functional gap-junction complexes and induces gap junction-dependant differentiation of mammary epithelial cells

    International Nuclear Information System (INIS)

    Talhouk, Rabih S.; Mroue, Rana; Mokalled, Mayssa; Abi-Mosleh, Lina; Nehme, Ralda; Ismail, Ayman; Khalil, Antoine; Zaatari, Mira; El-Sabban, Marwan E.

    2008-01-01

    Gap junctions (GJ) are required for mammary epithelial differentiation. Using epithelial (SCp2) and myoepithelial-like (SCg6) mouse-derived mammary cells, the role of heterocellular interaction in assembly of GJ complexes and functional differentiation (β-casein expression) was evaluated. Heterocellular interaction is critical for β-casein expression, independent of exogenous basement membrane or cell anchoring substrata. Functional differentiation of SCp2, co-cultured with SCg6, is more sensitive to GJ inhibition relative to homocellular SCp2 cultures differentiated by exogenous basement membrane. Connexin (Cx)32 and Cx43 levels were not regulated across culture conditions; however, GJ functionality was enhanced under differentiation-permissive conditions. Immunoprecipitation studies demonstrated association of junctional complex components (α-catenin, β-catenin and ZO-2) with Cx32 and Cx43, in differentiation conditions, and additionally with Cx30 in heterocellular cultures. Although β-catenin did not shuttle between cadherin and GJ complexes, increased association between connexins and β-catenin in heterocellular cultures was observed. This was concomitant with reduced nuclear β-catenin, suggesting that differentiation in heterocellular cultures involves sequestration of β-catenin in GJ complexes

  14. Multi-instrumental observations of a positive gigantic jet produced by a winter thunderstorm in Europe

    Science.gov (United States)

    van der Velde, Oscar A.; Bór, József; Li, Jingbo; Cummer, Steven A.; Arnone, Enrico; Zanotti, Ferruccio; Füllekrug, Martin; Haldoupis, Christos; Naitamor, Samir; Farges, Thomas

    2010-12-01

    At 2336:56 UTC on 12 December 2009, a bright gigantic jet (GJ) was recorded by an observer in Italy. Forty-nine additional sprites, elves, halos and two cases of upward lightning were observed that night. The location of the GJ corresponded to a distinct cloud top (-34°C) west of Ajaccio, Corsica. The GJ reached approximately 91 km altitude, with a "trailing jet" reaching 49-59 km, matching with earlier reported GJs. The duration was short at 120-160 ms. This is the first documented GJ which emerged from a maritime winter thunderstorm only 6.5 km tall, showing high cloud tops are not required for initiation of GJs. In the presence of strong vertical wind shear, the meteorological situation was different from typical outbreaks of fall and winter thunderstorms in the Mediterranean. During the trailing jet phase of the GJ, a sprite with halo triggered by a nearby cloud-to-ground lightning flash occurred at a relatively low altitude (origins in the cloud (i.e., a positive cloud-to-ionosphere discharge, +CI), with a large total charge moment change of 11600 C km and a maximum current of 3.3 kA. Early VLF transmitter amplitude perturbations detected concurrently with the GJ confirm the production of large conductivity changes due to electron density enhancements in the D-region of the ionosphere.

  15. TIDALLY DRIVEN ROCHE-LOBE OVERFLOW OF HOT JUPITERS WITH MESA

    Energy Technology Data Exchange (ETDEWEB)

    Valsecchi, Francesca; Rasio, Frederic A. [Center for Interdisciplinary Exploration and Research in Astrophysics (CIERA), and Northwestern University, Department of Physics and Astronomy, Evanston, IL 60208 (United States); Rappaport, Saul [Department of Physics, and Kavli Institute for Astrophysics and Space Research, Massachusetts Institute of Technology, Cambridge, MA 02139 (United States); Marchant, Pablo [Argelander-Institut für Astronomie, Universität Bonn, Auf dem Hgel 71, D-53121 Bonn (Germany); Rogers, Leslie A., E-mail: francesca@u.northwestern.edu, E-mail: rasio@northwestern.edu, E-mail: sar@mit.edu, E-mail: pablo@astro.uni-bonn.de, E-mail: larogers@caltech.edu [Department of Astronomy and Department of Geophysics and Planetary Sciences, California Institute of Technology, Pasadena, CA 91125 (United States)

    2015-11-10

    Many exoplanets have now been detected in orbits with ultra-short periods very close to the Roche limit. Building upon our previous work, we study the possibility that mass loss through Roche lobe overflow (RLO) may affect the evolution of these planets, and could possibly transform a hot Jupiter into a lower-mass planet (hot Neptune or super-Earth). We focus here on systems in which the mass loss occurs slowly (“stable mass transfer” in the language of binary star evolution) and we compute their evolution in detail with the binary evolution code Modules for Experiments in Stellar Astrophysics. We include the effects of tides, RLO, irradiation, and photo-evaporation (PE) of the planet, as well as the stellar wind and magnetic braking. Our calculations all start with a hot Jupiter close to its Roche limit, in orbit around a Sun-like star. The initial orbital decay and onset of RLO are driven by tidal dissipation in the star. We confirm that such a system can indeed evolve to produce lower-mass planets in orbits of a few days. The RLO phase eventually ends and, depending on the details of the mass transfer and on the planetary core mass, the orbital period can remain around a few days for several Gyr. The remnant planets have rocky cores and some amount of envelope material, which is slowly removed via PE at a nearly constant orbital period; these have properties resembling many of the observed super-Earths and sub-Neptunes. For these remnant planets, we also predict an anti-correlation between mass and orbital period; very low-mass planets (M{sub pl} ≲ 5 M{sub ⊕}) in ultra-short periods (P{sub orb} < 1 day) cannot be produced through this type of evolution.

  16. VUV-absorption cross section of CO2 at high temperatures and impact on exoplanet atmospheres

    Directory of Open Access Journals (Sweden)

    Venot Olivia

    2014-02-01

    Full Text Available Ultraviolet (UV absorption cross sections are an essential ingredient of photochemical atmosphere models. Exoplanet searches have unveiled a large population of short-period objects with hot atmospheres, very different from what we find in our solar system. Transiting exoplanets whose atmospheres can now be studied by transit spectroscopy receive extremely strong UV fluxes and have typical temperatures ranging from 400 to 2500 K. At these temperatures, UV photolysis cross section data are severely lacking. Our goal is to provide high-temperature absorption cross sections and their temperature dependency for important atmospheric compounds. This study is dedicated to CO2, which is observed and photodissociated in exoplanet atmospheres. We performed these measurements for the 115 - 200 nm range at 300, 410, 480, and 550 K. In the 195 - 230 nm range, we worked at seven temperatures between 465 and 800 K. We found that the absorption cross section of CO2 is very sensitive to temperature, especially above 160 nm. Within the studied range of temperature, the CO2 cross section can vary by more than two orders of magnitude. This, in particular, makes the absorption of CO2 significant up to wavelengths as high as 230 nm, while it is negligible above 200 nm at 300 K. To investigate the influence of these new data on the photochemistry of exoplanets, we implemented the measured cross section into a 1D photochemical model. The model predicts that accounting for this temperature dependency of CO2 cross section can affect the computed abundances of NH3, CO2, and CO by one order of magnitude in the atmospheres of hot Jupiter and hot Neptune.

  17. Planet traps and planetary cores: origins of the planet-metallicity correlation

    Energy Technology Data Exchange (ETDEWEB)

    Hasegawa, Yasuhiro [Institute of Astronomy and Astrophysics, Academia Sinica (ASIAA), P.O. Box 23-141, Taipei 10641, Taiwan (China); Pudritz, Ralph E., E-mail: yasu@asiaa.sinica.edu.tw, E-mail: pudritz@physics.mcmaster.ca [Department of Physics and Astronomy, McMaster University, Hamilton, ON L8S 4M1 (Canada)

    2014-10-10

    Massive exoplanets are observed preferentially around high metallicity ([Fe/H]) stars while low-mass exoplanets do not show such an effect. This so-called planet-metallicity correlation generally favors the idea that most observed gas giants at r < 10 AU are formed via a core accretion process. We investigate the origin of this phenomenon using a semi-analytical model, wherein the standard core accretion takes place at planet traps in protostellar disks where rapid type I migrators are halted. We focus on the three major exoplanetary populations—hot Jupiters, exo-Jupiters located at r ≅ 1 AU, and the low-mass planets. We show using a statistical approach that the planet-metallicity correlations are well reproduced in these models. We find that there are specific transition metallicities with values [Fe/H] = –0.2 to –0.4, below which the low-mass population dominates, and above which the Jovian populations take over. The exo-Jupiters significantly exceed the hot Jupiter population at all observed metallicities. The low-mass planets formed via the core accretion are insensitive to metallicity, which may account for a large fraction of the observed super-Earths and hot-Neptunes. Finally, a controlling factor in building massive planets is the critical mass of planetary cores (M {sub c,} {sub crit}) that regulates the onset of rapid gas accretion. Assuming the current data is roughly complete at [Fe/H] > –0.6, our models predict that the most likely value of the 'mean' critical core mass of Jovian planets is (M {sub c,} {sub crit}) ≅ 5 M {sub ⊕} rather than 10 M {sub ⊕}. This implies that grain opacities in accreting envelopes should be reduced in order to lower M {sub c,} {sub crit}.

  18. CHEOPS: A transit photometry mission for ESA's small mission programme

    Directory of Open Access Journals (Sweden)

    Queloz D.

    2013-04-01

    Full Text Available Ground based radial velocity (RV searches continue to discover exoplanets below Neptune mass down to Earth mass. Furthermore, ground based transit searches now reach milli-mag photometric precision and can discover Neptune size planets around bright stars. These searches will find exoplanets around bright stars anywhere on the sky, their discoveries representing prime science targets for further study due to the proximity and brightness of their host stars. A mission for transit follow-up measurements of these prime targets is currently lacking. The first ESA S-class mission CHEOPS (CHaracterizing ExoPlanet Satellite will fill this gap. It will perform ultra-high precision photometric monitoring of selected bright target stars almost anywhere on the sky with sufficient precision to detect Earth sized transits. It will be able to detect transits of RV-planets by photometric monitoring if the geometric configuration results in a transit. For Hot Neptunes discovered from the ground, CHEOPS will be able to improve the transit light curve so that the radius can be determined precisely. Because of the host stars' brightness, high precision RV measurements will be possible for all targets. All planets observed in transit by CHEOPS will be validated and their masses will be known. This will provide valuable data for constraining the mass-radius relation of exoplanets, especially in the Neptune-mass regime. During the planned 3.5 year mission, about 500 targets will be observed. There will be 20% of open time available for the community to develop new science programmes.

  19. The Ultraviolet Radiation Environment around M Dwarf Exoplanet Host Stars

    Science.gov (United States)

    France, Kevin; Froning, Cynthia S.; Linsky, Jeffrey L.; Roberge, Aki; Stocke, John T.; Tian, Feng; Bushinsky, Rachel; Desert, Jean-Michel; Mauas, Pablo; Mauas, Pablo; hide

    2013-01-01

    The spectral and temporal behavior of exoplanet host stars is a critical input to models of the chemistry and evolution of planetary atmospheres. Ultraviolet photons influence the atmospheric temperature profiles and production of potential biomarkers on Earth-like planets around these stars. At present, little observational or theoretical basis exists for understanding the ultraviolet spectra of M dwarfs, despite their critical importance to predicting and interpreting the spectra of potentially habitable planets as they are obtained in the coming decades. Using observations from the Hubble Space Telescope, we present a study of the UV radiation fields around nearby M dwarf planet hosts that covers both far-UV (FUV) and near-UV (NUV) wavelengths. The combined FUV+NUV spectra are publicly available in machine-readable format. We find that all six exoplanet host stars in our sample (GJ 581, GJ 876, GJ 436, GJ 832, GJ 667C, and GJ 1214) exhibit some level of chromospheric and transition region UV emission. No "UV-quiet" M dwarfs are observed. The bright stellar Lyman-alpha emission lines are reconstructed, and we find that the Lyman-alpha line fluxes comprise approximately 37%-75% of the total 1150-3100 A flux from most M dwarfs; approximately greater than 10(exp3) times the solar value. We develop an empirical scaling relation between Lyman-alpha and Mg II emission, to be used when interstellar H I attenuation precludes the direct observation of Lyman-alpha. The intrinsic unreddened flux ratio is F(Lyman-alpha)/F(Mg II) = 10(exp3). The F(FUV)/F(NUV) flux ratio, a driver for abiotic production of the suggested biomarkers O2 and O3, is shown to be approximately 0.5-3 for all M dwarfs in our sample, greather than 10(exp3) times the solar ratio. For the four stars with moderate signal-to-noise Cosmic Origins Spectrograph time-resolved spectra, we find UV emission line variability with amplitudes of 50%.500% on 10(exp2)-10(exp3) s timescales. This effect should be taken

  20. THE ULTRAVIOLET RADIATION ENVIRONMENT AROUND M DWARF EXOPLANET HOST STARS

    Energy Technology Data Exchange (ETDEWEB)

    France, Kevin; Froning, Cynthia S.; Stocke, John T.; Bushinsky, Rachel [Center for Astrophysics and Space Astronomy, University of Colorado, 389 UCB, Boulder, CO 80309 (United States); Linsky, Jeffrey L. [JILA, University of Colorado and NIST, 440 UCB, Boulder, CO 80309 (United States); Roberge, Aki [Exoplanets and Stellar Astrophysics Laboratory, NASA Goddard Space Flight Center, Greenbelt, MD 20771 (United States); Tian, Feng [Center for Earth System Sciences, Tsinghua University, Beijing 100084 (China); Desert, Jean-Michel [Division of Geological and Planetary Sciences, California Institute of Technology, Pasadena, CA 91125 (United States); Mauas, Pablo; Vieytes, Mariela [Instituto de Astronomsica del Espacio (CONICET-UBA), C.C. 67 Sucursal 28, 1428 Buenos Aires (Argentina); Walkowicz, Lucianne M., E-mail: kevin.france@colorado.edu [Department of Astrophysical Sciences, Princeton University, Princeton, NJ 08544 (United States)

    2013-02-15

    The spectral and temporal behavior of exoplanet host stars is a critical input to models of the chemistry and evolution of planetary atmospheres. Ultraviolet photons influence the atmospheric temperature profiles and production of potential biomarkers on Earth-like planets around these stars. At present, little observational or theoretical basis exists for understanding the ultraviolet spectra of M dwarfs, despite their critical importance to predicting and interpreting the spectra of potentially habitable planets as they are obtained in the coming decades. Using observations from the Hubble Space Telescope, we present a study of the UV radiation fields around nearby M dwarf planet hosts that covers both far-UV (FUV) and near-UV (NUV) wavelengths. The combined FUV+NUV spectra are publicly available in machine-readable format. We find that all six exoplanet host stars in our sample (GJ 581, GJ 876, GJ 436, GJ 832, GJ 667C, and GJ 1214) exhibit some level of chromospheric and transition region UV emission. No 'UV-quiet' M dwarfs are observed. The bright stellar Ly{alpha} emission lines are reconstructed, and we find that the Ly{alpha} line fluxes comprise {approx}37%-75% of the total 1150-3100 A flux from most M dwarfs; {approx}>10{sup 3} times the solar value. We develop an empirical scaling relation between Ly{alpha} and Mg II emission, to be used when interstellar H I attenuation precludes the direct observation of Ly{alpha}. The intrinsic unreddened flux ratio is F(Ly{alpha})/F(Mg II) = 10 {+-} 3. The F(FUV)/F(NUV) flux ratio, a driver for abiotic production of the suggested biomarkers O{sub 2} and O{sub 3}, is shown to be {approx}0.5-3 for all M dwarfs in our sample, >10{sup 3} times the solar ratio. For the four stars with moderate signal-to-noise Cosmic Origins Spectrograph time-resolved spectra, we find UV emission line variability with amplitudes of 50%-500% on 10{sup 2}-10{sup 3} s timescales. This effect should be taken into account in future UV

  1. Methamphetamine compromises gap junctional communication in astrocytes and neurons.

    Science.gov (United States)

    Castellano, Paul; Nwagbo, Chisom; Martinez, Luis R; Eugenin, Eliseo A

    2016-05-01

    Methamphetamine (meth) is a central nervous system (CNS) stimulant that results in psychological and physical dependency. The long-term effects of meth within the CNS include neuronal plasticity changes, blood-brain barrier compromise, inflammation, electrical dysfunction, neuronal/glial toxicity, and an increased risk to infectious diseases including HIV. Most of the reported meth effects in the CNS are related to dysregulation of chemical synapses by altering the release and uptake of neurotransmitters, especially dopamine, norepinephrine, and epinephrine. However, little is known about the effects of meth on connexin (Cx) containing channels, such as gap junctions (GJ) and hemichannels (HC). We examined the effects of meth on Cx expression, function, and its role in NeuroAIDS. We found that meth altered Cx expression and localization, decreased GJ communication between neurons and astrocytes, and induced the opening of Cx43/Cx36 HC. Furthermore, we found that these changes in GJ and HC induced by meth treatment were mediated by activation of dopamine receptors, suggesting that dysregulation of dopamine signaling induced by meth is essential for GJ and HC compromise. Meth-induced changes in GJ and HC contributed to amplified CNS toxicity by dysregulating glutamate metabolism and increasing the susceptibility of neurons and astrocytes to bystander apoptosis induced by HIV. Together, our results indicate that connexin containing channels, GJ and HC, are essential in the pathogenesis of meth and increase the sensitivity of the CNS to HIV CNS disease. Methamphetamine (meth) is an extremely addictive central nervous system stimulant. Meth reduced gap junctional (GJ) communication by inducing internalization of connexin-43 (Cx43) in astrocytes and reducing expression of Cx36 in neurons by a mechanism involving activation of dopamine receptors (see cartoon). Meth-induced changes in Cx containing channels increased extracellular levels of glutamate and resulted in higher

  2. Transgastric endoluminal gastrojejunostomy: technical development from bench to animal study (with video).

    Science.gov (United States)

    Chiu, Philip Wai Yan; Wai Ng, Enders Kwok; Teoh, Anthony Yun Bun; Lam, Candice Chuen Hing; Lau, James Yun Wong; Sung, Joseph Jao Yiu

    2010-02-01

    Gastrojejunal anastomosis is commonly performed for palliative management of malignant gastric outlet obstruction and bariatric surgery. Natural orifice transluminal endoscopic surgery revolutionized the surgical approach to intra-abdominal surgery. This study explored the possibility of performing gastrojejunostomy (GJ) by using a hybrid natural orifice transluminal endoscopic surgery approach. To develop a surgical technique for the performance of transgastric endoscopic GJ (TGEJ) in a porcine model. Prospective series of animal experiments. University hospital animal laboratory. Thirteen female domestic pigs. With the animals under general anesthesia, the endoscope is passed through the gastrotomy and a segment of small bowel is retrieved into the stomach. An enterotomy is then created, and an EndoGIA stapler is introduced through an intragastric port and passed between the small bowel and stomach wall. A GJ is formed after firing of the EndoGIA stapler. The pigs are allowed to resume their diet 1 day after the operation and are allowed to survive for 2 weeks before they are euthanized. The patency of the GJ is confirmed with a repeat endoscopy, contrast study, and postmortem examination. A total of 13 TEGJs were performed, 11 of which were successful. The mean operative time was 53.6 +/- 45.7 minutes. The mean time for gastrotomy was 4.7 minutes, and that for GJ was 42.5 minutes. One TEGJ was converted to open surgery because of malpositioning of the intragastric port, and the other failed because the enterotomy was too extensive. Ten of 11 pigs survived for 2 weeks, and endoscopic examination with contrast study confirmed that all the gastrojejunostomies were patent. On postmortem examination, the average size of the GJ was 30 mm. The length between duodenojejunal flexure and the site chosen to perform the GJ could not be determined. TEGJ is technically feasible with a patent and sizable anastomosis.

  3. Regulation of gap junction conductance by calcineurin through Cx43 phosphorylation: implications for action potential conduction.

    Science.gov (United States)

    Jabr, Rita I; Hatch, Fiona S; Salvage, Samantha C; Orlowski, Alejandro; Lampe, Paul D; Fry, Christopher H

    2016-11-01

    Cardiac arrhythmias are associated with raised intracellular [Ca 2+ ] and slowed action potential conduction caused by reduced gap junction (GJ) electrical conductance (Gj). Ventricular GJs are composed of connexin proteins (Cx43), with Gj determined by Cx43 phosphorylation status. Connexin phosphorylation is an interplay between protein kinases and phosphatases but the precise pathways are unknown. We aimed to identify key Ca 2+ -dependent phosphorylation sites on Cx43 that regulate cardiac gap junction conductance and action potential conduction velocity. We investigated the role of the Ca 2+ -dependent phosphatase, calcineurin. Intracellular [Ca 2+ ] was raised in guinea-pig myocardium by a low-Na solution or increased stimulation. Conduction velocity and Gj were measured in multicellular strips. Phosphorylation of Cx43 serine residues (S365 and S368) and of the intermediary regulator I1 at threonine35 was measured by Western blot. Measurements were made in the presence and absence of inhibitors to calcineurin, I1 or protein phosphatase-1 and phosphatase-2.Raised [Ca 2 + ] i decreased Gj, reduced Cx43 phosphorylation at S365 and increased it at S368; these changes were reversed by calcineurin inhibitors. Cx43-S368 phosphorylation was reversed by the protein kinase C inhibitor chelerythrine. Raised [Ca 2+ ] i also decreased I1 phosphorylation, also prevented by calcineurin inhibitors, to increase activity of the Ca 2+ -independent phosphatase, PPI. The PP1 inhibitor, tautomycin, prevented Cx43-365 dephosphorylation, Cx43-S368 phosphorylation and Gj reduction in raised [Ca 2+ ] i . PP2A had no role. Conduction velocity was reduced by raised [Ca 2+ ] i and reversed by calcineurin inhibitors. Reduced action potential conduction and Gj in raised [Ca 2+ ] are regulated by calcineurin-dependent Cx43-S365 phosphorylation, leading to Cx43-S368 dephosphorylation. The calcineurin action is indirect, via I1 dephosphorylation and subsequent activation of PP1.

  4. Effects of gap junction blockers on human neocortical synchronization.

    Science.gov (United States)

    Gigout, S; Louvel, J; Kawasaki, H; D'Antuono, M; Armand, V; Kurcewicz, I; Olivier, A; Laschet, J; Turak, B; Devaux, B; Pumain, R; Avoli, M

    2006-06-01

    Field potentials and intracellular recordings were obtained from human neocortical slices to study the role of gap junctions (GJ) in neuronal network synchronization. First, we examined the effects of GJ blockers (i.e., carbenoxolone, octanol, quinine, and quinidine) on the spontaneous synchronous events (duration = 0.2-1.1 s; intervals of occurrence = 3-27 s) generated by neocortical slices obtained from temporal lobe epileptic patients during application of 4-aminopyridine (4AP, 50 muM) and glutamatergic receptor antagonists. The synchronicity of these potentials (recorded at distances up to 5 mm) was decreased by GJ blockers within 20 min of application, while prolonged GJ blockers treatment at higher doses made them disappear with different time courses. Second, we found that slices from patients with focal cortical dysplasia (FCD) could generate in normal medium spontaneous synchronous discharges (duration = 0.4-8 s; intervals of occurrence = 0.5-90 s) that were (i) abolished by NMDA receptor antagonists and (ii) slowed down by carbenoxolone. Finally, octanol or carbenoxolone blocked 4AP-induced ictal-like discharges (duration = up to 35 s) in FCD slices. These data indicate that GJ play a role in synchronizing human neocortical networks and may implement epileptiform activity in FCD.

  5. ANALISIS ENERGI MASUKAN-KELUARAN PADA PROSES PRODUKSI KELAPA SAWIT (Elaesis guineensis jacq. Input-Output Energy Analyisis in Oil Palm Production

    Directory of Open Access Journals (Sweden)

    Agus Haryanto

    2012-03-01

    Penelitian ini bertujuan untuk menganalisis energi masukan-keluaran dan mengidentifikasi kemungkinan penghematan energi pada proses budidaya kelapa sawit. Penelitian dilakukan di PTPN VII Unit Usaha Rejosari, Lampung Selatan dengan mengamati semua energi yang digunakan dan dihasilkan. Energi masukan terdiri dari tenaga manusia, bahan bakar, energi tidak langsung dari pupuk, pestisida, dan alat-mesin pertanian. Energi keluaran berasal dari tandan buah segar (TBS dengan komponen minyak sawit, minyak inti sawit, serat, cangkang, dan tandan kosong, serta pelepah. Hasil penelitian menunjukkan bahwa budidaya kelapa sawit memerlukan energi masukan sebesar 57,63 GJ.ha-1  dan menghasilkan energi 339,14 GJ.ha-1. Sebagian besar energi masukan adalah penggunaan pupuk yang mencapai 31,22 GJ.ha-1  (54,18 % dari total energi masukan. Berdasarkan tahapan budidaya, maka pemeliharaan tanaman produktif memerlukan energi yang paling besar yaitu 33,06 GJ.ha-1  (57,37 %. Budidaya kelapa sawit menghasilkan energi neto 281,51 GJ.ha-1 dengan rasio energi 5,88, produktivitas energi 0,258 kg TBS/MJ, dan intensitas energi 3,87 MJ/kg TBS.   Kata kunci: Analisis energi, energi masukan, energi keluaran, indikator energi

  6. One-step separation and purification of three lignans and one flavonol from Sinopodophyllum emodi by medium-pressure liquid chromatography and high-speed counter-current chromatography.

    Science.gov (United States)

    Wang, Ping; Liu, Yongling; Chen, Tao; Xu, Wenhua; You, Jinmao; Liu, Yongjun; Li, Yulin

    2013-01-01

    Lignans and flavonols are the primary constituents of Sinopodophyllum emodi and have been used as cathartic, anthelmintic, chemotherapeutic and anti-hypertensive compounds. Although these compounds have been isolated, there have been no reports on the separation of 4'-demethyl podophyllotoxin, podophyllotoxin, deoxypodophyllotoxin and kaempferol in one step by medium-pressure liquid chromatography (MPLC) and high-speed counter-current chromatography (HSCCC). Development of an efficient method for the preparative separation and purification of three lignans and one flavonol from S. emodi. The precipitate of crude extracts was first separated by MPLC into four parts, numbered GJ-1, GJ-2, GJ-3 and GJ-4. GJ-1 was separated and purified by HSCCC using a solvent system composed of n-hexane:ethyl acetate:methanol:water (1.75:1.5:1:0.75, v/v/v/v). The purities of the target compounds were assessed using high-performance liquid chromatography (HPLC) and chemical structures were identified by (1) H-NMR and (13) C-NMR. The HSCCC and MPLC methods were successfully used for the preparative separation and purification of 4'-demethyl podophyllotoxin (8.5 mg, 92.4%), podophyllotoxin (40.1 mg, 92.1%), deoxypodophyllotoxin (4.6 mg, 98.1%), and kaempferol (1.6 mg, 96.7%) from a 100 mg sample. Three lignans (4'-demethyl podophyllotoxin, podophyllotoxin, deoxypodophyllotoxin) and one flavonol (kaempferol) were successfully isolated by HSCCC and MPLC in one step. Copyright © 2013 John Wiley & Sons, Ltd.

  7. Gardenia jasminoides Encodes an Inhibitor-2 Protein for Protein Phosphatase Type 1

    Science.gov (United States)

    Gao, Lan; Li, Hao-Ming

    2017-08-01

    Protein phosphatase-1 (PP1) regulates diverse, essential cellular processes such as cell cycle progression, protein synthesis, muscle contraction, carbohydrate metabolism, transcription and neuronal signaling. Inhibitor-2 (I-2) can inhibit the activity of PP1 and has been found in diverse organisms. In this work, a Gardenia jasminoides fruit cDNA library was constructed, and the GjI-2 cDNA was isolated from the cDNA library by sequencing method. The GjI-2 cDNA contains a predicted 543 bp open reading frame that encodes 180 amino acids. The bioinformatics analysis suggested that the GjI-2 has conserved PP1c binding motif, and contains a conserved phosphorylation site, which is important in regulation of its activity. The three-dimensional model structure of GjI-2 was buite, its similar with the structure of I-2 from mouse. The results suggest that GjI-2 has relatively conserved RVxF, FxxR/KxR/K and HYNE motif, and these motifs are involved in interaction with PP1.

  8. How can we improve the energy balance of ethanol production from wheat?

    Energy Technology Data Exchange (ETDEWEB)

    Jerry D. Murphy; Niamh M. Power [University College Cork, Cork (Ireland). Department of Civil and Environmental Engineering

    2008-08-15

    The gross energy in ethanol using wheat as a feedstock in Ireland is 66 GJ/ha/a. The net energy production is 25 GJ/ha/a. A model is proposed, whereby the ethanol production process is combined with combustion of straw, and digestion of stillage, resulting in two transport fuels; ethanol and biomethane. In the proposed system stillage is not dried, reducing the thermal demand by 35%. A quarter of the straw associated with the wheat grain is sufficient, when combusted, to satisfy the reduced thermal demands. Stillage is digested wet; the biogas is scrubbed, compressed and utilised as a transport fuel. The net energy now is 72 GJ/ha/a. The production cost of biomethane is two thirds that of ethanol. 37 refs., 1 fig., 10 tabs.

  9. [Effect of fruit and vegetable juices on the changes in the production of carcinogenic N-nitroso compounds in human gastric juice].

    Science.gov (United States)

    Ilńitskiĭ, A P; Iurchenko, V A

    1993-01-01

    The study was made of the effect of apple, grapefruit, orange and beet juices on in vitro formation of N-nitrosodimethylamine (NDMA) from sodium nitrite and amidopirin in human gastric juice (GJ). Experimental samples of GJ from outpatients attending the outpatient department of the AMS Cancer Research Center were used. The patients had various forms of gastritis and gastric cancer. It was found that fruit and beet juices may inhibit or enhance NDMA formation depending on the GJ composition, pH in particular. In acid medium (pH-1.3-3.4) there was a trend to inhibition of NDMA synthesis, while in neutral and alkaline (pH = 7.4-8.5) medium NDMA synthesis is activated. Practical implications of the findings are discussed.

  10. Living with a Red Dwarf: A Chandra Archival Study of dM Star Activity and Habitability

    Science.gov (United States)

    Engle, Scott

    2017-09-01

    We propose to analyze 6 archival Chandra visits, not pointed at, but serendipitously including 3 dM stars of known age. GJ 669 AB are a common proper motion pair, each are resolved and detected in 3 exposures, and LHS 373 is a much older dM star also detected on 3 exposures. Photometry (by us) of GJ 669 AB began 5 years ago, is ongoing, and has precisely determined rotation rates for both stars and evidence of frequent flaring from GJ 669 B. We will analyze the multiple exposures, derive an accurate mean level of X-ray activity from the targets, and also separate out and individually analyze and model any observed X-ray flares. This proposal will provide highly accurate coronal properties for the targets, but also very useful data for stellar evolution and planetary habitability studies.

  11. Near-Infrared Spectroscopy for Zeeman Spectra of Ti I in Plasma Using a Facing Target Sputtering System

    Science.gov (United States)

    Kobayashi, Shinji; Nishimiya, Nobuo; Suzuki, Masao

    2017-10-01

    The saturated absorption lines of neutral titanium were measured in the region of 9950-14380 cm-1 using a Ti:sapphire ring laser. A facing target sputtering system was used to obtain the gaseous state of a Ti I atom. The Zeeman splitting of 38 transitions was observed under the condition that the electric field component of a linearly polarized laser beam was parallel to the magnetic field. The gJ factors of the odd parity states were determined for 28 states belonging to 3d24s4p and 3d34p using those of the even parity states reported by Stachowska in 1997. The gJ factors of z5P1,2,3 levels were newly determined. gJ of y3F2, y3D2, z3P2, and z5S2 levels were refined.

  12. Swift X-ray monitoring of stellar coronal variability

    Science.gov (United States)

    Miller, Brendan; Hagen, Cedric; Gallo, Elena; Wright, Jason T.

    2018-01-01

    We used California Planet Search Ca II H and K core emission measurements to identify and characterize chromospheric activity cycles in a sample of main-sequence FGK stars. About a dozen of these with existing ROSAT archival data were targeted with Swift to obtain a current epoch X-ray flux. We find that coronal variability by a factor of several is common on decade-long timescales (we attempt to link to the chromospheric cycle phase) but can also occur on short timescales between Swift visits to a given target, presumably related to stellar rotation and coronal inhomogeneity or to small flares. Additionally, we present new Swift monitoring observations of two M dwarfs with known exoplanets: GJ 15A and GJ 674. GJ 15A b is around 5.3 Earth masses with an 11.4 day orbital period, while GJ 674 is around 11.1 Earth masses with a 4.7 day orbital period. GJ 15A was observed several times in late 2014 and then monitored at approximately weekly intervals for several months in early 2016, for a total exposure of 18 ks. GJ 674 was monitored at approximately weekly intervals for most of 2016, for a total exposure of 40 ks. We provide light curves and hardness ratios for both sources, and also compare to earlier archival X-ray data. Both sources show significant X-ray variability, including between consecutive observations. We quantify the energy distribution for coronal flaring, and compare to optical results for M dwarfs from Kepler. Finally, we discuss the implications of M dwarf coronal activity for exoplanets orbiting within the nominal habitable zone.

  13. Reduction of CO{sub 2} emission and oil dependency with biomass-based polygeneration

    Energy Technology Data Exchange (ETDEWEB)

    Joelsson, Jonas M; Gustavsson, Leif [Ecotechnology and Environmental Science, Department of Engineering and Sustainable Development, Mid Sweden University, SE-831 25 Oestersund (Sweden)

    2010-07-15

    We compare different options for the use of lignocellulosic biomass to reduce CO{sub 2} emission and oil use, focusing on polygeneration of biomass-based motor fuels and electricity, and discuss methodological issues related to such comparisons. The use of biomass can significantly reduce CO{sub 2} emission and oil use, but there is a trade-off between the reductions in CO{sub 2} emission and oil use. Bioelectricity from stand-alone plants replacing coal-based electricity reduced CO{sub 2} emission by 99 kg per GJ biomass input but gave no oil use reduction. Stand-alone produced methanol replacing diesel reduced the CO{sub 2} emission with 38 kg and the oil use with 0.67 GJ per GJ biomass, indicating that a potential CO{sub 2} emission reduction of 90 kg is lost per GJ oil reduced. CO{sub 2} emission and oil use reduction for alternatives co-producing fuel and electricity fall between the stand-alone alternatives. Plug-in hybrid-electric vehicles using bioelectricity reduced CO{sub 2} emission by 75-88 kg and oil use by 0.99-1.2 GJ, per GJ biomass input. Biomass can also reduce CO{sub 2} emission and/or oil use more efficiently if fossil-fuel-fired boilers or electric heating is replaced by district heating from biomass-based combined heat and power generation. This is also true if electricity or motor fuel is produced from black liquor gasification in pulp mills or if wood is used instead of concrete in building construction. Biomass gasification is an important technology to achieve large reductions, irrespective of whether CO{sub 2} emission or oil use reduction is prioritised. (author)

  14. Accurate measurement of junctional conductance between electrically coupled cells with dual whole-cell voltage-clamp under conditions of high series resistance.

    Science.gov (United States)

    Hartveit, Espen; Veruki, Margaret Lin

    2010-03-15

    Accurate measurement of the junctional conductance (G(j)) between electrically coupled cells can provide important information about the functional properties of coupling. With the development of tight-seal, whole-cell recording, it became possible to use dual, single-electrode voltage-clamp recording from pairs of small cells to measure G(j). Experiments that require reduced perturbation of the intracellular environment can be performed with high-resistance pipettes or the perforated-patch technique, but an accompanying increase in series resistance (R(s)) compromises voltage-clamp control and reduces the accuracy of G(j) measurements. Here, we present a detailed analysis of methodologies available for accurate determination of steady-state G(j) and related parameters under conditions of high R(s), using continuous or discontinuous single-electrode voltage-clamp (CSEVC or DSEVC) amplifiers to quantify the parameters of different equivalent electrical circuit model cells. Both types of amplifiers can provide accurate measurements of G(j), with errors less than 5% for a wide range of R(s) and G(j) values. However, CSEVC amplifiers need to be combined with R(s)-compensation or mathematical correction for the effects of nonzero R(s) and finite membrane resistance (R(m)). R(s)-compensation is difficult for higher values of R(s) and leads to instability that can damage the recorded cells. Mathematical correction for R(s) and R(m) yields highly accurate results, but depends on accurate estimates of R(s) throughout an experiment. DSEVC amplifiers display very accurate measurements over a larger range of R(s) values than CSEVC amplifiers and have the advantage that knowledge of R(s) is unnecessary, suggesting that they are preferable for long-duration experiments and/or recordings with high R(s). Copyright (c) 2009 Elsevier B.V. All rights reserved.

  15. The solar neighborhood. XXXIV. A search for planets orbiting nearby M dwarfs using astrometry

    International Nuclear Information System (INIS)

    Lurie, John C.; Henry, Todd J.; Ianna, Philip A.; Jao, Wei-Chun; Quinn, Samuel N.; Winters, Jennifer G.; Koerner, David W.; Riedel, Adric R.; Subasavage, John P.

    2014-01-01

    Astrometric measurements are presented for seven nearby stars with previously detected planets: six M dwarfs (GJ 317, GJ 667C, GJ 581, GJ 849, GJ 876, and GJ 1214) and one K dwarf (BD-10 -3166). Measurements are also presented for six additional nearby M dwarfs without known planets, but which are more favorable to astrometric detections of low mass companions, as well as three binary systems for which we provide astrometric orbit solutions. Observations have baselines of 3 to 13 years, and were made as part of the RECONS long-term astrometry and photometry program at the CTIO/SMARTS 0.9 m telescope. We provide trigonometric parallaxes and proper motions for all 16 systems, and perform an extensive analysis of the astrometric residuals to determine the minimum detectable companion mass for the 12 M dwarfs not having close stellar secondaries. For the six M dwarfs with known planets, we are not sensitive to planets, but can rule out the presence of all but the least massive brown dwarfs at periods of 2–12 years. For the six more astrometrically favorable M dwarfs, we conclude that none have brown dwarf companions, and are sensitive to companions with masses as low as 1 M Jup for periods longer than two years. In particular, we conclude that Proxima Centauri has no Jovian companions at orbital periods of 2–12 years. These results complement previously published M dwarf planet occurrence rates by providing astrometrically determined upper mass limits on potential super-Jupiter companions at orbits of two years and longer. As part of a continuing survey, these results are consistent with the paucity of super-Jupiter and brown dwarf companions we find among the over 250 red dwarfs within 25 pc observed longer than five years in our astrometric program.

  16. The solar neighborhood. XXXIV. A search for planets orbiting nearby M dwarfs using astrometry

    Energy Technology Data Exchange (ETDEWEB)

    Lurie, John C. [Department of Astronomy, University of Washington, Seattle, WA 98195 (United States); Henry, Todd J.; Ianna, Philip A. [RECONS Institute, Chambersburg, PA 17201 (United States); Jao, Wei-Chun; Quinn, Samuel N.; Winters, Jennifer G. [Department of Physics and Astronomy, Georgia State University, Atlanta, GA 30302 (United States); Koerner, David W. [Department of Physics and Astronomy, Northern Arizona University, Flagstaff, AZ 86011 (United States); Riedel, Adric R. [Department of Astrophysics, American Museum of Natural History, New York, NY 10034 (United States); Subasavage, John P., E-mail: lurie@uw.edu [United States Naval Observatory, Flagstaff, AZ 86001 (United States)

    2014-11-01

    Astrometric measurements are presented for seven nearby stars with previously detected planets: six M dwarfs (GJ 317, GJ 667C, GJ 581, GJ 849, GJ 876, and GJ 1214) and one K dwarf (BD-10 -3166). Measurements are also presented for six additional nearby M dwarfs without known planets, but which are more favorable to astrometric detections of low mass companions, as well as three binary systems for which we provide astrometric orbit solutions. Observations have baselines of 3 to 13 years, and were made as part of the RECONS long-term astrometry and photometry program at the CTIO/SMARTS 0.9 m telescope. We provide trigonometric parallaxes and proper motions for all 16 systems, and perform an extensive analysis of the astrometric residuals to determine the minimum detectable companion mass for the 12 M dwarfs not having close stellar secondaries. For the six M dwarfs with known planets, we are not sensitive to planets, but can rule out the presence of all but the least massive brown dwarfs at periods of 2–12 years. For the six more astrometrically favorable M dwarfs, we conclude that none have brown dwarf companions, and are sensitive to companions with masses as low as 1 M{sub Jup} for periods longer than two years. In particular, we conclude that Proxima Centauri has no Jovian companions at orbital periods of 2–12 years. These results complement previously published M dwarf planet occurrence rates by providing astrometrically determined upper mass limits on potential super-Jupiter companions at orbits of two years and longer. As part of a continuing survey, these results are consistent with the paucity of super-Jupiter and brown dwarf companions we find among the over 250 red dwarfs within 25 pc observed longer than five years in our astrometric program.

  17. Nonlinear analysis of doubly curved shells: An analytical approach

    Indian Academy of Sciences (India)

    Е10Ж. 0rЕs└1Ж. iY j. И Й0rs. iY j└1 З 0rs. iY jЗ1Кa2jX. Е11Ж. Nonlinearity in the governing equations of motion is due to the product of the dependent variables. The quadratic extrapolation technique is used for the linearization and a typical nonlinear function Gj can be expressed at any step j as,. Gj И Е0rЖJЕ0sЖJ. И. И.

  18. Performance monitoring of different module technologies and design configurations of PV system in South Africa

    CSIR Research Space (South Africa)

    Roro, Kittessa T

    2016-06-01

    Full Text Available /diesel fuel cost; CSIR analysis Renewables Conventionals 50% 92% 50% 10% Assumed load factor  Fuel cost @ 92 R/GJ 7.39 €/GJ 10% Lifetime cost per energy unit 85% 4 Coal/gas new-build options 7.6 14.3 23.9 0 2 4 6 8 10 12 14 16 18... distance <10 m) Similar inverter, AC cable size, DC cable size 14 Agenda Polycrystalline and thin film Market and Technology status The ERIC system description Methodology Performance comparison 15 1. Module technology...

  19. A global vision for energy forestry: concluding comments

    International Nuclear Information System (INIS)

    Dupont-Roc, Georges

    1997-01-01

    Two energy visions, aimed at predicting future energy demand and consumption, are contrasted to explore the likely future blend of energy resources utilized. In the ''sustained growth'' model both supply and demand grow, reaching 150 GJ yr -1 per capita by 2060. In the ''dematerialisation'' model lower energy input technologies allow an energy use per capita of 90 GJ yr -1 by the same year. Fossil fuel use peaks at different times and renewable energy sources penetrate the market more thoroughly leading to a more diverse and robust world energy system. (UK)

  20. Outlook for advanced biofuels

    International Nuclear Information System (INIS)

    Hamelinck, Carlo N; Faaij, Andre P.C.

    2006-01-01

    To assess which biofuels have the better potential for the short-term or the longer term (2030), and what developments are necessary to improve the performance of biofuels, the production of four promising biofuels-methanol, ethanol, hydrogen, and synthetic diesel-is systematically analysed. This present paper summarises, normalises and compares earlier reported work. First, the key technologies for the production of these fuels, such as gasification, gas processing, synthesis, hydrolysis, and fermentation, and their improvement options are studied and modelled. Then, the production facility's technological and economic performance is analysed, applying variations in technology and scale. Finally, likely biofuels chains (including distribution to cars, and end-use) are compared on an equal economic basis, such as costs per kilometre driven. Production costs of these fuels range 16-22 Euro /GJ HHV now, down to 9-13 Euro /GJ HHV in future (2030). This performance assumes both certain technological developments as well as the availability of biomass at 3 Euro /GJ HHV . The feedstock costs strongly influence the resulting biofuel costs by 2-3 Euro /GJ fuel for each Euro /GJ HHV feedstock difference. In biomass producing regions such as Latin America or the former USSR, the four fuels could be produced at 7-11 Euro /GJ HHV compared to diesel and gasoline costs of 7 and 8 Euro /GJ (excluding distribution, excise and VAT; at crude oil prices of ∼35 Euro /bbl or 5.7 Euro /GJ). The uncertainties in the biofuels production costs of the four selected biofuels are 15-30%. When applied in cars, biofuels have driving costs in ICEVs of about 0.18-0.24 Euro /km now (fuel excise duty and VAT excluded) and may be about 0.18 in future. The cars' contribution to these costs is much larger than the fuels' contribution. Large-scale gasification, thorough gas cleaning, and micro-biological processes for hydrolysis and fermentation are key major fields for RD and D efforts, next to

  1. Energy and electricity within the transformed economy of the Czech Republic

    International Nuclear Information System (INIS)

    Vazac, V.

    1995-01-01

    The development of the contribution of electricity generation to the power economy of Czechoslovakia, the Czech Republic, and of selected market economy countries is documented. The countries include Belgium, Japan, West Germany (prior to unification), Austria, Switzerland, and the US. The following parameters are given: per capita electricity and energy use (in kWh and GJ, respectively) and the share of electricity in the energy used by the country (in kWh/GJ). In all of the countries except Switzerland, the electricity share in the total energy use exhibits an increasing trend. (J.B.). 3 tabs

  2. A History of the Heart

    DEFF Research Database (Denmark)

    Høystad, Ole Martin

    Boken gjør rede for hvordan hjertet er blitt oppfattet og billedligt repræsentert i ulike tider i ulike kulturer, med vekt på høykulturene i første del, og på europeisk kultur i andre del av boken  ......Boken gjør rede for hvordan hjertet er blitt oppfattet og billedligt repræsentert i ulike tider i ulike kulturer, med vekt på høykulturene i første del, og på europeisk kultur i andre del av boken  ...

  3. Endoscopic gastric pouch plication – a novel endoluminal incision free approach to revisional bariatric surgery

    Directory of Open Access Journals (Sweden)

    Virk CS

    2010-04-01

    Full Text Available 10-40% of Roux-en-Y gastric bypass (RYGB patients regain significant weight after Roux-en-Y gastric bypass surgery due to dilation of the pouch and/or the gastrojejunal (GJ anastomosis. Traditional revision surgery is associated with significant morbidity (e.g. post-anastomotic GJ leak where less invasive endoluminal procedures may represent safer alternatives. The present article reports a case of the safe and successful use of endoluminal gastric pouch plication (EGPP using the StomaphyX™ device to correct both a dilated gastric pouch and a dilated gastrojejunostomy in a post-RYGB patient who regained significant weight.

  4. Statistical eclipses of close-in Kepler sub-Saturns

    Energy Technology Data Exchange (ETDEWEB)

    Sheets, Holly A.; Deming, Drake, E-mail: hsheets@astro.umd.edu [Department of Astronomy, University of Maryland, College Park, MD 20742-2421 (United States)

    2014-10-20

    We present a method to detect small atmospheric signals in Kepler's planet candidate light curves by averaging light curves for multiple candidates with similar orbital and physical characteristics. Our statistical method allows us to measure unbiased physical properties of Kepler's planet candidates, even for candidates whose individual signal-to-noise precludes the detection of their secondary eclipse. We detect a secondary eclipse depth of 3.83{sub −1.11}{sup +1.10} ppm for a group of 31 sub-Saturn (R < 6 R {sub ⊕}) planet candidates with the greatest potential for a reflected light signature ((R{sub p} /a){sup 2} > 10 ppm). Including Kepler-10b in this group increases the depth to 5.08{sub −0.72}{sup +0.71} ppm. For a control group with (R{sub p} /a){sup 2} < 1 ppm, we find a depth of 0.36 ± 0.37 ppm, consistent with no detection. We also analyze the light curve of Kepler-10b and find an eclipse depth of 7.08 ± 1.06 ppm. If the eclipses are due solely to reflected light, this corresponds to a geometric albedo of 0.22 ± 0.06 for our group of close-in sub-Saturns, 0.37 ± 0.05 if including Kepler-10b in the group, and 0.60 ± 0.09 for Kepler-10b alone. Including a thermal emission model does not change the geometric albedo appreciably, assuming A{sub B} = (3/2)*A{sub g} . Our result for Kepler-10b is consistent with previous works. Our result for close-in sub-Saturns shows that Kepler-10b is unusually reflective, but our analysis is consistent with the results of Demory for super-Earths. Our results also indicate that hot Neptunes are typically more reflective than hot Jupiters.

  5. The course of functional status and muscle strength in patients with late-onset sequelae of poliomyelitis: A systematic review

    NARCIS (Netherlands)

    Stolwijk-Swüste, Janneke M.; Beelen, Anita; Lankhorst, Gustaaf J.; Nollet, Frans

    2005-01-01

    Stolwijk-SwUste JM, Beelen A, Lankhorst GJ, Nollet F, for the CARPA Study Group. The course of functional status and muscle strength in patients with late-onset sequelae of poliomyelitis: a systematic review. Arch Phys Med Rehabil 2005;86:1693-701. Objectives: To review systematically studies of

  6. A new gonad-infecting species of Philometra (Nematoda: Philometridae) from the red cusk-eel Genypterus chilensis (Osteichthyes: Ophidiidae) off Chile

    Czech Academy of Sciences Publication Activity Database

    Moravec, František; Chávez, R. A.; Oliva, M. E.

    2011-01-01

    Roč. 108, č. 1 (2011), s. 227-232 ISSN 0932-0113 R&D Projects: GA MŠk LC522 Institutional research plan: CEZ:AV0Z60220518 Keywords : Philometra * Genypterus * Chile Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 2.149, year: 2011

  7. Raphidascaris (Raphidascaris) macrouri n. sp (Nematoda: Anisakidae) from two deep-sea macrourid fishes in the Western Mediterranean: Morphological and molecular characterisations

    Czech Academy of Sciences Publication Activity Database

    Pérez-i-García, D.; Constenla, M.; Carrasson, M.; Montero, F. E.; Soler-Membrives, A.; González-Solís, David

    2015-01-01

    Roč. 64, č. 5 (2015), s. 345-352 ISSN 1383-5769 R&D Projects: GA ČR(CZ) GBP505/12/G112 Institutional support: RVO:60077344 Keywords : Raphidascaris (Raphidascaris) macrouri * deep-water * Macrouridae * Nezumia aequalis * Trachyrincus scabrus * Spain Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 1.860, year: 2015

  8. Detection of shrew-borne hantavirus in Eurasian pygmy shrew (Sorex minutus) in Central Europe

    Czech Academy of Sciences Publication Activity Database

    Radosa, L.; Schlegel, M.; Gebauer, P.; Ansorge, H.; Heroldová, Marta; Jánová, Eva; Stanko, M.; Mošanský, L.; Fričová, J.; Pejčoch, M.; Suchomel, J.; Purchart, L.; Groschup, M. H.; Krüger, D. H.; Ulrich, R. G.; Klempa, B.

    2013-01-01

    Roč. 19, October (2013), s. 403-410 ISSN 1567-1348 Institutional support: RVO:68081766 Keywords : Hantavirus * shrew Sorex minutus * Asikkala virus * Cental Europe Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 3.264, year: 2013

  9. A revision of the genus Aphalloides (Digenea: Cryptogonimidae), parasites of European brackish water fishes

    Czech Academy of Sciences Publication Activity Database

    Kvach, Yuriy; Bryjová, A.; Sasal, P.; Winkler, H. M.

    2017-01-01

    Roč. 116, č. 7 (2017), s. 1973-1980 ISSN 0932-0113 R&D Projects: GA ČR(CZ) GBP505/12/G112 Institutional support: RVO:60077344 Keywords : Aphalloides * Taxonomic revision * Zoogeography * Molecular study Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine OBOR OECD: Veterinary science Impact factor: 2.329, year: 2016

  10. New data on the morphology of Dichelyne hartwichi (Nematoda, Cucullanidae), a parasite of freshwater tetraodontid fishes (Tetraodon spp.) in Thailand

    Czech Academy of Sciences Publication Activity Database

    Moravec, František; Fiala, Ivan; Dyková, Iva

    2011-01-01

    Roč. 56, č. 4 (2011), s. 433-437 ISSN 1230-2821 R&D Projects: GA MŠk LC522 Institutional research plan: CEZ:AV0Z60220518 Keywords : Parasitic nematode * Dichelyne * freshwater fish * Tetraodon * Thailand Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 0.789, year: 2011

  11. Heliconema longissimum (Ortlepp, 1923) (Nematoda: Physalopteridae) from Pisodonophis boro (Teleostei: Ophichthidae) in Thailand, with remarks on the taxonomy of the Proleptinae Schulz, 1927

    Czech Academy of Sciences Publication Activity Database

    Moravec, František; Taraschewski, H.; Thairungroj Anantaphruti, M.; Maipanich, W.; Laoprasert, T.

    2007-01-01

    Roč. 66, č. 1 (2007), s. 73-80 ISSN 0165-5752 R&D Projects: GA ČR(CZ) GA524/06/0170; GA MŠk LC522 Institutional research plan: CEZ:AV0Z60220518 Keywords : Heliconema * Pisodonophis * Thailand Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 1.125, year: 2007

  12. Raphidascaris (Ichthyascaris) arii sp n. (Nematoda: Anisakidae), a new ascaridoid nematode from marine catfishes in the Gulf of Thailand

    Czech Academy of Sciences Publication Activity Database

    Yooyen, T.; Moravec, František; Wongsawad, C.

    2011-01-01

    Roč. 48, č. 4 (2011), 262-267 ISSN 0440-6605 R&D Projects: GA MŠk LC522 Institutional research plan: CEZ:AV0Z60220518 Keywords : parasitic nematode * Raphidascaris * Ichthyascaris * Thailand Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 0.773, year: 2011

  13. Observations on two nematode species parasitizing freshwater fishes in Thailand, including Spinitectus thaiensis sp nov (Cystidicolidae) from Pseudomystus siamensis (Bagridae)

    Czech Academy of Sciences Publication Activity Database

    Moravec, František; Yooyen, T.

    2011-01-01

    Roč. 56, č. 1 (2011), 58-66 ISSN 1230-2821 Institutional research plan: CEZ:AV0Z60220518 Keywords : Parasitic nematode * freshwater fish * Thailand Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 0.789, year: 2011

  14. Procamallanus (Spirocamallanus) anguillae sp. n. (Camallanidae) and some other nematodes from the Indonesian shortfin eel Anguilla bicolor in Thailand

    Czech Academy of Sciences Publication Activity Database

    Moravec, František; Taraschewski, H.; Thairungroj Anantaphruti, M.; Maipanich, W.; Laoprasert, T.

    2006-01-01

    Roč. 100, č. 1 (2006), s. 69-75 ISSN 0932-0113 R&D Projects: GA ČR(CZ) GA524/06/0170 Institutional research plan: CEZ:AV0Z60220518 Keywords : Procamallanus * Anguilla * Thailand Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 1.140, year: 2006

  15. Two new sibling species of Procamallanus (Spirocamallanus) (Nematoda: Camallanidae) from marine fishes in the Gulf of Thailand

    Czech Academy of Sciences Publication Activity Database

    Yooyen, T.; Moravec, František; Wongsawad, C.

    2011-01-01

    Roč. 97, č. 5 (2011), 931-938 ISSN 0022-3395 R&D Projects: GA MŠk LC522 Institutional research plan: CEZ:AV0Z60220518 Keywords : Procamallanus * Perciformes * Thailand Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 1.405, year: 2011

  16. Two new species of Cucullanus Mu¨ ller, 1777 (Nematoda: Cucullanidae) from marine fishes off Thailand

    Czech Academy of Sciences Publication Activity Database

    Yooyen, T.; Moravec, František; Wongsawad, C.

    2011-01-01

    Roč. 78, č. 2 (2011), s. 139-149 ISSN 0165-5752 R&D Projects: GA MŠk LC522 Institutional research plan: CEZ:AV0Z60220518 Keywords : Cucullanus * marine fish * Thailand Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 1.250, year: 2011

  17. Philometra thaiensis sp. nov. (Nematoda, Philometridae) from Tetraodon palembangensis and T. fluviatilis (Pisces) from fresh waters in Thailand, with a key to Philometra spp. parasitic in the host's abdominal cavity

    Czech Academy of Sciences Publication Activity Database

    Moravec, František; Fiala, Ivan; Dyková, Iva

    2004-01-01

    Roč. 49, č. 4 (2004), s. 319-324 ISSN 1230-2821 R&D Projects: GA ČR GA524/03/0061 Institutional research plan: CEZ:AV0Z6022909 Keywords : Nematoda * Philometra * parasite Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 0.560, year: 2004

  18. The prognostic role of classical and nonclassical MHC class I expression in endometrial cancer

    NARCIS (Netherlands)

    Bijen, C.B.; Bantema-Joppe, E.J.; de Jong, Renske; Leffers, N.; Mourits, M.J.; Eggink, Henk F.; van der Zee, A.G.; Hollema, H.; de Bock, G.H.; Nijman, H.W.

    2010-01-01

    The aim of this study was to investigate classical MHC class I and nonclassical MHC (human leukocyte antigen-G [HLA-GJ) expression in a large cohort of patients with endometrial cancer, to determine the prognostic value of these cell surface markers and their relation with clinicopathological

  19. Protection by Purines in Toxin Models of Parkinson’s Disease

    Science.gov (United States)

    2013-07-01

    Puringergic Pathways to Clinical Trials for Parkinson’s Disease" [pending]. NIH (NINDS/ NIA ) R21 in response to FOA PA-11-261, “NIH Exploratory...pyrimidine bases, ribonucleosides, and ribonucleotides by high-pressure liquid chromatography. Analytical Biochemistry 1980; 106(2): 497– 505 . Quinlan GJ

  20. Ultrastructural study of spermiogenesis and the spermatozoon of the proteocephalidean cestode Barsonella lafoni de Chambrier et al., 2009, a parasite of the catfish Clarias gariepinus (Burchell, 1822) (Siluriformes, Clariidae)

    Czech Academy of Sciences Publication Activity Database

    Marigo, A. M.; Levron, Céline; Bâ, Ch. T.; Miquel, J.

    2012-01-01

    Roč. 251, č. 2 (2012), s. 147-159 ISSN 0044-5231 R&D Projects: GA AV ČR KJB600960813 Institutional research plan: CEZ:AV0Z60220518 Keywords : Spermiogenesis * Spermatozoon * Ultrastructure * Barsonella lafoni * Proteocephalinae * Proteocephalidae * Proteocephalidea * Cestoda Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 1.400, year: 2012

  1. ORF Alignment: NC_002695 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available 33) ref|NP_312213.1| 30S ribosomal subunit protein ... S10 [Escherichia coli O157:H7] pdb|1P87|J Chain J, Real ... Spac...P6G|J Chain J, Real ... Space Refined Coordinates Of The 30s Subunit Fitted Into ... The Low R

  2. ORF Alignment: NC_004741 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available 33) ref|NP_312213.1| 30S ribosomal subunit protein ... S10 [Escherichia coli O157:H7] pdb|1P87|J Chain J, Real ... Spac...P6G|J Chain J, Real ... Space Refined Coordinates Of The 30s Subunit Fitted Into ... The Low R

  3. ORF Alignment: NC_004337 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available 33) ref|NP_312213.1| 30S ribosomal subunit protein ... S10 [Escherichia coli O157:H7] pdb|1P87|J Chain J, Real ... Spac...P6G|J Chain J, Real ... Space Refined Coordinates Of The 30s Subunit Fitted Into ... The Low R

  4. ORF Alignment: NC_002655 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available 33) ref|NP_312213.1| 30S ribosomal subunit protein ... S10 [Escherichia coli O157:H7] pdb|1P87|J Chain J, Real ... Spac...P6G|J Chain J, Real ... Space Refined Coordinates Of The 30s Subunit Fitted Into ... The Low R

  5. ORF Alignment: NC_000913 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available 33) ref|NP_312213.1| 30S ribosomal subunit protein ... S10 [Escherichia coli O157:H7] pdb|1P87|J Chain J, Real ... Spac...P6G|J Chain J, Real ... Space Refined Coordinates Of The 30s Subunit Fitted Into ... The Low R

  6. ORF Alignment: NC_004431 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available 33) ref|NP_312213.1| 30S ribosomal subunit protein ... S10 [Escherichia coli O157:H7] pdb|1P87|J Chain J, Real ... Spac...P6G|J Chain J, Real ... Space Refined Coordinates Of The 30s Subunit Fitted Into ... The Low R

  7. A shark antibody heavy chain encoded by a nonsomatically rearranged VDJ is preferentially expressed in early development and is convergent with mammalian IgG.

    Science.gov (United States)

    Rumfelt, L L; Avila, D; Diaz, M; Bartl, S; McKinney, E C; Flajnik, M F

    2001-02-13

    In most vertebrate embryos and neonates studied to date unique antigen receptors (antibodies and T cell receptors) are expressed that possess a limited immune repertoire. We have isolated a subclass of IgM, IgM(1gj), from the nurse shark Ginglymostoma cirratum that is preferentially expressed in neonates. The variable (V) region gene encoding the heavy (H) chain underwent V-D-J rearrangement in germ cells ("germline-joined"). Such H chain V genes were discovered over 10 years ago in sharks but until now were not shown to be expressed at appreciable levels; we find expression of H(1gj) in primary and secondary lymphoid tissues early in life, but in adults only in primary lymphoid tissue, which is identified in this work as the epigonal organ. H(1gj) chain associates covalently with light (L) chains and is most similar in sequence to IgM H chains, but like mammalian IgG has three rather than the four IgM constant domains; deletion of the ancestral IgM C2 domain thus defines both IgG and IgM(1gj). Because sharks are the members of the oldest vertebrate class known to possess antibodies, unique or specialized antibodies expressed early in ontogeny in sharks and other vertebrates were likely present at the inception of the adaptive immune system.

  8. Multiple origins of European populations of the giant liver fluke Fascioloides magna (Trematoda: Fasciolidae), a liver parasite of ruminants

    Czech Academy of Sciences Publication Activity Database

    Kraľová-Hromadová, I.; Bazsalovicsová, E.; Štefka, Jan; Špakulová, M.; Vávrová, S.; Szemes, T.; Tkach, V.; Trudgett, A.; Pybus, M.

    2011-01-01

    Roč. 41, 3/4 (2011), 373-383 ISSN 0020-7519 Institutional research plan: CEZ:AV0Z60220518 Keywords : Biogeography * Alien species * Introduced parasite * Mitochondrial DNA * Cytochrome c oxidase * Nicotinamide dehydrogenase Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 3.393, year: 2011

  9. Cryptosporidium erinacei and C. parvum in a group of overwintering hedgehogs

    Czech Academy of Sciences Publication Activity Database

    Hofmannová, L.; Hauptman, K.; Huclová, K.; Květoňová, Dana; Sak, Bohumil; Kváč, Martin

    2016-01-01

    Roč. 56, č. 1 (2016), s. 15-20 ISSN 0932-4739 R&D Projects: GA ČR GA15-01090S Institutional support: RVO:60077344 Keywords : Cryptosporidiosis * Erinaceus europaeus * European hedgehog Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 2.581, year: 2016

  10. Orientatractis brycini sp. nov. (Nematoda: Atractidae) from characiform freshwater fishes in Gabon, Africa

    Czech Academy of Sciences Publication Activity Database

    González-Solís, David; Mariaux, J.

    2017-01-01

    Roč. 124, č. 1 (2017), s. 1-8 ISSN 0035-418X R&D Projects: GA ČR(CZ) GBP505/12/G112 Institutional support: RVO:60077344 Keywords : new species * nematode * Brycinus * Xenocharax Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine OBOR OECD: Veterinary science Impact factor: 0.380, year: 2016

  11. Case report

    African Journals Online (AJOL)

    raoul

    12 août 2010 ... Estermann F, B Denis, P Gaucher, D Regent, and D Sondag. Pneumatosis cystoides of the colon: knowing how to recognize it - Apropos of 8 cases. Ann Gastroenterol Hepatol (Paris). 1994; 30(4): 151-155. This article on PubMed. 12. Pun YL, DM Russell, GJ Taggart, and DR Barraclough. Pneumatosis ...

  12. Empirical D3 Dispersion as a Replacement for ab lnitio Dispersion Terms in Density Functional Theory-Based Symmetry-Adapted Perturbation Theory

    Czech Academy of Sciences Publication Activity Database

    Sedlák, Robert; Řezáč, Jan

    2017-01-01

    Roč. 13, č. 4 (2017), s. 1638-1646 ISSN 1549-9618 R&D Projects: GA ČR(CZ) GJ16-11321Y Institutional support: RVO:61388963 Keywords : intermolecular interaction energies * der Waals interactions * basis set convergence Subject RIV: CF - Physical ; Theoretical Chemistry OBOR OECD: Physical chemistry Impact factor: 5.245, year: 2016

  13. Surface morphology of Nicolla skrjabini (Trematoda: Opecoelidae), a common parasite of European freshwater fishes, as revealed by SEM

    Czech Academy of Sciences Publication Activity Database

    Moravec, František

    2009-01-01

    Roč. 105, č. 2 (2009), s. 577-578 ISSN 0932-0113 R&D Projects: GA MŠk LC522 Institutional research plan: CEZ:AV0Z60220518 Keywords : surface ultrastructure * Nicolla * Czech Republic Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 1.721, year: 2009

  14. Ultrastructure of the spermatozoon of the proteocephalidean cestode Proteocephalus torulosus (Batsch, 1786)

    Czech Academy of Sciences Publication Activity Database

    Bruňanská, Magdaléna; Nebesářová, Jana; Scholz, Tomáš

    2003-01-01

    Roč. 89, č. 5 (2003), s. 345-351 ISSN 0932-0113 R&D Projects: GA ČR GA524/01/1314 Institutional research plan: CEZ:AV0Z6022909 Keywords : cestoda * spermatozoon * ultrastructure Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 1.000, year: 2003

  15. On integrability of certain rank 2 sub-Riemannian structures

    Czech Academy of Sciences Publication Activity Database

    Kruglikov, B.S.; Vollmer, A.; Lukes-Gerakopoulos, Georgios

    2017-01-01

    Roč. 22, č. 5 (2017), s. 502-519 ISSN 1560-3547 R&D Projects: GA ČR(CZ) GJ17-06962Y Institutional support: RVO:67985815 Keywords : sub-Riemannian geodesic flow * Killing tensor * integral Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics OBOR OECD: Astronomy (including astrophysics,space science) Impact factor: 1.562, year: 2016

  16. Do habituation, host traits and seasonality have an impact on protist and helminth infections of wild western lowland gorillas?

    Czech Academy of Sciences Publication Activity Database

    Pafčo, B.; Benavides, J. A.; Pšenková-Profousová, I.; Modrý, D.; Červená, B.; Shutt, K. A.; Hasegawa, H.; Fuh, T.; Todd, A. F.; Petrželková, Klára Judita

    2017-01-01

    Roč. 116, č. 12 (2017), s. 3401-3410 ISSN 0932-0113 R&D Projects: GA ČR GA15-05180S Institutional support: RVO:68081766 Keywords : Western lowland gorilla * Parasite * Habituation * Human impact Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine OBOR OECD: Parasitology Impact factor: 2.329, year: 2016

  17. Interactive Graphic Journalism

    NARCIS (Netherlands)

    Schlichting, Laura

    2016-01-01

    textabstractThis paper examines graphic journalism (GJ) in a transmedial context, and argues that transmedial graphic journalism (TMGJ) is an important and fruitful new form of visual storytelling, that will re-invigorate the field of journalism, as it steadily tests out and plays with new media,

  18. Development of a Multilocus Sequence Tool for Typing Cryptosporidium muris and Cryptosporidium andersoni

    Czech Academy of Sciences Publication Activity Database

    Feng, Y.; Yang, W.; Ryan, U. M.; Zhang, L.; Kváč, Martin; Koudela, Břetislav; Modrý, David; Li, N.; Fayer, R.; Xiao, L.

    2011-01-01

    Roč. 49, č. 1 (2011), s. 34-41 ISSN 0095-1137 Institutional research plan: CEZ:AV0Z60220518 Keywords : ASTERN UNITED-STATES * RIBOSOMAL-RNA GENE * PHYLOGENETIC ANALYSIS * MOLECULAR ANALYSIS * NATURAL INFECTION * DAIRY- CATTLE * PREVALENCE * GENOTYPES * HUMANS * KENYA Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 4.153, year: 2011

  19. Variability in susceptibility of voles (Arvicolinae) to experimental infection with Cryptosporidium muris and Cryptosporidium andersoni

    Czech Academy of Sciences Publication Activity Database

    Modrý, David; Hofmannová, L.; Antalová, Z.; Sak, Bohumil; Kváč, Martin

    2012-01-01

    Roč. 111, č. 1 (2012), s. 471-473 ISSN 0932-0113 R&D Projects: GA MŠk(CZ) LH11061 Institutional support: RVO:60077344 Keywords : C-MURIS * CATTLE * PARVUM Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 2.852, year: 2012

  20. First identification of Neospora caninum by PCR in aborted bovine foetuses in Romania

    Czech Academy of Sciences Publication Activity Database

    Suteu, O.; Titilincu, A.; Modrý, David; Mihalca, A. D.; Mircean, A.; Cozma, V.

    2010-01-01

    Roč. 106, č. 3 (2010), s. 719-722 ISSN 0932-0113 Institutional research plan: CEZ:AV0Z60220518 Keywords : DEFINITIVE HOSTS * DAIRY- CATTLE * transmission * ABORTIONS Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 1.812, year: 2010

  1. Experimental demonstration of the reverse flow catalytic membrane reactor concept for energy efficient syngas production. Part 1: Influence of operating conditions

    NARCIS (Netherlands)

    Smit, J.; Bekink, G.J.; Sint Annaland, van M.; Kuipers, J.A.M.

    2007-01-01

    In this contribution the technical feasibility of the reverse flow catalytic membrane reactor (RFCMR) concept with porous membranes for energy efficient syngas production is investigated. In earlier work an experimental proof of principle was already provided [Smit, J., Bekink, G.J., van Sint

  2. Experimental demonstration of the reverse flow catalytic membrane reactor concept for energy efficient syngas production. Part 2: Model development

    NARCIS (Netherlands)

    Smit, J.; Bekink, G.J.; Sint Annaland, van M.; Kuipers, J.A.M.

    2007-01-01

    In this contribution the technical feasibility of the reverse flow catalytic membrane reactor (RFCMR) concept with porous membranes for energy efficient syngas production is investigated. In earlier work an experimental proof of principle was already provided [Smit, J., Bekink, G.J., van Sint

  3. A new species of Procamallanus (Nematoda: Camallanidae) from Pacific eels (Anguilla spp.)

    Czech Academy of Sciences Publication Activity Database

    Moravec, František; Justine, J.-L.; Würtz, J.; Taraschewski, H.; Sasal, P.

    2006-01-01

    Roč. 92, č. 1 (2006), s. 130-137 ISSN 0022-3395 R&D Projects: GA ČR(CZ) GA524/06/0170 Institutional research plan: CEZ:AV0Z60220518 Keywords : Procamallanus * Anguilla Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 1.300, year: 2006

  4. Regional new energy vision for Kakegawa City. Formulation survey report; 2001 nendo Kakegawa shi chiiki shin energy vision sakutei chosa hokokusho

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2002-02-01

    For promoting the introduction of new energy and for enhancing people's consciousness of such at Kakegawa City, Shizuoka Prefecture, surveys and studies were conducted involving the energy demand of the city, the amount of new energy resources in existence, and new energy introduction projects, and a vision was formulated. The city consumes approximately 11,638 GJ/year, with the industrial sector consuming 4,896 GJ, the residential/commercial sector 3,608 GJ, and the transportation sector 3,134 GJ. Energy types are electric power, gas oil, heavy oil, gasoline, kerosene, LPG, and town gas, as listed in the descending order in terms of consumption rate. The amount of carbon dioxide resulting from the consumption is estimated at 673,214 t-CO2. Projects for new energy introduction were studied, which involved photovoltaic power generation for the general-purpose gymnasium, kindergartens, the school meal center, and meeting places; introduction of solar heat utilization systems into public facilities; financial support system for the purchase of solar heat utilization apparatuses; refuse-fueled power generation and heat utilization at a new cleaning center; utilization of biogas from garbage and stock raising waste; utilization of woody resources; clean-energy vehicles; and so on. (NEDO)

  5. The water footprint of energy from biomass: a quantitative assessment and consequences of an increasing share of bio-energy in energy supply

    NARCIS (Netherlands)

    Gerbens-Leenes, Winnie; Hoekstra, Arjen Ysbert; van der Meer, Theodorus H.

    2009-01-01

    This paper assesses the water footprint (WF) of different primary energy carriers derived from biomass expressed as the amount of water consumed to produce a unit of energy (m3/GJ). The paper observes large differences among the WFs for specific types of primary bio-energy carriers. The WF depends

  6. Spinitectus aguapeiensis n. sp (Nematoda: Cystidicolidae) from Pimelodella avanhandavae Eigenmann (Siluriformes: Heptapteridae) in the River Aguapei, Upper Parana River Basin, Brazil

    Czech Academy of Sciences Publication Activity Database

    Acosta, A.A.; González-Solís, David; Da Silva, R.J.

    2017-01-01

    Roč. 94, č. 6 (2017), s. 649-656 ISSN 0165-5752 R&D Projects: GA ČR(CZ) GBP505/12/G112 Institutional support: RVO:60077344 Keywords : fresh-water fish * southern Mexico * intestine * osorioi * Chiapas Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine OBOR OECD: Veterinary science Impact factor: 1.181, year: 2016

  7. Dawestrema cycloancistrium (Monogenea) from the head pores of arapaimas

    Czech Academy of Sciences Publication Activity Database

    Santos, C. P.; Da Silva, M.T.; Moravec, František

    2017-01-01

    Roč. 125, č. 2 (2017), s. 93-100 ISSN 0177-5103 Institutional support: RVO:60077344 Keywords : Amazonia * Arapaima gigas * Brazil * Freshwater fish * Monogenea * Parasite * Peru * Pirarucu Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine OBOR OECD: Veterinary science Impact factor: 1.549, year: 2016

  8. A tonoplast intrinsic protein in Gardenia jasminoides

    Science.gov (United States)

    Gao, Lan; Li, Hao-Ming

    2017-08-01

    Physiological and molecular studies proved that plasma membrane intrinsic proteins (PIPs) and tonoplast intrinsic proteins (TIPs) subfamily of aquaporins play key functions in plant water homeostasis. Five specialized subgroups (TIP1-5) of TIPs have been found in higher plants, in which the TIP1 and TIP2 isoforms are the largest arbitrary groups. TIPs have high water-transport activity than PIPs, some TIPs can transport other small molecule such as urea, ammonia, hydrogen peroxide, and carbon dioxide. In this work, the structure of the putative tonoplast aquaporin from Gardenia jasminoides (GjTIP) was analyzed. Its transcript level has increased during fruit maturation. A phylogenetic analysis indicates that the protein belongs to TIP1 subfamily. A three-dimensional model structure of GjTIP was built based on crystal structure of an ammonia-permeable AtTIP2-1 from Arabidopsis thaliana. The model structure displayed as a homo-tetramer, each monomer has six trans-membrane and two half-membrane-spanning α helices. The data suggests that the GjTIP has tendency to be a mixed function aquaporin, might involve in water, urea and hydrogen peroxide transport, and the gating machanism founded in some AQPs involving pH and phosphorylation response have not been proved in GjTIP.

  9. A comparative molecular survey of malaria prevalence among Eastern chimpanzee populations in Issa Valley (Tanzania) and Kalinzu (Uganda)

    Czech Academy of Sciences Publication Activity Database

    Mapua, M. I.; Petrželková, Klára Judita; Burgunder, J.; Dadáková, E.; Brožová, K.; Hrazdilová, K.; Stewart, F. A.; Piel, A. K.; Vallo, Peter; Fuehrer, H.-P.; Hashimoto, C.; Modrý, D.; Qablan, M. A.

    2016-01-01

    Roč. 15, č. 423 (2016), s. 423 ISSN 1475-2875 Institutional support: RVO:68081766 Keywords : Cyt-b gene * Laverania * Malaria * Pan troglodytes schweinfurthii * Plasmodium spp Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 2.715, year: 2016

  10. A comparative molecular survey of malaria prevalence among Eastern chimpanzee populations in Issa Valley (Tanzania) and Kalinzu (Uganda)

    Czech Academy of Sciences Publication Activity Database

    Mapua, M. I.; Petrželková, Klára Judita; Burgunder, J.; Dadáková, E.; Brožová, K.; Hrazdilová, K.; Stewart, F. A.; Piel, A. K.; Vallo, P.; Fuehrer, H.-P.; Hashimoto, C.; Modrý, David; Qablan, M. A.

    2016-01-01

    Roč. 15, AUG 19 (2016), č. článku 423. ISSN 1475-2875 Institutional support: RVO:60077344 Keywords : Malaria * Pan troglodytes schweinfurthii * Plasmodium spp. * Laverania * Cyt-b gene Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 2.715, year: 2016

  11. Redescription of Ichthyouris bursata Moravec & Prouza, 1995 (Nematoda: Pharyngodonidae), a parasite of wild and aquarium-reared discus Symphysodon spp. (Osteichthyes)

    Czech Academy of Sciences Publication Activity Database

    Moravec, František; Laoprasert, T.

    2008-01-01

    Roč. 71, č. 1 (2008), s. 137-143 ISSN 0165-5752 R&D Projects: GA MŠk LC522; GA ČR(CZ) GA524/06/0170 Institutional research plan: CEZ:AV0Z60220518 Keywords : Ichthyouris * Symphysodon * Thailand Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 0.927, year: 2008

  12. Gardenia jasminoides extracts and gallic acid inhibit lipopolysaccharide-induced inflammation by suppression of JNK2/1 signaling pathways in BV-2 cells

    Directory of Open Access Journals (Sweden)

    Wen-Hung Lin

    2015-06-01

    Conclusion:Taken together, these results indicate that the protective mechanism of the GJ extract involves an antioxidant effect and inhibition of JNK2/1 MAP kinase and COX-2 expressions in LPS-induced inflammation of BV-2 cells.

  13. Interoceanic occurrence of species of Aristocleidus Mueller, 1936 (Monogenoidea: Dactylogyridae) parasitizing the gills of gerreid fishes in the Neotropics

    Czech Academy of Sciences Publication Activity Database

    Mendoza-Franco, Edgar F.; Violante-González, J.; Roche, D. G.

    2009-01-01

    Roč. 105, č. 3 (2009), s. 703-708 ISSN 0932-0113 Institutional research plan: CEZ:AV0Z60220518 Keywords : Neotropics * Gerreidae * Aristocleidus * Diapterus * Gerres * host specificity * Isthmus of Panama Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 1.721, year: 2009

  14. New species of Diplectanum (Monogenoidea: Diplectanidae), and proposal of a new genus of the Dactylogyridae from the gills of gerreid fishes (Teleostei) from Mexico and Panama

    Czech Academy of Sciences Publication Activity Database

    Mendoza-Franco, Edgar F.; Roche, D. G.; Torchin, M. E.

    2008-01-01

    Roč. 55, č. 3 (2008), 171-179 ISSN 0015-5683 Institutional research plan: CEZ:AV0Z60220518 Keywords : Monogenoidea * Diplectanidae * Dactylogyridae * Diplectanum * Octouncuhaptor * Diplectanum gatunense * Diplectanum mexicanum * Octouncuhaptor eugerrei * Eugerres brasilianus * Panama * Mexico Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 1.307, year: 2008

  15. The inclusion of herd-year-season by sire interaction in the ...

    African Journals Online (AJOL)

    The inclusion of herd-year-season by sire interaction in the estimation of genetic parameters in Bonsmara cattle. FWC Neser, KV Konstantinov, GJ Erasmus. Abstract. No abstract. Full Text: EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT.

  16. Eugregarine trophozoite detachment from the host epithelium via epimerite retraction: Fiction or fact?

    Czech Academy of Sciences Publication Activity Database

    Valigurová, A.; Michalková, V.; Koudela, Břetislav

    2009-01-01

    Roč. 39, č. 11 (2009), s. 1235-1242 ISSN 0020-7519 R&D Projects: GA MŠk LC522 Institutional research plan: CEZ:AV0Z60220518 Keywords : Apicomplexa * epimerite retraction * trophozoite Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 3.819, year: 2009

  17. Strongyloides infections of humans and great apes in Dzanga-Sangha Protected Areas, Central African Republic and in degraded forest fragments in Bulindi, Uganda

    Czech Academy of Sciences Publication Activity Database

    Hasegawa, H.; Kalousová, B.; McLennan, M. R.; Modrý, David; Profousová-Pšenková, I.; Shutt-Phillips, K. A.; Todd, A.; Huffman, M. A.; Petrželková, Klára Judita

    2016-01-01

    Roč. 65, č. 5 (2016), s. 367-370 ISSN 1383-5769 Institutional support: RVO:60077344 Keywords : chimpanzee * Gorilla * Human * Strongyloides * transmission * HVR-IV * cox1 Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 1.744, year: 2016

  18. Tortoise tick Hyalomma aegyptium as long term carrier of Q fever agent Coxiella burnetii—evidence from experimental infection

    Czech Academy of Sciences Publication Activity Database

    Široký, P.; Kubelová, M.; Modrý, David; Erhart, Jan; Literák, I.; Špitálská, E.; Kocianová, E.

    2010-01-01

    Roč. 107, č. 6 (2010), s. 1515-1520 ISSN 0932-0113 Institutional research plan: CEZ:AV0Z60220518 Keywords : BURGDORFERI SENSU-LATO * SOUTH-KANARA DISTRICT * COWDRIA-RUMINANTIUM * BACTERIAL DISEASES * ESTUDO-GRAECA * UTTAR-PRADESH * SLOVAKIA * POIKILOTHERMS * RICKETTSIAE * HEARTWATER Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 1.812, year: 2010

  19. Life cycle of tortoise tick Hyalomma aegyptium under laboratory conditions

    Czech Academy of Sciences Publication Activity Database

    Široký, P.; Erhart, Jan; Petrželková, Klára Judita; Kamler, M.

    2011-01-01

    Roč. 54, č. 3 (2011), 277-284 ISSN 0168-8162 Institutional research plan: CEZ:AV0Z60930519; CEZ:AV0Z60220518 Keywords : Hyalomma aegyptium * Testudo * Life-cycle * Laboratory rearing Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 1.725, year: 2011

  20. First report of metacestodes of Cyclustera ralli (Underwood and Dronen, 1986) (Cestoda: Cyclophyllidea) from the fish intermediate host, Fundulus heteroclitus (Linnaeus, 1766) (Cyprinodontiformes: Fundulidae) from Virginia, U.S.A

    Czech Academy of Sciences Publication Activity Database

    Scholz, Tomáš; Harris, C. E.

    2006-01-01

    Roč. 73, č. 1 (2006), s. 130-133 ISSN 1525-2647 R&D Projects: GA ČR GA524/04/0342; GA MŠk LC522 Institutional research plan: CEZ:AV0Z60220518 Keywords : metacestodes * fish * morphology Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 0.659, year: 2006

  1. A Median-Type Condition for Graph Tiling

    Czech Academy of Sciences Publication Activity Database

    Piguet, Diana; Saumell, Maria

    2017-01-01

    Roč. 61, August (2017), s. 979-985 ISSN 1571-0653 R&D Projects: GA ČR GJ16-07822Y Grant - others:GA MŠk(CZ) LO1506 Institutional support: RVO:67985807 Keywords : extremal graph theory * graph tiling * regularity lemma * LP-duality Subject RIV: BA - General Mathematics OBOR OECD: Pure mathematics

  2. Effects of fishing on parasitism in a sparid fish: Contrasts between two areas of the Western Mediterranean

    Czech Academy of Sciences Publication Activity Database

    Marzoug, D.; Boutiba, Z.; Kostadinova, Aneta; Pérez-del-Olmo, A.

    2012-01-01

    Roč. 61, č. 3 (2012), s. 414-420 ISSN 1383-5769 Institutional research plan: CEZ:AV0Z60220518 Keywords : Parasite communities * Fishing * Boops boops * Mediterranean * Santa Pola Bay * Gulf of Oran * Richness * Abundance Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 2.302, year: 2012

  3. A comparative study of karyotypes and chromosomal location of rDNA genes in important liver flukes Fasciola hepatica and Fascioloides magna (Trematoda: Fasciolidae)

    Czech Academy of Sciences Publication Activity Database

    Reblánová, M.; Špakulová, M.; Orosová, Martina; Kraľová-Hromadová, I.; Bazsalovicsová, E.; Rajský, D.

    2011-01-01

    Roč. 109, č. 4 (2011), s. 2021-1028 ISSN 0932-0113 Institutional research plan: CEZ:AV0Z60220518 Keywords : SCHISTOSOMA-MANSONI * DIFFERENTIATION * FISH * ITS2 * HYBRIDIZATION * EPIDEMIOLOGY * LOCALIZATION * CYTOGENETICS * SHEEP Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 2.149, year: 2011

  4. Jede Nation hat eben ihre eigen Wahrheit

    Czech Academy of Sciences Publication Activity Database

    Stach, Stephan

    Č. 118 (2016), s. 13 ISSN 0174-4909 R&D Projects: GA ČR(CZ) GJ16-01775Y Institutional support: RVO:68378114 Keywords : politics of memory * Museum of the Second World War * Poland Subject RIV: AB - History

  5. Ľ événement de sens à ľ horizon de ľ infini

    Czech Academy of Sciences Publication Activity Database

    Fazakas, Istvan

    2015-01-01

    Roč. 5, č. 2 (2015), s. 84-94 ISSN 1804-624X R&D Projects: GA ČR(CZ) GJ16-00994Y Institutional support: RVO:67985955 Keywords : expression * meaning * infinity * Tengelyi * ipseity Subject RIV: AA - Philosophy ; Religion OBOR OECD: Philosophy, History and Philosophy of science and technology

  6. Egg formation and the early embryonic development of Aspidogaster limacoides Diesing, 1835 (Aspidogastrea: Aspidogastridae), with comments on their phylogenetic significance

    Czech Academy of Sciences Publication Activity Database

    Świderski, Z.; Poddubnaya, L. G.; Gibson, D. I.; Levron, Céline; Młocicki, D.

    2011-01-01

    Roč. 60, č. 4 (2011), 371-380 ISSN 1383-5769 R&D Projects: GA ČR GAP506/10/1994 Institutional research plan: CEZ:AV0Z60220518 Keywords : Aspidogaster limacoides * Aspidogastrea * Eggshell * Early embryo * Embryonic envelope * Intrauterine eggs * Ultrastructure Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 2.132, year: 2011

  7. KHAWIA SAUROGOBII N. SP (CESTODA: CARYOPHYLLIDEA) FROM FRESHWATER FISH SAUROGOBIO SPP. (CYPRINIDAE) IN CHINA

    Czech Academy of Sciences Publication Activity Database

    Xi, B. W.; Oros, Mikuláš; Wang, G. T.; Wu, S. G.; Gao, D.; Nie, P.

    2009-01-01

    Roč. 95, č. 6 (2009), s. 1516-1519 ISSN 0022-3395 R&D Projects: GA ČR GA524/08/0885; GA MŠk LC522 Institutional research plan: CEZ:AV0Z60220518 Keywords : CESTOIDEA Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 1.195, year: 2009

  8. Codetection of respiratory syncytial virus in habituated wild western lowland gorillas and humans during a respiratory disease outbreak

    Czech Academy of Sciences Publication Activity Database

    Grützmacher, K. S.; Köndgen, S.; Keil, V.; Todd, A.; Feistner, A.; Herbinger, I.; Petrželková, Klára Judita; Fuh, T.; Leendertz, S. A.; Calvignac-Spencer, S.; Leendertz, F. H.

    2016-01-01

    Roč. 13, č. 3 (2016), s. 499-510 ISSN 1612-9202 Institutional support: RVO:68081766 Keywords : respiratory disease * respiratory syncytial virus * enterovirus * western lowland gorillas * great apes * noninvasive detection Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 2.252, year: 2016

  9. 95 East and Central African Journal of Surgery Volume 12 Number 2 ...

    African Journals Online (AJOL)

    Josephine Nakato

    1638. 7. Shore EM, Feldmann GJ etal: A recurrent mutation in BMP type1 receptor ACVR1 causes inherited and sporadic fibrodysplasia ossificans progressiva. Nature & Genetics. 2006 DOI:10.1038/ng1783. 8. Druce M, Morris VH, Stump: Femoral nerve compression in fibrodysplasia ossificans progressiva. Rheumatology.

  10. Mitochondrial Damage: A Diagnostic and Metabolic Approach in Traumatic Brain Injury and Post-Traumatic Disorder

    Science.gov (United States)

    2013-01-29

    Global mapping of the yeast genetic interaction network. Science 2004;303:808-13. 28. Chen S, Wang C, Eberly LE, Caffo BS, Schwartz BS. Adaptive control...of the false discovery rate in voxel-based morphometry. Hum Brain Mapp 2009;30:2304-11. 29. Parihar MS, Brewer GJ. Mitoenergetic failure in

  11. Strongyloides infections of humans and great apes in Dzanga-Sangha Protected Areas, Central African Republic and in degraded forest fragments in Bulindi, Uganda

    Czech Academy of Sciences Publication Activity Database

    Hasegawa, H.; Kalousová, B.; McLennan, M. R.; Modrý, D.; Profousová-Pšenková, I.; Shutt-Phillips, K. A.; Todd, A.; Huffman, M. A.; Petrželková, Klára Judita

    2016-01-01

    Roč. 65, č. 5 (2016), s. 367-370 ISSN 1383-5769 R&D Projects: GA ČR GA15-05180S Institutional support: RVO:68081766 Keywords : Chimpanzee * Cox1 * Gorilla * Human * HVR-IV * Strongyloides * Transmission Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 1.744, year: 2016

  12. Autochthonous Hepatozoon infection in hunting dogs and foxes from the Czech Republic

    Czech Academy of Sciences Publication Activity Database

    Mitková, B.; Hrazdilová, K.; Steinbauer, V.; D'Amico, G.; Mihalca, A. D.; Modrý, David

    2016-01-01

    Roč. 115, č. 11 (2016), s. 4167-4171 ISSN 0932-0113 Institutional support: RVO:60077344 Keywords : Hepatozoon canis * dogs * red fox es * Czech Republic * autochthonous infection Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 2.329, year: 2016

  13. North American tree squirrels and ground squirrels with overlapping ranges host different Cryptosporidium species and genotypes

    Czech Academy of Sciences Publication Activity Database

    Stenger, B.L.S.; Clark, M.E.; Kváč, Martin; Khan, E.; Giddings, C.W.; Prediger, Jitka; McEvoy, J.M.

    2015-01-01

    Roč. 36, 2015-Dec (2015), s. 287-293 ISSN 1567-1348 R&D Projects: GA ČR GA15-01090S Institutional support: RVO:60077344 Keywords : Cryptosporidium * Tree squirrels * Ground squirrels * Host specificity * Zoonotic Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 2.591, year: 2015

  14. Lawsonia intracellularis in wild mammals in the Slovak Carpathians

    Czech Academy of Sciences Publication Activity Database

    Tomanová, K.; Literák, I.; Klimeš, J.; Pavlačík, L.; Mrlík, Vojtěch; Smola, J.

    2003-01-01

    Roč. 39, č. 2 (2003), s. 407-411 ISSN 0090-3558 Institutional research plan: CEZ:AV0Z6093917 Keywords : Mammalia * Slovakia * Lawsonia intracellularis Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 0.793, year: 2003 http://www.jwildlifedis.org/cgi/reprint/39/2/407

  15. Sviplan for Holandsosen – plan for lyngsviing i Holandsosen naturreservat, Vega kommune

    OpenAIRE

    Sjøskog Kvalvik, Maja Sofia; Carlsen, Thomas; Bär, Annette

    2012-01-01

    Holandsosen naturreservat ble befart i juni 2012 for å gjøre en vurdering av områder som har behov for og er egnet for lyngsviing. Svibare områder er avgrenset på kart og beskrevet i sviplanen. Planen presenterer også retningslinjer som forklarer viktige prinsipper for sviing av lynghei i Holandsosen.

  16. Infection with Crenosoma vulpis lungworm in a dog in the Czech Republic

    Czech Academy of Sciences Publication Activity Database

    Husník, R.; Sloboda, M.; Kovaříková, S.; Koudela, Břetislav

    2011-01-01

    Roč. 48, č. 1 (2011), 56-58 ISSN 0440-6605 Institutional research plan: CEZ:AV0Z60220518 Keywords : Crenosoma vulpis * fox lungworm * larvoscopy * chronic cough * bronchoscopy Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 0.773, year: 2011

  17. Quantum chemical analysis of the structures of MgSO4 hydrates

    NARCIS (Netherlands)

    Iype, E.; Ozen, C.; Nedea, S.V.; Rindt, C.C.M.; Zondag, H.A.

    2012-01-01

    Magnesium sulfate salts can form hydrated compounds with up to seven degree of hydration with an energy exchange of the order of 2.8GJ/m3 [1]. In addition, this salt is abundant in nature and thus this material is a potential candidate for storing energy in seasonal heat storage systems. One of the

  18. Domain-Based Local Pair Natural Orbital Version of Mukherjee’s State-Specific Coupled Cluster Method

    Czech Academy of Sciences Publication Activity Database

    Brabec, Jiří; Lang, Jakub; Saitow, M.; Pittner, Jiří; Neese, F.; Demel, Ondřej

    2018-01-01

    Roč. 14, č. 3 (2018), s. 1370-1382 ISSN 1549-9618 R&D Projects: GA ČR GJ15-00058Y Institutional support: RVO:61388955 Keywords : MULTIREFERENCE PERTURBATION-THEORY * SINGLE-REFERENCE FORMALISM * ELECTRON CORRELATION METHODS Subject RIV: CF - Physical ; Theoretical Chemistry OBOR OECD: Physical chemistry Impact factor: 5.245, year: 2016

  19. Detection of Indistinct Fe-N Stretching Bands in Iron(V) Nitrides by Photodissociation Spectroscopy

    Czech Academy of Sciences Publication Activity Database

    Andris, E.; Navrátil, R.; Jašík, J.; Sabenya, G.; Costas, M.; Srnec, Martin; Roithová, J.

    2018-01-01

    Roč. 24, č. 20 (2018), s. 5078-5081 ISSN 1521-3765 R&D Projects: GA ČR(CZ) GJ15-10279Y Institutional support: RVO:61388955 Keywords : photodissociation spectrochemistry * infrared spectra * DFT Subject RIV: CF - Physical ; Theoretical Chemistry OBOR OECD: Physical chemistry

  20. Vom sozialistischen Postindustrialismus zur Marktgesellschaft. Zukunftsforschung in der Tschechoslowakei (1960er-1980er Jahre)

    Czech Academy of Sciences Publication Activity Database

    Sommer, Vítězslav

    2017-01-01

    Roč. 57, č. 1 (2017), s. 55-81 ISSN 0523-8587 R&D Projects: GA ČR GJ15-19437Y Institutional support: RVO:68378114 Keywords : socialism * Czechoslovakia * futurology Subject RIV: AB - History OBOR OECD: History (history of science and technology to be 6.3, history of specific sciences to be under the respective headings)

  1. Cucullanid nematodes (Nematoda: Cucullanidae) from deep-sea marine fishes off New Caledonia, including Dichelyne etelidis n. sp

    Czech Academy of Sciences Publication Activity Database

    Moravec, František; Justine, J.-L.

    2011-01-01

    Roč. 78, č. 2 (2011), s. 95-108 ISSN 0165-5752 R&D Projects: GA MŠk LC522 Institutional research plan: CEZ:AV0Z60220518 Keywords : Cucullanidae * marine fish * New Caledonia Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 1.250, year: 2011

  2. Synopsis of the species of Myxidium Butschli, 1882 (Myxozoa: Myxosporea: Bivalvulida)

    Czech Academy of Sciences Publication Activity Database

    Eiras, J. C.; Saraiva, A.; Cruz, C.; Santos, M. J.; Fiala, Ivan

    2011-01-01

    Roč. 80, č. 2 (2011), 81-116 ISSN 0165-5752 Institutional research plan: CEZ:AV0Z60220518 Keywords : FRESH-WATER FISHES * SP-N MYXOZOA * WEST-BENGAL * GENUS MYXIDIUM * GALL-BLADDER * RED - SEA * GALLBLADDER * PARASITES * INDIA * EGYPT Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 1.250, year: 2011

  3. Rhabdochona (Rhabdochona) keralaensis sp nov (Rhabdochonidae) and some other nematodes in the Indian mottled eel Anguilla bengalensis bengalensis from India

    Czech Academy of Sciences Publication Activity Database

    Moravec, František; Sheeba, S.; Kumar, A. B.

    2012-01-01

    Roč. 57, č. 1 (2012), 74-82 ISSN 1230-2821 R&D Projects: GA MŠk LC522 Institutional research plan: CEZ:AV0Z60220518 Keywords : Rhabdochona * Anguilla * India Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 1.000, year: 2012

  4. The effect of the fluoroquinolone norfloxacin on somatic indices and oxidative stress parameters in early stages of common carp (Cyprinus carpio L.)

    Czech Academy of Sciences Publication Activity Database

    Charvátová, N.; Želinská, G.; Dobšíková, R.; Stancová, V.; Živná, D.; Plhalová, L.; Blahová, J.; Sehonová, P.; Maršálek, P.; Bartošková, M.; Prokeš, Miroslav; Piskořová, I.; Svobodová, Z.

    2015-01-01

    Roč. 36, Supplement 1 (2015), s. 79-87 ISSN 0172-780X Institutional support: RVO:68081766 Keywords : antibiotics * fish * morphometry * antioxidant enzymes * lipid peroxidation Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 0.946, year: 2015

  5. The essential function of the Trypanosoma brucei Trl1 homolog in procyclic cells is maturation of the intron-containing tRNATyr

    Czech Academy of Sciences Publication Activity Database

    Lopes, R.R.S.; Silveira, G. de O.; Eitler, R.; Vidal, R.S.; Kessler, A.; Hinger, S.; Paris, Zdeněk; Alfonzo, J. D.; Polycarpo, C.

    2016-01-01

    Roč. 22, č. 8 (2016), s. 1190-1199 ISSN 1355-8382 R&D Projects: GA ČR GJ15-21450Y Institutional support: RVO:60077344 Keywords : Trypanosoma * tRNA * tRNA editing * splicing * intron Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 4.605, year: 2016

  6. Late flooding combined with warm autumn – potential possibility for prolongation of transmission of mosquito-borne diseases

    Czech Academy of Sciences Publication Activity Database

    Šebesta, O.; Gelbič, Ivan

    2016-01-01

    Roč. 71, č. 11 (2016), s. 1292-1297 ISSN 0006-3088 Institutional support: RVO:60077344 Keywords : Aedes vexans * Aedes sticticus * autumn floods Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 0.759, year: 2016

  7. PT-symmetric invisible defects and confluent Darboux-Crum transformations

    Czech Academy of Sciences Publication Activity Database

    Correa, F.; Jakubský, Vít; Plyushchay, M. S.

    2015-01-01

    Roč. 92, č. 2 (2015), 023839 ISSN 1050-2947 R&D Projects: GA ČR(CZ) GJ15-07674Y Institutional support: RVO:61389005 Keywords : supersymmetric quantum mechanics * bound states * optics Subject RIV: BE - Theoretical Physics Impact factor: 2.808, year: 2014

  8. Two new species of philometrids (Nematoda: Philometridae) from marine fishes off South Carolina

    Czech Academy of Sciences Publication Activity Database

    Moravec, František; de Buron, I.

    2009-01-01

    Roč. 95, č. 3 (2009), s. 722-727 ISSN 0022-3395 R&D Projects: GA ČR(CZ) GA524/06/0170; GA MŠk LC522 Institutional research plan: CEZ:AV0Z60220518 Keywords : Philometra * Philometroides * marine fish Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 1.195, year: 2009

  9. The amphibians of Mount Oku, Cameroon: an updated species inventory and conservation review

    Czech Academy of Sciences Publication Activity Database

    Doherty-Bone, T. M.; Gvoždík, Václav

    2017-01-01

    Roč. 643, č. 643 (2017), s. 109-139 ISSN 1313-2989 R&D Projects: GA ČR GJ15-13415Y Institutional support: RVO:68081766 Keywords : Biodiversity * caecilians * Cameroon Volcanic Line * Central Africa * frogs * Lake Oku * montane forests and grasslands Subject RIV: EG - Zoology OBOR OECD: Zoology Impact factor: 1.031, year: 2016

  10. Diversity of Microsporidia, Cryptosporidium and Giardia in Mountain Gorillas (Gorilla beringei beringei) in Volcanoes National Park, Rwanda

    Czech Academy of Sciences Publication Activity Database

    Sak, Bohumil; Petrželková, Klára Judita; Květoňová, Dana; Mynářová, A.; Pomajbíková, K.; Modrý, David; Cranfield, M. R.; Mudakikwa, A.; Kváč, Martin

    2014-01-01

    Roč. 9, č. 11 (2014), e109751 E-ISSN 1932-6203 R&D Projects: GA ČR GA206/09/0927 Institutional support: RVO:60077344 Keywords : infection diseases * gorilla * genotypes Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 3.234, year: 2014

  11. Hope-filled, energy-conscious town of Itakura. Regional new energy vision for Itakura Town; 2001 nendo Itakura machi shin energy vision. Yume ippai enetown Itakura

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2002-02-01

    For promoting the introduction of new energy and for enhancing people's consciousness of such at Itakura Town, Niigata Prefecture, surveys and studies were conducted involving energy demand of the town, the amount of new energy resources in existence, and new energy introduction projects, and a vision was formulated. In fiscal 2000 the town consumed 549,973 GJ/year in energy, with the industrial sector consuming 202,014 GJ, the residential/commercial sector 194,233 GJ, and the transportation sector 153,725 GJ. The energy types were gasoline, kerosene, electricity, gas oil, heavy oil, and LPG, as named in the descending order in terms of consumed amount. It is estimated that the energy consumption resulted in the emission of carbon dioxide of 11,839 t-C/year. New energy introduction projects were discussed, which involved wind power generation for the Itakura sewage purification center; snow-aided cooling systems for a Yasuragi rest house and the special nursing home for elderly people; snow-aided refrigeration for a unhusked rice silo; photovoltaic power generation and cogeneration for the town office; photovoltaic/wind power-driven hybrid street lamps; use of biomass solid fuel for heating public facilities; use of clean-energy vehicles as official vehicles; and the like. (NEDO)

  12. Case report

    African Journals Online (AJOL)

    abp

    Total knee replacement including a modular distal femoral component in elderly patients with acute fracture or nonunion. J Orthop. Trauma. 1995; 9(3):231-7. PubMed | Google Scholar. 19. Haidukewych GJ, Berry DJ, Jacofsky DJ, Torchia ME. Treatment of supracondylar femur nonunions with open reduction and.

  13. Novel Cryptosporidium bat genotypes III and IV in bats/nfrom the USA and Czech Republic

    Czech Academy of Sciences Publication Activity Database

    Kváč, Martin; Hořická, A.; Sak, Bohumil; Prediger, Jitka; Salát, J.; Širmarová, J.; Bartonička, T.; Clark, M.; Chelladurai, J.R.J.J.; Gillam, E.; McEvoy, J.

    2015-01-01

    Roč. 114, č. 10 (2015), s. 3917-3921 ISSN 0932-0113 R&D Projects: GA ČR GA15-01090S Institutional support: RVO:60077344 Keywords : Cryptosporidium * Bats * SSU * Actin * PCR Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 2.027, year: 2015

  14. Role of the invasive Chinese sleeper Perccottus glenii (Actinopterygii: Odontobutidae) in the distribution of fish parasites in Europe: New data and a review

    Czech Academy of Sciences Publication Activity Database

    Kvach, Yuriy; Kutsokon, Y.; Stepien, C. A.; Markovych, M.

    2016-01-01

    Roč. 71, č. 8 (2016), s. 941-951 ISSN 0006-3088 R&D Projects: GA ČR(CZ) GBP505/12/G112 Institutional support: RVO:68081766 Keywords : Chinese sleeper * enemy release hypothesis * invasive species * parasites * Perccottus glenii Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 0.759, year: 2016

  15. Roles of bacteria in the bark beetle holobiont - how do they shape this forest pest?

    Czech Academy of Sciences Publication Activity Database

    García-Fraile, Paula

    2018-01-01

    Roč. 172, č. 2 (2018), s. 111-125 ISSN 0003-4746 R&D Projects: GA ČR(CZ) GJ16-15293Y Institutional support: RVO:61388971 Keywords : Bacterial pathogens * bacterial symbionts * beetle nutrition Subject RIV: EE - Microbiology, Virology OBOR OECD: Microbiology Impact factor: 2.046, year: 2016

  16. Two new species of Philometra (Nematoda: Philometridae) from needlefishes (Belonidae) in Iraq, with a key to Philometra spp. parasitic in the host’s subcutaneous tissue, fins and musculature

    Czech Academy of Sciences Publication Activity Database

    Moravec, František; Ali, A. H.

    2005-01-01

    Roč. 52, č. 3 (2005), s. 267-273 ISSN 0015-5683 R&D Projects: GA ČR GA524/03/0061 Institutional research plan: CEZ:AV0Z60220518 Keywords : Philometra * marine fishes * Iraq Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 1.138, year: 2005

  17. Philometroides acanthopagri sp. nov., a new philometrid (Nematoda, Philometridae) from the musculature of Acanthopagrus latus (Sparidae) from marine waters of Iraq

    Czech Academy of Sciences Publication Activity Database

    Moravec, František; Jassim, A. A. R.; Al-Salim, N. K.

    2012-01-01

    Roč. 57, č. 4 (2012), s. 372-377 ISSN 1230-2821 R&D Projects: GA ČR GBP505/12/G112 Institutional research plan: CEZ:AV0Z60220518 Keywords : Philometroides * Acanthopagrus * Iraq Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 1.000, year: 2012

  18. Two species of Rhabdochona Railliet, 1916 (Nematoda: Rhabdochonidae) parasitising cyprinid fishes in Iraq, with a redescription of R. tigridis Rahemo, 1978 (emend.)

    Czech Academy of Sciences Publication Activity Database

    Moravec, František; Saraiva, A.; Abdullah, S. M. A.; Bilal, S. J.; Rahemo, Z. I. F.

    2009-01-01

    Roč. 74, č. 2 (2009), s. 125-135 ISSN 0165-5752 R&D Projects: GA ČR(CZ) GA524/06/0170; GA MŠk LC522 Institutional research plan: CEZ:AV0Z60220518 Keywords : Rhabdochona * Cyprinidae * Iraq Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 0.911, year: 2009

  19. Pathology In Practice

    Czech Academy of Sciences Publication Activity Database

    Frye, F. L.; Modrý, David; Široký, P.

    2009-01-01

    Roč. 235, č. 5 (2009), s. 511-512 ISSN 0003-1488 Institutional research plan: CEZ:AV0Z60220518 Keywords : european pond turtle * cutaneous horn Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 1.714, year: 2009

  20. Electronic Structure of the Ferryl Intermediate in the α-Ketoglutarate Dependent Non-Heme Iron Halogenase SyrB2: Contributions to H Atom Abstraction Reactivity

    Czech Academy of Sciences Publication Activity Database

    Srnec, Martin; Wong, S. D.; Matthews, M. L.; Krebs, C.; Bollinger, J. M.; Solomon, E. I.

    2016-01-01

    Roč. 138, č. 15 (2016), s. 5110-5122 ISSN 0002-7863 R&D Projects: GA ČR(CZ) GJ15-10279Y Institutional support: RVO:61388955 Keywords : Ferryl intermediate * syringomycin halogenase * electronic structure Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 13.858, year: 2016

  1. Cryptosporidium from tortoises: Genetic characterisation, phylogeny and zoonotic implications

    Czech Academy of Sciences Publication Activity Database

    Traversa, D.; Iorio, R.; Otranto, D.; Modrý, David; Šlapeta, J.

    2008-01-01

    Roč. 22, č. 2 (2008), s. 122-128 ISSN 0890-8508 Institutional research plan: CEZ:AV0Z60220518 Keywords : Cryptosporidium * tortoises * COWP * Testudo * epidemiology * 18S SSU rDNA Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 2.196, year: 2008

  2. Oncomiracidial development, survival and swimming behaviour of the monogenean Sparicotyle chrysophrii (Van Beneden and Hesse, 1863)

    Czech Academy of Sciences Publication Activity Database

    Repulles-Albelda, A.; Holzer, Astrid S.; Raga, J. A.; Montero, F. E.

    338-341, MAR 29 (2012), s. 47-55 ISSN 0044-8486 Institutional research plan: CEZ:AV0Z60220518 Keywords : Sparicotyle chrysophrii * Sparus aurata * Polyopisthocotylea * Oncomiracidial development * Hatching * Survival time Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 2.009, year: 2012 http://www.sciencedirect.com/science/article/pii/S0044848612000646

  3. New philometrids (Nematoda, Philometridae) from head tissues of two serranid fishes (Epinephelus morio and Mycteroperca microlepis) off Florida, northern Gulf of Mexico

    Czech Academy of Sciences Publication Activity Database

    Moravec, František; Bakenhaster, M.; Fajer-Avila, E.

    2010-01-01

    Roč. 55, č. 4 (2010), s. 359-368 ISSN 1230-2821 R&D Projects: GA MŠk LC522 Institutional research plan: CEZ:AV0Z60220518 Keywords : Parasitic nematode * Philometra * marine fish * Epinephelus * Mycteroperca * Gulf of Mexico * Florida Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 1.144, year: 2010

  4. Neopsilotrema n. g. (Digenea: Psilostomidae) and three new species from ducks (Anseriformes: Anatidae) in North America and Europe

    Czech Academy of Sciences Publication Activity Database

    Kudlai, Olena; Pulis, E.E.; Kostadinova, Aneta; Tkach, V.V.

    2016-01-01

    Roč. 93, č. 4 (2016), s. 307-319 ISSN 0165-5752 R&D Projects: GA ČR GBP505/12/G112 Institutional support: RVO:60077344 Keywords : sequences * Platyhelminthes * morphology Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 1.181, year: 2016

  5. The effect of tramadol hydrochloride on early life stages of fish

    Czech Academy of Sciences Publication Activity Database

    Sehonová, P.; Plhalová, L.; Blahová, J.; Beránková, P.; Doubková, V.; Prokeš, Miroslav; Tichý, F.; Večerek, V.; Svobodová, Z.

    2016-01-01

    Roč. 44, June (2016), s. 151-157 ISSN 1382-6689 Institutional support: RVO:68081766 Keywords : Aquatic contamination * Cyprinus carpio * Danio rerio * Oxidative stress * Toxicity test Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 2.313, year: 2016

  6. Colourings without monochromatic disjoint pairs

    Czech Academy of Sciences Publication Activity Database

    Clemens, D.; Das, S.; Tran, Tuan

    2018-01-01

    Roč. 70, May (2018), s. 99-124 ISSN 0195-6698 R&D Projects: GA ČR GJ16-07822Y Institutional support: RVO:68081715 Keywords : Erdos-Rothschild problem * intersecting families * Erdos-Ko-Rado theorem Subject RIV: BA - General Mathematics Impact factor: 0.786, year: 2016

  7. Antimicrobial-resistant Enterobacteriaceae from humans and wildlife in Dzanga-Sangha Protected Area, Central African Republic

    Czech Academy of Sciences Publication Activity Database

    Janatová, M.; Albrechtová, K.; Petrželková, Klára Judita; Dolejská, M.; Papoušek, I.; Masaříková, M.; Čížek, A.; Todd, A.; Shutt, K.; Kalousová, B.; Profousová-Pšenková, I.; Modrý, David; Literák, I.

    2014-01-01

    Roč. 171, 3-4 (2014), s. 422-431 ISSN 0378-1135 Institutional support: RVO:60077344 Keywords : ESBL * PMQR * Enterobacteriaceae * Resistance * Gorilla Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 2.511, year: 2014

  8. Sensitivity of Lyme Borreliosis Spirochetes to Serum Complement of Regular Zoo Animals: Potential Reservoir Competence of Some Exotic Vertebrates

    Czech Academy of Sciences Publication Activity Database

    Tichá, L.; Golovchenko, Maryna; Oliver, J. H., Jr.; Grubhoffer, Libor; Rudenko, Natalia

    2016-01-01

    Roč. 16, č. 1 (2016), s. 13-19 ISSN 1530-3667 EU Projects: European Commission(XE) 278976 - ANTIGONE Institutional support: RVO:60077344 Keywords : Borrelia burgdorferi sensu lato * Lyme disease * serum complement * exotic animals * reservoir hosts * zoo Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 2.045, year: 2016

  9. Clickable antifouling polymer brushes for polymer pen lithography

    Czech Academy of Sciences Publication Activity Database

    Bog, U.; de los Santos Pereira, Andres; Mueller, S. L.; Havenridge, S.; Parrillo, Viviana; Bruns, M.; Holmes, A. E.; Rodriguez-Emmenegger, C.; Fuchs, H.; Hirtz, M.

    2017-01-01

    Roč. 9, č. 13 (2017), s. 12109-12117 ISSN 1944-8244 R&D Projects: GA ČR(CZ) GJ15-09368Y Institutional support: RVO:61389013 Keywords : antifouling * biofunctional interfaces * polymer brushes Subject RIV: CD - Macromolecular Chemistry OBOR OECD: Polymer science Impact factor: 7.504, year: 2016

  10. Dissociative electron attachment and anion-induced dimerization in pyruvic acid

    Czech Academy of Sciences Publication Activity Database

    Zawadzki, Mateusz; Ranković, Miloš; Kočišek, Jaroslav; Fedor, Juraj

    2018-01-01

    Roč. 20, č. 10 (2018), s. 6838-6844 ISSN 1463-9076 R&D Projects: GA ČR GA17-04844S; GA ČR GJ16-10995Y Institutional support: RVO:61388955 Keywords : pyruvic acid * electron attachment * dimerization Subject RIV: CF - Physical ; Theoretical Chemistry OBOR OECD: Physical chemistry Impact factor: 4.123, year: 2016

  11. The local limit of the uniform spanning tree on dense graphs

    Czech Academy of Sciences Publication Activity Database

    Hladký, Jan; Nachmias, A.; Tran, Tuan

    First Online: 10 January (2018) ISSN 0022-4715 R&D Projects: GA ČR GJ16-07822Y Keywords : uniform spanning tree * graph limits * Benjamini-Schramm convergence * graphon * branching process Subject RIV: BA - General Mathematics Impact factor: 1.349, year: 2016

  12. Frontier Molecular Orbital Contributions to Chlorination versus Hydroxylation Selectivity in the Non-Heme Iron Halogenase SyrB2

    Czech Academy of Sciences Publication Activity Database

    Srnec, Martin; Solomon, E. I.

    2017-01-01

    Roč. 139, č. 6 (2017), s. 2396-2407 ISSN 0002-7863 R&D Projects: GA ČR(CZ) GJ15-10279Y Institutional support: RVO:61388955 Keywords : Chlorination * Chlorine compounds * Free radical reactions Subject RIV: CF - Physical ; Theoretical Chemistry OBOR OECD: Physical chemistry Impact factor: 13.858, year: 2016

  13. Redescription of Rhabdochona cotti (Nematoda, Rhabdochonidae) from Cottus caeruleomentum (Teleostei, Cottidae) in Maryland, USA, with remarks on the taxonomy of North American Rhabdochona spp

    Czech Academy of Sciences Publication Activity Database

    Moravec, František; Muzzall, P.

    2007-01-01

    Roč. 52, č. 1 (2007), s. 51-57 ISSN 1230-2821 R&D Projects: GA ČR(CZ) GA524/06/0170; GA MŠk LC522 Institutional research plan: CEZ:AV0Z60220518 Keywords : Rhabdochona * Cottus * USA Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 0.814, year: 2007

  14. „Duch czasu wycisnął jednak na tej pracy swej piętno“. Historia Zagłady w badaniach Żydowskiego Instytutu Historycznego w okresie stalinowskim

    Czech Academy of Sciences Publication Activity Database

    Stach, Stephan

    -, č. 13 (2017), s. 138-159 ISSN 1895-247X R&D Projects: GA ČR(CZ) GJ16-01775Y Institutional support: RVO:68378114 Keywords : holocaust studies * stalinism * Jewish Historical Institute Subject RIV: AB - History OBOR OECD: History (history of science and technology to be 6.3, history of specific sciences to be under the respective headings)

  15. ‚The Spirit of the Time Left its Stamp on These Works‘. Writing the History of the Shoah at the Jewish Historical Institute in Stalinist Poland

    Czech Academy of Sciences Publication Activity Database

    Stach, Stephan

    2016-01-01

    Roč. 5, č. 5 (2016), s. 185-211 ISSN 2084-3518 R&D Projects: GA ČR(CZ) GJ16-01775Y Institutional support: RVO:68378114 Keywords : Poland * Jewish history * holocaust memory Subject RIV: AB - History http://www.enrs.eu/studies_files/4/

  16. Accurate DFT-D3 Calculations in a Small Basis Set

    Czech Academy of Sciences Publication Activity Database

    Hostaš, Jiří; Řezáč, Jan

    2017-01-01

    Roč. 13, č. 8 (2017), s. 3575-3585 ISSN 1549-9618 R&D Projects: GA ČR(CZ) GJ16-11321Y Institutional support: RVO:61388963 Keywords : density functional theory * molecular orbital methods * quantum chemical methods Subject RIV: CF - Physical ; Theoretical Chemistry OBOR OECD: Physical chemistry Impact factor: 5.245, year: 2016

  17. Prevalence of Borrelia burgdorferi sensu lato genospecies in host-seeking Ixodes ricinus ticks in selected South Bohemian locations (Czech Republic)

    Czech Academy of Sciences Publication Activity Database

    Danielová, V.; Daniel, M.; Rudenko, Natalia; Golovchenko, Maryna

    2004-01-01

    Roč. 12, č. 3 (2004), s. 151-156 ISSN 1210-7778 R&D Projects: GA ČR GA524/03/1326 Institutional research plan: CEZ:AV0Z6022909 Keywords : Ixodes ricinus * Borrelia * Czech Republic Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine

  18. Detection of Borrelia burgdorferi sensu stricto in Amblyomma americanum ticks in the southeastern United States: the case of selective compatibility

    Czech Academy of Sciences Publication Activity Database

    Rudenko, Natalia; Golovchenko, Maryna; Clark, K.; Oliver, J.; Grubhoffer, Libor

    2016-01-01

    Roč. 5, MAY 25 (2016), č. článku e48. ISSN 2222-1751 EU Projects: European Commission(XE) 278976 - ANTIGONE Institutional support: RVO:60077344 Keywords : lyme disease spirochete * Dermacentor variabilis * Ixodes scapularis * Ixodidae * Acari * strain Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 5.605, year: 2016

  19. Tick-borne encephalitis virus-specific RT-PCR - a rapid test for detection of the pathogen without viral RNA purification

    Czech Academy of Sciences Publication Activity Database

    Rudenko, Natalia; Golovchenko, Maryna; Cihlářová, Věra; Grubhoffer, Libor

    2004-01-01

    Roč. 48, č. 3 (2004), s. 167-171 ISSN 0001-723X R&D Projects: GA ČR GA524/03/1326 Institutional research plan: CEZ:AV0Z6022909 Keywords : Ixodes ricinus * tick-borne encephalitis virus * RT-PCR Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 0.605, year: 2004

  20. Transstadial Transmission of Borrelia turcica in Hyalomma aegyptium Ticks

    Czech Academy of Sciences Publication Activity Database

    Kalmár, Z.; Cozma, V.; Sprong, H.; Jahfari, S.; D’Amico, G.; Mărcutan, D.I.; Ionică, A.M.; Magdaş, C.; Modrý, David; Mihalca, A. D.

    2015-01-01

    Roč. 10, č. 2 (2015), e0115520 E-ISSN 1932-6203 Institutional support: RVO:60077344 Keywords : Borne relapsing fever * Lyme disease * imported reptiles Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 3.057, year: 2015

  1. Population Bottlenecks during the Infectious Cycle of the Lyme Disease Spirochete Borrelia burgdorferi

    Czech Academy of Sciences Publication Activity Database

    Rego, Ryan O. M.; Bestor, A.; Štefka, Jan; Rosa, P. A.

    2014-01-01

    Roč. 9, č. 6 (2014), e101009 E-ISSN 1932-6203 Institutional support: RVO:60077344 Keywords : sensu stricto * mammalian host * peromyscus-leucopus * Ixodes ricinus * ticks * mice * transmission * dissemination * diversity * North America Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 3.234, year: 2014

  2. Spectrally isomorphic Dirac systems: Graphene in an electromagnetic field

    Czech Academy of Sciences Publication Activity Database

    Jakubský, Vít

    2015-01-01

    Roč. 91, č. 4 (2015), 045039 ISSN 1550-7998 R&D Projects: GA ČR(CZ) GJ15-07674Y Institutional support: RVO:61389005 Keywords : matrix Hamiltonians * magnetic barriers * supersymmetry Subject RIV: BE - Theoretical Physics Impact factor: 4.643, year: 2014

  3. Crimean-Congo Hemorrhagic Fever Virus in Bulgaria and Turkey

    Czech Academy of Sciences Publication Activity Database

    Mertens, M.; Schuster, I.; Sas, M. A.; Vatansever, Z.; Hubálek, Zdeněk; Güven, E.; Deniz, A.; Georgiev, G.; Peshev, R.; Groschup, M. H.

    2016-01-01

    Roč. 16, č. 9 (2016), s. 619-623 ISSN 1530-3667 EU Projects: European Commission(XE) 261504 - EDENEXT Institutional support: RVO:68081766 Keywords : Crimean-Congo hemorrhagic fever virus: CCHFV * domestic animals * ELISA * epidemiology Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 2.045, year: 2016

  4. Rodents as a Source of Salmonella Contamination in Wet Markets in Thailand

    Czech Academy of Sciences Publication Activity Database

    Ribas, A.; Saijuntha, W.; Agatsuma, T.; Prantlová, Veronika; Poonlaphdecha, S.

    2016-01-01

    Roč. 16, č. 8 (2016), s. 537-540 ISSN 1530-3667 R&D Projects: GA ČR GA15-01090S Institutional support: RVO:60077344 Keywords : Norway rat * Pacific rat * S. 4,[5], 12:i * Salmonella * typhimurium * weltevreden * wet market * zoonoses Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 2.045, year: 2016

  5. Long-term selection experiment with Afrikaner cattle

    African Journals Online (AJOL)

    Mario Beffa

    Long-term selection experiment with Afrikaner cattle. 3. Selection applied and response in calf growth traits. L.M. Beffa. 1,2,3. , J.B. van Wyk. 1# and G.J. Erasmus. 1. 1 University of the Free State, P.O. Box 339, Bloemfontein 9300, South Africa. 2 Matopos Research Station, P. Bag K5137, Bulawayo, Zimbabwe ...

  6. Occurrence of Philometra lateolabracis (Nematoda: Philometridae) in the gonads of marine perciform fishes in the Mediterranean region

    Czech Academy of Sciences Publication Activity Database

    Moravec, František; Glamuzina, B.; Marino, G.; Merella, P.; Di Cave, D.

    2003-01-01

    Roč. 53, č. 3 (2003), s. 267-269 ISSN 0177-5103 R&D Projects: GA ČR GA524/03/0061 Institutional research plan: CEZ:AV0Z6022909 Keywords : parasitic nematode * Philometra lateolabracis * marine fish Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 1.263, year: 2003

  7. Dracunculus brasiliensis sp. n. (Nematoda: Dracunculidae) from the anaconda, Eunectes murinus (Ophidia: Boidae)

    Czech Academy of Sciences Publication Activity Database

    Moravec, František; Santos, C. P.

    2009-01-01

    Roč. 104, č. 3 (2009), s. 589-592 ISSN 0932-0113 R&D Projects: GA ČR(CZ) GA524/06/0170 Institutional research plan: CEZ:AV0Z60220518 Keywords : Dracunculus * Eunectes * Brazil Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 1.721, year: 2009

  8. Larval Pseudoproleptus sp. (Nematoda: Cystidicolidae) found in the Amazon river prawn Macrobrachium amazonicum (Decapoda: Palaemonidae) in Brazil

    Czech Academy of Sciences Publication Activity Database

    Moravec, František; Santos, C. P.

    2009-01-01

    Roč. 95, č. 3 (2009), s. 634-638 ISSN 0022-3395 R&D Projects: GA ČR(CZ) GA524/06/0170; GA MŠk LC522 Institutional research plan: CEZ:AV0Z60220518 Keywords : Pseudoproleptus * Macrobrachium * Brazil Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 1.195, year: 2009

  9. New species of Freitascapillaria (Nematoda: Capillariidae) from the intestine of Cottus caeruleomentum (Teleostei: Cottidae) in Maryland

    Czech Academy of Sciences Publication Activity Database

    Moravec, František; Muzzall, P.

    2009-01-01

    Roč. 95, č. 4 (2009), s. 987-990 ISSN 0022-3395 R&D Projects: GA ČR(CZ) GA524/06/0170; GA MŠk LC522 Institutional research plan: CEZ:AV0Z60220518 Keywords : Freitascapillaria * Cottus * USA Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 1.195, year: 2009

  10. Do galaxies that leak ionizing photons have extreme outflows?

    Czech Academy of Sciences Publication Activity Database

    Chisholm, J.; Orlitová, Ivana; Schaerer, D.; Verhamme, A.; Worseck, G.; Izotov, Y.I.; Thuan, T.X.; Guseva, N.G.

    2017-01-01

    Roč. 605, September (2017), A67/1-A67/19 E-ISSN 1432-0746 R&D Projects: GA ČR(CZ) GJ17-06217Y Institutional support: RVO:67985815 Keywords : galaxies * irregular * ISM Subject RIV: BN - Astronomy , Celestial Mechanics, Astrophysics OBOR OECD: Astronomy (including astrophysics,space science) Impact factor: 5.014, year: 2016

  11. Lie Algebras for Constructing Nonlinear Integrable Couplings

    International Nuclear Information System (INIS)

    Zhang Yufeng

    2011-01-01

    Two new explicit Lie algebras are introduced for which the nonlinear integrable couplings of the Giachetti-Johnson (GJ) hierarchy and the Yang hierarchy are obtained, respectively. By employing the variational identity their Hamiltonian structures are also generated. The approach presented in the paper can also provide nonlinear integrable couplings of other soliton hierarchies of evolution equations. (general)

  12. Spinning test body orbiting around a Kerr black hole: Circular dynamics and gravitational-wave fluxes

    Czech Academy of Sciences Publication Activity Database

    Lukes-Gerakopoulos, Georgios; Harms, E.; Bernuzzi, S.; Nagar, A.

    2017-01-01

    Roč. 96, č. 6 (2017), 064051/1-064051/13 ISSN 2470-0010 R&D Projects: GA ČR(CZ) GJ17-06962Y Institutional support: RVO:67985815 Keywords : general-relativity * test particles * conserved quantities Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics OBOR OECD: Astronomy (including astrophysics,space science) Impact factor: 4.568, year: 2016

  13. Effect of salicylic acid on early life stages of common carp (Cyprinus carpio)

    Czech Academy of Sciences Publication Activity Database

    Živná, D.; Sehonová, P.; Plhalová, L.; Maršálek, P.; Blahová, J.; Prokeš, Miroslav; Divišová, L.; Stancová, V.; Dobšíková, R.; Tichý, F.; Široká, Z.; Svobodová, Z.

    2015-01-01

    Roč. 40, č. 1 (2015), s. 319-325 ISSN 1382-6689 Institutional support: RVO:68081766 Keywords : Pharmaceutical residues * NSAIDs * Oxidative stress * Lipid peroxidation Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 2.187, year: 2015

  14. Phylogenetic position of Dracunculus medinensis and some related nematodes inferred from 18S rRNA

    Czech Academy of Sciences Publication Activity Database

    Wijová, Martina; Moravec, František; Horák, Aleš; Modrý, David; Lukeš, Julius

    2005-01-01

    Roč. 96, č. 2 (2005), s. 133-135 ISSN 0932-0113 R&D Projects: GA ČR GA524/03/0061 Institutional research plan: CEZ:AV0Z60220518 Keywords : Dracunculus * Nematoda * phylogeny Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 1.226, year: 2005

  15. A new species of Australotaenia (Cestoda: Proteocephalidea) from a snake in Cambodia: host switching or postcyclic parasitism in a distant region?

    Czech Academy of Sciences Publication Activity Database

    de Chambrier, A.; Scholz, Tomáš

    2012-01-01

    Roč. 59, č. 4 (2012), s. 279-286 ISSN 0015-5683 Institutional support: RVO:60077344 Keywords : taxonomy * zoogeography * tapeworms * helminths * Reptilia * South East Asia * Indomalayan Region Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 2.515, year: 2012 http://folia.paru.cas.cz/detail.php?id=22092

  16. Description of Eimeria arabukosokokensis sp. n. (Apicomplexa: Eimeriidae) from Telescopus semiannulatus (Serpentes: Colubridae) with notes on eimerian coccidia from snakes of Eastern Kenya

    Czech Academy of Sciences Publication Activity Database

    Šlapeta, Jan Roger; Modrý, David; Ashe, J.; Koudela, Břetislav

    2003-01-01

    Roč. 50, č. 1 (2003), s. 23-30 ISSN 0015-5683 R&D Projects: GA ČR GA524/00/P015 Institutional research plan: CEZ:AV0Z6022909 Keywords : Coccidia * Caryospora * Eimeria Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 0.469, year: 2003

  17. Cryptosporidium testudinis sp. n., Cryptosporidium ducismarci Traversa, 2010 and Cryptosporidium tortoise genotype III (Apicomplexa: Cryptosporidiidae) in tortoises

    Czech Academy of Sciences Publication Activity Database

    Ježková, Jana; Horčičková, Michaela; Hlásková, Lenka; Sak, Bohumil; Květoňová, Dana; Novák, J.; Hofmannová, L.; McEvoy, J.; Kváč, Martin

    2016-01-01

    Roč. 63, October 14 (2016), č. článku 035. ISSN 1803-6465 R&D Projects: GA ČR GA15-01090S Institutional support: RVO:60077344 Keywords : morphology * transmission studies * taxonomy * new species * molecular phylogeny Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 1.082, year: 2016

  18. TESTING OF FRAMED STRUCTURE PARTS OF COMPACT MUON SOLENOID BY NONDESTRUCTIVE METHOD

    Directory of Open Access Journals (Sweden)

    L. V. Larchenkov

    2013-01-01

    Full Text Available Suspension parts of a compact muon solenoid for Large Hadron Collider have been tested in the paper. The paper describes a steady-state and cyclic “tension-compression” load created by superconducting electromagnet with energy of 3 GJ and magnetic induction of 4 tesla. A nondestructive testing method has been applied in the paper.

  19. Strength Exercise Improves Muscle Mass and Hepatic Insulin Sensitivity in Obese Youth

    NARCIS (Netherlands)

    Van Der Heijden, Gert-Jan; Wang, Zhiyue J.; Chu, Zili; Toffolo, Gianna; Manesso, Erica; Sauer, Pieter J. J.; Sunehag, Agneta L.

    VAN DER HEIJDEN, G.-J., Z. J. WANG, Z. CHU, G. TOFFOLO, E. MANESSO, P. J. J. SAUER, and A. L. SUNEHAG. Strength Exercise Improves Muscle Mass and Hepatic Insulin Sensitivity in Obese Youth. Med. Sci. Sports Exerc., Vol. 42, No. 11, pp. 1973-1980, 2010. Introduction: Data on the metabolic effects of

  20. Preparation of PbSe nanoparticles by electron beam irradiation

    Indian Academy of Sciences (India)

    A novel method has been developed by electron beam irradiation to prepare PbSe nanoparticles. 2 MeV 10mA GJ-2-II electronic accelerator was used as radiation source. Nanocrystalline PbSe was prepared rapidly at room temperature under atmospheric pressure without any kind of toxic reagents. The structure and ...

  1. Gut microbiome composition and metabolomic profiles of wild western lowland gorillas (Gorilla gorilla gorilla) reflect host ecology

    Czech Academy of Sciences Publication Activity Database

    Gomez, A.; Petrželková, Klára Judita; Yeoman, C. J.; Vlčková, K.; Mrázek, Jakub; Koppová, Ingrid; Carbonero, F.; Ulanov, A.; Modrý, D.; Todd, A.; Torralba, M.; Nelson, K.; Gaskins, H. R.; Wilson, B.; Stumpf, R. M.; White, B. A.; Leigh, S. R.

    2015-01-01

    Roč. 24, č. 10 (2015), s. 2551-2565 ISSN 0962-1083 R&D Projects: GA ČR GA206/09/0927 Institutional support: RVO:68081766 ; RVO:67985904 Keywords : western lowland gorillas * microbiome * metabolomics * foraging ecology * anthropogenic interactions Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 5.947, year: 2015

  2. 100% citrus juice: Nutritional contribution, dietary benefits, and association with anthropometric measures.

    Science.gov (United States)

    Rampersaud, Gail C; Valim, M Filomena

    2017-01-02

    Citrus juices such as 100% orange (OJ) and grapefruit juice (GJ) are commonly consumed throughout the world. This review examines the contributions of OJ and GJ to nutrient intake, diet quality, and fruit intake, and supports citrus juices as nutrient-dense beverages. This review also explores the research examining associations between OJ and GJ intake and anthropometric measures. Citrus juices are excellent sources of vitamin C and contribute other key nutrients such as potassium, folate, magnesium, and vitamin A. OJ intake has been associated with better diet quality in children and adults. OJ intake has not been associated with adverse effects on weight or other body measures in observational studies in children and adults. In adults, some observational studies report more favorable body mass index or body measure parameters in OJ consumers compared to nonconsumers. Intervention studies in adults report no negative impacts of OJ or GJ consumption on anthropometric measures, although these measures were typically not the primary outcomes examined in the studies. Moderate consumption of citrus juices may provide meaningful nutritional and dietary benefits and do not appear to negatively impact body weight, body composition, or other anthropometric measures in children and adults.

  3. A review on mesopelagic fishes belonging to family Myctophidae

    Digital Repository Service at National Institute of Oceanography (India)

    Catul, V.; Gauns, M.; Karuppasamy, P.K.

    Jr (1991) Life histories of three species of lanternfishes (Pisces: Myctophidae) from the eastern Gulf of Mexico. II- Age and growth patterns. Mar Biol 111:21-27 Gjөsæter J (1984) Mesopelagic fish, a large potential resource in the Arabian Sea. Deep...

  4. SUMMARY CLINICS

    African Journals Online (AJOL)

    Valentine

    and endometriosis-related adhesions. Obstet Gynecol. 1998; 92:766-70. 4. Sulaiman H, Gabelle G, Davis MSc C, Mutsaers SE,. Boulos P, Laurent GJ et al. Presence and distribution of sensory nerve fibers in human peritoneal adhesions. Ann. Surg 2001;234,2: 256-61. 5. Olive DL, Blackwell RE, Copperman AB. En-.

  5. Role of actin cytoskeleton at multiple levels of T cell activation

    Czech Academy of Sciences Publication Activity Database

    Huranová, Martina; Štěpánek, Ondřej

    2016-01-01

    Roč. 3, č. 4 (2016), s. 585-596 ISSN 2372-0301 R&D Projects: GA ČR GJ16-09208Y Institutional support: RVO:68378050 Keywords : T cell * actin * cytoskeleton * TCR * signal transduction * antigen recognition * antigen affinity threshold * immunological synapse Subject RIV: EB - Genetics ; Molecular Biology

  6. Thelazia callipaeda in wild carnivores from Romania: new host and geographical records

    Czech Academy of Sciences Publication Activity Database

    Mihalca, A. D.; Ionică, A.M.; D’Amico, G.; Daskalaki, A.A.; Deak, G.; Matei, I.A.; Șimonca, V.; Iordache, D.; Modrý, David; Gherman, C.M.

    2016-01-01

    Roč. 9, JUN 18 (2016), č. článku 350. ISSN 1756-3305 Institutional support: RVO:60077344 Keywords : Thelazia callipaeda * Canis aureus * Canis lupus * Felis silvestris * Romania Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 3.080, year: 2016

  7. Tapeworm Diphyllobothrium dendriticum (Cestoda)-Neglected or Emerging Human Parasite?

    Czech Academy of Sciences Publication Activity Database

    Kuchta, Roman; Brabec, Jan; Kubáčková, P.; Scholz, Tomáš

    2013-01-01

    Roč. 7, č. 12 (2013), e2535 ISSN 1935-2727 R&D Projects: GA ČR GAP506/12/1632 Institutional support: RVO:60077344 Keywords : tapeworm * human disease * cox1 gene Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 4.716, year: 2011

  8. Pancreatitis associated with the helminth Serpinema microcephalus (Nematoda: Camallanidae) in exotic Red-Eared Slider Turtles (Trachemys scripta elegans)

    Czech Academy of Sciences Publication Activity Database

    Hidalgo-Vila, J.; Martínez-Silvestre, A.; Ribas, Alexis; Casanova, J. C.; Pérez-Santigosa, N.; Díaz-Paniagua, C.

    2011-01-01

    Roč. 47, č. 1 (2011), s. 201-205 ISSN 0090-3558 Institutional research plan: CEZ:AV0Z60930519 Keywords : helminth * invasive exotic turtles * pancreatitis * reptiles Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 1.079, year: 2011 http://www.jwildlifedis.org/cgi/reprint/47/1/201

  9. Taxonomy and biology of proteocephalidean cestodes: current state and perspectives

    Czech Academy of Sciences Publication Activity Database

    Scholz, Tomáš; de Chambrier, A.

    2003-01-01

    Roč. 40, č. 2 (2003), s. 65-75 ISSN 0440-6605 R&D Projects: GA ČR GA524/01/1314 Institutional research plan: CEZ:AV0Z6022909 Keywords : Proteocephalidea * taxonomy * phylogeny Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 0.474, year: 2003

  10. A new genus and two new species of Aporhynchidae (Cestoda: Trypanorhyncha) from catsharks (Caranchiniformes: Scyliorhinidae) off Taiwan

    Czech Academy of Sciences Publication Activity Database

    Caira, J. N.; Kuchta, Roman; Desjardins, L.

    2010-01-01

    Roč. 96, č. 6 (2010), s. 1185-1190 ISSN 0022-3395 R&D Projects: GA AV ČR KJB600960902; GA MŠk LC522 Institutional research plan: CEZ:AV0Z60220518 Keywords : Taiwan * catshark * Trypanorhyncha Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 1.208, year: 2010

  11. Female morphology of Philometra hyderabadensis Rasheed, 1963 (Nematoda: Philometridae), a little-known parasite of the catfish Wallago attu Bloch & Schneider in India, as revealed by SEM observations

    Czech Academy of Sciences Publication Activity Database

    Moravec, František; Chavan, S. P.

    2012-01-01

    Roč. 83, č. 2 (2012), s. 117-122 ISSN 0165-5752 R&D Projects: GA ČR GBP505/12/G112 Institutional research plan: CEZ:AV0Z60220518 Keywords : Philometra * Wallago * India Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 1.260, year: 2012

  12. Audit of Visual Outcome of Cataract Surgeries in a Private Eye ...

    African Journals Online (AJOL)

    tulyasys

    Ophthalmologists can only ensure quality control and be beer armed ... [2] This will help to achieve the targets of the VISION 2020 ... 85% of operated eyes should have good outcome (≥6/18 vision) and less .... may not be instilling their eye drops according to ... Limburg H, Foster A, Gilbert C, Johnson GJ, Kyndt M. Routine.

  13. Composition and age structure of the Pelophylax esculentus complex (Anura; Ranidae) population in inland Croatia

    Czech Academy of Sciences Publication Activity Database

    Čavlovič, K.; Buj, I.; Karaica, D.; Jelič, D.; Choleva, Lukáš

    2018-01-01

    Roč. 54, č. 1 (2018), s. 11-20 ISSN 0036-3375 R&D Projects: GA ČR GJ15-19947Y Institutional support: RVO:67985904 Keywords : hybridogenesis * population composition * allozyme markers Subject RIV: EG - Zoology OBOR OECD: Zoology Impact factor: 1.250, year: 2016

  14. On the bright side of a forest pest-the metabolic potential of bark beetles' bacterial associates

    Czech Academy of Sciences Publication Activity Database

    Fabryová, Anna; Kostovčík, Martin; Diez-Mendez, A.; Jimenez-Gomez, A.; Celador-Lera, L.; Saati-Santamaria, Z.; Sechovcová, Hana; Menéndez, E.; Kolařík, Miroslav; García-Fraile, Paula

    2018-01-01

    Roč. 619, APR 1 2018 (2018), s. 9-17 ISSN 0048-9697 R&D Projects: GA ČR(CZ) GJ16-15293Y Institutional support: RVO:61388971 ; RVO:67985904 Keywords : Lignocellulolytic enzymes * Biomass hydrolysis * Genome sequence Subject RIV: EE - Microbiology, Virology OBOR OECD: Microbiology Impact factor: 4.900, year: 2016

  15. Abrupt change in mean using block bootstrap and avoiding variance estimation

    Czech Academy of Sciences Publication Activity Database

    Peštová, Barbora; Pešta, M.

    2018-01-01

    Roč. 33, č. 1 (2018), s. 413-441 ISSN 0943-4062 Grant - others:GA ČR(CZ) GJ15-04774Y Institutional support: RVO:67985807 Keywords : Block bootstrap * Change in mean * Change point * Hypothesis test ing * Ratio type statistics * Robustness Subject RIV: BB - Applied Statistics, Operational Research Impact factor: 0.434, year: 2016

  16. Benchmark Applications of Variations of Multireference Equation of Motion Coupled-Cluster Theory

    Czech Academy of Sciences Publication Activity Database

    Huntington, L. M.; Demel, Ondřej; Nooijen, M.

    2016-01-01

    Roč. 12, č. 1 (2016), s. 114-132 ISSN 1549-9618 R&D Projects: GA ČR GJ15-00058Y Institutional support: RVO:61388955 Keywords : MR-EOM * Benchmark applications * variations Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 5.245, year: 2016

  17. Estimates of the costs of steam derived from nuclear and fossil fuels

    International Nuclear Information System (INIS)

    Spiewak, I.; Klepper, O.H.

    1978-01-01

    Process steam from intermediate size and large reactors is cheaper than steam produced in conventional boilers burning coal, or oil at $2.21/GJ($14/barrel in 1976 dollars). Small nuclear and coal-based steam supply systems may be competitive with oil under criteria that consider long-term economic inflation and the detailed financial and tax structure of the energy user

  18. Taxonomic status, redescription, and surface ultrastructure of Ascocotyle (Phagicola) pindoramensis n. comb. (Digenea: Heterophyidae)

    Czech Academy of Sciences Publication Activity Database

    Simoes, S. B. E.; Scholz, Tomáš; Barbosa, H. S.; Santos, C. P.

    2006-01-01

    Roč. 92, č. 3 (2006), s. 501-508 ISSN 0022-3395 R&D Projects: GA AV ČR IAA6022404; GA MŠk LC522 Institutional research plan: CEZ:AV0Z60220518 Keywords : Digenea * Heterophyidae * taxonomy Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 1.300, year: 2006

  19. Thermodynamic and thermoeconomic analyses of a trigeneration (TRIGEN) system with a gas-diesel engine: Part II - An application

    International Nuclear Information System (INIS)

    Balli, Ozgur; Aras, Haydar; Hepbasli, Arif

    2010-01-01

    The paper is Part 2 of the study on the thermodynamic and thermoeconomic analyses of trigeneration system with a gas-diesel engine. In Part 1, thermodynamic and thermoeconomic methodologies for such a comprehensive analysis were provided, while this paper applies the developed methodology to an actual TRIGEN system with a rated output of 6.5 MW gas-diesel engine installed in the Eskisehir Industry Estate Zone, Turkey. Energy and exergy efficiencies, equivalent electrical efficiency, the Public Utility Regulatory Policies Act (PURPA) efficiency, fuel energy saving ratio, fuel exergy saving ratio and other thermodynamic performance parameters are determined for the TRIGEN system. The efficiencies of energy, exergy, PURPA and equivalent electrical efficiency of the entire system are found to be 58.97%, 36.13%, 45.7% and 48.53%, respectively. For the whole system and its components, exergetic cost allocations and various exergoeconomic performance parameters are calculated using the exergoeconomic analysis based on specific exergy costing method (SPECO). The specific unit exergetic cost of the net electrical power, heat energy in the Factory Heating Center (FHC) heating, heat energy in the Painting Factory Heating (PFH) and chilled water in the absorption chiller (ACh) produced by the TRIGEN system are obtained to be 45.94 US$/GJ, 29.98 US$/GJ, 42.42 US$/GJ and 167.52 US$/GJ, respectively.

  20. Cryptosporidium ubiquitum, C. muris and Cryptosporidium deer genotype in wild cervids and caprines in the Czech Republic

    Czech Academy of Sciences Publication Activity Database

    Kotková, Michaela; Němejc, K.; Sak, Bohumil; Hanzal, V.; Květoňová, Dana; Hlásková, Lenka; Čondlová, Šárka; McEvoy, J.; Kváč, Martin

    2016-01-01

    Roč. 63, 25 January (2016), č. článku 003. ISSN 1803-6465 R&D Projects: GA ČR GA15-01090S Institutional support: RVO:60077344 Keywords : Cryptosporidiidae * epidemiology * phylogeny * SSU * gp60 Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 1.082, year: 2016

  1. Crystal Structures of Intermediates in the Dehalogenation of Haloalkanoates by L-2-Haloacid Dehalogenase

    NARCIS (Netherlands)

    Ridder, Ivo S.; Rozeboom, Henriëtte J.; Kalk, Kor H.; Dijkstra, Bauke W.

    1999-01-01

    The L-2-haloacid dehalogenase from the 1,2-dichloroethane-degrading bacterium Xanthobacter autotrophicus GJ10 catalyzes the hydrolytic dehalogenation of small L-2-haloalkanoates to their corresponding D-2-hydroxyalkanoates, with inversion of the configuration at the C2 atom. The structure of the

  2. Effect of cluster environment on the electron attachment to 2-nitrophenol

    Czech Academy of Sciences Publication Activity Database

    Kočišek, Jaroslav; Grygoryeva, Kateřina; Lengyel, Jozef; Fárník, Michal; Fedor, Juraj

    2016-01-01

    Roč. 70, č. 4 (2016), s. 98-105 ISSN 1434-6060 R&D Projects: GA ČR GJ16-10995Y; GA ČR GA14-14082S Institutional support: RVO:61388955 Keywords : electron attachment * cluster environment * 2-nitrophenol Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 1.288, year: 2016

  3. A new species of Dentiphilometra (Nematoda: Philometridae) from the musculature of the gray snapper Lutjanus griseus (Osteichthyes) off the Caribbean coast of Mexico

    Czech Academy of Sciences Publication Activity Database

    González-Solís, D.; Moravec, František; Tuz Paredes, V. M.

    2007-01-01

    Roč. 93, č. 6 (2007), s. 1132-1135 ISSN 0022-3395 R&D Projects: GA ČR(CZ) GA524/06/0170; GA MŠk LC522 Institutional research plan: CEZ:AV0Z60220518 Keywords : parasitic nematode * Dentiphilometra * Mexico Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 1.129, year: 2007

  4. Dichelyne (Cucullanellus) romani n. sp (Nematoda: Cucullanidae) in notacanthid fishes from the Northeast Atlantic and Western Mediterranean

    Czech Academy of Sciences Publication Activity Database

    Isbert, W.; Esteban Montero, F.; Carrasson, M.; González-Solís, David

    2015-01-01

    Roč. 91, č. 1 (2015), s. 35-47 ISSN 0165-5752 R&D Projects: GA ČR(CZ) GBP505/12/G112 Institutional support: RVO:60077344 Keywords : ribosomal dna * marine fishes * pisces * sea * Ascaridoidea * Sciaenidae * morphology * tornquist * parasites * Mexico Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 1.316, year: 2015

  5. Redescription of Paraleptus chiloscyllii Yin et Zhang, 1983 (Nematoda: Physalopteridae) from the Arabian carpetshark Chiloscyllium arabicum (Chondrichthyes: Hemiscylliidae) off Iraq

    Czech Academy of Sciences Publication Activity Database

    González-Solís, David; Ali, A. H.

    2015-01-01

    Roč. 60, č. 4 (2015), s. 759-766 ISSN 1230-2821 R&D Projects: GA ČR(CZ) GBP505/12/G112 Institutional support: RVO:60077344 Keywords : Arabian Gulf * elasmobranchs * nematode Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 1.293, year: 2015

  6. preliminary phytochemical screening and antioxidant activity

    African Journals Online (AJOL)

    DR. AMINU

    reduction mechanism of DPPH correlated with presence of hydroxyl ... are known to occur in plant species belonging to the .... Alcohol, wine and ... oxidation. Athelosclerosis, 123: 83-91. Zhu, N., Wang, M., Wei, G.J., Lin, J.K., Yang, C.S. and.

  7. Blocked stomodeal valve of the insect vector: similar mechanism of transmission in two trypanosomatid models

    Czech Academy of Sciences Publication Activity Database

    Volf, P.; Hajmová, M.; Sádlová, J.; Votýpka, Jan

    2004-01-01

    Roč. 34, č. 11 (2004), s. 1221-1227 ISSN 0020-7519 Grant - others:GA FRVŠ(CZ) FRVŠ 2356/2002 Institutional research plan: CEZ:AV0Z6022909 Keywords : stomodeal valve * sand fly * Leishmania Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 3.092, year: 2004

  8. International Journal of Arts and Humanities(IJAH) Bahir Dar- Ethiopia

    African Journals Online (AJOL)

    DrNneka

    a combination of government and Christian efforts being a dominant religion in the area. ... “A people's culture includes their beliefs, rules of behaviour, language, ...... Indiana: University. Idowu, E.B. (1996). Olodumare: God in Yoruba belief. Ibadan: Longman. (Original work Published in 1962). Irikana, G.J. (2011). Mangrove ...

  9. Ionizing Shocks in Argon. Part 1: Collisional-Radiative Model and Steady-State Structure (Preprint)

    Science.gov (United States)

    2010-09-09

    absorption oscillator strength is given by fabsij = gj gi Aji 3γ . (43) Contributions to the parameter γ have been assumed to result from a combination of...discretization, the Saha temperatures of the higher states (green, red and blue solid curves) overshoot Te and relaxes with Th, indicating over

  10. Dependence of the immune response to coccidiosis on the age of rabbit suckling

    Czech Academy of Sciences Publication Activity Database

    Pakandl, Michal; Hlásková, Lenka; Poplštein, M.; Chromá, V.; Vodička, T.; Salát, Jiří; Mucksová, J.

    2008-01-01

    Roč. 103, č. 6 (2008), s. 1265-1271 ISSN 0932-0113 R&D Projects: GA ČR GA524/05/2328 Institutional research plan: CEZ:AV0Z60220518 Keywords : suckling rabbits * coccidiosis * immune response Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 1.473, year: 2008

  11. Coexistence of gain-of-function JAK2 germ line mutations with JAK2(V617F) in polycythemia vera

    Czech Academy of Sciences Publication Activity Database

    Láníková, Lucie; Babošová, Oľga; Swierczek, S.; Wang, L.; Wheeler, D.A.; Divoky, V.; Kořínek, Vladimír; Prchal, J.T.

    2016-01-01

    Roč. 128, č. 18 (2016), s. 2266-2270 ISSN 0006-4971 R&D Projects: GA ČR GJ15-18046Y; GA MŠk LO1419 Institutional support: RVO:68378050 Keywords : JAK2 mutations * polycythemia vera Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 13.164, year: 2016

  12. Spectroscopic insights into quadruplexes of five-repeat telomere DNA sequences upon G-block damage

    Czech Academy of Sciences Publication Activity Database

    Dvořáková, Zuzana; Vorlíčková, Michaela; Renčiuk, Daniel

    2017-01-01

    Roč. 1861, č. 11 (2017), s. 2750-2757 ISSN 0304-4165 R&D Projects: GA ČR(CZ) GJ17-19170Y Institutional support: RVO:68081707 Keywords : k+ solution * guanine quadruplexes Subject RIV: CE - Biochemistry OBOR OECD: Biochemistry and molecular biology Impact factor: 4.702, year: 2016

  13. Phasmid ultrastructure of an ascaridoid nematode Hysterothylacium auctum

    Czech Academy of Sciences Publication Activity Database

    Fagerholm, H.-P.; Bruňanská, Magdaléna; Roepstorff, A.; Eriksen, L.

    2004-01-01

    Roč. 90, č. 3 (2004), s. 499-506 ISSN 0022-3395 Institutional research plan: CEZ:AV0Z6022909 Keywords : Nematoda * Ascaridoidea * phasmid Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 1.439, year: 2004

  14. Point correlation dimension can reveal functional changes caused by gap junction blockers in the 4-aminopyridine in vivo rat epilepsy model

    Energy Technology Data Exchange (ETDEWEB)

    Jardanhazy, Anett [Department of Neurology, University of Szeged, Semmelweis u. 6, Szeged H-6725 (Hungary); Molnar, Mark [Department of Psychophysiology, Institute for Psychology of the Hungarian Academy of Sciences, P.O. Box 398, Budapest H-1394 (Hungary)], E-mail: molnar@cogpsyphy.hu; Jardanhazy, Tamas [Department of Neurology, University of Szeged, Semmelweis u. 6, Szeged H-6725 (Hungary)], E-mail: jt@nepsy.szote.u-szeged.hu

    2009-04-15

    The contribution of gap junction (GJ) blockers to seizure initiation was reexamined by means of an analysis on nonlinear dynamics with point correlation dimension (PD2i) at as well as around the primary focus, and mirror focus in an already active 4-aminopyridine-induced in vivo epilepsy model. From the data base of the ECoGs of anesthetized adult rats treated with quinine, a selective blocker of Cx36, and in combination with an additional broad-spectrum GJ blocker, carbenoxolone, 14 cases of each condition were reexamined with a stationarity insensitive nonlinear PD2i method. The blockade of the Cx36 channels decreased the usual drop of the point correlation dimension at the beginning of the seizures, and this was enhanced by the additional use of the global blocker carbenoxolone. The so-called characteristic DC shift just prior to seizure onset denotes a low dimensional seizure event and the recognizable seizures display very variable, rapidly changing dynamics, as revealed by the PD2i analysis. This nonlinear PD2i analysis demonstrated that the different GJ blockers in the already active epileptic model helped seizure initiation, but exerted inhibitory effects on the seizure onset itself, acting differently on the local components of the network organization generating seizure discharges, possibly changing the coupling strengths and time delays in the GJ-s.

  15. Point correlation dimension can reveal functional changes caused by gap junction blockers in the 4-aminopyridine in vivo rat epilepsy model

    International Nuclear Information System (INIS)

    Jardanhazy, Anett; Molnar, Mark; Jardanhazy, Tamas

    2009-01-01

    The contribution of gap junction (GJ) blockers to seizure initiation was reexamined by means of an analysis on nonlinear dynamics with point correlation dimension (PD2i) at as well as around the primary focus, and mirror focus in an already active 4-aminopyridine-induced in vivo epilepsy model. From the data base of the ECoGs of anesthetized adult rats treated with quinine, a selective blocker of Cx36, and in combination with an additional broad-spectrum GJ blocker, carbenoxolone, 14 cases of each condition were reexamined with a stationarity insensitive nonlinear PD2i method. The blockade of the Cx36 channels decreased the usual drop of the point correlation dimension at the beginning of the seizures, and this was enhanced by the additional use of the global blocker carbenoxolone. The so-called characteristic DC shift just prior to seizure onset denotes a low dimensional seizure event and the recognizable seizures display very variable, rapidly changing dynamics, as revealed by the PD2i analysis. This nonlinear PD2i analysis demonstrated that the different GJ blockers in the already active epileptic model helped seizure initiation, but exerted inhibitory effects on the seizure onset itself, acting differently on the local components of the network organization generating seizure discharges, possibly changing the coupling strengths and time delays in the GJ-s.

  16. Anatomie a histologie zubů morčete domácího (Cavia aperea f. porcellus)

    Czech Academy of Sciences Publication Activity Database

    Mináriková, A.; Buchtová, Marcela; Jekl, V.

    2017-01-01

    Roč. 14, č. 4 (2017), s. 175-179 ISSN 1214-6080 R&D Projects: GA ČR(CZ) GA17-14886S Institutional support: RVO:67985904 Keywords : guinea pigs * dentition Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine OBOR OECD: Veterinary science

  17. Stray cats are more frequently infected with zoonotic protists than pet cats

    Czech Academy of Sciences Publication Activity Database

    Kváč, Martin; Hofmannová, L.; Ortega, Y.; Holubová, Nikola; Horčičková, Michaela; Kicia, M.; Hlásková, Lenka; Květoňová, Dana; Sak, Bohumil; McEvoy, J.

    2017-01-01

    Roč. 64, 6 December (2017), č. článku 034. ISSN 1803-6465 R&D Projects: GA ČR GA15-01090S Institutional support: RVO:60077344 Keywords : Cryptosporidium * Giardia * Encephalitozoon * Enterocytozoon bieneusi * antiparasitics * PCR Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine OBOR OECD: Veterinary science Impact factor: 1.082, year: 2016

  18. Effects of selected tricyclic antidepressants on early-life stages of common carp (Cyprinus carpio)

    Czech Academy of Sciences Publication Activity Database

    Sehonová, P.; Plhalová, L.; Blahová, J.; Doubková, V.; Maršálek, P.; Prokeš, Miroslav; Tichý, F.; Skládaná, M.; Fiorino, E.; Mikula, P.; Večerek, V.; Faggio, C.; Svobodová, Z.

    2017-01-01

    Roč. 185, October (2017), s. 1072-1080 ISSN 0045-6535 Institutional support: RVO:68081766 Keywords : Mixture toxicity * Amitriptyline * Nortriptyline * Clomipramine * Oxidative stress Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine OBOR OECD: Environmental sciences (social aspects to be 5.7) Impact factor: 4.208, year: 2016

  19. Book Reviews

    Directory of Open Access Journals (Sweden)

    Redactie KITLV

    1953-04-01

    Full Text Available - G.J. Held, P.E. de Josselin de Jong, Minangkabau and Negri Sembilan; Socio-political structure in Indonesia, 1951, PhD thesis, Leiden, viii + 208 pp. H.Th. Fischer, C. Nooteboom, Trois problèmes d'ethnologie maritime, 1952, Rotterdam: Museum van Land- en Volkenkunde, 25 figuren.

  20. A new gonad-infecting species of Philometra Costa, 1845 (Nematoda: Philometridae) from the marine fish Terapon jarbua (Forsskal) (Terapontidae) off the eastern coast of India

    Czech Academy of Sciences Publication Activity Database

    Moravec, František; Gopalakrishnan, A.; Rajkumar, M.; Saravanakumar, A.; Kaliyamoorthy, S.

    2011-01-01

    Roč. 80, č. 1 (2011), 23-33 ISSN 0165-5752 R&D Projects: GA MŠk LC522 Institutional research plan: CEZ:AV0Z60220518 Keywords : Philometra * Terapon * India Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 1.250, year: 2011

  1. Two cystidicolids (Nematoda, Cystidicolidae) from marine fishes off New Caledonia

    Czech Academy of Sciences Publication Activity Database

    Moravec, František; Justine, J.-L.

    2009-01-01

    Roč. 54, č. 4 (2009), s. 341-349 ISSN 1230-2821 R&D Projects: GA MŠk LC522 Institutional research plan: CEZ:AV0Z60220518 Keywords : Cystidicolid nematode * marine fish * New Caledonia Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 1.070, year: 2009

  2. Nematode parasites of fishes: recent advances and problems of their research

    Czech Academy of Sciences Publication Activity Database

    Moravec, František

    2007-01-01

    Roč. 49, č. 3 (2007), s. 155-160 ISSN 0048-2951 R&D Projects: GA ČR(CZ) GA524/06/0170; GA MŠk LC522 Institutional research plan: CEZ:AV0Z60220518 Keywords : parasitic nematode * research * fish Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine

  3. Raphidascaris (Ichthyascaris) etelidis n. sp (Nematoda, Anisakidae), a new ascaridoid nematode from lutjanid fishes off New Caledonia

    Czech Academy of Sciences Publication Activity Database

    Moravec, František; Justine, J.-L.

    2012-01-01

    Roč. 34, č. 1 (2012), s. 113-121 ISSN 1280-9551 R&D Projects: GA MŠk LC522 Institutional research plan: CEZ:AV0Z60220518 Keywords : Parasitic nematode * Raphidascaris * Ichthyascaris * Etelis * Pristipomoides * marine fishes * New Caledonia * South Pacific * new species Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 0.696, year: 2012

  4. New data on the morphology of Procamallanus (Procamallanus) annulatus and Procamallanus (Spirocamallanus) monotaxis (Nematoda: Camallanidae) from marine fishes off New Caledonia

    Czech Academy of Sciences Publication Activity Database

    Moravec, František; Justine, J.-L.

    2011-01-01

    Roč. 48, č. 1 (2011), 41-50 ISSN 0440-6605 R&D Projects: GA MŠk LC522 Institutional research plan: CEZ:AV0Z60220518 Keywords : Procamallanus * marine fish * New Caledonia Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 0.773, year: 2011

  5. Intermediate hosts of the trematode Collyriclum faba (Plagiochiida: Collyriclidae) identified by an integrated morphological and genetic approach

    Czech Academy of Sciences Publication Activity Database

    Heneberg, P.; Faltýnková, Anna; Bizos, J.; Mala, M.; Žiak, J.; Literák, I.

    2015-01-01

    Roč. 8, FEB 8 2015 (2015), s. 85 ISSN 1756-3305 Institutional support: RVO:60077344 Keywords : cercariae * DNA analysis * fluke * host -parasite interaction * Hydrobiidae * life cycle * Littorinimorpha Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 3.234, year: 2015

  6. Phylogenetic analysis of coccidian parasites from invertebrates: search for missing links

    Czech Academy of Sciences Publication Activity Database

    Kopečná, Jana; Jirků, Milan; Oborník, Miroslav; Tokarev, Y. S.; Lukeš, Julius; Modrý, David

    2006-01-01

    Roč. 157, č. 2 (2006), s. 173-183 ISSN 1434-4610 R&D Projects: GA ČR GP524/03/D104 Institutional research plan: CEZ:AV0Z60220518 Keywords : Adelina * Aggregata * molecular phylogeny Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 3.262, year: 2006

  7. Evolutionary relationships of Spirurina (Nematoda: Chromadorea: Rhabditida) with special emphasis on dracunculoid nematodes inferred from SSU rRNA gene sequences

    Czech Academy of Sciences Publication Activity Database

    Wijová, Martina; Moravec, František; Horák, Aleš; Lukeš, Julius

    2006-01-01

    Roč. 36, č. 9 (2006), s. 1067-1075 ISSN 0020-7519 R&D Projects: GA ČR(CZ) GA524/06/0170 Institutional research plan: CEZ:AV0Z60220518 Keywords : Nematoda * Spirurina * SSU rRNA gene sequences Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 3.337, year: 2006

  8. Genetic diversity of Cryptosporidium spp. including novel identification of the Cryptosporidium muris and Cryptosporidium tyzzeri in horses in the Czech Republic and Poland

    Czech Academy of Sciences Publication Activity Database

    Wagnerová, Pavla; Sak, Bohumil; McEvoy, J.; Rost, M.; Perec Matysiak, A.; Ježková, J.; Kváč, Martin

    2015-01-01

    Roč. 114, č. 4 (2015), s. 1619-1624 ISSN 0932-0113 R&D Projects: GA ČR GA15-01090S Institutional support: RVO:60077344 Keywords : horse * Cryptosporidium * SSU * gp60 * MLST Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 2.027, year: 2015

  9. Non-specific myiases of domestic animals in Czech and Slovac Republics

    Czech Academy of Sciences Publication Activity Database

    Minář, Jan

    2004-01-01

    Roč. 12, č. 1 (2004), s. 107-109 ISSN 1336-300X Institutional research plan: CEZ:AV0Z5007907 Keywords : non-specific myiasis * domestic animals * Lucilia sericata Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine

  10. Cryptosporidium parvum and Enterocytozoon bieneusi in American Mustangs and Chincoteague ponies

    Czech Academy of Sciences Publication Activity Database

    Wagnerová, Pavla; Sak, Bohumil; McEvoy, J.; Rost, M.; Sherwood, D.; Holcomb, K.; Kváč, Martin

    2016-01-01

    Roč. 162, MAR (2016), s. 24-27 ISSN 0014-4894 R&D Projects: GA ČR GA15-01090S Institutional support: RVO:60077344 Keywords : feral horses * Cryptosporidium * SSU * gp60 * Microsporidia * ITS Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 1.724, year: 2016

  11. Tick-borne encephalitis virus in horses, Austria, 2011

    Czech Academy of Sciences Publication Activity Database

    Rushton, J. O.; Lecollinet, S.; Hubálek, Zdeněk; Svobodová, Petra; Lussy, H.; Nowotny, N.

    2013-01-01

    Roč. 19, č. 4 (2013), s. 635-637 ISSN 1080-6040 Institutional support: RVO:68081766 Keywords : tick-borne encephalitis virus (TBEV) * strains Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 7.327, year: 2013

  12. Activation of protective cell-mediated immune response in gastric mucosa during Cryptosporidium muris infection and re-infection in immunocompetent mice

    Czech Academy of Sciences Publication Activity Database

    Jalovecká, M.; Sak, Bohumil; Kváč, Martin; Květoňová, Dana; Kučerová, Z.; Salát, Jiří

    2010-01-01

    Roč. 106, č. 5 (2010), s. 1159-1166 ISSN 0932-0113 R&D Projects: GA AV ČR KJB500960701 Institutional research plan: CEZ:AV0Z60220518 Keywords : Cryptosporidium muris * T-lymphocyte migration * gastric mucosa Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 1.812, year: 2010

  13. Molecular characterization of Cryptosporidium spp. in pre-weaned dairy calves in the Czech Republic: Absence of C. ryanae and management-associated distribution of C. andersoni, C. bovis and C. parvum subtypes

    Czech Academy of Sciences Publication Activity Database

    Kváč, Martin; Hromadová, N.; Květoňová, Dana; Rost, M.; Sak, Bohumil

    2011-01-01

    Roč. 177, 3/4 (2011), s. 378-382 ISSN 0304-4017 Institutional research plan: CEZ:AV0Z60220518 Keywords : Calves * Cryptosporidium andersoni * C. bovis * C. parvum * GP60 * SSU Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 2.579, year: 2011

  14. Prevalence and age-related infection of Cryptosporidium suis, C. muris and Cryptosporidium pig genotype II in pigs on a farm complex in the Czech Republic

    Czech Academy of Sciences Publication Activity Database

    Kváč, Martin; Hanzlíková, D.; Sak, Bohumil; Květoňová, Dana

    2009-01-01

    Roč. 160, 3/4 (2009), s. 319-322 ISSN 0304-4017 R&D Projects: GA ČR GP523/07/P117 Institutional research plan: CEZ:AV0Z60220518 Keywords : Cryptosporidium infection * age specificity * pigs Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 2.278, year: 2009

  15. Molecular characterization of Cryptosporidium isolates from pigs at slaughterhouses in South Bohemia, Czech Republic

    Czech Academy of Sciences Publication Activity Database

    Kváč, Martin; Sak, Bohumil; Hanzlíková, D.; Kotilová, J.; Květoňová, Dana

    2009-01-01

    Roč. 104, č. 2 (2009), s. 425-428 ISSN 0932-0113 R&D Projects: GA ČR GP523/07/P117 Institutional research plan: CEZ:AV0Z60220518 Keywords : Cryptosporidium spp. * slaughterhouse * pigs Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 1.721, year: 2009

  16. Prevalence and pathogenicity of Cryptosporidium andersoni in one herd of beef cattle

    Czech Academy of Sciences Publication Activity Database

    Kváč, Martin; Vítovec, J.

    2003-01-01

    Roč. 50, č. 9 (2003), s. 451-457 ISSN 0931-1793 Institutional research plan: CEZ:AV0Z6022909; CEZ:MSM 122200002 Keywords : cryptosporidiosis * cattle * Cryptosporidium andersoni Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 0.656, year: 2003

  17. The first report on Cryptosporidium suis and Cryptosporidium pig genotype II in Eurasian wild boars (Sus scrofa) (Czech Republic)

    Czech Academy of Sciences Publication Activity Database

    Němejc, K.; Sak, Bohumil; Květoňová, Dana; Hanzal, V.; Jeníková, Martina; Kváč, Martin

    2012-01-01

    Roč. 184, 2/4 (2012), 122-125 ISSN 0304-4017 Grant - others:Mšk(CZ) 6007665806 Institutional research plan: CEZ:AV0Z60220518; CEZ:AV0Z50450515 Keywords : Cryptosporidium suis * Cryptosporidium pig genotype II * Eurasian wild boar * SSU * PCR Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 2.381, year: 2012

  18. Prevalence and molecular characterization of Cryptosporidium spp. in dairy cattle in South Bohemia, the Czech Republic

    Czech Academy of Sciences Publication Activity Database

    Ondráčková, Z.; Kváč, Martin; Sak, Bohumil; Květoňová, Dana; Rost, M.

    2009-01-01

    Roč. 165, 1/2 (2009), s. 141-144 ISSN 0304-4017 R&D Projects: GA ČR GP523/07/P117 Institutional research plan: CEZ:AV0Z60220518 Keywords : Cryptosporidium spp. * cattle * slaughterhouses Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 2.278, year: 2009

  19. Effects of low and high temperatures on infectivity of Cryptosporidium muris oocysts suspended in water

    Czech Academy of Sciences Publication Activity Database

    Neumayerová, H.; Koudela, Břetislav

    2008-01-01

    Roč. 153, 3/4 (2008), s. 197-202 ISSN 0304-4017 Institutional research plan: CEZ:AV0Z60220518 Keywords : Cryptosporidium muris * oocysts * low and high temperatures * infectivity Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 2.039, year: 2008

  20. Parasites of Harmonia axyridis: current research and perspectives

    Czech Academy of Sciences Publication Activity Database

    Haelewaters, D.; Zhao, S. Y.; Clusella-Trullas, S.; Cottrell, T. E.; De Kesel, A.; Fiedler, L.; Herz, A.; Hesketh, H.; Hui, C.; Kleespies, R. G.; Losey, J. E.; Minnaar, I. A.; Murray, K. M.; Nedvěd, Oldřich; Pfliegler, W. P.; Raak-van den Berg, C. L.; Riddick, E. W.; Shapiro-Ilan, D. I.; Smyth, R. R.; Steenberg, T.; van Wielink, P. S.; Viglášová, S.; Zhao, Z.; Ceryngier, P.; Roy, H. E.

    2017-01-01

    Roč. 62, č. 3 (2017), s. 355-371 ISSN 1386-6141 Institutional support: RVO:60077344 Keywords : Coccipolipus hippodamiae * enemy release hypothesis * Harmonia axyridis Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine OBOR OECD: Other biological topics Impact factor: 1.918, year: 2016 https://link.springer.com/article/10.1007/s10526-016-9766-8

  1. Cryptosporidium meleagridis and C. baileyi (Apicomplexa) in domestic and wild birds in Algeria

    Czech Academy of Sciences Publication Activity Database

    Laatamna, A.E.; Holubová, Nikola; Sak, Bohumil; Kváč, Martin

    2017-01-01

    Roč. 64, JUN 13 (2017), č. článku 018. ISSN 1803-6465 R&D Projects: GA ČR GA15-01090S Institutional support: RVO:60077344 Keywords : avian cryptosporidia * pcr * epidemiology * Northern Africa Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine OBOR OECD: Veterinary science Impact factor: 1.082, year: 2016

  2. Designing molecular printboards: a photolithographic platform for recodable surfaces

    Czech Academy of Sciences Publication Activity Database

    Abt, D.; Schmidt, B. V. K. J.; Pop-Georgievski, Ognen; Quick, A. S.; Danilov, D.; Kostina, Nina Yu.; Bruns, M.; Wenzel, W.; Wegener, M.; Rodriguez-Emmenegger, Cesar; Barner-Kowollik, C.

    2015-01-01

    Roč. 21, č. 38 (2015), s. 13186-13190 ISSN 0947-6539 R&D Projects: GA ČR(CZ) GJ15-09368Y Institutional support: RVO:61389013 Keywords : cyclodextrin * molecular printboard * photoconjugation Subject RIV: BO - Biophysics Impact factor: 5.771, year: 2015

  3. Effect of trichloroethylene on the competitive behavior of toluene-degrading bacteria

    NARCIS (Netherlands)

    Mars, Astrid E.; Prins, Gjalt T.; Wietzes, Pieter; Koning, Wim de; Janssen, Dick B.

    The influence of trichloroethylene (TCE) on a mixed culture of four different toluene-degrading bacterial strains (Pseudomonas putida mt-2, P. putida F1, P. putida GJ31, and Burkholderia cepacia G4) was studied with a fed-batch culture. The strains were competing for toluene, which was added at a

  4. PATTERNS OF SEVEN AND COMPLICATED MALARIA IN CHILDREN

    African Journals Online (AJOL)

    GB

    2013-11-03

    Nov 3, 2013 ... Law WP, Dore GJ, Duncombe CJ et al. Risk of severe hepatotoxicity associated with antiretroviral therapy in the HIV-NAT Cohort,. Thailand, 1996–2001. AIDS. 2003; 17:2191–. 2199. 5. Montessori V, Press N, Harris M, Akagi L,. Montaner JS. Adverse effects of antiretroviral therapy for HIV infection. CMAJ.

  5. First record of ostracods as natural intermediate hosts of Anguillicola crassus, a pathogenic swimbladder parasite of eels Anguilla spp..

    Czech Academy of Sciences Publication Activity Database

    Moravec, František; Nagasawa, K.; Miyakawa, M.

    2005-01-01

    Roč. 66, č. 3 (2005), s. 171-173 ISSN 0177-5103 R&D Projects: GA ČR GA524/03/0061 Institutional research plan: CEZ:AV0Z60220518 Keywords : Physocypria * Anguillicola * Japan Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 1.361, year: 2005

  6. Aeromonas Hydrophila: A Re-Emerging Pathogen

    Digital Repository Service at National Institute of Oceanography (India)

    Lakshmanaperumalsamy, P.; Thayumanavan, T.; Subashkumar, R.

    origin. Journal of Hygiene 81,161 ? 169. Trust, T.J., Sparrow, R.A.H., 1974. The bacterial flora in the alimentary tract of freshwater salmonid fishes. Canadian Journal of Microbiology 20, 1219 ? 1228. Tsai, G.J., Chen, T.H., 1995. Growth characteristics...

  7. Energy recovery from waste incineration: Assessing the importance of district heating networks

    International Nuclear Information System (INIS)

    Fruergaard, T.; Christensen, T.H.; Astrup, T.

    2010-01-01

    Municipal solid waste incineration contributes with 20% of the heat supplied to the more than 400 district heating networks in Denmark. In evaluation of the environmental consequences of this heat production, the typical approach has been to assume that other (fossil) fuels could be saved on a 1:1 basis (e.g. 1 GJ of waste heat delivered substitutes for 1 GJ of coal-based heat). This paper investigates consequences of waste-based heat substitution in two specific Danish district heating networks and the energy-associated interactions between the plants connected to these networks. Despite almost equal electricity and heat efficiencies at the waste incinerators connected to the two district heating networks, the energy and CO 2 accounts showed significantly different results: waste incineration in one network caused a CO 2 saving of 48 kg CO 2 /GJ energy input while in the other network a load of 43 kg CO 2 /GJ. This was caused mainly by differences in operation mode and fuel types of the other heat producing plants attached to the networks. The paper clearly indicates that simple evaluations of waste-to-energy efficiencies at the incinerator are insufficient for assessing the consequences of heat substitution in district heating network systems. The paper also shows that using national averages for heat substitution will not provide a correct answer: local conditions need to be addressed thoroughly otherwise we may fail to assess correctly the heat recovery from waste incineration.

  8. African Journal of Biotechnology - Vol 9, No 53 (2010)

    African Journals Online (AJOL)

    Analysis of combining ability and heredity parameters of glucosinolates in Chinese kale · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. G-J Chen, Y Si, B-H Cao, E-Y Feng, J-J Lei, 9026-9031 ...

  9. Anaplasma phagocytophilum increases the levels of histone modifying enzymes to inhibit cell apoptosis and facilitate pathogen infection in the tick vector Ixodes scapularis

    Czech Academy of Sciences Publication Activity Database

    Cabezas-Cruz, A.; Alberdi, P.; Ayllón, N.; Valdés, James J.; Pierce, R.; Villar, M.; de la Fuente, J.

    2016-01-01

    Roč. 11, č. 4 (2016), s. 303-319 ISSN 1559-2294 EU Projects: European Commission(XE) 278976 - ANTIGONE; European Commission(XE) 316304 - MODBIOLIN Institutional support: RVO:60077344 Keywords : Anaplasma * epigenetic s * histone modifying enzyme * histone * pathogen * tick Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 4.394, year: 2016

  10. Multiple cross-species transmission events of human adenoviruses (HAdV) during hominine evolution

    Czech Academy of Sciences Publication Activity Database

    Hoppe, E.; Pauly, M.; Gillespie, T. R.; Akoua-Koffi, C.; Hohmann, G.; Fruth, B.; Karhemere, S.; Madinda, N. F.; Mugisha, L.; Muyembe, J.-J.; Todd, A.; Petrželková, Klára Judita; Gray, M.; Robbins, M.; Bergl, R. A.; Wittig, R. M.; Zuberbuehler, K.; Boesch, C.; Schubert, G.; Leendertz, F. H.; Ehlers, B.; Calvignac-Spencer, S.

    2015-01-01

    Roč. 32, č. 8 (2015), s. 2072-2084 ISSN 0737-4038 R&D Projects: GA ČR GA206/09/0927 Institutional support: RVO:68081766 Keywords : adenovirus * African great apes * zoonosis Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 13.649, year: 2015

  11. Multiple Cross-Species Transmission Events of Human/nAdenoviruses (HAdV) during Hominine Evolution

    Czech Academy of Sciences Publication Activity Database

    Hoppe, E.; Pauly, M.; Gillespie, T. R.; Akoua-Koffi, C.; Hohmann, G.; Fruth, B.; Karhemere, S.; Madinda, N. F.; Mugisha, L.; Muyembe, J.-J.; Todd, A.; Petrželková, Klára Judita; Gray, M.; Robbins, M.; Bergl, R. A.; Wittig, R. M.; Zuberbühler, K.; Boesch, C.; Schubert, G.; Leendertz, F. H.; Ehlers, B.; Calvignac-Spencer, S.

    2015-01-01

    Roč. 32, č. 8 (2015), s. 2072-2084 ISSN 0737-4038 R&D Projects: GA ČR GA206/09/0927 Institutional support: RVO:60077344 Keywords : adenovirus * African great apes * zoonosis Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 13.649, year: 2015

  12. Wild chimpanzees are infected by Trypanosoma brucei

    Czech Academy of Sciences Publication Activity Database

    Jirků, Milan; Votýpka, Jan; Petrželková, Klára Judita; Jirků-Pomajbíková, K.; Kriegová, Eva; Vodička, R.; Lankester, F.; Leendertz, S. A. J.; Wittig, R. M.; Boesch, C.; Modrý, David; Ayala, F. J.; Leendertz, F. H.; Lukeš, Julius

    2015-01-01

    Roč. 4, č. 3 (2015), s. 277-282 ISSN 2213-2244 R&D Projects: GA MŠk(CZ) EE2.3.30.0032 EU Projects: European Commission(XE) 316304 Institutional support: RVO:60077344 Keywords : Trypanosomes * Chimpanzee * Non-human primates * Transmission * Diagnostics Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine

  13. First report of Enterocytozoon bieneusi infection on a pig farm in the Czech Republic

    Czech Academy of Sciences Publication Activity Database

    Sak, Bohumil; Kváč, Martin; Hanzlíková, D.; Cama, V.

    2008-01-01

    Roč. 153, 3/4 (2008), s. 220-224 ISSN 0304-4017 R&D Projects: GA ČR GP523/07/P117 Institutional research plan: CEZ:AV0Z60220518 Keywords : Enterocytozoon bieneusi * pigs * microsporidia Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 2.039, year: 2008

  14. Eye trematode infection in small passerines in Peru caused by Philophthalmus lucipetus, an agent with a zoonotic potential spread by an invasive freshwater snail

    Czech Academy of Sciences Publication Activity Database

    Literák, I.; Heneberg, P.; Sitko, J.; Wetzel, E. J.; Callirgos, J. M. C.; Čapek, Miroslav; Basto, D. V.; Papoušek, I.

    2013-01-01

    Roč. 62, č. 4 (2013), s. 390-396 ISSN 1383-5769 R&D Projects: GA AV ČR IAA601690901; GA MŠk LC06073 Institutional support: RVO:68081766 Keywords : Birds * Caenogastropoda * Digenea * DNA analysis * Echinostomida * Eye trematode * Fluke Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 2.111, year: 2013

  15. New dactylogyrids (Monogenea) parasitizing the gills of catfishes (Siluriformes) from the Amazon River basin in Peru

    Czech Academy of Sciences Publication Activity Database

    Mendoza-Franco, Edgar F.; Scholz, Tomáš

    2009-01-01

    Roč. 95, č. 4 (2009), s. 865-870 ISSN 0022-3395 R&D Projects: GA MŠk LC522 Institutional research plan: CEZ:AV0Z60220518 Keywords : Monogenea * taxonomy * fish * Neotropical Region * Ancyrocephalinae * redescriptions * Auchenipteridae * Pimelodidae Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 1.195, year: 2009

  16. TUCUNARELLA N. GEN. AND OTHER DACTYLOGYRIDS (MONOGENOIDEA) FROM CICHLID FISH (PERCIFORMES) FROM PERUVIAN AMAZONIA

    Czech Academy of Sciences Publication Activity Database

    Mendoza-Franco, Edgar F.; Scholz, Tomáš; Rozkošná, Petra

    2010-01-01

    Roč. 96, č. 3 (2010), s. 491-498 ISSN 0022-3395 R&D Projects: GA MŠk LC522 Institutional research plan: CEZ:AV0Z60220518 Keywords : NEOTROPICAL MONOGENEA * ANCYROCEPHALINAE * PROPOSAL * GILLS * TREMATODES * TELEOSTEI Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 1.208, year: 2010

  17. Tapeworms (Cestoda: Proteocephalidea) of teleost fi shes from the Amazon River in Peru: additional records as an evidence of unexplored species diversity

    Czech Academy of Sciences Publication Activity Database

    de Chambrier, A.; Kuchta, Roman; Scholz, Tomáš

    2015-01-01

    Roč. 122, č. 1 (2015), s. 149-163 ISSN 0035-418X R&D Projects: GA ČR GBP505/12/G112 Institutional support: RVO:60077344 Keywords : Catfish * freshwater fish * Siluriformes * Peru * Pimelodidae * Amazonia * species diversity * faunal survey Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 0.431, year: 2015

  18. Redescription of Alinema amazonicum (Travassos, 1960) n. comb., a philometrid nematode with unusual morphology

    Czech Academy of Sciences Publication Activity Database

    Moravec, František; Scholz, Tomáš; Dyková, Iva; Kuchta, Roman; Fiala, Ivan; Kohn, A.

    2006-01-01

    Roč. 92, č. 1 (2006), s. 138-144 ISSN 0022-3395 R&D Projects: GA ČR GA524/03/0061 Institutional research plan: CEZ:AV0Z60220518 Keywords : Philometra * Alinema * Peru Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 1.300, year: 2006

  19. Philometrid nematodes infecting fishes from the Everglades National Park, Florida, USA, with description of two new species

    Czech Academy of Sciences Publication Activity Database

    Moravec, František; Bakenhaster, M.

    2010-01-01

    Roč. 57, č. 3 (2010), s. 213-222 ISSN 0015-5683 R&D Projects: GA MŠk LC522 Institutional research plan: CEZ:AV0Z60220518 Keywords : Philometridae * Marine fish * USA Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 1.533, year: 2010

  20. NeemAzal T/S – toxicity to early-life stages of common carp (Cyprinus carpio L.)

    Czech Academy of Sciences Publication Activity Database

    Chromcová, L.; Blahová, J.; Živná, D.; Plhalová, L.; Casuscelli di Tocco, F.; Divišová, L.; Prokeš, Miroslav; Faggio, C.; Tichý, F.; Svobodová, Z.

    2015-01-01

    Roč. 60, č. 1 (2015), s. 23-30 ISSN 0375-8427 Institutional support: RVO:68081766 Keywords : Neemazal T/S * embryo-larval toxicity test * azadirachtin * oxidative stress * histopathology * insecticide Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 0.560, year: 2015

  1. South African Medical Journal - Vol 83, No 10 (1993)

    African Journals Online (AJOL)

    Do high fetal catecholamine levels affect heart rate variability and tneconiutn passage during labour? EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. G.J. Hofmeyr, J. Esser, V. Cheryl Ukodem, Marie Lawson, T. Kramer, A. M. Gulmezoglu, 739-742 ...

  2. A new species of Eimeria Schneider, 1875 (Apicomplexa: Eimeriidae) from Alectoris barbara (Aves: Phasianidae) from the Canary Islands (Spain)

    Czech Academy of Sciences Publication Activity Database

    Fernández-Alvarez, A.; Modrý, David; Foronda, P.

    2016-01-01

    Roč. 115, č. 5 (2016), s. 1817-1825 ISSN 0932-0113 Institutional support: RVO:60077344 Keywords : Coccidia * Eimeria barbarae n. sp * Alectoris barbara * Canary Island Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 2.329, year: 2016

  3. Eurasian golden jackal as host of canine vector-borne protists

    Czech Academy of Sciences Publication Activity Database

    Mitková, B.; Hrazdilová, K.; D'Amico, G.; Duscher, G. G.; Suchentrunk, F.; Forejtek, P.; Gherman, C.M.; Matei, I.A.; Ionică, A.M.; Daskalaki, A.A.; Mihalca, A. D.; Votýpka, Jan; Hulva, P.; Modrý, David

    2017-01-01

    Roč. 10, APR 14 (2017), č. článku 183. ISSN 1756-3305 Institutional support: RVO:60077344 Keywords : Eurasian golden jackal * Babesia * Hepatozoon * Theileria annae * Leishmania Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine OBOR OECD: Veterinary science Impact factor: 3.080, year: 2016

  4. Differential protein expression in chicken macrophages and heterophils in vivo following infection with Salmonella Enteritidis

    Czech Academy of Sciences Publication Activity Database

    Sekelova, Z.; Štěpánová, H.; Polanský, O.; Varmužová, K.; Faldynová, M.; Fedr, Radek; Rychlík, I.; Vlasatiková, L.

    2017-01-01

    Roč. 48, JUN2017 (2017), č. článku 35. ISSN 0928-4249 Institutional support: RVO:68081707 Keywords : endoplasmic-reticulum stress * messenger-rna expression * quantitative proteomics * internal control Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine OBOR OECD: Microbiology Impact factor: 2.798, year: 2016

  5. Tick-Borne Encephalitis in Sheep, Romania

    Czech Academy of Sciences Publication Activity Database

    Salát, J.; Mihalca, A. D.; Mihaiu, M.; Modrý, D.; Růžek, Daniel

    2017-01-01

    Roč. 23, č. 12 (2017), s. 2065-2067 ISSN 1080-6040 Institutional support: RVO:60077344 Keywords : borrelia-burgdorferi * virus * tbev Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine OBOR OECD: Veterinary science Impact factor: 8.222, year: 2016

  6. First report of Rickettsia raoultii in field collected Dermacentor reticulatus ticks from Austria

    Czech Academy of Sciences Publication Activity Database

    Duscher, G. G.; Hodžić, A.; Weiler, M.; Vaux, A. G. C.; Rudolf, Ivo; Sixl, W.; Medlock, J. M.; Versteirt, V.; Hubálek, Zdeněk

    2016-01-01

    Roč. 7, č. 5 (2016), s. 720-722 ISSN 1877-959X Institutional support: RVO:68081766 Keywords : Rickettsia raoultii * Dermacentor reticulatus * TIBOLA * DEBONEL * Austria Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 3.230, year: 2016

  7. Autochthonous Babesia canis, Hepatozoon canis and imported Babesia gibsoni infection in dogs in the Czech Republic

    Czech Academy of Sciences Publication Activity Database

    Mitková, B.; Hrazdilová, K.; Novotna, M.; Juránková, J.; Hofmannová, L.; Forejtek, P.; Modrý, David

    2017-01-01

    Roč. 62, č. 3 (2017), s. 138-146 ISSN 0375-8427 Institutional support: RVO:60077344 Keywords : tick-borne diseases * apicomplexan parasites * PCR detection * 18S rDNA Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine OBOR OECD: Veterinary science Impact factor: 0.489, year: 2016

  8. The occurrence of Ixodes ricinus ticks and important tick-borne pathogens in areas with high tick-borne encephalitis prevalence in different altitudinal levels of the Czech Republic. Part I. Ixodes ricinus ticks and tick-borne encephalitis virus

    Czech Academy of Sciences Publication Activity Database

    Daniel, M.; Danielová, V.; Kříž, B.; Růžek, Daniel; Fialová, A.; Malý, M.; Materna, J.; Pejčoch, M.; Erhart, Jan

    2016-01-01

    Roč. 65, č. 2 (2016), s. 118-128 ISSN 1210-7913 Institutional support: RVO:60077344 Keywords : Ixodes ricinus * tick-borne encephalitis virus * occurence * altitude * region * season Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 0.500, year: 2016

  9. No impact of strongylid infections on the detection of Plasmodium spp. in faeces of western lowland gorillas and eastern chimpanzees

    Czech Academy of Sciences Publication Activity Database

    Mapua, M. I.; Pafčo, B.; Burgunder, J.; Profousová-Pšenková, I.; Todd, A.; Hashimoto, C.; Qablan, M. A.; Modrý, David; Petrželková, Klára Judita

    2017-01-01

    Roč. 16, APR 26 (2017), č. článku 175. ISSN 1475-2875 Institutional support: RVO:60077344 Keywords : co-infection * faeces * Strongylid * Necator spp. * Plasmodium spp. * malaria * Western lowland gorilla * Eastern chimpanzee Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine OBOR OECD: Veterinary science Impact factor: 2.715, year: 2016

  10. Zoonotic microsporidia in dogs and cats in Poland

    Czech Academy of Sciences Publication Activity Database

    Piekarska, J.; Kicia, M.; Wesołowska, M.; Kopacz, Z.; Gorczykowski, M.; Szczepankiewicz, D.; Kváč, Martin; Sak, Bohumil

    2017-01-01

    Roč. 246, 15 November (2017), s. 108-111 ISSN 0304-4017 Institutional support: RVO:60077344 Keywords : cat * dog * Encephalitozoon spp. * Enterocytozoon bieneusi * zoonosis Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine OBOR OECD: Veterinary science Impact factor: 2.356, year: 2016

  11. An annotated list of the species of Gangesia Woodland, 1924 (Cestoda: Proteocephalidea), parasites of catfishes in Asia, with new synonyms and a key to their identification

    Czech Academy of Sciences Publication Activity Database

    Ash, Anirban; de Chambrier, A.; Shimazu, T.; Ermolenko, A. V.; Scholz, Tomáš

    2015-01-01

    Roč. 91, č. 1 (2015), s. 13-33 ISSN 0165-5752 R&D Projects: GA ČR GBP505/12/G112 Institutional support: RVO:60077344 Keywords : tapeworm * redescription * terminology Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 1.316, year: 2015

  12. INFLUENCE OF ORGANIC NUTRIENTS AND COCULTURES ON THE COMPETITIVE BEHAVIOR OF 1,2-DICHLOROETHANE-DEGRADING BACTERIA

    NARCIS (Netherlands)

    Wijngaard, Arjan J. van den; Kleij, Roelof G. van der; Doornweerd, Rianne E.; Janssen, Dick B.

    1993-01-01

    The effects of organic nutrients and cocultures on substrate removal by and competitive behavior of 1,2-dichloroethane-degrading bacteria were investigated. Xanthobacter autotrophicus GJ10 needed biotin for optimal growth on 1,2-dichloroethane. In continuous culture, dilution of biotin to a

  13. Rhabdias lacertae n. sp. (Nematoda: Rhabdiasidae), the first rhabdiasid species parasitising lizards in Europe

    Czech Academy of Sciences Publication Activity Database

    Moravec, František

    2010-01-01

    Roč. 77, č. 1 (2010), s. 23-27 ISSN 0165-5752 Institutional research plan: CEZ:AV0Z60220518 Keywords : Rhabdias * Lacerta * Slovakia Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 1.056, year: 2010

  14. Spotted fever group rickettsiae detected in immature stages of ticks parasitizing on Iberian endemic lizard Lacerta schreiberi Bedriaga, 1878

    Czech Academy of Sciences Publication Activity Database

    Kubelová, M.; Papoušek, I.; Bělohlávek, T.; Goüy de Bellocq, Joëlle; Baird, Stuart J. E.; Široký, P.

    2015-01-01

    Roč. 6, č. 6 (2015), s. 711-714 ISSN 1877-959X Institutional support: RVO:68081766 Keywords : Spotted fever group rickettsiae * Rickettsia monacensis * Rickettsia helvetica * Ixodes ricinus * Lacerta schreiberi Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 2.690, year: 2015

  15. Vavraia culicis (Weiser, 1947) Weiser, 1977 revisited: cytological characterisation of a Vavraia culicis-like microsporidium isolated from mosquitoes in Florida and the establishment of Vavraia culicis floridensis subsp. n

    Czech Academy of Sciences Publication Activity Database

    Vávra, Jiří; Becnel, J. J.

    2007-01-01

    Roč. 54, č. 4 (2007), s. 259-271 ISSN 0015-5683 R&D Projects: GA ČR GA524/07/1003 Institutional research plan: CEZ:AV0Z60220518 Keywords : Vavraia * Aedes albopictus * mosquito es * parasites * microsporidia * ultrastructure Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 1.000, year: 2007

  16. Spatial feeding preferences of ornithophilic mosquitoes, blackflies and biting midges

    Czech Academy of Sciences Publication Activity Database

    Černý, O.; Votýpka, Jan; Svobodová, M.

    2011-01-01

    Roč. 25, č. 1 (2011), 104-108 ISSN 0269-283X Institutional research plan: CEZ:AV0Z60220518 Keywords : Culex * Culicoides * Eusimulium * Trypanosoma * height preferences * ornithophilic Diptera Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 1.910, year: 2011

  17. Alboserpin, a Factor Xa Inhibitor from the Mosquito Vector of Yellow Fever, Binds Heparin and Membrane Phospholipids and Exhibits Antithrombotic Activity

    Czech Academy of Sciences Publication Activity Database

    Calvo, E.; Mizurini, D.M.; Sa-Nunes, A.; Ribeiro, J.M.C.; Andersen, J. F.; Mans, B.J.; Monteiro, R.Q.; Kotsyfakis, Michalis; Francischetti, I.M.B.

    2011-01-01

    Roč. 286, č. 32 (2011), 27998-28010 ISSN 0021-9258 Institutional research plan: CEZ:AV0Z60220518 Keywords : serpin * mosquito * Aedes albopictus * phospholipids * Factor Xa * heparin * binding affinity * coagulation * thrombus * bleeding Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 4.773, year: 2011

  18. Generalized scalar tensor theory in four and higher

    Indian Academy of Sciences (India)

    Si EEN() Y (CHAKRAB (I)RTY ; A RAE INDA (Gj(..)SH". Department of Mathematics, Jadavpur University, Calcutta 703 032, India. "Darpur, J K S High Schooi, Vill. and P.O. Durpur 7 i 2 143, Hooghly District, India. Email: subency Ejuphys. ernet.in. MS received 28 February 2000; revised 26 December 2000. Abstraci, n this ...

  19. Multimodal and widespread somatosensory abnormalities in persistent shoulder pain in the first 6 months after stroke: an exploratory study

    NARCIS (Netherlands)

    Roosink, M.; van Dongen, R.T.; Buitenweg, J.R.; Renzenbrink, G.J.; Geurts, A.C.H.; IJzerman, M.J.

    2012-01-01

    Roosink M, Van Dongen RT, Buitenweg JR, Renzenbrink GJ, Geurts AC, IJzerman MJ. Multimodal and widespread somatosensory abnormalities in persistent shoulder pain in the first 6 months after stroke: an exploratory study. OBJECTIVE: To explore the role of multimodal and widespread somatosensory

  20. South African Journal of Animal Science - Vol 24, No 1 (1994)

    African Journals Online (AJOL)

    Synchronization of oestrus in sheep: Use of different doses of progestagen outside the normal breeding season · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. JPC Greyling, WF Kotzé, GJ Taylor, WJ Hagendijk, F Cloete, 33-37 ...

  1. Synchronization of oestrus in sheep: Use of different doses of ...

    African Journals Online (AJOL)

    Synchronization of oestrus in sheep: Use of different doses of progestagen outside the normal breeding season. JPC Greyling, WF Kotzé, GJ Taylor, WJ Hagendijk, F Cloete. Abstract. No Abstract. Full Text: EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT.

  2. Validating a Conceptual Framework for the Core Concept of ”Cell-cell Communication”

    Czech Academy of Sciences Publication Activity Database

    Michael, J.; Martinková, Patrícia; McFarland, J.L.; Wright, A.; Cliff, W.; Modell, H.; Wenderoth, M.P.

    2017-01-01

    Roč. 41, č. 2 (2017), s. 260-265 ISSN 1043-4046 R&D Projects: GA ČR GJ15-15856Y Institutional support: RVO:67985807 Keywords : conceptual framework * core concept * cell-cell communication * physiology Subject RIV: AM - Education OBOR OECD: Education , general; including training, pedagogy, didactics [and education systems] Impact factor: 1.755, year: 2016

  3. PATTERNS OF SEVEN AND COMPLICATED MALARIA IN CHILDREN

    African Journals Online (AJOL)

    GB

    found registered in the delivery logbook, their card number documented in the delivery logbook was used as an initial entry to access their chart (where the detailed ..... Eclampsia Trial. Lancet, 1995; 345: 1455–63. 25. Duley L, Henderson-Smart DJ, Walker GJ,. Chou D. Magnesium sulphate versus diazepam for eclampsia.

  4. Eradication of pinworm infections from laboratory rat colonies using ivermectin

    Czech Academy of Sciences Publication Activity Database

    Lytvynets, Andrej; Langrová, I.; Vadlejch, J.

    2005-01-01

    Roč. 42, č. 3 (2005), s. 185-185 ISSN 0440-6605. [Helminthological Days /13./. 09.05.2005-19.05.2005, Ředkovec] Keywords : Syphacia muris * Aspiculuris tetraptera * laboratory rat * ivermectin Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine

  5. Filamoeba sp. Isolated from Hot-water Piping System, a Host of Legionella Closely Related to Legionella micdadei

    Czech Academy of Sciences Publication Activity Database

    Dyková, Iva; Hrubá, L.; Kostka, Martin; Pecková, Hana

    2009-01-01

    Roč. 48, č. 4 (2009), s. 321-327 ISSN 0065-1583 R&D Projects: GA ČR GA524/09/0137; GA MŠk LC522 Institutional research plan: CEZ:AV0Z60220518 Keywords : Filamoeba sp. * intracellular * Legionella sp. Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 0.775, year: 2009

  6. Personal news

    NARCIS (Netherlands)

    NN,

    1980-01-01

    Dr. M.M.J. van Balgooy and his companions on the Celebes Expedition, Dr. E. Hennipman, Mr. G.J. de Joncheere and Dr. E.F. de Vogel left Leiden on 5 April 1979, visited the SING and BO-Herbaria on the way. In Celebes visit was paid to Hasanudin University at Ujung Pandang (olim Makassar), in Bali to

  7. South African Journal of Clinical Nutrition - Vol 24, No 4 (2011)

    African Journals Online (AJOL)

    South African private practising clinical dietitians' perceptions of the relevance of service-specific healthcare marketing principles and communication elements · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. LM Hanekom, GJ Gericke, PJ Becker, 192-198.

  8. Download this PDF file

    African Journals Online (AJOL)

    Chloride was determined using Volhard's method. [9] and nitrate using the Brucine method [10]. Total phosphate .... "Meu MTN 31 MARTIN MATH DIMANA. M 1. Fig. 7. ..... B.K. Shephard, A.W. Mcintosh, G.J. Atchison and D.W. Nelson, Water.

  9. Genetically encoded fluorescent probe to visualize phosphatidylinositol

    Czech Academy of Sciences Publication Activity Database

    Eisenreichová, Andrea; Humpolíčková, Jana; Bouřa, Evžen

    2017-01-01

    Roč. 284, Suppl 1 (2017), s. 364-365 ISSN 1742-464X. [FEBS Congress /42./ From Molecules to Cells and Back. 10.09.2017-14.09.2017, Jerusalem] R&D Projects: GA ČR GJ15-21030Y; GA MŠk LO1302 Institutional support: RVO:61388963 Keywords : phosphatidylinositol * fluorescent probe Subject RIV: CE - Biochemistry

  10. Validation of Flotac for the detection and quantification of Troglodytella abrassarti and Neobalantidium coli in chimpanzees and pigs

    Czech Academy of Sciences Publication Activity Database

    Růžicová, M.; Petrželková, Klára Judita; Kalousová, B.; Modrý, David; Pomajbíková, Kateřina

    2014-01-01

    Roč. 100, č. 5 (2014), s. 662-670 ISSN 0022-3395 R&D Projects: GA ČR GA206/09/0927 Institutional support: RVO:60077344 Keywords : Balantidium coli * lowland gorillas * helminth eggs Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 1.227, year: 2014

  11. Experimental studies on the development of Contracaecum rudolphii (Nematoda: Anisakidae) in copepod and fish paratenic hosts

    Czech Academy of Sciences Publication Activity Database

    Moravec, František

    2009-01-01

    Roč. 56, č. 3 (2009), s. 185-193 ISSN 0015-5683 R&D Projects: GA MŠk LC522; GA AV ČR IA62211 Institutional research plan: CEZ:AV0Z60220518 Keywords : Contracaecum rudolphii * life cycle * Czech Republic Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 1.266, year: 2009

  12. Herci díla zkázy. Demolice starého Mostu a role památkové péče

    Czech Academy of Sciences Publication Activity Database

    Spurný, Matěj

    2016-01-01

    Roč. 76, č. 3 (2016), s. 3-16 ISSN 1210-5538 R&D Projects: GA ČR GJ15-19437Y Institutional support: RVO:68378114 Keywords : Czechoslovakia * state socialism * historical conservation Subject RIV: AB - History

  13. Three nematode species from elasmobranchs off New Caledonia

    Czech Academy of Sciences Publication Activity Database

    Moravec, František; Justine, J.-L.

    2006-01-01

    Roč. 64, č. 2 (2006), s. 131-145 ISSN 0165-5752 R&D Projects: GA ČR(CZ) GA524/06/0170 Institutional research plan: CEZ:AV0Z60220518 Keywords : Terranova * Echinocephalus * New Caledonia Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 0.856, year: 2006

  14. The effect of diazinon on blood plasma biochemistry in carp (Cyprinus carpio L.)

    Czech Academy of Sciences Publication Activity Database

    Lusková, Věra; Svoboda, M.; Kolářová, J.

    Roc. 71, č. 1 (2002), s. 117-123 ISSN 0001-7213 Institutional research plan: CEZ:AV0Z6093917 Keywords : common carp * acute toxicity * haematology Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 0.370, year: 2002 http://vfu-www.vfu.cz/acta-vet/vol71/pdf/71_117.pdf

  15. Antibodies to arboviruses in house sparrows (Passer domesticus) in the Czech Republic

    Czech Academy of Sciences Publication Activity Database

    Juřicová, Zina; Literák, I.; Pinowski, J.

    2000-01-01

    Roč. 69, č. 3 (2000), s. 213-215 ISSN 0001-7213 R&D Projects: GA ČR GA524/96/1059 Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 0.240, year: 2000 http://vfu-www.vfu.cz/acta-vet/vol69/pdf/69_213.pdf

  16. Avipoxvirus infection in wild birds: new findings from Slovakia and Poland

    Czech Academy of Sciences Publication Activity Database

    Literák, I.; Halouzka, R.; Hromádko, M.; Honza, Marcel; Pinowska, B.; Haman, A.

    2001-01-01

    Roč. 70, č. 3 (2001), s. 339-344 ISSN 0001-7213 Institutional research plan: CEZ:MSM 161700001 Keywords : cutaneous lesion Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 0.274, year: 2001 http://vfu-www.vfu.cz/acta-vet/vol70/pdf/70_339.pdf

  17. Chondrocytic potential of allogenic mesenchymal stem cells transplanted without immunosuppression to regenerate physeal defect in rabbits

    Czech Academy of Sciences Publication Activity Database

    Gál, P.; Nečas, A.; Plánka, L.; Kecová, H.; Křen, L.; Krupa, P.; Hlučilová, Jana; Usvald, Dušan

    2007-01-01

    Roč. 76, - (2007), s. 265-275 ISSN 0001-7213 R&D Projects: GA MŠk 2B06130 Grant - others:MZd(CZ) NR8483 Institutional research plan: CEZ:AV0Z50450515 Keywords : growth plate injury * bone bridge * limb deformity Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 0.687, year: 2007

  18. The effect of diazinon on haematological indices of common carp (Cyprinus carpio L.)

    Czech Academy of Sciences Publication Activity Database

    Svoboda, M.; Lusková, Věra; Drastichová, J.; Žlábek, V.

    2001-01-01

    Roč. 70, č. 4 (2001), s. 457-465 ISSN 0001-7213 Institutional research plan: CEZ:MSM 162700004 Keywords : common carp * acute toxicity * haematology Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 0.274, year: 2001 http://vfu-www.vfu.cz/acta-vet/vol70/pdf/70_457.pdf

  19. Larvae of trombiculid mites (Acarina: Trombiculidae) in wild birds in Slovak and Polish Carpathians

    Czech Academy of Sciences Publication Activity Database

    Literák, I.; Honza, Marcel; Pinowska, B.; Haman, A.

    2001-01-01

    Roč. 70, č. 4 (2001), s. 479-483 ISSN 0001-7213 Institutional research plan: CEZ:MSM 161700001 Keywords : Passerines * parasites * Trombiculidae Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 0.274, year: 2001 http://vfu-www.vfu.cz/acta-vet/vol70/pdf/70_479.pdf

  20. Contribution to canine babesiosis in the Czech Republic

    Czech Academy of Sciences Publication Activity Database

    Konvalinová, J.; Rudolf, Ivo; Šikutová, Silvie; Hubálek, Zdeněk; Svobodová, V.; Svoboda, M.

    2012-01-01

    Roč. 81, č. 2 (2012), s. 91-95 ISSN 0001-7213 Institutional support: RVO:68081766 Keywords : dogs * Babesia canis * antibodies * Dermacentor reticulatus Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 0.393, year: 2012

  1. Occurrence of Strongyloides papillosus associated with extensive pulmonary lesions and sudden deaths in calves on a beef farm in a highland area of South Bohemia (Czech Republic)

    Czech Academy of Sciences Publication Activity Database

    Kváč, Martin; Vítovec, J.

    2007-01-01

    Roč. 44, č. 1 (2007), s. 10-13 ISSN 0440-6605 Institutional research plan: CEZ:AV0Z60220518 Keywords : Strongyloides papillosus * beef calves * prevalence * sudden death syndrome Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 0.373, year: 2007

  2. Specific circularly polarized luminescence of Eu(III), Sm(III), and Er(III) induced by N-acetylneuraminic acid

    Czech Academy of Sciences Publication Activity Database

    Wu, Tao; Bouř, Petr

    2018-01-01

    Roč. 54, č. 14 (2018), s. 1790-1792 ISSN 1359-7345 R&D Projects: GA ČR(CZ) GJ16-08764Y; GA MŠk(CZ) LTC17012 Institutional support: RVO:61388963 Keywords : sialic acid * MRI * recognition Subject RIV: CF - Physical ; Theoretical Chemistry OBOR OECD: Physical chemistry Impact factor: 6.319, year: 2016

  3. Factors determining parasite community richness and species composition in black snook Centropomus nigrescens (Centropomidae) from coastal lagoons in Guerrero, Mexico

    Czech Academy of Sciences Publication Activity Database

    Violante-González, J.; Mendoza-Franco, Edgar F.; Rojas-Herrera, A.; Guerrero, S.G.

    2010-01-01

    Roč. 107, č. 1 (2010), 59-66 ISSN 0932-0113 Institutional research plan: CEZ:AV0Z60220518 Keywords : TRES-PALOS LAGOON * HELMINTH COMMUNITIES * PACIFIC COAST * BALTIC SEA * FISHES * SIMILARITY * COLONIZATION * TELEOSTEI * BRAZIL * GILLS Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 1.812, year: 2010

  4. Thermoresponsive polymer nanoparticles co-deliver RSV F trimers with a TLR-7/8 adjuvant

    Czech Academy of Sciences Publication Activity Database

    Francica, J. R.; Lynn, G. M.; Laga, Richard; Joyce, M. G.; Ruckwardt, T. J.; Morabito, K. M.; Chen, M.; Chaudhuri, R.; Zhang, B.; Sastry, M.; Druz, A.; Ko, K.; Choe, M.; Pechar, Michal; Georgiev, I. S.; Kueltzo, L. A.; Seymour, L. W.; Mascola, J. R.; Kwong, P. D.; Graham, B. S.; Seder, R. A.

    2016-01-01

    Roč. 27, č. 10 (2016), s. 2372-2385 ISSN 1043-1802 R&D Projects: GA ČR(CZ) GJ16-14957Y; GA MŠk(CZ) LQ1604 Institutional support: RVO:61389013 Keywords : thermoresponsive polymers * polymer vaccines * toll-like receptor agonists Subject RIV: CD - Macromolecular Chemistry Impact factor: 4.818, year: 2016

  5. Empirical Self-Consistent Correction for the Description of Hydrogen Bonds in DFTB3

    Czech Academy of Sciences Publication Activity Database

    Řezáč, Jan

    2017-01-01

    Roč. 13, č. 10 (2017), s. 4804-4817 ISSN 1549-9618 R&D Projects: GA ČR(CZ) GJ16-11321Y Institutional support: RVO:61388963 Keywords : density functional theory * tight-binding method * including dispersion corrections Subject RIV: CF - Physical ; Theoretical Chemistry OBOR OECD: Physical chemistry Impact factor: 5.245, year: 2016

  6. changes in activities of enzymes of glutamate metabolism in rat ...

    African Journals Online (AJOL)

    Eth. j Sci. & Technci 4(1 ; 45-56. 2006. iSSN 1816-3375 phenyi glyoxal etc (Elliot, 1951; ..... B. and Watson. ... In: Keler, L. J. Jr., Garattini, S., Kare, M.R., Reynolds, ... Patel, A J, Weir, M.D., Hunt, A., Tahourdin, C.S.M. and Thomas, D G.J. (1985).

  7. Imagination et temporalisation chez Kant, Husserl et Richir

    Czech Academy of Sciences Publication Activity Database

    Fazakas, Istvan

    2016-01-01

    Roč. 3, č. 2 (2016), s. 502-521 ISSN 2067-3655 R&D Projects: GA ČR(CZ) GJ16-00994Y Institutional support: RVO:67985955 Keywords : image * imagination * phantasia * schematism * temporalization * presence * present * weilen Subject RIV: AA - Philosophy ; Religion http://www.metajournal.org/article_details.php?id=278

  8. Energy analysis of various grassland utilisation systems

    Directory of Open Access Journals (Sweden)

    Jozef Ržonca

    2005-01-01

    Full Text Available In 2003 and 2004 was carried out the energy analysis of the different types of permanent grassland utilization on the Hrubý Jeseník locality. There were estimated values of the particular entrances of additional energy. Energy entrances moved according to the pratotechnologies from 2.17 GJ. ha–1 to 22.70 GJ.ha–1. The biggest share on energy entrances had fertilizers. It was 84.93% by the nitrogen fertilisation. The most energy benefit of brutto and nettoenergy was marked by the low intensive utilisation (33.40 GJ.ha–1 NEL and 32.40 GJ.ha–1 NEV on average. The highest value of energy efficiency (13.23% was marked by the low intensive utilization of permanent grassland. By using of higher doses of industrial fertilizers has energy efficiency decreased. From view of energy benefit and intensiveness on energy entrances it appears the most available utilisation of permanent grassland with three cuts per year (first cut on May 31st at the latest, every next after 60 days or two cuts per year (first cut on July 15th, next cuts after 90 days.

  9. Effects of auxins on in vitro reserve compounds of Phalaenopsis ...

    African Journals Online (AJOL)

    SAM

    2014-03-26

    Mar 26, 2014 ... Micropropagation of oca on a high sucrose medium promotes starch accumulation and plant establishment in soil. New Zeal. J. Crop Hort. 21:91-93. De Klerk GJ (2002). Rooting of microcuttings: theory and practice. In. Vitro Cel. Dev.-Pl. 38:415-422. Debergh PC, Maene LJ (1981). A scheme for commercial ...

  10. Philometrids (Nematoda: Philometridae) in carangid and serranid fishes off New Caledonia, including three new species

    Czech Academy of Sciences Publication Activity Database

    Moravec, František; Justine, J.-L.

    2014-01-01

    Roč. 21, MAY 19 2014 (2014), s. 21 ISSN 1252-607X R&D Projects: GA ČR GBP505/12/G112 Institutional support: RVO:60077344 Keywords : Parasitic nematode * Philometra * Marine fish * Alepes * Epinephelus * Selar * New Caledonia Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 1.092, year: 2014

  11. Brucellosis of the common vole (Microtus arvalis)

    Czech Academy of Sciences Publication Activity Database

    Hubálek, Zdeněk; Scholz, H.; Sedláček, I.; Melzer, F.; Sanogo, Yibayiri Osée; Nesvadbová, Jiřina

    2007-01-01

    Roč. 7, č. 4 (2007), s. 679-688 ISSN 1530-3667 Institutional research plan: CEZ:AV0Z60930519 Keywords : common vole * brucellosis Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 1.919, year: 2007

  12. DOSIS & DOSIS 3D: long-term dose monitoring onboard the Columbus Laboratory of the International Space Station (ISS)

    Czech Academy of Sciences Publication Activity Database

    Berger, T.; Przybyla, B.; Matthia, D.; Reitz, G.; Burmeister, S.; Labrenz, J.; Bilski, P.; Horwacik, T.; Twardak, A.; Hajek, M.; Fugger, M.; Hofstatter, C.; Sihver, L.; Palfalvi, J. K.; Szabó, J.; Stradi, A.; Ambrožová, Iva; Kubančák, Ján; Brabcová, Kateřina; Vanhavere, F.; Cauwels, V.; Van Hoey, O.; Schoonjans, W.; Parisi, A.; Gaza, R.; Semones, E.; Yukihara, E.; Benton, E.; Doull, B. A.; Uchihori, Y.; Kodaira, S.; Kitamura, H.; Böhme, M.

    2016-01-01

    Roč. 6, NOV (2016), č. článku A39. ISSN 2115-7251 R&D Projects: GA ČR GJ15-16622Y Institutional support: RVO:61389005 Keywords : International Space Station * Columbus * space radiation * DOSIS * DOSIS 3D Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics Impact factor: 2.446, year: 2016

  13. Prevalence of Borrelia miyamotoi in Ixodes Ticks in Europe and the United States

    Czech Academy of Sciences Publication Activity Database

    Crowder, C. D.; Carolan, H. E.; Rounds, M. A.; Hönig, Václav; Mothes, B.; Haag, H.; Nolte, O.; Luft, B. J.; Grubhoffer, Libor; Ecker, D. J.; Schutzer, S. E.; Eshoo, M. W.

    2014-01-01

    Roč. 20, č. 10 (2014), s. 1678-1682 ISSN 1080-6040 Institutional support: RVO:60077344 Keywords : ionization mass spectrometry * polymerase chain reaction * Lyme disease * burgdorferi * spirochete * infection * vector * meningoencephalitis * identification * pathogens Subject RIV: GJ - Animal Vermins ; Diseases , Veterinary Medicine Impact factor: 6.751, year: 2014

  14. Cryptosporidium Pig Genotype II in Immunocompetent Man

    Czech Academy of Sciences Publication Activity Database

    Kváč, Martin; Květoňová, Dana; Sak, Bohumil; Ditrich, Oleg

    2009-01-01

    Roč. 15, č. 6 (2009), s. 982-983 ISSN 1080-6040 R&D Projects: GA ČR GP523/07/P117 Institutional research plan: CEZ:AV0Z60220518 Keywords : immunocompetent patients * cryptosporidiosis * Cryptosporidium pig genotype II Subject RIV: GJ - Animal Vermins ; Diseases , Veterinary Medicine Impact factor: 6.794, year: 2009

  15. First report of Rickettsia raoultii and Rickettsia helvetica in Dermacentor reticulatus ticks from the Czech Republic

    Czech Academy of Sciences Publication Activity Database

    Rudolf, Ivo; Venclíková, Kristýna; Blažejová, Hana; Betášová, Lenka; Mendel, Jan; Hubálek, Zdeněk; Parola, P.

    2016-01-01

    Roč. 7, č. 6 (2016), s. 1222-1224 ISSN 1877-959X Institutional support: RVO:68081766 Keywords : Rickettsia spp. * Dermacentor spp. * DEBONEL * SENLAT Subject RIV: GJ - Animal Vermins ; Diseases , Veterinary Medicine Impact factor: 3.230, year: 2016

  16. Usutu Virus in Blackbirds (Turdus merula), Czech Republic, 2011-2012

    Czech Academy of Sciences Publication Activity Database

    Hubálek, Zdeněk; Rudolf, Ivo; Čapek, Miroslav; Bakonyi, T.; Betášová, Lenka; Nowotny, N.

    2014-01-01

    Roč. 61, č. 3 (2014), s. 273-276 ISSN 1865-1674 Institutional support: RVO:68081766 Keywords : Usutu virus * blackbird * Turdus merula * Czechland Subject RIV: GJ - Animal Vermins ; Diseases , Veterinary Medicine Impact factor: 2.944, year: 2014

  17. Piroplasms in feral and domestic equines in rural areas of the Danube Delta, Romania, with survey of dogs as a possible reservoir

    Czech Academy of Sciences Publication Activity Database

    Gallusová, M.; Qablan, M.; D'Amico, G.; Oborník, Miroslav; Petrželková, Klára Judita; Mihalca, A. D.; Modrý, David

    2014-01-01

    Roč. 206, 3-4 (2014), s. 287-292 ISSN 0304-4017 Institutional support: RVO:60077344 Keywords : T. equi * Babesia cablli * Equine piroplasmoses * Danube Delta * Genetic diversity Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 2.460, year: 2014

  18. Piroplasms in feral and domestic equines in rural areas of the Danube Delta, Romania, with survey of dogs as a possible reservoir

    Czech Academy of Sciences Publication Activity Database

    Gallusová, M.; Qablan, M. A.; D'Amico, G.; Oborník, M.; Petrželková, Klára Judita; Mihalca, A. D.; Modrý, D.

    2014-01-01

    Roč. 206, 3-4 (2014), s. 287-292 ISSN 0304-4017 Institutional support: RVO:68081766 Keywords : T. equi * Babesia caballi * Equine piroplasmoses * Danube Delta * Genetic diversity Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 2.460, year: 2014

  19. Microsporidia and Cryptosporidium in horses and donkeys in Algeria: Detection of a novel Cryptosporidium hominis subtype family (Ik) in a horse

    Czech Academy of Sciences Publication Activity Database

    Laatamna, A.E.; Wagnerová, Pavla; Sak, Bohumil; Květoňová, Dana; Xiao, L.; Rost, M.; McEvoy, J.; Saadi, A.R.; Aissi, M.; Kváč, Martin

    2015-01-01

    Roč. 208, 3-4 (2015), s. 135-142 ISSN 0304-4017 R&D Projects: GA ČR GA15-01090S Institutional support: RVO:60077344 Keywords : Horses * Donkeys * Cryptosporidium spp. * Encephalitozoon spp. * Enterocytozoon bieneusi * Molecular prevalence Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 2.242, year: 2015

  20. Idiosyncratic responses to climate-driven forest fragmentation and marine incursions in reed frogs from Central Africa and the Gulf of Guinea Islands

    Czech Academy of Sciences Publication Activity Database

    Bell, R. C.; Parra, J. L.; Badjedjea, G.; Barej, M. F.; Blackburn, D. C.; Burger, M.; Channing, A.; Dehling, J. M.; Greenbaum, E.; Gvoždík, Václav; Kielgast, J.; Kusamba, C.; Lötters, S.; McLaughlin, P. J.; Nagy, Z. T.; Rödel, M.-O.; Portik, D. M.; Stuart, B. L.; VanDerWal, J.; Zassi-Boulou, A.-G.; Zamudio, K. R.

    2017-01-01

    Roč. 26, č. 19 (2017), s. 5223-5244 ISSN 0962-1083 R&D Projects: GA ČR GJ15-13415Y Institutional support: RVO:68081766 Keywords : climatic refugia * ecological niche modelling * Hyperolius * land-bridge island * lineage divergence * riverine barriers Subject RIV: EH - Ecology, Behaviour OBOR OECD: Ecology Impact factor: 6.086, year: 2016