Modeling study on geological environment at Horonobe URL site
International Nuclear Information System (INIS)
Shimo, Michito; Yamamoto, Hajime; Kumamoto, Sou; Fujiwara, Yasushi; Ono, Makoto
2005-02-01
The Horonobe underground research project has been operated by Japan Nuclear Cycle Development Institute to study the geological environment of sedimentary rocks in deep underground. The objectives of this study are to develop a geological environment model, which incorporate the current findings and the data obtained through the geological, geophysical, and borehole investigations at Horonobe site, and to predict the hydrological and geochemical impacts caused by the URL shaft excavation to the surrounding area. A three-dimensional geological structure model was constructed, integrating a large-scale model (25km x 15km) and a high-resolution site-scale model (4km x 4km) that have been developed by JNC. The constructed model includes surface topography, geologic formations (such as Yuchi, Koetoi, Wakkanai, and Masuporo Formations), and two major faults (Ohomagari fault and N1 fault). In hydrogeological modeling, water-conductive fractures identified in Wakkanai Formation are modeled stochastically using EHCM (Equivalent Heterogeneous Continuum Model) approach, to represent hydraulic heterogeneity and anisotropy in the fractured rock mass. Numerical code EQUIV FLO (Shimo et al., 1996), which is a 3D unsaturated-saturated groundwater simulator capable of EHCM, was used to simulate the regional groundwater flow. We used the same model and the code to predict the transient hydrological changes caused by the shaft excavations. Geochemical data in the Horonobe site such as water chemistries, mineral compositions of rocks were collected and summarized into digital datasets. M3 (Multivariate, Mixing and Mass-balance) method developed by SKB (Laaksoharju et al., 1999) was used to identify waters of different origins, and to infer the mixing ratio of these end-members to reproduce each sample's chemistry. Thermodynamic code such as RHREEQC, GWB, and EQ3/6 were used to model chemical reactions that explain the present minerals and aqueous concentrations observed in the site
International Nuclear Information System (INIS)
Lim, Doo Hyun; Hatanaka, Koichiro; Ishii, Eiichi
2010-01-01
JAEA-Horonobe Underground Research Laboratory (URL) is designed for research and development on high-level radioactive waste (HLW) repository in sedimentary rock. For a potential HLW repository, understanding and implementing fracturing and faulting system, with data from the site characterization, into the performance assessment is essential because fracture and fault will be the major conductors or barriers for the groundwater flow and radionuclide release. The objectives are i) quantitative derivation of characteristics and correlation of fracturing/faulting system with geologic and geophysics data obtained from the site characterization, and ii) preliminary performance assessment calculation with characterized site information
Energy Technology Data Exchange (ETDEWEB)
Lim, Doo Hyun [NE Union Hill Road, Suite 200, WA 98052 (United States); Hatanaka, Koichiro; Ishii, Eiichi [Japan Atomic Energy Agency, Hokkaido (Japan)
2010-10-15
JAEA-Horonobe Underground Research Laboratory (URL) is designed for research and development on high-level radioactive waste (HLW) repository in sedimentary rock. For a potential HLW repository, understanding and implementing fracturing and faulting system, with data from the site characterization, into the performance assessment is essential because fracture and fault will be the major conductors or barriers for the groundwater flow and radionuclide release. The objectives are i) quantitative derivation of characteristics and correlation of fracturing/faulting system with geologic and geophysics data obtained from the site characterization, and ii) preliminary performance assessment calculation with characterized site information
International Nuclear Information System (INIS)
Inagaki, Daisuke; Sawada, Sumiyuki; Tokiwa, Tetsuya; Tsusaka, Kimikazu; Amano, Yuki; Niinuma, Hiroaki
2012-09-01
The Horonobe Underground Research Laboratory (URL) Project has being pursued by the Japan Atomic Energy Agency (JAEA) to enhance the reliability of relevant disposal technologies through investigations of the deep geological environment within the host sedimentary formations at Horonobe, northern Hokkaido. The URL project consists of two major research areas, 'Geoscientific Research' and 'R and D on Geological Disposal Technologies', and proceeds in three overlapping phases, 'Phase I: Surface-based investigations', 'Phase II: Investigations during tunnel excavation' and 'Phase III: Investigations in the underground facilities', over a period of around 20 years. The Phase I geoscientific research was carried out from March 2001 to March 2006 in parallel with design and execution scheme on URL facilities. In addition, identifying key issues that need to be addressed in the Phase II/III investigations was planned. At the begining of the Phase II investigations, an investigation report titled 'Measurement Plan and Observational Construction Program on Shaft Excavation at the Horonobe Underground Research Laboratory Project' (hereinafter referred to as 'Observational Construction Program') and an investigation report titled 'Measurement Plan and Observational Construction Program on Drift Excavation at the Horonobe Underground Research Laboratory Project' were published. The Observational Construction Program summarizes the followings from the results of the Phase I investigations: measurements for safety and reasonable constructions, enhancement of shaft design and construction technologies and evaluation of appropriateness for the deep geological environment model estimated before shaft excavation. This report summarizes the measurements data acquired at the Ventilation Shaft, the East Shaft and the drifts in 2010 fiscal year based on the Observational Construction Program. The report summarizes the measurements data for the purpose of acquisition the basic data for
International Nuclear Information System (INIS)
Inagaki, Daisuke; Tokiwa, Tetsuya; Murakami, Hiroaki
2013-02-01
The Horonobe Underground Research Laboratory (URL) Project has being pursued by the Japan Atomic Energy Agency (JAEA) to enhance the reliability of relevant disposal technologies through investigations of the deep geological environment within the host sedimentary formations at Horonobe, northern Hokkaido. The URL project consists of two major research areas, 'Geoscientific Research' and 'R and D on Geological Disposal Technologies', and proceeds in three overlapping phases, 'Phase I: Surface-based investigations', 'Phase II: Investigations during tunnel excavation' and 'Phase III: Investigations in the underground facilities', over a period of around 20 years. The Phase I geoscientific research was carried out from March 2001 to March 2006 in parallel with design and execution scheme on URL facilities. In addition, identifying key issues that need to be addressed in the Phase II/III investigations was planned. At the beginning of the Phase II investigations, an investigation report titled 'Measurement Plan and Observational Construction Program on Shaft Excavation at the Horonobe Underground Research Laboratory Project' (hereinafter referred to as 'Observational Construction Program') and an investigation report titled 'Measurement Plan and Observational Construction Program on Drift Excavation at the Horonobe Underground Research Laboratory Project' were published. The Observational Construction Program summarizes the followings from the results of the Phase I investigations: measurements for safety and reasonable constructions, enhancement of shaft design and construction technologies and evaluation of appropriateness for the deep geological environment model estimated before shaft excavation. This report summarizes the measurements data acquired at the Ventilation Shaft, the East Shaft and the drifts in 2011 fiscal year based on the Observational Construction Program. The report summarizes the measurements data for the purpose of acquisition the basic data for
Collection of URL measurement data in 2006 at the Horonobe Underground Research Laboratory project
International Nuclear Information System (INIS)
Kumagai, Yasuhito; Funaki, Hironori; Yamasaki, Masanao; Yamaguchi, Takehiro; Sanada, Hiroyuki; Abe, Hironobu; Orukawa, Go
2008-07-01
The Horonobe Underground Research Laboratory (URL) Project is being pursued by the Japan Atomic Energy Agency (JAEA) to enhance the reliability of relevant disposal technologies through investigations of the deep geological environment within the host sedimentary formations at Horonobe, northern Hokkaido. The project consists two major research area, Geoscientific Research' and 'R and D on Geological Disposal', and proceeds in three overlapping phases, 'Phase I: Surface-based investigation', 'Phase II: Construction' and 'Phase III: Operation', over a period of 20 years. The Phase I geoscientific research was carried out from March 2001 to March 2005 in parallel with design and execution scheme on URL facilities. In addition, identifying key issues that need to be addressed in the Phase II/III investigations was carried out. At the inception of the Phase II investigations, an investigation report titled 'Measurement Plan and Observational Construction Program on Shaft Excavation at the Horonobe Underground Research Laboratory Project' (hereinafter referred to as Observational Construction Program') was published. The Observational Construction Program summarizes followings lessons learnt from the Phase I investigations: measurements for safety/reasonable construction, measurements for R and D on enhancement of shaft design/construction technology, and measurements for verification of the deep geological environment estimated before shaft excavation. This report summarizes the measurements data acquired at the Ventilation Shaft (to approx. 50m depth) and the East Shaft (to approx. 40m depth) in 2006 based on the Observational Construction Program. CD-ROM and DVD-ROM are attached as an appendix. (J.P.N.)
In situ test plan for concrete materials using low alkaline cement at Horonobe URL
International Nuclear Information System (INIS)
Kobayashi, Yasushi; Yamada, Tsutomu; Nakayama, Masashi; Matsui, Hiroya; Matsuda, Takeshi; Konishi, Kazuhiro; Iriya, Keishiro; Noda, Masaru
2007-03-01
HLW (high-level radioactive waste) repository is to be constructed at depths of over three hundred meters below the surface. Shotcrete and lining will be used for safety under construction and operational period. Concrete is a kind of composite material which is constituted by aggregate, cement and additives. Low alkaline cement has been developed from the viewpoint of long term stability of the barrier systems which would be influenced by high alkaline arising from cement material. HFSC (Highly Fly-ash contained Silica-fume Cement) is one of a low alkaline cement, which contains silica fume and coal ash. It has been developed in Japan Atomic Energy Agency (JAEA). JAEA are now implementing the construction of the under ground research laboratory (URL) at Horonobe for the purpose of research in deep geological science and repository engineering technology. This report shows the in situ test plan for shotcrete using HFSC at Horonobe URL with identifying requirements for cement materials to be used in HLW repository, and also reviews major literatures of low alkaline cement. This in situ test plan is aiming to assess the performance of HFSC shotcrete in terms of mechanics, workability, durability, and so on. (author)
Collection of URL measurement data in 2007 at the Horonobe Underground Research Laboratory project
International Nuclear Information System (INIS)
Yamasaki, Masanao; Funaki, Hironori; Niinuma, Hiroaki; Fujikawa, Daisuke; Sanada, Hiroyuki; Hiraga, Naoto; Tsusaka, Kimikazu; Yamaguchi, Takehiro
2008-11-01
The Horonobe Underground Research Laboratory (URL) Project has being pursued by the Japan Atomic Energy Agency (JAEA) to enhance the reliability of relevant disposal technologies through investigations of the deep geological environment within the host sedimentary formations at Horonobe, northern Hokkaido. The project consists of two major research areas, Geoscientific Research' and 'R and D on Geological Disposal', and proceeds in three overlapping phases, 'Phase I: Surface-based investigation', 'Phase II: Construction' and 'Phase III: Operation', over a period of 20 years. The Phase I geoscientific research was planned from March 2001 to March 2006 in parallel with design and execution scheme on URL facilities. In addition, identifying key issues that need to be addressed in the Phase II/III investigations was planned. At the beginning of the Phase II investigations, an investigation report titled 'Measurement Plan and Observational Construction Program on Shaft Excavation at the Horonobe Underground Research Laboratory Project' (hereinafter referred to as 'Observational Construction Program') was published. The Observational Construction Program summarizes the followings from the results of the Phase I investigations: measurements for safety and reasonable constructions, enhancement of shaft design and construction technologies and evaluation of appropriateness for the deep geological environment model estimated before shaft excavation. This report summarizes the measurements data acquired at the Ventilation Shaft, the East Shaft and the drifts in 2007 based on the Observational Construction Program. The report summarizes for the purpose of the following: sharing the investigation and measurements data, preventing the loss of them and acquisition the basic data for carrying out the Observational Construction Program. Two DVD-ROMs are attached as an appendix. (J.P.N.)
International Nuclear Information System (INIS)
Nakayama, Masashi; Ohno, Hirokazu; Tanai, Kenji; Fujita, Tomoo; Sugita, Yutaka
2016-06-01
The Horonobe Underground Research Laboratory (URL) Project has being pursued by Japan Atomic Energy Agency (JAEA) to enhance the reliability of relevant disposal technologies through investigations of the deep geological environment within the host sedimentary formation at Horonobe, northern Hokkaido. The URL Project consists of two major research areas, “Geoscientific Research” and “Research and Development on Geological Disposal Technologies”, and proceeds in three overlapping phases, “Phase I: Surface-based investigations”, “Phase II: Investigations during tunnel excavation” and “Phase III: Investigations in the underground facilities”, over a period of around 20 years. Phase III investigation was started in 2010 fiscal year. The in-situ experiment for performance confirmation of engineered barrier system (EBS experiment) was prepared from 2013 to 2014 fiscal year at G.L.-350m gallery (Niche No.4), and heating by electric heater in simulated overpack started in January, 2015. One of objectives of the experiment is acquiring data concerned with Thermal – Hydrological – Mechanical – Chemical (THMC) coupled behavior. These data will be used in order to confirm the performance of engineered barrier system. In EBS experiment, the backfill material using mixture of bentonite and muck from Horonobe URL construction was used for backfilling a part of Niche No.4. This report shows the results of properties of the backfill material, confirmation test of compaction method and making backfill material block, and so on. From these results, it was confirmed that the backfill material would satisfy target value of the permeability and the swelling pressure. (author)
International Nuclear Information System (INIS)
Ota, Kunio; Abe, Hironobu; Kunimaru, Takanori
2011-03-01
The Horonobe Underground Research Laboratory (URL) Project is being pursued by the Japan Atomic Energy Agency (JAEA) to enhance the reliability of relevant disposal technologies through investigations of the deep geological environment within the host sedimentary formations at Horonobe in Hokkaido, northern Japan. The project consists of two major research areas, 'Geoscientific Research' and 'R and D on Geological Disposal', and proceeds in three overlapping phases, 'Phase I: Surface-based investigation', 'Phase II: Construction' and 'Phase III: Operation', over a period of 20 years. The present report summarises the results of the Phase I geoscientific research carried out from March 2001 to March 2005. Integration of the results from different disciplines ensures that the Phase I goals have been successfully achieved and identifies key issues that need to be addressed in Phases II and III. More importantly, efforts are made to summarise as many lessons learnt from the Phase I investigations and other technical achievements as possible to form a 'knowledge base' that will reinforce the technical basis for both implementation and the formulation of safety regulations. Based on experiences of selecting the URL area and site in Horonobe Town, important factors that should be taken into consideration in such selection processes and their rationale are demonstrated. In the course of stepwise surface-based investigations, a number of achievements have been made, which can eventually provide examples of integrated methodologies for characterising the sedimentary formations. The relevant surface-based investigation techniques have thus been further developed. The Horonobe URL has been designed based on geoscientific information accumulated during the surface-based investigations and the plans for safe construction and operation of the URL have been defined in a feasible manner. In addition, a variety of environmental measures taken during Phase I have proved to be
International Nuclear Information System (INIS)
Hama, Katsuhiro; Sasao, Eiji; Iwatsuki, Teruki; Saegusa, Hiromitsu; Sato, Toshinori; Umeda, Koji; Yasue, Kenichi; Asamori, Koichi; Osawa, Hideaki; Koide, Kaoru; Nagae, Isako; Natsuyama, Ryoko; Mizuno, Takashi; Fujita, Tomoo; Sasamoto, Hiroshi; Matsuoka, Toshiyuki; Yokota, Hideharu; Ishii, Eiichi; Aoyagi, Kazuhei; Nakayama, Masashi; Ito, Hiroaki; Tsusaka, Kimikazu; Ohyama, Takuya; Senba, Takeshi; Amano, Kenji
2015-08-01
We have synthesised the research results from Mizunami/Horonobe URLs and geo-stability projects in the second mid-term research phase. It could be used as technical bases for NUMO/Regulator in each decision point from siting to beginning of disposal (Principal Investigation to Detailed Investigation Phase). High quality construction techniques and field investigation methods have been developed and implemented and these will be directly applicable to the National Disposal Program (along with general assessments of hazardous natural events and processes). It will be crucial to acquire technical knowledge on decisions of partial backfilling and final closure by actual field experiments in Mizunami/Horonobe URLs as main themes for the next phases. (author)
International Nuclear Information System (INIS)
Sanada, Hiroyuki; Niunoya, Sumio; Matsui, Hiroya
2008-09-01
Horonobe URL (Underground Research Laboratory) Project is conducted at Horonobe-cho, Teshio-gun, Hokkaido. This research report shows the result of the rock mechanical investigations which have been carried out from 2004 to 2005 as a part of the project. The objectives of the rock mechanical investigation are as follows: To obtain the data which were necessary for construction design of URL. To confirm the distribution of rock mechanical properties in and around URL construction area. The results of the investigations are summarized as follows: 1) Variation and values of depth direction of physical and mechanical properties in the laboratory construction area corresponded approximately to the results obtained from the rock mechanical investigations of HDB-1-8. 2) The major redesign had been not had about physical and mechanical properties in the laboratory construction area being able to divide into three zones and length of its own zone in updating rock mechanical model. 3) From the results of initial stress measured by hydraulic fracturing, the results that the direction of the maximum principle stress is E-W was no different from results obtained from the investigations of HDB-1-8, but the magnitude correlation among maximum, minimum principle stress and overburden pressure measured around G.L.-927 m showed different trends compared with the results of HDB-1-8. 4) Diatomaceous mudstone was yielded under isotropic compression. Cam-clay model as constitutive law of diatomaceous mudstone should be used for tunnel excavation analysis. 5) Uniaxial compression strength of rock saturated under saline water is larger than that of saturated under freshwater. Poisson's ratio of rock saturated under saline water is smaller than that of saturated under saline water. 6) The effective confining pressure increases with the equivalent opening width and permeability decreases. 7) The value of principle stress obtained from DSCA method is larger than that obtained from hydraulic
International Nuclear Information System (INIS)
Sakai, Toshihiro; Matsuoka, Toshiyuki
2015-06-01
The Horonobe Underground Research Laboratory (URL) Project, a comprehensive research project investigating the deep underground environment in sedimentary rock, is being pursued by the Japan Atomic Energy Agency (JAEA) at Horonobe-cho in Northern Hokkaido, Japan. One of the main goals of the URL project is to establish techniques for investigation, analysis and assessment of the deep geological environment. JAEA constructed the geologic map and the database of geological mapping in Horonobe-cho in 2005 based on the existing literatures and 1/200,000 geologic maps published by Geological Survey of Japan, and then updated the geologic map in 2007 based on the results of various investigations which were conducted around the URL as the surface based investigation phase of the URL project. On the other hand, there are many geological survey data which are derived from natural resources (petroleum, natural gas and coal, etc.) exploration in and around Horonobe-cho. In this report, we update the geologic map and the database of the geological mapping based on these geological survey and topographical analysis data in and around the Horonobe area, and construct a digital geologic map and a digital database of geological mapping as GIS. These data can be expected to improve the precision of modeling and analyzing of geological environment including its long-term evaluation. The digital data is attached on CD-ROM. (J.P.N.)
International Nuclear Information System (INIS)
Hama, Katsuhiro; Sasao, Eiji; Iwatsuki, Teruki; Onoe, Hironori; Sato, Toshinori; Yasue, Kenichi; Asamori, Koichi; Niwa, Masakazu; Osawa, Hideaki; Nagae, Isako; Natsuyama, Ryoko; Fujita, Tomoo; Sasamoto, Hiroshi; Matsuoka, Toshiyuki; Takeda, Masaki; Aoyagi, Kazuhei; Nakayama, Masashi; Miyakawa, Kazuya; Ito, Hiroaki; Ohyama, Takuya; Senba, Takeshi; Amano, Kenji
2016-08-01
We have synthesized the research results from the Mizunami/Horonobe Underground Research Laboratories (URLs) and geo-stability projects in the second mid-term research phase. This report can be used as a technical basis for the Nuclear Waste Management Organization of Japan/Regulator at each decision point from siting to beginning of disposal (Principal Investigation to Detailed Investigation Phase). High-quality construction techniques and field investigation methods have been developed and implemented, which will be directly applicable to the National Disposal Program (together with general assessments of hazardous natural events and processes). Acquisition of technical knowledge on decisions of partial backfilling and final closure from actual field experiments in the Mizunami/Horonobe URLs will be crucial as the main theme for the next phases. (author)
International Nuclear Information System (INIS)
Aoyagi, Kazuhei; Kawate, Satoshi
2015-12-01
The Horonobe Underground Research Laboratory (URL) Project has being pursued by the Japan Atomic Energy Agency (JAEA) to enhance the reliability of relevant disposal technologies through investigations of the deep geological environment within the host sedimentary formations at Horonobe, northern Hokkaido. The URL project consists of two major research areas, “Geoscientific Research” and “R and D on Geological Disposal Technologies”, and proceeds in three overlapping phases, “Phase I: Surface-based investigations”, “Phase II: Investigations during tunnel excavation” and “Phase III: Investigations in the underground facilities”, over a period of around 20 years. The Phase I geoscientific research was carried out from March 2001 to March 2006 in parallel with design and execution scheme on URL facilities. In addition, identifying key issues that need to be addressed in the Phase II/III investigations were planned. At the beginning of the Phase II investigations, an investigation report titled “Measurement Plan and Observational Construction Program on Shaft Excavation at the Horonobe Underground Research Laboratory Project” (hereinafter referred to as “Observational Construction Programs”) and an investigation report titled “Measurement Plan and Observational Construction Program on Drift Excavation at the Horonobe Underground Research Laboratory Project” were published. The Observational Construction Program summarizes the followings from the results of the Phase I investigations: measurements for safety and reasonable constructions, enhancement of shaft design and construction technologies and evaluation of appropriateness for the deep geological environment model estimated before shaft excavation. This report summarizes the measurements data acquired at the Ventilation Shaft, the West Shaft and the drifts in 2013 fiscal year for the purpose of the basic data for carrying out the Observational Construction Program. A DVD-ROM is
International Nuclear Information System (INIS)
Inagaki, Daisuke
2014-03-01
The Horonobe Underground Research Laboratory (URL) Project has being pursued by the Japan Atomic Energy Agency (JAEA) to enhance the reliability of relevant disposal technologies through investigations of the deep geological environment within the host sedimentary formations at Horonobe, northern Hokkaido. The URL project consists of two major research areas, 'Geoscientific Research' and 'R and D on Geological Disposal Technologies', and proceeds in three overlapping phases, 'Phase I: Surface-based investigations', 'Phase II: Investigations during tunnel excavation' and 'Phase III: Investigations in the underground facilities', over a period of around 20 years. The Phase I geoscientific research was carried out from March 2001 to March 2006 in parallel with design and execution scheme on URL facilities. In addition, identifying key issues that need to be addressed in the Phase II/III investigations was planned. At the begining of the Phase II investigations, an investigation report titled 'Measurement Plan and Observational Construction Program on Shaft Excavation at the Horonobe Underground Research Laboratory Project' (hereinafter referred to as 'Observational Construction Program') and an investigation report titled 'Measurement Plan and Observational Construction Program on Drift Excavation at the Horonobe Underground Research Laboratory Project' were published. The Observational Construction Program summarizes the followings from the results of the Phase I investigations: measurements for safety and reasonable constructions, enhancement of shaft design and construction technologies and evaluation of appropriateness for the deep geological environment model estimated before shaft excavation. This report summarizes the measurements data acquired at the Ventilation Shaft, the East Shaft and the drifts in 2012 fiscal year based on the Observational Construction Program. The report summarizes the measurements data for the purpose of acquisition of the basic data
International Nuclear Information System (INIS)
Yamasaki, Masanao; Yamaguchi, Takehiro; Funaki, Hironori; Fujikawa, Daisuke; Tsusaka, Kimikazu
2008-09-01
The Horonobe URL Project is being pursued by the Japan Atomic Energy Agency (JAEA) to enhance the reliability of relevant disposal technologies through investigations of the deep geological environment within the host sedimentary formations at Horonobe, northern Hokkaido. The project consists of two major research areas, 'Geoscientific Research' and 'R and D' on Geological Disposal', and proceeds in three overlapping phases, 'Phase I: Surface-based investigation', 'Phase II: Construction' and 'Phase III: Operation', over a period of 20 years. On the Horonobe URL Project, 'Phase 1' was finished in 2005FY and construction of the underground facility was started since then. Now, 'Phase 2' (investigations during construction of the underground facilities) is on-going. On the 'Development of engineering techniques for use in the deep underground environment' in Phase 1, based on the various types of data acquired on investigations from the surface, the design of underground facility in advance was planned. At the inception of the Phase II investigations, an investigation report titled 'Measurement Plan and Observational Construction Program on Shaft Excavation at the Horonobe URL Project' (hereinafter referred to as 'Observational Construction Program') was published. The Observational Construction Program summarizes followings from the Phase I investigations: measurements for safety/reasonable construction, measurements for R and D on enhancement of shaft design/construction technology, and measurements for verification of the deep geological environment model estimated before shaft excavation, and it is on-going. This report summarizes the measurement plan during construction of drifts based on the design in advance and the observational construction program for feedback measurements data into design and construction on subsequent steps. This report also describes about design and construction management program of underground facility and R and D program on
International Nuclear Information System (INIS)
Kunimaru, Takanori; Ota, Kunio; Alexander, W. Russell; Yamamoto, Hajime
2010-11-01
Characterisation of the geological environment within host sedimentary formations is currently ongoing at the site of the Horonobe Underground Research Laboratory in northern Hokkaido, Japan, with the main aim of establishing and testing the relevant techniques for future repository site characterisation. One facet of this is one of the first use of rock matrix porewater data in Japan, in conjunction with the site groundwater data, as part of characterisation of the site hydrochemistry. Surface-based investigations have been largely completed and one of the remaining issues is the development of an appropriate quality assurance (QA) system which is applicable to all aspects of the site characterisation process. A QA audit of hydrochemical datasets for boreholes HDB-9 - 11 has been carried out by the application of a formal QA analysis which is based on the methodology previously employed for groundwaters during the recent site characterisation programme in Sweden. To set this novel approach specifically for rock matrix porewater data in context, several guidelines for assigning the QA categories of the porewater data are proposed. Discussion on the quality level of both the groundwater and porewater data is presented as is a preliminary description of the site hydrochemistry. This exercise has indicated areas where additional information would be of value and further improvement of work would be required to the ongoing hydrochemical characterisation at Horonobe. Overall, it is emphasised that an appropriate QA system, which is among the first such tools required for repository site characterisation, will save on effort by reducing errors and the requirement to re-sample and re-analysis - but this can only be guaranteed by continuously assessing if the system is truly fit-for-purpose and amending it as necessary based on the practical experience of the end-users on-site. (author)
Drying-induced deformation of Horonobe sedimentary rock in the Koetoi and Wakkanai formations
International Nuclear Information System (INIS)
Illankoon, Thilini Nuwanradha; Yee, Suu Mon; Osada, Masahiko; Maekawa, Keisuke; Tada, Hiroyuki; Kumasaka, Hiroo
2013-01-01
In order to increase the long-term safety of geological disposal sites, knowledge of the drying-induced deformation characteristics of the rock mass in underground ventilated galleries is necessary to understand its cracking susceptibility and the chance of further propagation of the excavation damaged zone. Hence, strain was measured in ten cylindrical mudstone specimens (4 from Koetoi formation and 6 from Wakkanai formation respectively) cored at Horonobe Underground Research Laboratory (URL), an off-site (generic) URL, to examine deformation behavior during desiccation. The specimens were prepared in one-dimensional drying conditions in a 25degC or 40degC climatic chamber with 50% relative humidity. Mercury intrusion porosimetry (MIP) was also conducted to measure the pore size distributions of each formation. The recorded data showed that the Koetoi formation specimens generated smaller maximum shrinkage values (10,000 μ) compared to those from the Wakkanai formation (13,000 μ and 24,000 μ for Wakkanai groups I and II respectively). Wakkanai formation specimens were divided into two groups (Wakkanai groups I and II) according to their strain behavior. The porosity of the Koetoi formation was 54% whereas that of the Wakkanai formation was 27 - 38%. MIP results clearly indicate that the Wakkanai formation has a greater mesopore volume (63% and 73% of porosity for Wakkanai groups I and II respectively) than the Koetoi formation (8% of porosity) which contributes to its greater shrinkage. In addition, Wakkanai groups I and II have different pore size distribution patterns. Therefore, Wakkanai groups I and II exhibit distinct strain behaviors during drying. Similarities in grain density, a decrease in porosity and a gradual increase in mesopore volume with depth confirm the progressive hardening of Horonobe sedimentary rock. The pore volume in the 0.013 - 0.025 μm pore radius range exerts a strong influence on shrinkage generation in the Wakkanai formation
Horonobe Underground Research Laboratory project. Current status on the surface-based investigation
International Nuclear Information System (INIS)
Hama, Katsuhiro; Ishii, Eiichi
2004-01-01
Aims of the Horonobe URL project are presenting concrete geological environment as an example of sedimentary formation and confirming reliability of technologies for geological disposal of High-Level Radioactive Waste (HLW) by applying them to actual geological condition of sedimentary formation. Social aim is providing opportunities for general public to experience the actual deep underground circumstance and R and D activities to be conducted there. (author)
Horonobe Underground Research Laboratory project. Investigation program for the 2008 fiscal year
International Nuclear Information System (INIS)
Nakayama, Masashi; Sanada, Hiroyuki; Yamaguchi, Takehiro; Sugita, Yutaka
2008-09-01
As part of the research and development program on geological disposal of high-level radioactive waste (HLW), the Horonobe Underground Research Center, a division of the Japan Atomic Energy Agency (JAEA), is implementing the Horonobe Underground Research Laboratory Project (Horonobe URL Project) with the aim at investigating sedimentary rock formations. According to the research plan described in the Midterm Plan of JAEA, geological investigations are to be carried out during the drilling of a shaft down to intermediate depth, while research and development in the areas of engineering technology and safety assessment are to be promoted by collaboration with other research organizations. The results of the R and D activities will be systematized as a 'knowledge base' that supports a wide range of arguments related to the safety of geological disposal. The Horonobe URL Project is planned to extend over a period of 20 years. The investigations will be conducted in three phases, namely 'Phase 1: Surface-based investigations', 'Phase 2: Construction phase' (investigations during construction of the underground facilities) and 'Phase 3: Operation phase' (research in the underground facilities). This report summarizes the investigation program for the 2008 fiscal year (2008/2009), the 4th year of the Phase 2 investigations. In the 2008 fiscal year, investigations in geoscientific research', including 'development of techniques for investigating the geological environment', 'development of techniques for long-term monitoring of the geological environment', 'development of engineering techniques for use in the deep underground environment' and studies on the long-term stability of the geological environment', are continuously carried out. Investigations in 'research and development on geological disposal technology', including 'improving the reliability of disposal technologies' and 'enhancement of safety assessment methodologies', are also continuously carried out
Energy Technology Data Exchange (ETDEWEB)
Amano, Yuki; Yamamoto, Yoichi; Nanjyo, Isao; Murakami, Hiroaki; Yokota, Hideharu; Yamazaki, Masanori; Iwatsuki, Teruki [Japan Atomic Energy Agency, Geological Isolation Research and Development Directorate, Horonobe, Hokkaido (Japan); Kunimaru, Takanori [Japan Atomic Energy Agency, Geological Isolation Research and Development Directorate, Mizunami, Gifu (Japan); Oyama, Takahiro [Central Research Inst. of Electric Power Industry, Tokyo (Japan)
2012-02-15
In the Horonobe Underground Research Laboratory (URL) Project, groundwater from boreholes, river water and precipitation have been analyzed for the environmental monitoring since the fiscal year 2001. This report shows the data set of water chemistry since the fiscal year 2001 to the fiscal year 2010. (author)
International Nuclear Information System (INIS)
Amano, Yuki; Yamamoto, Yoichi; Nanjyo, Isao; Murakami, Hiroaki; Yokota, Hideharu; Yamazaki, Masanori; Iwatsuki, Teruki; Kunimaru, Takanori; Oyama, Takahiro
2012-02-01
In the Horonobe Underground Research Laboratory (URL) Project, groundwater from boreholes, river water and precipitation have been analyzed for the environmental monitoring since the fiscal year 2001. This report shows the data set of water chemistry since the fiscal year 2001 to the fiscal year 2010. (author)
International Nuclear Information System (INIS)
Sanada, Hiroyuki; Niunoya, Sumio; Matsui, Hiroya; Fujii, Yoshiaki
2009-01-01
Understanding initial stress condition in deep underground is important for such construction as rock cavern for geological disposal of HLW and underground power plant. Neogene sedimentary rock is widely distributed in Japan. There are only a few studies of initial stress measurement in Neogene sedimentary rock mass in Japan due to difficulty of measurement. Evaluation of initial stress condition around Horonobe Underground Research Laboratory Project was carried out in order to understand initial stress condition and applicability of AE, DSCA and hydraulic fracturing (HF) methods to Neogene sedimentary rock. Initial stress values obtained from AE method is smaller than overburden pressure due to time dependency of Kaizer effect. It would be difficult to use AE method as initial stress measurement method for Horonobe Siliceous rocks. Principal stress values by DSCA are similar to those by HF tests. Directions of maximum horizontal principal stresses are approximately in E-W and corresponded to HF results. In HF, rod type and wire-line type systems were compared. Workability of rod type was much better than wire-line type. However, re-opening pressure were not able to be precisely measured in case of rod type system due to the large compliance of the packers and rods. Horizontal maximum and minimum principal stresses increase linearly in HF results. Deviatoric stress is acting at shallow depth. Initial stress condition approaches hydrostatic condition with depth. Direction of maximum horizontal principal stress was in E-W direction which was similar to tectonic movement around Horonobe URL by triangular surveying. (author)
International Nuclear Information System (INIS)
Eki, Nobuhiro; Yamazaki, Shinichi
2004-01-01
Japan Nuclear Cycle Development Institute (JNC) has been conducting two Underground Research Laboratory (URL) Projects. 'The Long-term Program for Research, Development and Utilization of Atomic Energy (Atomic Energy Commission, 2000)' states their technical and social importance for the Japan's program for the Geological Disposal (GD) of HLW and shows an expectation of earlier execution of the projects. One of the URL projects is Neogene argillaceous sedimentary formation hosted Horonobe URL Project. The aims of the Horonobe URL project are; Presenting concrete geological environment as an example of sedimentary formation, Confirming reliability of technologies for geological disposal of High-Level Radioactive Waste (HLW) by applying them to actual geological condition of sedimentary formation, Providing opportunities to experience the actual deep underground circumstance for the general public. The project is composed of six subjects; 1) development of site characterization methodology, 2) development of monitoring techniques, 3) development of engineering techniques for underground development, 4) neotectonic characterization of the area, 5) development of engineering techniques for designing, construction and operation of a repository, 6) development of safety assessment methodology. The project consists of three phases: investigations form the surface (Phase 1), investigations during construction of the underground facility (Phase 2) and researches using the facility (Phase 3). The total duration is about 20 years. From 2000, surface-based site investigations are going on. In course of the investigations, a series of geophysical surveys has been employed. Along with the town-wide investigation, an area for site-scale investigation was selected, a land for facilities construction was acquired in the area and the land preparation has started in 2003. Geological information gave more detailed and concrete figure of URL, which is composed of three shafts down to
International Nuclear Information System (INIS)
Aoyagi, Kazuhei; Ishii, Eiichi; Fujita, Tomoo; Kondo, Keiji; Tsusaka, Kimikazu
2015-03-01
Japan Atomic Energy Agency (JAEA) has been conducting R and D activities at the off-site URL at Horonobe, Hokkaido, Japan in order to enhance reliability of technology related to deep geological disposal of HLW in sedimentary rocks. In this report, strength properties (cohesion and frictional angle) of rock masses in the Koetoi and Wakkanai formations are investigated on the basis of triaxial tests conducted in the Horonobe URL considering the relative depths to the formation. Strength properties investigated in this report are compared with the properties obtained in the designing phase. The cohesion in the Koetoi Formation increased with increasing depth. On the other hand, in the transition zone of the Wakkanai Formation, the cohesion increased significantly in the shallow Wakkanai formation (transition zone). Below the transition zone, the cohesion does not significantly depend on the depth. Thus the strength properties between two formations were found to be different. Comparing the cohesions and frictional angles determined from triaxial tests with the values determined in the designing phase, there was no agreement between these values in almost all the depth. Thus it is essential to determine cohesion and frictional angle considering the relative depths to the formation for detailed understanding of strength properties of rock mass. A CD-ROM is attached as an appendix. (J.P.N.)
Development of a groundwater monitoring system at Horonobe Underground Research Center
International Nuclear Information System (INIS)
Nanjo, Isao; Amano, Yuki; Iwatsuki, Teruki; Murakami, Hiroaki; Kunimaru, Takanori; Morikawa, Keita; Hosoya, Shinichi
2012-03-01
Japan Atomic Energy Agency (JAEA) develops basic investigation techniques for deep geological environment around Underground Research Laboratory (URL) at Horonobe area, Japan. The observation technique of hydrochemical condition in low permeable sedimentary rock around the facility is one of R and D subjects. We report, 1) development of hydrochemical monitoring system to observe water pressure, pH, electric conductivity, dissolved oxygen, redox potential and temperature, 2) hydrochemical observation results around URL under construction. The applicability of the hydrochemical monitoring system is evaluated for low permeable sedimentary rock bearing abundant dissolved gases. The hydrochemical observation during facility construction demonstrates that pH and redox potential of groundwater almost did not changed even at hydraulic disturbed zone (water pressure decreased zone). A CD-ROM is attached as an appendix. (J.P.N.)
International Nuclear Information System (INIS)
Matsui, Hiroya; Nakayama, Masashi; Sanada, Hiroyuki; Yamaguchi, Takehiro
2008-09-01
As past of the research and development program on the geological disposal of high-level radioactive waste (HLW), the Horonobe Underground Research Center, a division of the Japan Atomic Energy Agency (JAEA), is implementing the Horonobe Underground Research Laboratory Project (Horonobe URL Project) with the aim at investigating sedimentary rock formations. According to the research plan described in the Midterm Plan of JAEA, geological investigations are to be carried out during the drilling of a shaft down to intermediate depth, while research and development in the areas of engineering technology and safety assessment are to be promoted by collaboration with other research organizations. The results of the R and D activities will be systematized as a 'knowledge base' that supports a wide range of arguments related to the safety of geological disposal. The Horonobe URL Project is planned to extend over a period of 20 years. The investigations will be conducted in three phases, namely 'Phase 1: Surface-based investigations', 'Phase 2: Construction phase' (investigations during construction of the underground facilities) and 'Phase 3: Operation phase' (research in the underground facilities). This report summarizes the investigation program for the 2007 fiscal year (2007/2008), the third year of the Phase 2 investigations. In the 2007 fiscal year, investigations in geoscientific research', including 'development of techniques for investigating the geological environment', 'development of techniques for use in the deep underground environment' and 'studies on the long-term stability of the geological environment', is continuously carried out. Investigations in 'research and development on geological disposal technology', including improving the reliability of disposal technologies' and 'enhancement of safety assessment methodologies' are also continuously carried out. Construction of the underground facilities is ongoing at the Ventilation Shaft and the East Shaft
International Nuclear Information System (INIS)
Sakurai, Akitaka; Aoyagi, Kazuhei
2016-07-01
The Horonobe Underground Research Laboratory (URL) Project has being pursued by Japan Atomic Energy Agency (JAEA) to enhance the reliability of relevant disposal technologies through investigations of the deep geological environment within the host sedimentary formations at Horonobe, northern Hokkaido. The URL project consists of two major research areas, 'Geoscientific Research' and 'R and D on Geological Disposal Technologies', and proceeds in three overlapping phases, 'Phase I: Surface-based investigations', 'Phase II: Investigations during tunnel excavation' and 'Phase III: Investigations in the underground facilities', over a period of around 20 years. The Phase I geoscientific research was carried out from March 2001 to March 2006 in parallel with design and execution scheme on URL facilities. In addition, identifying key issues that need to be addressed in the Phase II/III investigations were planned. At the beginning of the Phase II investigations, investigation reports related to measurement plan and observational construction program on shaft and drift excavation were published. The observational construction program summarizes the followings from the results of the Phase I investigations: measurements for safety and reasonable constructions, enhancement of shaft design and construction technologies and evaluation of appropriateness for the deep geological environment model estimated before shaft excavation. Currently, Phase III investigation related to geological disposal in underground facilities has been conducting. Also, measurement for consideration of long-term stability of the tunnel has been continued. This report summarizes the measurements data acquired at the West Shaft in 2014 fiscal year for the purpose of the basic data for carrying out the Observational Construction Program. A DVD-ROM is attached as an appendix. (J.P.N.)
International Nuclear Information System (INIS)
Oyama, Takahiro; Kiho, Kenzo; Suzuki, Koichi; Nakata, Eiji; Tanaka, Shiro; Hasegawa, Takuma; Nakata, Kotaro; Nagaoka, Toru; Nakamura, Takamichi; Fukushima, Tatsuo; Ishii, Eiichi; Kunimaru; Takanori; Hama, Katsuhiro; Iwatsuki, Teruki; Sugita, Yutaka; Yabuuchi, Satoshi; Miyahara, Shigenori; Takahashi, Kazuharu
2010-01-01
CRIEPI (Central Research Institute of Electric Power Industry) and JAEA (Japan Atomic Energy Agency) have been conducting a collaboration research to develop methodology for the characterization of geological environment since FY 2002. This report describes the results of the collaboration research in mainly from FY 2004 to FY 2008. As the collaboration research, the following research results were obtained. (1) Study on the slaking property. We discovered the spherical silica (amorphous silica) in siliceous rock (Opalin chert) between the Koetoi and Wakkanai Formation. The permeability of this chert (10 -12 m/sec) decreases to compare with near depth diatomaceous mudstone (10 -10 m/sec). This diatomaceous mudstone dose not rapidly slakes. Excavated disturbed zone(EdZ) at -140 m tunnel was estimated with drilled cores and gas flows from the tunnel wall. (2) Study on the chemical weathering of the sedimentary rock. The weathering property was investigated of mudstone at an outcrop and east shaft. Weathering profile was divided oxidized, dissolved, transition and fresh zone. Oxidation was limited to the vicinity of surface. (3) Study on the pore water extraction methodology. Sample preparation under N 2 condition before porewater squeezing to prevent oxidation showed that the squeezed porewater chemistry was affected by the sample storage period before squeezing. (4) Study on exploration method considering the physical property of the rock. The depth profile of the mechanical and permeability properties can be estimated by the results of physical logging in the borehole and laboratory measurements of core samples. (5) Study on the applicability of the controlled drilling system to the Horonobe site. The controlled drilling system was applied to the Hokushin site and the Kami-horonobe site in the Horonobe town. At the Kami-horonobe site, the system was applied to drill the Omagari fault and characterize the hydro-geology around the fault. The controlled drilling was
International Nuclear Information System (INIS)
Nakayama, Masashi; Ohno, Hirokazu; Nakayama, Mariko; Kobayashi, Masato
2016-07-01
The Horonobe Underground Research Laboratory (URL) Project has being pursued by Japan Atomic Energy Agency to enhance the reliability of relevant disposal technologies through investigations of the deep geological environment within the host sedimentary formation at Horonobe, northern Hokkaido. The URL Project consists of two major research areas, 'Geoscientific Research' and 'Research and Development on Geological Disposal Technologies', and proceeds in three overlapping phases, 'Phase I: Surface-based investigations', 'Phase II: Investigations during tunnel excavation' and 'Phase III: Investigations in the underground facilities', over a period of around 20 years. Phase III investigation was started in 2010 fiscal year. The in-situ experiment for performance confirmation of engineered barrier system (EBS experiment) had been prepared from 2013 to 2014 fiscal year at G.L.-350m gallery, and heating by electric heater in simulated overpack had started in January, 2015. One of objectives of the experiment is acquiring data concerned with Thermal - Hydrological - Mechanical - Chemical (THMC) coupled behavior. These data will be used in order to confirm the performance of engineered barrier system. This report summarizes the measurement data acquired from the EBS experiment from December, 2014 to March, 2016. The summarized data of the EBS experiment will be published periodically. A CD-ROM is attached as an appendix. (J.P.N)
International Nuclear Information System (INIS)
Kiho, Kenzo; Oyama, Takahiro; Suzuki, Koichi; Nakata, Eiji; Tanaka, Shiro; Miyakawa, Kimio; Ishii, Eiichi; Takahashi, Kazuharu; Kunimaru, Takanori; Tsukui, Rota; Fukushima, Tatsuo; Seya, Masami; Hama, Katsuhiro; Aoki, Kazuhiro
2006-01-01
CRIEPI (Central Research Institute of Electric Power Industry) and JAEA (Japan Atomic Energy Agency) have been conducting a collaboration research to develop methodology for the characterization of geological environment since FY 2002. This report describes the results of the collaboration research in mainly FY 2003. As the collaboration research, the following research results were obtained. (1) Study on the diagenesis of the sedimentary rock of the Noegene Tertiary. The maximum burial depth of the formation can be estimated. (2) Study on the chemical weathering of the soft sedimentary rock. The acidic water can be caused by the chemical weathering of the rock in the Koetoi formation. (3) Study on the pore water extraction. The hydrochemical condition at the Horonobe site can be estimated by the results of the chemical analyses of extracted pore water, and the different pressure of the extraction results the different chloride contents of the pore water. (4) Study on exploration method considering the physical property of the rock. The depth profile of the mechanical properties can be estimated by the results of physical logging in the borehole. (5) Study on the applicability of the controlled drilling system to the Horonobe site. The controlled drilling system can be applicable to drill the directional borehole. (author)
International Nuclear Information System (INIS)
Sato, Toshinori; Sasamoto, Hiroshi; Ishii, Eiichi; Matsuoka, Toshiyuki; Hayano, Akira; Miyakawa, Kazuya; Fujita, Tomoo; Tanai, Kenji; Nakayama, Masashi; Takeda, Masaki; Yokota, Hideharu; Aoyagi, Kazuhei; Ohno, Hirokazu; Shigeta, Naotaka; Hanamuro, Takahiro; Ito, Hiroaki
2017-03-01
The Horonobe Underground Research Laboratory (URL) Project is being pursued by the Japan Atomic Energy Agency (JAEA) to enhance the reliability of relevant disposal technologies through investigations of the deep geological environment within the host sedimentary formations at Horonobe, northern Hokkaido. The project consists of two major research areas, 'Geoscientific Research' and 'R and D on Geological Disposal', and proceeds in three overlapping phases, 'Phase I: Surface-based investigation', 'Phase II: Construction' and 'Phase III: Operation', over a period of 20 years. This report summarizes the results of the Phase II investigations carried out from April 2005 to June 2014 to a depth of 350 m. Integration of work from different disciplines into a 'geosynthesis' ensures that the Phase II goals have been successfully achieved and identifies key issues that need to be addressed in the Phase II investigations. Efforts are made to summarize as many lessons learnt from the Phase II investigations and other technical achievements as possible to form a 'knowledge base' that will reinforce the technical basis for both implementation and the formulation of safety regulations. (author)
International Nuclear Information System (INIS)
Nakayama, Masashi; Ohno, Hirokazu; Nakayama, Mariko; Kobayashi, Masato
2015-09-01
The Horonobe Underground Research Laboratory (URL) Project has being pursued by Japan Atomic Energy Agency (JAEA) to enhance the reliability of relevant disposal technologies through investigations of the deep geological environment within the host sedimentary formation at Horonobe, northern Hokkaido. The URL Project consists of two major research areas, “Geoscientific Research” and “Research and Development on Geological Disposal Technologies”, and proceeds in three overlapping phases, “Phase I: Surface-based investigations”, “Phase II: Investigations during tunnel excavation” and “Phase III: Investigations in the underground facilities”, over a period of around 20 years. Phase III investigation was started in 2010 fiscal year. The in-situ experiment for performance confirmation of engineered barrier system (EBS experiment) had been prepared from 2013 to 2014 fiscal year at G.L.-350m gallery, and heating by electric heater in simulated overpack had started in January, 2015. One of objectives of the experiment is acquiring data concerned with Thermal – Hydrological – Mechanical – Chemical (THMC) coupled behavior. These data will be used in order to confirm the performance of engineered barrier system. This report summarizes the measurement data acquired from the EBS experiment from December, 2014 to March, 2015. The summarized data of the EBS experiment will be published periodically. A CD-ROM is attached as an appendix. (J.P.N)
Estimation of erosion amount by geochemical characteristic in the Horonobe area, northern Hokkaido
International Nuclear Information System (INIS)
Takahashi, Kazuharu; Niizato, Tadafumi; Yasue, Ken-ichi; Ishii, Eiichi
2005-08-01
This article presents the results of the estimated amount of erosion and uplifting based on mineralogy and organic geochemical characters of the Neogene siliceous rock (Wakkanai and Koetoi Formations) in Horonobe. As a result of the transformational change of silica minerals, it was clarified that the erosion amount was about 0.66 [m ky -1 ] or more at the large uplift site, and about 0.21 [m ky -1 ] or more at the small uplift site at Hokushin region, Horonobe area. In this case of the correlation with the palaeo-geothermal temperature and the sterane/sterene ratio, the ratio is effective measure to estimate the burial depth and erosion amount. We think that the estimation of the amount of erosion and uplifting became possible in high resolution by the organic geochemical character. (author)
International Nuclear Information System (INIS)
Nakayama, Masashi; Niunoya, Sumio; Minamide, Masashi
2016-01-01
In Japan, high-level radioactive waste repository will be constructed in a stable host rock formation more than 300 m underground. Tunnel support is used for safety during the construction and operation, so, shotcrete and concrete lining are used as the tunnel support. Concrete is a composite material comprised of aggregate, cement, water and various additives. Low alkaline cement has been developed for the long term stability of the barrier systems whose performance could be negatively affected by highly alkaline conditions arising due to cement used in a repository. Japan Atomic Energy Agency (JAEA) has developed the low alkaline cement, named as HFSC (Highly fly-ash contained silicafume cement), containing over 60wt% of silicafume (SF) and Fly-ash (FA). JAEA is presently constructing the underground research laboratory (URL) at Horonobe for research and development in the geosciences and repository engineering technology. HFSC was used experimentally as the shotcrete material in construction of part of the 350 m deep gallery in the Horonobe URL in 2013. The objective of this experiment was to assess the performance of HFSC shotcrete in terms of mechanics, workability, durability, and so on. HFSC used in this experiment is composed of 40wt% OPC (Ordinary Portland Cement), 20wt% SF, and 40wt% FA. This composition was determined based on mechanical testing of various mixes of the above components. Because of the low OPC content, the strength of HFSC tends to be lower than that of OPC in normal concrete. The total length of tunnel constructed using HFSC shotcrete is about 112 m at 350 m deep drift. The workability of HFSC shotcrete was confirmed by this experimental construction. In this report, we present detailed results of the in-situ construction test. (author)
International Nuclear Information System (INIS)
Gaussen, J.L.
2001-01-01
Bure URL project is one of the components of the French research program dedicated to the study of HLLLW (High Level Long Lived Radioactive Waste) disposal in geologic repository within the framework of the 1991 Radioactive Waste Act. Pursuant to the said act, the objective of the URL project is to participate in the ''evaluation of options for retrievable or non- retrievable disposal in deep geologic formations''. More precisely, the goal of this URL, which is situated 300 km East of Paris, is to gain a better knowledge of a site capable of hosting a geologic repository. (author)
International Nuclear Information System (INIS)
Tsusaka, Kimikazu; Inagaki, Daisuke; Koike, Masashi; Ijiri, Yuji; Hatsuyama, Yoshihiro
2011-01-01
The authors investigated concrete lining stress caused by excavation of a 6.5 m diameter access shaft at the Horonobe Underground Research Laboratory. They analyzed lining stress distribution by three-dimensional analysis. The stress distribution was also measured with ten stress meters installed in each section in the direction of maximum and minimum initial stresses. As a result, it was clarified that the maximum and minimum lining stresses occurred in the inner bottom in the direction of the minimum initial stress and in the inner top in the direction of the maximum initial stress, respectively, and the more than 10 MPa stress inclination between them occurred in 60 cm thick and 2 m high concrete lining. (author)
Preliminary study on the corrosion behavior of carbon steel in Horonobe groundwater environment
International Nuclear Information System (INIS)
Taniguchi, Naoki; Kogawa, Noritaka; Maeda, Kazuto
2006-08-01
It is necessary to understand the corrosion behavior of candidate overpack materials to plan the in-situ engineered barrier test at underground laboratory constructing at Horonobe and to design the overpacks suitable to Horonobe environment. The preliminary corrosion tests of carbon steel which is a candidate material for overpacks were carried out using artificial groundwater and actual groundwater sampled at Horonobe. As the results of anodic polarization experiments, the anodic polarization curves of carbon steel in buffer material were active dissolution type, and the corrosion type of carbon steel in Horonobe groundwater environment was expected to be general corrosion. The results of immersion test under air equilibrium condition showed that the degrees of corrosion localization were not exceeded the data obtained in previous studies. The trend of corrosion rates in buffer material under anaerobic condition were similar to the data obtained in previous studies. Based on the experimental results, it was confirmed that the corrosion assessment model and assumed corrosion rate in second progress report (H12 report) can be applied to the assessment for Horonobe groundwater condition. (author)
International Nuclear Information System (INIS)
Kunimaru, Takanori; Ota, Kunio; Amano, Kenji; Alexander, W. Russell
2011-01-01
An appropriate QMS, which is among the first tools required for repository site characterisation, will save on effort by reducing errors and the requirement to resample and reanalyse - but this can only be guaranteed by continuously assessing if the system is truly fit-for-purpose and amending it as necessary based on the practical experience of the end-users on-site. A QA audit of hydrochemical datasets for boreholes HDB-1-11 from Horonobe URL project by JAEA has been carried out by the application of a formal QA analysis which is based on the methodology previously employed for groundwaters during the recent site characterisation programme in Sweden. This methodology has been successfully applied to the groundwaters of the fractured crystalline rocks of the Fennoscandian Shield and has now been adapted and applied to some of the ground- and porewaters of the Horonobe URL area. This paper will present this system in the context of the Japanese national programme and elucidate improvements made during hands-on application of the borehole investigation QMS. Further improvements foreseen for the future will also be discussed with a view of removing inter-operator variability as much as is possible. Only then can confidence by placed in URL project or repository site hydrochemical datasets. (author)
Basic characteristic test of buffer/backfill material under Horonobe groundwater condition
International Nuclear Information System (INIS)
Kikuchi, Hirohito; Tanai, Kenji
2005-02-01
By the second progress report (H12) on research and development for the geological disposal of high-level radioactive waste (HLW) in Japan, Japan Nuclear Cycle Development Institute (JNC) extended the data base of basic properties of compacted bentonite which were mainly obtained by using distilled water as test fluid. This report presents influence of Horonobe groundwater on the basic properties of buffer and backfill material. The Horonobe groundwater is a type of saline groundwater. The groundwater was sampled at GL-300 m or deeper by using bore hole HDB-6 of the underground laboratory of Horonobe site. In addition, basic properties are also obtained by using distilled water, synthetic seawater, and NaCl solution. Experimental results are as follows; 1) Swelling characteristics, hydraulic characteristics and mechanical characteristics of the buffer material and backfill material decrease by the influence of saline water. The relationship between effective clay density and swelling stress is described by the following equation. σ = exp (2.5786ρ b 3 - 12.238ρ b 2 + 21.818ρ b - 14.035) where σ is swelling stress [MPa], ρ b is effective clay density [Mg/m 3 ]. The relationship between effective clay density and intrinsic permeability is described by the following equation. κ = exp (-41.466 + 4.316ρ b - 4.069ρ b 2 ) where κ is intrinsic permeability [m 2 ], ρ b is effective clay density [Mg/m 3 ]. The relationship between effective clay density and unconfined compressive strength is described by the following equation. qu = 1.4 x 10 -4 exp (5.637ρ b ) where qu is unconfined compressive strength [MPa], ρ b is effective clay density [Mg/m 3 ]. 2) Saline water doesn't influence the thermal characteristic of the buffer material. The thermal conductivity and specific heat are derived by using the relationship that was obtained so far. (author)
International Nuclear Information System (INIS)
Matsui, Hiroya
2005-09-01
This report describes for preliminary research plan in Phase 2 and Phase 3 taken into consideration of expected geological environment at location of URL based on the results of the investigations until FY 2003/2004. Duration of construction phase and total cost are considered as important factors for planning as well. The below items are planned for in-situ experiments in Phase 2 and Phase 3 in/around URL are planning. Phase 2. (In-situ experiments for understanding of geological environment) Geological survey at tunnel. Inflow measurement in shafts. Water pressure monitoring and groundwater sampling around shafts during excavation of URL. Investigation for EDZ around shafts. Stress measurement on support. Detail investigations for geological environment around drifts. Excavation disturbance experiment in a drift. Investigation for desaturation zone and REDOX condition around drifts. (Engineered barrier system) In-situ experiment on low-alkali concrete. In-situ experiment for gas migration in engineering barrier system. Phase 3. (In-situ experiments for understanding of geological environment) EDZ experiment for stress interference. Investigation of long-term behavior of EDZ around drifts. Detail investigation on fault/fault zone. Monitoring for the change of geological environment at earthquake. Backfill test in boreholes. (Engineered barrier system) T-H-M-C experiment. In-situ experiment for corrosion of overpack. Investigation of the influence of a concrete to engineering barrier system and geological environment. In-situ experiment for interference between backfill material and geological environment. Backfill test in a drift. (Safety assessment) Tracer tests in engineering barrier system, natural barrier and fault/fault zone. (author)
International Nuclear Information System (INIS)
2001-03-01
The Horonobe Underground Research Laboratory (Tentative name) Project under planning at Horonobe-machi by the Japan Nuclear Cycle Development Institute (JNC) is a research facility on deep underground shown in the Long-term program on research, development and application of nuclear energy (June, 1994)' (LPNE), where some researches on the deep underground targeted at sedimentary rocks are carried out. The plan on The Horonobe Underground Research Laboratory performed at Horonobe-machi' is an about 20 years plan ranging from beginning to finishing of its survey and research, which is carried out by three steps such as 'Survey and research performed from earth surface', 'Survey and research performed under excavation of road', and Survey and research performed by using the road'. The Horonobe Underground Research Laboratory is one of research facilities on deep underground shown its importance in LPNE, and carries out some researches on the deep underground at a target of the sedimentary rocks. And also The Horonobe Underground Research Laboratory confirms some technical reliability and support on stratum disposal shown in the 'Technical reliability on stratum disposal of the high level radioactive wastes. The Second Progress Report of R and D on geological disposal' summarized on November, 1999 by JNC through actual tests and researches at the deep stratum. The obtained results are intended to reflect to disposal business of The Horonobe Underground Research Laboratory and safety regulation and so on performed by the government, together with results of stratum science research, at the Tono Geoscience Center, of geological disposal R and D at the Tokai Works, or of international collaborations. For R and D at the The Horonobe Underground Research Laboratory after 2000, following subjects are shown: 1) Survey technique on long-term stability of geological environment, 2) Survey technique on geological environment, 3) Engineering technique on engineered barrier and
Horonobe underground research program. Research report of 2002 FY investigation
International Nuclear Information System (INIS)
2003-06-01
Main results of investigation about Horonobe deep underground research center in 2002 FY were reported. It consists of six chapters: introduction, main results, selection of research center area, underground science research, R and D of geological disposal, and the environmental survey and research center on the ground. The research center area at about 3 km north of Horonobe (B1) was selected in the four areas: A, B1, B2 and C on the basis of data, researches in the sky, aboveground and underground and other conditions. The model of geological environment was constructed by physical, geological, surface water supply researches. Development of geological environment monitoring techniques, investigation of long stabilization of geological environment and design of underground facilities are reported. The basic design of preparation of research center was investigated. (S.Y.)
Investigation on geological environments (IGE)
Energy Technology Data Exchange (ETDEWEB)
Lerouge, C.; Widory, D.; Guerrot, C.; Gaucher, E.C. [Bureau de Recherches Geologiques et Minieres (BRGM), 45 - Orleans (France); Buschaert, S. [ANDRA - Agence Nationale pour la Gestion des Dechets Radioactifs, Dir. Scientifique, 92 - Chatenay Malabry (France); Kurikami, H.; Takeuchi, R. [JAEA - Japan Atomic Energy Agency, Hokkaido (Japan); Yabuuchi, S. [METI - Ministry of Economy, Trade and Industry, Tokyo (Japan); Kunimaru, T. [Japan Atomic Energy Agency (JAEA), Horonobe Underground Research Unit, Geological Isolation Research and Development Directorate, Hokkaido (Japan); Yamamoto, H. [Technology Center, Taisei Corporation, Yokohama (Japan); Matray, J.M.; Savoye, S.; Cabrera, J.; Lecathelinais, P. [Institut de Radioprotection et de Surete Nucleaire (IRSN), 92 - Fontenay-aux-Roses (France); Goncalves, J.; Girardin, I. [Universite Pierre et Marie Curie, UMR 7619-Sisyphe, 75 - Paris (France); Craen, M. de; Honty, M.; Wemaere, I.; Van Geet, M. [SCK-CEN - Belgian Nuclear Research Centre - Environment, Healt and Safety Institute, Mol (Belgium); Van Geet, M. [ONDRAF/NIRAS - Belgian Agency for Radioactive Waste and Enriched Fissile Materials, Brussel (Belgium); Le Gal La Salle, C.; Lancelot, J. [Nimes Univ., GIS, UMR 6635 CNRS, 30 (France); Benedetti, L.; Bourles, D.; Hamelin, B. [Aix-Marseille-3 Univ., CEREGE, UMR 6635 CNRS, 13 (France); Fatmi, H.; Ababou, R. [Institut de Mecanique des Fluides de Toulouse, 31 -Toulouse (France); Wemaere, I.; Marivoet, J.; Labat, S. [SCK-CEN - Belgian Nuclear Research Centre, Mol (Belgium); Fedor, F. [MECSEKERC Ltd, Dir. of Environmental Protection (Hungary); Mathe, Z. [MECSEKERC Ltd, Lab. of Env. Geology and Soil Mechanics (Hungary); Hamos, G. [MECSEKERC Ltd, Dept. of Geosciences (Hungary); Somodi, G. [MECSEKERC Ltd, Dept. of Geotechnics (Hungary)
2007-07-01
This session gathers 9 articles (posters) dealing with: (S, O, Sr) isotopic constraints on the diagenetic evolution of the Callovo-Oxfordian formation at the Meuse/Haute-Marne URL; the scale effect and heterogeneity of hydraulic conductivity of sedimentary rocks at Horonobe URL site; the investigation and modeling of 3D distribution of water chemistries in Horonobe, Hokkaido, Japan; PH4: a 250 m deep borehole in Tournemire for assessing the contribution of transport phenomena to assumed overpressures in the Toarcian/Domerian semipermeable; the lateral variability of mineralogy and pore water chemistry of the Boom Clay; {sup 36}Cl in groundwaters of Oxfordian and Dogger limestones of the Eastern Paris basin: implications for old groundwater dating; the statistical preprocessing and analyses of hydro-geo-meteorologic time series in the PP experiment of Mont Terri (method. and first results); the hydraulic conductivity of the Boom Clay in north-east Belgium based on four core-drilled boreholes; and a new approach of laboratory permeability measurement of very tight rocks: experimental data of BCF, Mecsek Mts, SW Hungary.
Horonobe Underground Research Laboratory project. Investigation report for the 2010 fiscal year
International Nuclear Information System (INIS)
Nakayama, Masashi; Sawada, Sumiyuki; Sugita, Yutaka
2011-09-01
The Horonobe Underground Research Laboratory Project is planned to extend over a period 20 years. The investigations will be conducted in three phases, namely 'Phase 1: Surface-based investigations', 'Phase 2: Construction Phase' (investigations during construction of the underground facilities) and 'Phase 3: Operation phase' (research in the underground facilities). This report summarizes the results of the investigations for the 2010 fiscal year (2010/2011). The investigations, which are composed of 'Geoscientific research' and 'R and D on geological disposal technology', were carried out according to 'Horonobe Underground Research Laboratory Project Investigation Program for the 2010 Fiscal year'. The results of these investigations, along with the results which were obtained in other departments of Japan Atomic Energy Agency (JAEA), are properly offered to the implementations and the safety regulations. For the sake of this, JAEA has proceeded with the project in collaboration with experts from domestic and overseas research organisations. (author)
International Nuclear Information System (INIS)
Kusano, Tomohiro; Ishii, Eiichi
2016-02-01
Japan Atomic Energy Agency (JAEA) is performing the Horonobe Underground Research Laboratory Project, which includes a scientific study of the deep geological environment as a basis of research and development for geological disposal of high level radioactive wastes (HLW), in order to establish comprehensive techniques for the investigation, analysis and assessment of the deep geological environment in the sedimentary rock. This report aims at compiling fracture data of drill core obtained from the Horonobe Underground Research Laboratory Project (Phase 1). (author)
URL Mining Using Agglomerative Clustering Algorithm
Directory of Open Access Journals (Sweden)
Chinmay R. Deshmukh
2015-02-01
Full Text Available Abstract The tremendous growth of the web world incorporates application of data mining techniques to the web logs. Data Mining and World Wide Web encompasses an important and active area of research. Web log mining is analysis of web log files with web pages sequences. Web mining is broadly classified as web content mining web usage mining and web structure mining. Web usage mining is a technique to discover usage patterns from Web data in order to understand and better serve the needs of Web-based applications. URL mining refers to a subclass of Web mining that helps us to investigate the details of a Uniform Resource Locator. URL mining can be advantageous in the fields of security and protection. The paper introduces a technique for mining a collection of user transactions with an Internet search engine to discover clusters of similar queries and similar URLs. The information we exploit is a clickthrough data each record consist of a users query to a search engine along with the URL which the user selected from among the candidates offered by search engine. By viewing this dataset as a bipartite graph with the vertices on one side corresponding to queries and on the other side to URLs one can apply an agglomerative clustering algorithm to the graphs vertices to identify related queries and URLs.
Horonobe Underground Research Laboratory project. Investigation report for the 2006 fiscal year
International Nuclear Information System (INIS)
Matsui, Hiroya; Nakayama, Masashi; Sanada, Hiroyuki
2008-05-01
The Horonobe Underground Research Laboratory is planned to extend over a period of 20 years. The investigations will be conducted in three phases, namely 'Phase 1: Surface-based investigations', 'Phase 2: Construction Phase' (investigations during construction of the underground facilities) and 'Phase 3: Operation phase' (research in the underground facilities). This report summarizes the results of the investigations for the 2006 fiscal year (2006/2007), the second year of the Phase 2 investigations. The investigations, which are composed of 'Geoscientific research' and 'R and D on the geological disposal of high-level radioactive waste (HLW)', were carried out according to 'Horonobe Underground Research Laboratory Project Investigation Program for the 2006 Fiscal Year'. The results of these investigations, along with the results which were obtained in other departments of Japan Atomic Energy Agency (JAEA), are properly offered to the implementations and the safety regulations. JAEA proceeded with the project in, collaboration with experts from domestic and overseas research organisation. (author)
Horonobe Underground Research Laboratory project. Investigation report for the 2007 fiscal year
International Nuclear Information System (INIS)
Nakayama, Masashi; Sanada, Hiroyuki; Sugita, Yutaka
2008-09-01
The Horonobe Underground Research Laboratory Project is planned to extend over a period of 20 years. The investigations will be conducted in three phases, namely 'Phase 1: Surface-based investigations', 'Phase 2: Construction Phase' (investigations during construction of the underground facilities) and 'Phase 3: Operation phase' (research in the underground facilities). This report summarizes the results of the investigations for the 2007 fiscal year (2007/2008), the 3rd year of the Phase 2 investigations. The investigations, which are composed of 'Geoscientific research' and 'R and D on the geological disposal of high-level radioactive waste (HLW)', were carried out according to 'Horonobe Underground Research Laboratory Project Investigation Program for the 2007 Fiscal Year'. The results of these investigations, along with the results which were obtained in other departments of Japan Atomic Energy Agency (JAEA), are properly offered to the implementations and the safety regulations. JAEA proceeded with the project in collaboration with experts from domestic and overseas research organisation. (author)
Horonobe Underground Research Laboratory project investigation report for the 2008 fiscal year
International Nuclear Information System (INIS)
Nakayama, Masashi; Sano, Michiaki; Sanada, Hiroyuki; Sugita, Yutaka
2009-11-01
The Horonobe Underground Research Laboratory Project is planned to extend over a period 20 years. The investigations will be conducted in three phases, namely 'Phase 1: Surface-based investigations' 'Phase 2: Construction Phase' (investigations during construction of the underground facilities) and 'Phase 3: Operation phase' (research in the underground facilities). This report summarizes the results of the investigations for the 2008 fiscal year (2008/2009), the 4th year of the Phase 2 investigations. The investigations, which are composed of 'Geoscientific research' and 'R and D on geological disposal technology', were carried out according to 'Horonobe Underground Research Laboratory Project Investigation Program for the 2008 Fiscal year'. The results of these investigations, along with the results which were obtained in other departments of Japan Atomic Energy Agency (JAEA), are properly offered to the implementations and the safety regulations. For the sake of this, JAEA has proceeded with the project in collaboration with experts from domestic and overseas research organisations. (author)
Horonobe Underground Research Laboratory Project. Plans for surface-based investigations. Phase 1
International Nuclear Information System (INIS)
Goto, Junichi; Hama, Katsuhiro
2003-10-01
The Horonobe Underground Research Laboratory Project is an investigation project which is planned over 20 years. The investigations are conducted in the three phases: investigations from surface (Phase 1), investigations during construction of the underground facility (Phase 2) and investigations using the facility (Phase 3). Taking into account the results from 'H12: Project of Establish the Scientific and Technical Basis for HLW Disposal in Japan - Second Progress Report on Research and Development for the Geological Disposal of HLW in Japan-' (JNC, 2000), research and development goals for the Horonobe URL project were re-defined as follows; a) Development of investigation technologies for the geological environment, b) Development of monitoring technologies for the geological environment, c) Study on the long-term stability of the geological environment, d) Development of the basis for engineering technologies in deep underground, e) Verification of technologies for engineered barriers, f) Development of detailed designing technologies of the repositories, and g) Improvement of safety assessment methodologies. Investigations for the goals a) to d) and e) to g) are conducted in the 'Geoscientific Research' and 'Research and Development on Geological Disposal', respectively. In Phase 1, a 'laboratory construction area' of a few kilometers square is selected based on the results from early stage investigations. Subsequent investigations are concentrated in the selected area and its periphery. Acquisition of data by surface-based investigations, modeling of the geological environment and predictions of changes in the geological environment caused by the construction of the underground facility, are conducted in a) Development of investigation technologies for the geological environment. Development and installation of monitoring equipments and data acquisition prior to the construction of the underground facility fall under b) Development of monitoring technologies
International Nuclear Information System (INIS)
Takaji, Kazuhiko; Shigeno, Yoshimasa; Simogouchi, Takafumi
2005-02-01
In the Horonobe underground research project, various in-situ experiments are conducted in order to confirm the applicability of the Engineered Barrier System (EBS) design techniques shown in H12 report, to understand the long-term effects of EBS, and to improve the reliability of the prediction method. Moreover, since it is assumed that the circumference of Horonobe underground research laboratory is the saline water environment, to understand the mechanical behavior of the bentonite mixture material under the saline water environment is important when influenced in design of in-situ experiments. In this study, unconfined compression tests, consolidated-undrained triaxial compression tests and long-term consolidation tests of the bentonite mixture material were performed using groundwater that is extracted near the Horonobe underground research laboratory, and simulation analyses of EBS over a period of time using the results of laboratory experiments etc. were carried out. Consequently, although compressive strength and the elastic modulus under the saline water environment declined compared with that the fresh water, neither shear deformation behavior under triaxial stress condition nor volume deformation behavior by consolidation test almost had a difference, and it was suggested that there were few possibilities that the saline water had serious influence mechanically also about long-term mechanical behavior. (author)
Preliminary analysis for model development of groundwater evolution in Horonobe area
International Nuclear Information System (INIS)
Yoshida, Yasushi; Yui, Mikazu
2003-03-01
The preliminary analysis for model development of groundwater evolution in Horonobe area was performed with data at D-1, HDB-1 and HDB-2 bore hole where hydrogen / oxygen isotope concentration, mineral property in sedimentary rock and physico-chemical parameters (pH, Eh and ionic concentrations) were measured. As a result of analysis for hydrogen and oxygen isotope concentration, saline water in marine sediment was diluted by the mixing with shallow groundwater and diffusion. And as a result of analysis for a concentration of bicarbonate from the difference of pH values measured between in-situ and under air, the estimated in-situ concentration of bicarbonate differs from that measured under air. And minerals which were assumed to be equilibrium with groundwater were selected by thermodynamic calculation. This report presents the results of preliminary analysis for groundwater evolution by using data derived from D-1, HDB-1 and HDB-2 boring research. In order to establish the model which interprets the groundwater evolution as a next step, data which satisfy the representative in-situ property of groundwater chemistry in Horonobe area are needed. Reliable measurements for physico-chemical parameter and property of minerals in sedimentary rock in dominant layer and at the variety of depth are also needed. (author)
bit.ly/malicious: Deep Dive into Short URL based e-Crime Detection
Gupta, Neha; Aggarwal, Anupama; Kumaraguru, Ponnurangam
2014-01-01
Existence of spam URLs over emails and Online Social Media (OSM) has become a massive e-crime. To counter the dissemination of long complex URLs in emails and character limit imposed on various OSM (like Twitter), the concept of URL shortening has gained a lot of traction. URL shorteners take as input a long URL and output a short URL with the same landing page (as in the long URL) in return. With their immense popularity over time, URL shorteners have become a prime target for the attackers ...
International Nuclear Information System (INIS)
Nakayama, Masashi; Sato, Haruo; Sugita, Yutaka; Ito, Seiji; Minamide, Masashi; Kitagawa, Yoshito
2011-01-01
In Japan, any high level radioactive waste (HLW) pos is to be constructed at over 300 m depth below surface. Tunnel support is used for safety during the construction and operation, and shotcrete and concrete lining are used as the tunnel support. Concrete is a composite material comprised of aggregate, cement and various admixtures. Low alkaline cement has been developed for the long term stability of the barrier systems whose performance could be negatively affected by highly alkaline conditions arising due to cement used in a repository. Japan Atomic Energy Agency (JAEA) has developed a low alkaline cement, named as HFSC (Highly Flyash Contained Silicafume Cement), containing over 60wt% of silica-fume (SF) and fly-ash (FA). HFSC was used experimentally as the shotcrete material in construction of part of the 140m deep gallery in the Horonobe Underground Research Laboratory (URL). The objective of this experiment was to assess the performance of HFSC shotcrete in terms of mechanics, workability, durability, and so on. HFSC used in this experiment is composed of 40wt% OPC (Ordinary Portland Cement), 20wt% SF, and 40 wt% FA. This composition was determined based on mechanical testing of various mixes of the above components. Because of the low OPC content, the strength of HFSC tends to be lower than that of OPC. The total length of tunnel using HFSC shotcrete is about 73 m and about 500 m 3 of HESC was used. The workability of HESC shotcrete was confirmed in this experimental construction. (author)
International Nuclear Information System (INIS)
Kurihara, Yuji; Yui, Mikazu; Tanai, Kenji
2004-04-01
Following studies have been done in this papers in order to apply the technologies based on H12 report to the actual geological conditions of Horonobe underground research laboratory. 1) Reconsidering the process of repository design, the design process charts of a repository were presented. In the H12 report, the design process of the engineering barrier system was followed by the facility design process. In this paper, the both processes were placed in parallel position. 2) The relation between geological conditions and the performance of engineering barrier systems and the specifications of engineering barrier systems was arranged and the geological information needed for design of engineering barrier were selected. 3) The appropriate form of geological information as input-data for design were showed and the procedure for setting input-data was presented. 4) Based on the state of geological investigations at Horonobe, mechanical input-data were arranged for the design of the in-situ experiments on engineered barrier system at HORONOBE. 5) The stability of the hall for the in-situ experiments was studied by numerical analysis and the results indicated that there are difference in stability between the depth of 500 m and 570 m. (author)
International Nuclear Information System (INIS)
Kim, Kyung Su; Bae, Dae Seok; Kim, Geon Young
2012-01-01
This report analysed the development status on the SKB's Hard Rock Laboratory and Nagra's Grimsel Test Site facilities to investigate their facility overview, operation system, site condition, project history and procedure, and current experiment programmes of underground research laboratory. SKB and Nagra had launched high level radioactive waste disposal project around 1970's. Actual site investigation activities were initiated since 1990's and the time schedule for siting programmes to determine the final disposal site were taken fifteen to thirty years. Furthermore, ten to twenty years will be needed to site characterization, facility design, construction, and operation commissioning. Nagra had constructed Grimsel Test Site facility in southern Switzerland Apls with the collaboration of KWO electrical company in early 1980's. This facility is characterized of a centre of excellence for underground Research and Development (R and D) to support projects for the disposal of radioactive and chemo-toxic waste and not a potential repository site. The SKB's Aspo HRL constructed in outside Oskarshamn is a unique PBG-URL facility. SKB is conducting full-scale research and development here in preparation for the construction of a final repository for spent nuclear fuel. The research programmes for the development of disposal technologies is performed over thirty to fifty years prior to repository operation. In 2000's, research on long-term phenomena, i.e., optimization of disposal concept, understanding of coupling process, validation of mathematical model, test and development of safety assessment models, characterization of deep geochemical environment, and long-term demonstration experiments have been leading the issues of research and development
A study on groundwater infiltration in the Horonobe area, northern Hokkaido, Japan
International Nuclear Information System (INIS)
Yokota, Hideharu; Yamamoto, Yoichi; Maekawa, Keisuke; Hara, Minoru
2011-01-01
In the Horonobe area of northern Hokkaido, the Japan Atomic Energy Agency has been carrying out various hydrological observations to estimate the recharge rate. Subsurface earth temperature and soil moisture content have been observed at HGW-1 site (GL-0.7m to GL-2.3m, since 2005) and Hokushin Meteorological Station (GL-0.1m to GL-1.1m, since 2008). The results have revealed groundwater infiltration and recharge occurring throughout year, the shallow groundwater-infiltration velocity depending on the depth and the position of the Zero Flux Plane. For the estimation of boundary conditions in groundwater flow simulation, in this study, the shallow groundwater-flow system has been examined qualitatively on the basis of the variation of the subsurface earth temperature and the soil moisture content. In the future, it is necessary to quantitatively assess the shallow groundwater infiltration and recharge rate, the intermediate runoff, and the evapotranspiration based on the observed data of the weighing lysimeter, and the other measurement stations in the area. (author)
International Nuclear Information System (INIS)
Tanai, Kenji; Fujita, Tomoo; Noda, Masaru; Yamamoto, Shuichi; Shimura, Tomoyuki; Sato, Shin
2013-01-01
Japan Atomic Energy Agency has been planning in-situ gas migration test in Horonobe URL, Hokkaido. This paper discusses the optimum gas injection procedure for the test to understand gas migration behaviour in surrounded rock. The stepwise constant gas injection was selected, taking into account domestic and overseas gas related research results. Hydro-mechanical-gas coupling analysis which is able to consider the dissolved methane in Horonobe groundwater was applied to evaluate the gas behaviour. The results have indicated no significant mechanical damages to the rock and have supported the appropriateness of selected gas injection procedure for the test. (author)
Exploring Global Exposure Factors Resources URLs
U.S. Environmental Protection Agency — The dataset is a compilation of hyperlinks (URLs) for resources (databases, compendia, published articles, etc.) useful for exposure assessment specific to consumer...
Study on synthesis of geological environment at Horonobe area. A technical review
International Nuclear Information System (INIS)
Toida, Masaru; Suyama, Yasuhiro; Shiogama, Yukihiro; Atsumi, Hiroyuki; Abe, Yasunori; Furuichi, Mitsuaki
2003-03-01
The objective of the Horonobe Under Ground Research Project includes enhancing reliability of disposal techniques and safety assessment methods which are based on data on deep underground geological environment obtained by surface explorations and models for geological environment developed using those data. In this study, through development of conceptual models of geological environment based on those data, the flows from data collection to modeling, which have been conducted independently for each geological environment of geology/geological structure, hydrogeology, geochemistry of groundwater and rock mechanics, were synthesized, and a systematic approach including processes from investigation of geological environment to its modeling was established, which is expected to ensure objectivity and traceability of the design and safety assessment of a disposal system. This study is also a part of a program that includes an iterative process in which geological models would be developed and revised repeatedly through the Horonobe Under Ground Research Project and development of geological environment investigation techniques. The results of the study are summarized as follows: (1) Models based on current knowledge were developed; conceptual geology/geological structural model, conceptual hydrogeological model, conceptual geochemical model of groundwater, and conceptual rock mechanical model, (2) Information of data flow and interpretation in the modeling process were synthesized into an data flow which includes knowledge on historical geology and palaeogeology in addition to four models shown above in terms of safety assessment, and (3) Based on modeling processes and syntheses of data flow shown above, tasks that should be considered were organized and suggestions of investigation program were provided for the next phase. (author)
International Nuclear Information System (INIS)
Hiraga, Naoto; Ishii, Eiichi
2008-02-01
The following three kinds of analyses were conducted for the 1st phase of the Horonobe Underground Research Laboratory Project. Mineral composition analysis of core sample. Whole rock chemical composition analysis of core sample. Surface gas composition analysis. This document summarizes the results of these analyses. (author)
Gone in Six Characters: Short URLs Considered Harmful for Cloud Services
Georgiev, Martin; Shmatikov, Vitaly
2016-01-01
Modern cloud services are designed to encourage and support collaboration. To help users share links to online documents, maps, etc., several services, including cloud storage providers such as Microsoft OneDrive and mapping services such as Google Maps, directly integrate URL shorteners that convert long, unwieldy URLs into short URLs, consisting of a domain such as 1drv.ms or goo.gl and a short token. In this paper, we demonstrate that the space of 5- and 6-character tokens included in shor...
Horonobe underground research laboratory project investigation report for the 2005 fiscal year
International Nuclear Information System (INIS)
Matsui, Hiroya; Niizato, Tadafumi; Yamaguchi, Takehiro
2006-11-01
The investigations in 2005 fiscal year (2005/2006) were focused on the Hokushin area, which was selected as the area for laboratory construction. The main investigation region extends over approximately 3 km x 3 km. Geophysical, geological and surface hydrogeological investigations are carried out to acquire the geoscientific data needed to develop techniques for investigating the geological environment. And the borehole investigation at HDB-11 was finished in 2005. About development of techniques for long-term monitoring of the geological environment, long-term monitoring systems were operative in boreholes drilled in a previous investigation, and were also installed in the remaining boreholes (HDB-9, 10; drilled in 2004). A remotely operated monitoring system (ACROSS) was also installed and tested. About study on long-term stability of the geological environment, for tracing tectonic changes at Horonobe, geological survey and ground penetrating radar were carried out. Observations using seismograph, global positioning system (GPS) and electromagnetic exploration system installed until 2006 were continuing. About improving the reliability of disposal technology, laboratory tests of low alkaline concrete, shotcrete test at full-size simulated tunnel were carried out. Applicability confirmation of EBS designing methods was carried out with geological environmental data of Phase 1. About sophistication of safety assessment methodologies, Sorption test using drill core was carried out. Solute transport analysis was also carried out. In parallel with these investigations, Phase 2 investigation program were planned. About surface facility, Research and Administration Facility and Test Facility were constructed and started to use since February 2006. Public information house was begun to construct. About underground facility, temporary surplus soil (muck) yard was constructed. Surplus soil yard and drainage line were designed. These caused by toxic substance founded in
International Nuclear Information System (INIS)
Tokiwa, Tetsuya; Niizato, Tadafumi; Nohara, Tsuyoshi; Asamori, Koichi; Matsuura, Yuki; Kosaka, Hideki
2011-01-01
In this study, we present the preliminary results for the estimation of a horizontal crustal movement by using geodetic and geological approach in the Horonobe area, northern Hokkaido, Japan. The estimations have been carried out by using a GPS data and a geological cross section obtained by applying balanced-section method. As results of this study, both of the shortening rates estimated by GPS data and balanced-section method indicate several millimeters per year. Namely, there is no contradiction between geodetic and geological data, and it is considered that Horonobe area is still situated similar tendency and magnitude of a crustal movement. It is seemingly considered that geodetic data is unhelpful for estimating the long-term crustal movement, because period of geodetic observations is a very short. However, the result of this study indicates that geodetic data provide valuable information for estimating the long-term crustal movement in the area, and it is considered that geodetic approach play an important role in improvement of the credibility of evaluation for prediction of long-term stability. (author)
International Nuclear Information System (INIS)
Fujita, Tomoo; Taniguchi, Naoki; Maekawa, Keisuke; Sawada, Atsushi; Makino, Hitoshi; Sasamoto, Hiroshi; Yoshikawa, Hideki; Shibata, Masahiro; Ota, Kunio; Miyahara, Kaname; Naito, Morimasa; Yui, Mikazu; Matsui, Hiroya; Hama, Katsuhiro; Kunimaru, Takanori; Takeuchi, Ryuji; Tanai, Kenji; Kurikami, Hiroshi; Wakasugi, Keiichiro; Ishii, Eiichi
2011-03-01
This report summarizes the progress of research and development on geological disposal during the surface-based investigation phase (2001-2005) in the Horonobe Underground Research Laboratory project, of which aims are to apply the design methods of geological disposal and mass transport analysis to actual geological conditions obtained from the project as an example of actual geological environment. For the first aim, the design methods for the geological disposal facility proposed in 'H12 report (the second progress report)' was reviewed and then improved based on the recent knowledge. The applicability of design for engineered barrier system, backfill of disposal tunnel, underground facility was illustrated. For the second aim, the conceptual structure from site investigation and evaluation to mass transport analysis was developed as a work flow at first. Then following this work flow a series of procedures for mass transport analysis was applied to the actual geological conditions to illustrate the practical workability of the work flow and the applicability of this methodology. Consequently, based on the results, future subjects were derived. (author)
International Nuclear Information System (INIS)
Fujita, Tomoo; Taniguchi, Naoki; Tanai, Kenji; Nishimura, Mayuka; Kobayashi, Yasushi; Hiramoto, Masayuki; Maekawa, Keisuke; Sawada, Atsushi; Makino, Hitoshi; Sasamoto, Hiroshi; Yoshikawa, Hideki; Shibata, Masahiro; Wakasugi, Keiichiro; Nakano, Katsushi; Seo, Toshihiro; Miyahara, Kaname; Naito, Morimasa; Yui, Mikazu; Matsui, Hiroya; Kurikami, Hiroshi; Kunimaru, Takanori; Ishii, Eiichi; Ota, Kunio; Hama, Katsuhiro; Takeuchi, Ryuji
2007-03-01
This report summarizes the progress of research and development on geological disposal during the surface-based investigation phase (2001-2005) in the Horonobe Underground Research Laboratory project (HOR), of which aims are to apply the design methods of geological disposal and mass transport analysis to actual geological conditions obtained from the surface-based investigations in HOR as an example of actual geological environment. For the first aim, the design methods for the geological disposal facility proposed in 'H12 report (the second progress report)' was reviewed and then improved based on the recent knowledge. The applicability of design for engineered barrier system, backfill of disposal tunnel, underground facility was illustrated. For the second aim, the conceptual structure from site investigation and evaluation to mass transport analysis was developed as a work flow at first. Then following this work flow a series of procedures for mass transport analysis was applied to the actual geological conditions to illustrate the practical workability of the work flow and the applicability of this methodology. Consequently, based on the results, future subjects were derived. (author)
New Searching Capability and OpenURL Linking in the ADS
Eichhorn, Guenther; Accomazzi, A.; Grant, C. S.; Henneken, E.; Kurtz, M. J.; Thompson, D. M.; Murray, S. S.
2006-12-01
The ADS is the search system of choice for the astronomical community. It also covers a large part of the physics and physics/astronomy education literature. In order to make access to this system as easy as possible, we developed a Google-like interface version of our search form. This one-field search parses the user input and automatically detects author names and year ranges. Firefox users can set up their browser to have this search field installed in the top right corner search field to have even easier access to the ADS search capability. The basic search is available from the ADS Homepage at: http://adsabs.harvard.edu To aid with access to subscription journals the ADS now supports OpenURL linking. If your library supports an OpenURL server, you can specify this server in the ADS preference settings. All links to journal articles will then automatically be directed to the OpenURL with the appropriate link information. We provide a selection of known OpenURL servers to choose from. If your server is not in this list, please send the necessary information to ads@cfa.harvard.edu and we will include it in our list. The ADS is funded by NASA grant NNG06GG68G.
Directory of Open Access Journals (Sweden)
Ju Wang
2018-06-01
Full Text Available With the rapid development of nuclear power in China, the disposal of high-level radioactive waste (HLW has become an important issue for nuclear safety and environmental protection. Deep geological disposal is internationally accepted as a feasible and safe way to dispose of HLW, and underground research laboratories (URLs play an important and multi-faceted role in the development of HLW repositories. This paper introduces the overall planning and the latest progress for China's URL. On the basis of the proposed strategy to build an area-specific URL in combination with a comprehensive evaluation of the site selection results obtained during the last 33 years, the Xinchang site in the Beishan area, located in Gansu Province of northwestern China, has been selected as the final site for China's first URL built in granite. In the process of characterizing the Xinchang URL site, a series of investigations, including borehole drilling, geological mapping, geophysical surveying, hydraulic testing and in situ stress measurements, has been conducted. The investigation results indicate that the geological, hydrogeological, engineering geological and geochemical conditions of the Xinchang site are very suitable for URL construction. Meanwhile, to validate and develop construction technologies for the Beishan URL, the Beishan exploration tunnel (BET, which is a 50-m-deep facility in the Jiujing sub-area, has been constructed and several in situ tests, such as drill-and-blast tests, characterization of the excavation damaged zone (EDZ, and long-term deformation monitoring of surrounding rocks, have been performed in the BET. The methodologies and technologies established in the BET will serve for URL construction. According to the achievements of the characterization of the URL site, a preliminary design of the URL with a maximum depth of 560 m is proposed and necessary in situ tests in the URL are planned. Keywords: Beishan, Xinchang site, Granite
International Nuclear Information System (INIS)
Hara, Akio; Tsuji, Takashi; Nishimura, Mizue
2005-01-01
Borehole log interpretation methods, which are usually used by petroleum exploration companies, are applied for evaluating heterogeneity of deep underground diatomaceous mudstones in the Horonobe area. Natural gamma ray log and electrical micro image (EMI) log data were used for the log interpretation. Five sedimentary facies, A to E, were established from the EMI log interpretation. Significant correlations between the sedimentary facies, the chemical contents, the natural gamma ray level, and the electric conductivity in the diatomaceous mudstone were seen. Spatial distribution of the diatomaceous mudstone, in lithology and thickness, was recognized through borehole correlation, which seems to reflect the sedimentary environment change. (author)
International Nuclear Information System (INIS)
Osawa, Hideaki; Umeki, Hiroyuki; Ota, Kunio; Maekawa, Keisuke; Kunimaru, Takanori; Niizato, Tadafumi; Asamori, Koichi; Yamanaka, Yoshiaki; Shigehiro, Michiko; Abe, Hironobu; Hama, Katsuhiro; Takeuchi, Shinji; Amano, Kenji; Saegusa, Hiromitsu; Matsukawa, Toshiyuki; Miyamoto, Tetsuo; Toyoda, Gakuji; Sawada, Atsushi; Shimada, Akiomi
2008-11-01
This project is planned as a five-year program aiming to develop an advanced integration technology for characterization of a site for radioactive waste geological disposal. It is carried out by the Geological Isolation Research and Development Directorate of Japan Atomic Energy Agency with the fund of Agency for Natural Resources and Energy of the Ministry of Economy, Trade and Industry. This report summarizes the outcome of the first year (FY 2007) activities of the project. The site characterization is a dynamic and complex process and needs close linkage with repository design and performance assessment (PA). A geosynthesis methodology has been developed for integrating site characterization information into design and PA, and applied for e.g. on-going JAEA's studies at two generic URLs at Mizunami and Horonobe. This methodology explicitly presents an information flow (often referred to as geosynthesis data flow diagram or data flow diagram, in short) from measurements by site investigation to generating data sets for design and PA. It is a useful tool for guiding the site characterization in a transparent and traceable manner. As site investigation proceeds and information being obtained on geological environments of the site increases, the site characterization plan is iteratively reviewed and modified reflecting the updated information. Such modification would also be needed when changes would occur on socio-political boundary conditions. In fact, the data flow diagrams for two generic URL projects have been revised several times so far due to the increase in the amount of information on geological environments and changes of societal conditions. An advanced technology aimed at in this project is therefore focused on developing flexible approach and tools, which is named as Information Synthesis and Interpretation System (ISIS), to support the stepwise 'optimization' of the site characterization plan. In FY 2007, a basic concept for ISIS has been developed
International Nuclear Information System (INIS)
Ivanovich, M.; Longworth, G.; Wilkins, M.A.; Hasler, S.E.
1987-12-01
Uranium series disequilibrium measurements of actinide activities and activity ratios have been used to study the geochemical history of Lac du Bonnet granite, from the URL site, Pinawa, Canada. Measurements on core profiles between fractured surfaces and the parent rock show that the granite underwent high temperature events several million years ago, followed by more recent low temperature events within the last million years. The main locations for the rock/water interaction and exchange of actinides are the fracture surfaces. The results of similar measurements on separated mineral phases show that the 'soft' minerals such as biotite and feldspar are more vulnerable to weathering than the 'hard' accessory minerals such as zircon. (author)
Constructing Uniform Resource Locators (URLs) for Searching the Marine Realms Information Bank
Linck, Guthrie A.; Allwardt, Alan O.; Lightsom, Frances L.
2009-01-01
The Marine Realms Information Bank (MRIB) is a digital library that provides access to free online scientific information about the oceans and coastal regions. To search its collection, MRIB uses a Common Gateway Interface (CGI) program, which allows automated search requests using Uniform Resource Locators (URLs). This document provides an overview of how to construct URLs to execute MRIB queries. The parameters listed allow detailed control of which records are retrieved, how they are returned, and how their display is formatted.
A Comprehensive Study of Features and Algorithms for URL-Based Topic Classification
Weber, I; Henzinger, M; Baykan, E
2011-01-01
Given only the URL of a Web page, can we identify its topic? We study this problem in detail by exploring a large number of different feature sets and algorithms on several datasets. We also show that the inherent overlap between topics and the sparsity of the information in URLs makes this a very challenging problem. Web page classification without a page's content is desirable when the content is not available at all, when a classification is needed before obtaining the content, or when classification speed is of utmost importance. For our experiments we used five different corpora comprising a total of about 3 million (URL, classification) pairs. We evaluated several techniques for feature generation and classification algorithms. The individual binary classifiers were then combined via boosting into metabinary classifiers. We achieve typical F-measure values between 80 and 85, and a typical precision of around 86. The precision can be pushed further over 90 while maintaining a typical level of recall betw...
Natural analogue study on trace element migration in geological formation at Horonobe area, Japan
International Nuclear Information System (INIS)
Iwatsuki, Teruki; Ishii, Eiichi; Mizuno, Takashi; Honda, T.
2010-01-01
Usefulness of natural analog to study radionuclide transport models for deep geological repositories for high-level and long lived radioactive wastes is widely recognized. As the groundwater flow in the Horonobe area, Hokkaido, Japan is known to be stationary with neutral pH value and of reductive nature for a long-term, the authors began natural analog study by observing atomic distribution of such trace elements as rare earths, uranium, and thorium in carbonate nodules and veins of uranium minerals from several selected faults (Wakkanai F., Ketoi F., etc) in the area with the use of XED, XRF, and ICP-MS. The results give important information as to the maintainability of the rocks for trace elements and help to provide confidence in the safety assessment in the long term. (S. Ohno)
Microbiological influences on fracture surfaces of intact mud-stone
International Nuclear Information System (INIS)
West, J.M.; Harrison, H.; Wragg, J.; Wagner, D.; Milodowski, A.E.; Turner, G.; Lacinska, A.; Holyoake, S.; Harrington, J.; Coombs, P.; Bateman, K.; Yoshikawa, H.; Sasaki, Y.; Aoki, K.
2012-01-01
Document available in extended abstract form only. It is well recognised that microbes live in a wide range of subsurface environments including potential geological repository host rocks; and their presence can have an impact on transport processes. Microbial activity in any environment is located on chemical or physical interfaces, usually within bio-films. Their impact on transport can be physical (e.g. altering porosity) and/or chemical (e.g. changing redox conditions or altering pH) often resulting in intracellular or extracellular mineral formation or degradation. Consequently, the significance of microbial activity on the transport properties of potential host rocks for geological repositories is now being investigated. This pilot study investigates changes in transport properties that are because of microbial activity in sedimentary mud-stone rock environments at the Japan Atomic Energy Agency (JAEA) Horonobe underground research laboratory (URL) in northern Japan. The geological setting of the URL is summarised elsewhere. Geo-microbiological assessments of ground waters, from boreholes, previously drilled at Horonobe, have revealed the presence of a diverse indigenous microbiological ecosystem. The impacts of the presence of these microbes on the performance of a high-level radioactive waste (HLW) repository, using geo-microbiological data from Horonobe, has shown that denitrifying bacteria is likely to be the group of organisms with the greatest activity. Consequently, the impact of this group of organisms, specifically Pseudomonas denitrificans, on Horonobe rock transport properties, is the focus of this study. In brief, two experiments, one biotic and a 'control', were carried out using a flow-through column operated at a constant rate of fluid flow and under pressurised conditions. Changes in biological and chemical parameters were monitored throughout the experiment together with changes in confining pressure and temperature. The experiments were
The large scale in-situ PRACLAY heater and seal tests in URL HADES, Mol, Belgium
Energy Technology Data Exchange (ETDEWEB)
Xiangling Li; Guangjing Chen; Verstricht, Jan; Van Marcke, Philippe; Troullinos, Ioannis [ESV EURIDICE, Mol (Belgium)
2013-07-01
In Belgium, the URL HADES was constructed in the Boom Clay formation at the Mol site to investigate the feasibility of geological disposal in a clay formation. Since 1995, the URL R and D programme has focused on large scale demonstration tests like the PRACLAY Heater and Seal tests. The main objective of the Heater Test is to demonstrate that the thermal load generated by the heat-emitting waste will not jeopardise the safety functions of the host rock. The primary objective of the Seal Test is to provide suitable hydraulic boundary conditions for the Heater Test. The Seal Test also provides an opportunity to investigate the in-situ behaviour of a bentonite-based EBS. The PRACLAY gallery was constructed in 2007 and the hydraulic seal was installed in 2010. The bentonite is hydrated both naturally and artificially. The swelling, total pressure and pore pressure of the bentonite are continuously measured and analysed by numerical simulations to get a better understanding of this hydration processes. The timing of switching on the heater depends on the progress of the bentonite hydration, as a sufficient seal swelling is needed to fulfill its role. A set of conditions to be met for the heater switch-on and its schedule will be given. (authors)
Directory of Open Access Journals (Sweden)
Parisa Allami
2012-12-01
Full Text Available When the World Wide Web provides suitable methods for producing and publishing information to scientists, the Web has become a mediator to publishing information. This environment has been formed billions of web pages that each of them has a special title, special content, special address and special purpose. Search engines provide a variety of facilities limit search results to raise the possibility of relevance in the retrieval results. One of these facilities is the limitation of the keywords and search terms to the title or URL. It can increase the possibility of results relevance significantly. Search engines claim what are limited to title and URL is most relevant. This research tried to compare the results relevant between results limited in title and URL in agricultural and Humanities areas from their users sights also it notice to Comparison of the presence of keywords in the title and URL between two areas and the relationship between search query numbers and matching keywords in title and their URLs. For this purpose, the number of 30 students in each area whom were in MA process and in doing their thesis was chosen. There was a significant relevant of the results that they limited their information needs to title and URL. There was significantly relevance in URL results in agricultural area, but there was not any significant difference between title and URL results in the humanities. For comparing the number of keywords in title and URL in two areas, 30 keywords in each area were chosen. There was not any significantly difference between the number of keywords in the title and URL of websites in two areas. To show relationship between number of search keyword and the matching of title and URL 45 keywords in each area were chosen. They were divided to three parts (one keyword, two keywords and three keywords. It was determined that if search keyword was less, the amount of matching between title and URL was more and if the matching
International Nuclear Information System (INIS)
Yamamoto, Hajime; Shimo, Michito; Kunimaru, Takanori; Kurikami, Hiroshi
2007-01-01
In Neogene-Quaternary sedimentary basins, natural gases such as methane are often dissolved in groundwater significantly. In this paper, two-phase flow simulations incorporating the degassing of methane, and carbon dioxide, were performed for the shaft excavation in Horonobe underground research project. The results drawn from the simulations are summarized as follows. 1) As depth increases, degassing and gas inflow occurs significantly. 2) Degassing increases the compressibility of pore fluids, resulting in slow changes in groundwater pressures. 3) Although the occurrence of gas phase decreases water mobility, the influence of the dissolved gas on the groundwater inflow rate to the shaft was small. (author)
SiteGuide: An example-based approach to web site development assistance
Hollink, V.; de Boer, V.; van Someren, M.; Filipe, J.; Cordeiro, J.
2009-01-01
We present ‘SiteGuide’, a tool that helps web designers to decide which information will be included in a new web site and how the information will be organized. SiteGuide takes as input URLs of web sites from the same domain as the site the user wants to create. It automatically searches the pages
Experimental concept for a ventilation experiment at the URL
International Nuclear Information System (INIS)
Cruchaudet, M.; Noiret, A.; Armand, G.; Tabani, P.
2010-01-01
Document available in extended abstract form only. Full text follows: A ventilation experiment, named SDZ, is currently running at the Meuse/Haute-Marne URL. The first aim of this experiment is to evaluate the hydro-mechanical effects of the desaturation of the rock around a drift, generated by the ventilation. The second purpose of this experiment is to monitor hydraulic and mechanical parameters around a drift during re-saturation phases. The ventilation experiment is settled in a dedicated zone of the URL at an end of a drift called GED (second experimental drift). This zone is entirely isolated from the rest of the drifts by an airlock. The experimental zone is 12 m long and 4.4 m in diameter. The main experimental zone is 7.2 m long. In this zone, there is no concrete on the rock. The rest of the zone corresponds to a quenched zone in order to act as a buffer zone with the end of the drift. A dedicated ventilation system is used to keep constant during each step of the experiment the flow, the hygrometry and the temperature of the air circulating in the experimental zone. A full network of sensors is present both in the rock (pressure and saturation measurements, extensometers) and in the drift (temperature, hygrometry and flow measurements, monitoring of fracture extension of the drift's wall, convergence measurements). In details, this network consists of 50 mechanical measurements, 53 hydraulic measurements and 48 climatic measurements. At first, the hygrometry in the zone will be kept constant at 20% for a temperature of around 23 deg. C (which corresponds to the temperature of the rock at the location of the experimental zone) for several months until pressure and saturation profile around the zone stabilize. This step correspond to the desaturation phase of the experiment. Then the hygrometry of the air injected the zone will be increased first at 50% for several months and finally at 80%, corresponding to the re-saturation phases for the experiment
White, Joshua S.; Matthews, Jeanna N.; Stacy, John L.
2012-06-01
Phishing website analysis is largely still a time-consuming manual process of discovering potential phishing sites, verifying if suspicious sites truly are malicious spoofs and if so, distributing their URLs to the appropriate blacklisting services. Attackers increasingly use sophisticated systems for bringing phishing sites up and down rapidly at new locations, making automated response essential. In this paper, we present a method for rapid, automated detection and analysis of phishing websites. Our method relies on near real-time gathering and analysis of URLs posted on social media sites. We fetch the pages pointed to by each URL and characterize each page with a set of easily computed values such as number of images and links. We also capture a screen-shot of the rendered page image, compute a hash of the image and use the Hamming distance between these image hashes as a form of visual comparison. We provide initial results demonstrate the feasibility of our techniques by comparing legitimate sites to known fraudulent versions from Phishtank.com, by actively introducing a series of minor changes to a phishing toolkit captured in a local honeypot and by performing some initial analysis on a set of over 2.8 million URLs posted to Twitter over a 4 days in August 2011. We discuss the issues encountered during our testing such as resolvability and legitimacy of URL's posted on Twitter, the data sets used, the characteristics of the phishing sites we discovered, and our plans for future work.
International Nuclear Information System (INIS)
Niizato, T.; Yasue, K.I.; Kurikami, H.
2009-01-01
In order to assess the long-term stability of the geological environments for over several hundred thousand years, it is important to consider the influence of natural events and processes, such as uplift, subsidence, denudation and climate change, on the geological environments, especially in an active region such as Japan. This study presents a conceptual model related to the future natural events and processes which have potential impacts on the groundwater flow conditions in the Horonobe area, Hokkaido, northern Japan on the basis of the neo-tectonics, palaeogeography, palaeo-climate, historical development of landform, and present state of groundwater flow conditions. We conclude that it is important to consider interactions among natural events and processes on the describing of the best-possible approximation of the time-variation of geological environment. (authors)
International Nuclear Information System (INIS)
Yabuuchi, Satoshi; Kunimaru, Takanori; Ishii, Eiichi; Hatsuyama, Yoshihiro; Ijiri, Yuji; Matsuoka, Kiyoyuki; Ibara, Tetsuo; Matsunami, Shinjiro; Makino, Akiya
2009-02-01
The Pilot Borehole Investigation of the Ventilation Shaft was conducted in Horonobe, Hokkaido, Japan from October 2007 to March 2008. Main purpose of the investigation is to understand geological, hydrogeological and hydrochemical properties of the formation where the Ventilation Shaft has been excavated. Hydraulic packer tests show that hydraulic conductivity lies in the range from 1.1E-11 to 1.4E-7 m/sec down to 500m in depth. This heterogeneity mainly depends on the distribution and permeability of groundwater inflow points, which were detected by Fluid Electric Conductivity logging. High conductive zones were found between 263m and 290m, 355m and 370m of the depth in the pilot borehole. An effective method for reducing groundwater inflow should be considered for the deeper Ventilation Shaft excavation. (author)
International Nuclear Information System (INIS)
2005-06-01
Horonobe Underground Research Laboratory Project is planned for over 20 years to establish the scientific and technical basis for the underground disposal of high-level radioactive wastes in Japan. The investigations are conducted by JNC in three phases, from the surface (Phase I), during the construction of the underground facilities (Phase II), and using the facilities (Phase III). This report concerns the investigation plans for Phase II. During excavation of shafts and drifts, detailed geological and borehole investigation will be conducted and the geological model constructed in Phase I is evaluated and revised by newly acquired data of geophysical and geological environment. Detailed in-situ experiments, as well as the effects of shaft excavation, are also done to study long-term changes, rock properties, groundwater flow and chemistry to ensure the reliability of repository technology and establish safety assessment methodology. (S. Ohno)
International Nuclear Information System (INIS)
Ishii, Eiichi; Yasue, Ken-ichi; Tsukuwi, Routa; Tanaka, Takenobu; Matsuo, Koichi; Sugiyama, Kazutoshi; Matsuo, Shigeaki
2006-01-01
We investigated the geological structure and hydrogeological properties of the Omagari Fault in Neogene siliceous sedimentary rocks of the Horonobe area, northern Hokkaido, by geological mapping, borehole investigations, reflection seismic survey, and audio-frequency magnetotelluric survey. As a result of the investigation, the 3-D distribution of the Fault was clarified and the following were shown. In addition, the magnetotelluric survey in particular was effective for mapping of the 3-D distribution and hydrogeological properties of the fault. The Omagari Fault has a fault zone, about 120 m wide, that consists mainly of the damage zone, and has a permeable structure. The magnetotelluric survey shows several high-resistivity zones, one of which corresponds to the Omagari Fault inferred from the reflection seismic surveys. The high resistivity zones are correlative with the concentration zones of low-saline water, which suggests infiltration of ground water through the permeable Omagari Fault zone. The Omagari Fault over-steps at the earth surface and at the same time is converging in subsurface zones. (author)
International Nuclear Information System (INIS)
Tsusaka, Kimikazu; Tokiwa, Tetsuya; Inagaki, Daisuke; Hatsuyama, Yoshihiro; Koike, Masashi; Ijiri, Yuji
2012-01-01
Japan Atomic Energy Agency has been excavating three deep shafts through soft sedimentary rock in the Horonobe Underground Research Laboratory. In this paper, the authors discussed rock mass behaviour induced by a 6.5 m diameter shaft sinking. They conducted geological mapping in an excavation face and boreholes digged around the shaft wall, field measurements such as convergence measurements and monitoring of rock displacements using multi-interval borehole extensometers around a shaft at around 160 m and 220 m in depths, and three-dimensional numerical analysis which models the shaft excavation procedure such as timing of installation of support elements and setting and removal of a concrete form. As a result, it was clarified that remarkably large compressive strains occurred within about 1 m into the shaft wall in a radial direction since the rock mass behaviour was controlled by the concrete lining and that the behaviour would predominantly be induced by the fractures closing which opened significantly and propagated during excavation steps before the installation of a concrete lining and the directions where the strains occurred heavily depended on the fracture orientation around the shaft. (author)
The full-scale Emplacement (FE) Experiment at the Mont Terri URL
International Nuclear Information System (INIS)
Mueller, H.R.; Weber, H.P.; Koehler, S.; Vogt, T.; Vietor, T.
2012-01-01
Document available in extended abstract form only. The Full-Scale Emplacement (FE) Experiment at the Mont Terri underground research laboratory (URL) is a full-scale heater test in a clay-rich formation. It simulates the construction, waste emplacement and backfilling of a spent fuel (SF) / vitrified high-level waste (HLW) repository tunnel as realistically as possible. The entire experiment implementation as well as the post-closure THM(C) evolution will be monitored using several hundred sensors. These are distributed in the host rock in the near- and far-field, the tunnel lining, the engineered barrier system and on the heaters. The aim of this experiment is to investigate HLW repository-induced thermo-hydro-mechanical (THM) coupled effects on the host rock and the validation of existing coupled THM models. A further aim is the verification of the technical feasibility of constructing a 50 m repository section at full scale with all relevant components using standard industrial equipment. Finally, the experiment will demonstrate the canister and buffer emplacement procedures for underground conditions based on the Swiss disposal concept. Experimental layout The FE experiment is based on the Swiss disposal concept for SF / HLW. The 50 m long test gallery, at the end of the former MB test tunnel in the Mont Terri URL, will be realised with a diameter of approx. 3 m. In the experiment gallery, 3 heaters with dimensions similar to those of waste canisters will be emplaced on top of abutments built of bentonite blocks. The remaining space will be backfilled with compacted bentonite pellets. The experiment will be sealed off towards the start niche with a concrete plug holding the buffer in place and reducing air and water fluxes. The first scoping calculations and design modelling for the 'far-field' instrumentation have been completed; these works have been carried out using CodeBRIGHT and the multiphase flow simulator TOUGH2. With an initial heat output of 1500 W
HA Cells monitoring at the Underground Research Laboratory (URL) in the CMHM (Andra)
International Nuclear Information System (INIS)
Gay, Olivier; Allagnat, Dominique; Morel, Jacques; Armand, Gilles
2010-01-01
The experimental monitoring program of the HA (High Activity) cells was carried out at the Underground Research Laboratory (URL) in the Meuse Haute Marne department in France (CMHM Andra). Inspections made by video and photographs, section measurements and geo-referenced trajectories, in addition to measurements of convergence, temperature and hygrometry over time, allowed a better analysis of the behaviour of the HA cells after excavation, and subsequently over the long term. (authors)
Habibzadeh, P
2013-01-01
Over the last decade, Web sites (URLs) have been increasingly cited in scientific articles. However, the contents of the page of interest may change over the time. To investigate the trend of citation to URLs in five general medical journals since January 2006 to June 2013 and to compare the trends in mainstream journals with small journals. References of all original articles and review articles published between January 2006 and June 2013 in three regional journals - Archives of Iranian Medicine (AIM), Eastern Mediterranean Health Journal (EMHJ), and Journal of Postgraduate Medical Institute (JPMI) - and two mainstream journals - The Lancet and British Medical Journal (BMJ) - were reviewed. The references were checked to determine the frequency of citation to URLs as well as the rate of accessibility of the URLs cited. A total of 2822 articles was studied. Since January 2006 onward, the number of citations to URLs increased in the journals (doubling time ranged from 4.2 years in EMHJ to 13.9 years in AIM). Overall, the percentage of articles citing at least one URL has increased from 24% in 2006 to 48.5% in 2013. Accessibility to URLs decayed as the references got old (half life ranged from 2.2 years in EMHJ to 5.3 years in BMJ). The ratio of citation to URLs in the studied mainstream journals, as well as the ratio of URLs accessible were significantly (pjournals. URLs are increasingly cited, but their contents decay with time. The trend of citing and decaying URLs are different in mainstream journals compared to small medical journals. Decay of URL contents would jeopardize the accuracy of the references and thus, the body of evidence. One way to tackle this important obstacle is to archive URLs permanently.
Sentiment Analysis of Web Sites Related to Vaginal Mesh Use in Pelvic Reconstructive Surgery.
Hobson, Deslyn T G; Meriwether, Kate V; Francis, Sean L; Kinman, Casey L; Stewart, J Ryan
2018-05-02
The purpose of this study was to utilize sentiment analysis to describe online opinions toward vaginal mesh. We hypothesized that sentiment in legal Web sites would be more negative than that in medical and reference Web sites. We generated a list of relevant key words related to vaginal mesh and searched Web sites using the Google search engine. Each unique uniform resource locator (URL) was sorted into 1 of 6 categories: "medical", "legal", "news/media", "patient generated", "reference", or "unrelated". Sentiment of relevant Web sites, the primary outcome, was scored on a scale of -1 to +1, and mean sentiment was compared across all categories using 1-way analysis of variance. Tukey test evaluated differences between category pairs. Google searches of 464 unique key words resulted in 11,405 URLs. Sentiment analysis was performed on 8029 relevant URLs (3472 legal, 1625 "medical", 1774 "reference", 666 "news media", 492 "patient generated"). The mean sentiment for all relevant Web sites was +0.01 ± 0.16; analysis of variance revealed significant differences between categories (P Web sites categorized as "legal" and "news/media" had a slightly negative mean sentiment, whereas those categorized as "medical," "reference," and "patient generated" had slightly positive mean sentiments. Tukey test showed differences between all category pairs except the "medical" versus "reference" in comparison with the largest mean difference (-0.13) seen in the "legal" versus "reference" comparison. Web sites related to vaginal mesh have an overall mean neutral sentiment, and Web sites categorized as "medical," "reference," and "patient generated" have significantly higher sentiment scores than related Web sites in "legal" and "news/media" categories.
Nagaraja, Aragudige; Joseph, Shine A.; Polen, Hyla H.; Clauson, Kevin A.
2011-01-01
Purpose: The aim of this paper is to assess and catalogue the magnitude of URL attrition in a high-impact, open access (OA) general medical journal. Design/methodology/approach: All "Public Library of Science Medicine (PLoS Medicine)" articles for 2005-2007 were evaluated and the following items were assessed: number of entries per issue; type of…
What We've Learned From Doing Usability Testing on OpenURL Resolvers and Federated Search Engines
Cervone, Frank
2005-01-01
OpenURL resolvers and federated search engines are important new services in the library field. For some librarians, these services may seem "old hat" by now, but for the majority these services are still in the early stages of implementation or planning. In many cases, these two services are offered as a seamlessly integrated whole.…
International Nuclear Information System (INIS)
Nakayama, Masashi; Kobayashi, Yasushi; Matsuda, Takeshi; Noda, Masaru; Iriya, Keishiro; Takeda, Nobufumi
2009-11-01
In Horonobe Underground Research Center construction of underground facility began in 2005 and a construction practicality test with HFSC (Highly Fly-ash contained Silica-fume Cement) is planned in a part of the gallery. Before the HFSC is used as a tunnel support in the gallery, it is necessary to validate that the HFSC is valid under the actual construction condition. The research results in the FY 2007 are as follows. For evaluating corrosion behavior in the HFSC and the durability of the HFSC, reinforced concrete specimen with HFSC 226 have been exposed to off-shore condition in saline water and splashed zone for 6 years and analyzed the corrosion rate and the amount of chloride intrusion. The durability of the HFSC reinforced concrete was assessed to be more than 50 years until cracking due to corrosion is generated. The pH measurements and the analysis of the chemical composition of solid and liquid phase in the HFSC cocrete-water immersion experiments, which were started in the FY 2002, were carried out. Also for the experiments of cement paste for shotcreting, which were started in the FY 2005, were analyzed. Furthermore, results and findings obtained in earlier studies including this study were summarized, and based on those, method of quality control including test method, frequency, standards etc. was suggested. (author)
International Nuclear Information System (INIS)
Tsusaka, Kimikazu; Inagaki, Daisuke; Nago, Makito; Koike, Masashi; Matsubara, Makoto; Sugawara, Kentaro
2013-01-01
A shaft is the shortest way to access the deep underground. In shaft sinking through large-scale faults or under low competence factor, spalling of shaft walls is likely to occur. Although earlier studies indicated that rock spalling is an undesirable phenomenon that threatens safety in excavation work and causes delay in construction schedule, there have been few studies which discussed damage to concrete lining induced by spalling. Japan Atomic Energy Agency has been constructing three shafts (one for ventilation and the others for access) to a depth of 500 m in the Horonobe Underground Research Laboratory. During the construction of the Ventilation Shaft (4.5 m diameter) below a depth of 250 m, rock spalling occurred at several depths and an open crack developed in the concrete lining installed just above the location of the rock spalling. In this study, the geometry of the shaft wall was measured using a three-dimensional laser scanner. Numerical analysis was also conducted to estimate changes in stress distribution and deformation induced by rock spalling in both the concrete lining and the surrounding rock. As a result, it was clarified that rock spalling induced a vertical tensile stress in the concrete lining. Especially, the tensile stress in a concrete lining was likely to exceed the tensile strength of the concrete lining when it developed more than 100 cm into the wall rock. (author)
International Nuclear Information System (INIS)
Aoyagi, Kazuhei; Ishii, Eiichi; Ishida, Tsuyoshi
2017-01-01
In the construction of a deep underground facility, the hydromechanical properties of the rock mass around an underground opening are changed significantly due to stress redistribution. This zone is called an excavation damaged zone (EDZ). In high-level radioactive waste disposal, EDZs can provide a shortcut for the escape of radionuclides to the surface environment. Therefore, it is important to develop a method for predicting the detailed characteristics of EDZs. For prediction of the EDZ in the Horonobe Underground Research Laboratory of Japan, we conducted borehole televiewer surveys, rock core analyses, and repeated hydraulic conductivity measurements. We observed that niche excavation resulted in the formation of extension fractures within 0.2 to 1.0 m into the niche wall, i.e., the extent of the EDZ is within 0.2 to 1.0 m into the niche wall. These results are largely consistent with the results of a finite element analysis implemented with the failure criteria considering failure mode. The hydraulic conductivity in the EDZ was increased by 3 to 5 orders of magnitude compared with the outer zone. The hydraulic conductivity in and around the EDZ has not changed significantly in the two years following excavation of the niche. These results show that short-term unloading due to excavation of the niche created a highly permeable EDZ. (author)
Geological disposal of high-level radioactive waste and the role of rock engineering
International Nuclear Information System (INIS)
Sugihara, Kozo
2008-01-01
Japan Atomic Energy Agency (JAEA) and its predecessors have been conducting an extensive geoscientific research program since the 1970's in order to contribute to the formation of a firm scientific and technological basis for the geological disposal of high level radioactive waste in Japan. As a part of this program, in situ experiments have been performed at the Tono Mine in soft sedimentary rocks and at the Kamaishi Mine in hard crystalline rocks. An experiment on excavation disturbance has been one of these experiments and has revealed the extent and properties of the excavation disturbed zone (EDZ) and the applicability of available measurement methods. It is suggested that mechanical excavation and controlled excavation have reduced excavation damage of the rock mass around a drift, although some improvements in the currently available methods for measuring and simulating the EDZ are essential to understand excavation disturbance in more detail. JAEA is now promoting two underground research laboratory projects in Japan; the Mizunami Underground Research Laboratory (MIU) project for crystalline rocks and the Horonobe Underground Research Laboratory (Horonobe URL) project for sedimentary rocks. From a rock mechanical point of view, the major interest in these projects will be paid to failure phenomenon deep underground, rock stress estimation at larger scales and long-term physical stability of underground structure. These projects are open for international collaboration. (author)
Practical application of the KMS: 2) site characterisation - 16355
International Nuclear Information System (INIS)
Semba, Takeshi; Osawa, Hideaki; Hioki, Kazumasa; Tachibana, Shoko; Takase, Hiroyasu; McKinley, Ian
2009-01-01
The characterisation of potential repository sites will produce huge volumes of information, which must be correlated, quality assured, integrated, analysed, documented and archived in a rigorous and efficient manner. While some of this work involves rather routine data handling that may be easily automated, much of it requires input of tacit knowledge which involves the experience of expert staff. To provide support for the Japanese implementer and also the regulator, a JAEA team is attempting to capture both Japanese and international geo-synthesis experience within a Knowledge Management System (KMS) framework, which is termed ISIS. This is a hybrid system that combines 'smart' software with human experts, although an aim is to capture tacit knowledge within expert systems to the maximum extent practicable. Initial tests, based mainly on field work carried out by JAEA at the sites of the Mizunami and Horonobe underground research laboratories, have utilised expert systems as modules in a 'blackboard system' approach to planning or implementing the processing of field data. Examples are presented of sub-systems where this approach has already been demonstrated and perspectives for more extensive application to integrated geo-synthesis management are discussed. (authors)
The disposal of Canada's nuclear fuel waste: site screening and site evaluation technology
International Nuclear Information System (INIS)
Davison, C.C.; Brown, A.; Everitt, R.A.; Gascoyne, M.; Kozak, E.T.; Lodha, G.S.; Martin, C.D.; Soonawala, N.M.; Stevenson, D.R.; Thorne, G.A.; Whitaker, S.H.
1994-06-01
carefully characterized to understand the groundwater flow conditions in the rock. This understanding would be used to situate the disposal vault in the rock so as to allow the flow and chemical characteristics of the groundwater to enhance the safety of the disposal system. The geoscience methods for characterizing the conditions within plutonic rocks of the Canadian Shield have been developed and tested by AECL at geologic research areas on the Shield. This report presents examples of the site characterization methods which are drawn from the studies at these research areas. The geoscience work performed at the Whiteshell Research Area (WRA) on the Shield in southeastern Manitoba comes closest to illustrating the spatial coverage of characterization that would be required for siting an actual nuclear fuel waste disposal vault in a candidate area of the Shield. The characterization work done at the site of the Underground Research Laboratory (URL) in the WRA demonstrates how to evaluate the geoscience conditions of the rock at a candidate disposal site, and illustrates how that information would be used to confirm the suitability of the site for disposal. This report presents evidence from case studies at the URL and the geologic research areas that the surface-based, borehole and underground site characterization methods developed by AECL are now sufficiently developed that they can be used to obtain the geoscience information needed for siting a disposal vault in plutonic rock of the Canadian Shield. We expect that these site characterization methods will continue to be improved and that new methods will be developed during the long time period required for implementation of the disposal project. Improvements and new developments are continuing through ongoing research at the site of the URL and at the other geologic research areas on the Shield. However the methods that are currently available are sufficiently well developed to allow siting to commence. (author)
S Abelm okra l Screen mosch leaf cu field c ing of hus cal url and ...
African Journals Online (AJOL)
sunny
y okra has a reas late okra. 1977; Nwoke. 1998). World uit-vegetable on License 4.0 y n or a .... nineties while the substantive work was carried out in the Department of Crop ... measuring 6.5 x 6.0 m for the protected plots and 7.5 x 7.0 m for ..... gen the oth spe the obv imp. 26 Afr. J igure 3. Chron. Okra Leaf curl a urling and ...
Development of comprehensive techniques for coastal site characterisation. (1) Strategic overview
International Nuclear Information System (INIS)
Ota, Kunio; Amano, Kenji; Niizato, Tadafumi; Alexander, W. Russell; Yamanaka, Yoshiaki
2011-01-01
Any assessment of long-term repository safety will require development of a set of analyses and arguments to demonstrate the persistence of the key safety functions of the geological environment up to several hundred thousand years into the future. However, likely future global climatic and sea-level fluctuations and uplift/subsidence would result in a dramatic change in the location of the current coastline with a subsequent significant change to hydraulic and hydrochemical conditions at coastal sites. It is thus of great importance in the Japanese disposal programme to establish comprehensive techniques for coastal site characterisation. To this end, a systematic framework, which is known as a 'Geosynthesis Data Flow Diagram', has been formulated, which outlines a basic radmap of the geosynthesis methodology for characterising temporal and spatial changes of various properties and processes of coastal sites, with particular focus on the palaeohydrogeology. A basic strategy for stepwise surface-based investigations has also been proposed, which incorporates the geosynthesis methodology in an effective manner. This Technique has been introduced in an ongoing collaborative programme for characterising the coastal geological environment around Horonobe in northern Hokkaido, Japan, and now tested and optimised based on accumulated technical knowledge and experience during the progress of the investigations. (author)
Togo, Yoko S.; Takahashi, Yoshio; Amano, Yuki; Matsuzaki, Hiroyuki; Suzuki, Yohey; Terada, Yasuko; Muramatsu, Yasuyuki; Ito, Kazumasa; Iwatsuki, Teruki
2016-10-01
This paper reports the concentration, speciation and isotope ratio (129I/127I) of iodine from both groundwater and host rocks in the Horonobe area, northern Hokkaido, Japan, to clarify the origin and migration of iodine in sedimentary rocks. Cretaceous to Quaternary sedimentary rocks deposited nearly horizontally in Tenpoku Basin and in the Horonobe area were uplifted above sea level during active tectonics to form folds and faults in the Quaternary. Samples were collected from the Pliocene Koetoi and late Miocene Wakkanai formations (Fms), which include diatomaceous and siliceous mudstones. The iodine concentration in groundwater, up to 270 μmol/L, is significantly higher than that of seawater, with the iodine enrichment factor relative to seawater reaching 800-1500. The iodine concentration in the rocks decreases from the Koetoi to Wakkanai Fms, suggesting that iodine was released into the water from the rocks of deeper formations. The iodine concentration in the rocks is sufficiently high for forming iodine-rich groundwater as found in this area. X-ray absorption near edge structure (XANES) analysis shows that iodine exists as organic iodine and iodide (I-) in host rocks, whereas it exists mainly as I- in groundwater. The isotope ratio is nearly constant for iodine in the groundwater, at [0.11-0.23] × 10-12, and it is higher for iodine in rocks, at [0.29-1.1] × 10-12, giving iodine ages of 42-60 Ma and 7-38 Ma, respectively. Some iodine in groundwater must have originated from Paleogene and even late Cretaceous Fms, which are also considered as possible sources of oil and gas, in view of the old iodine ages of the groundwater. The iodine ages of the rocks are older than the depositional ages, implying that the rocks adsorbed some iodine from groundwater, which was sourced from greater depths. The iodine concentration in groundwater decreases with decreasing chlorine concentration due to mixing of iodine-rich connate water and meteoric water. A likely scenario
The survey of the Omagari fault using electric survey
International Nuclear Information System (INIS)
Matsuo, Koichi; Kishimoto, Munemaru; Negi, Tateyuki; Teshima, Minoru
2005-08-01
The present document is to report the results of geophysical survey by electric survey around a site proposed for the Horonobe Underground Research Program at Horonobe-cho, Hokkaido by the Japan Nuclear Cycle Development Institute. Electric survey using dipole-dipole array was carried out at 2,061 points using 101 electrodes over 1 km survey line in the area of Hokushin in Horonobe-cho near presumed Omagari-fault. Two dimensional resistivity inversion analysis was carried out and the resistivity structure from the surface to 250 m below sea level became clear. The resistivity structure was studied by comparing structure presumed from existing geological and geophysical informations. Resistivity distribution near surface was about 100 ohm-m and it became from 10 to 2 ohm-m as the depth increasing. Resistivity near presumed Omagari-fault was relatively lower than around that fault. Resistivity distribution was good agreement with two dimensional resistivity structure perfumed by AMT survey (2003) and existing electrical resistivity log data. Resistivity distribution of shallow zone at survey area was clear because the density of survey points were very high. (author)
One-Time URL: A Proximity Security Mechanism between Internet of Things and Mobile Devices.
Solano, Antonio; Dormido, Raquel; Duro, Natividad; González, Víctor
2016-10-13
The aim of this paper is to determine the physical proximity of connected things when they are accessed from a smartphone. Links between connected things and mobile communication devices are temporarily created by means of dynamic URLs (uniform resource locators) which may be easily discovered with pervasive short-range radio frequency technologies available on smartphones. In addition, a multi cross domain silent logging mechanism to allow people to interact with their surrounding connected things from their mobile communication devices is presented. The proposed mechanisms are based in web standards technologies, evolving our social network of Internet of Things towards the so-called Web of Things.
Study on geology and geological structure based on literature studies
International Nuclear Information System (INIS)
Funaki, Hironori; Ishii, Eiichi; Yasue, Ken-ichi; Takahashi, Kazuharu
2005-03-01
Japan Nuclear Cycle Development Institute (JNC) is proceeding with underground research laboratory (URL) project for the sedimentary rock in Horonobe, Hokkaido. This project is an investigation project which is planned over 20 years. Surface-based investigations (Phase 1) have been conducted for the present. The purposes of the Phase 1 are to construct the geological environment model (geological-structural, hydrogeological, and hydrochemical models) and to confirm the applicability of investigation technologies for the geological environment. The geological-structural model comprises the base for the hydrogeological and hydrochemical models. We constructed the geological-structural model by mainly using data obtained from literature studies. Particulars regarding which data the model is based on and who has performed the interpretation are also saved for traceability. As a result, we explain the understanding of degree and the need of information on stratigraphy and discontinuous structure. (author)
International Nuclear Information System (INIS)
Davison, C.C.; Guvanasen, V.
1985-01-01
Atomic Energy of Canada Limited (AECL) is constructing an Underground Research Laboratory (URL) to a depth of 250 m in a previously undisturbed granitic pluton located near Lac du Bonnet, Manitoba, as one of the major research projects within the Canadian Nuclear Fuel Waste Management Program. This paper discusses the hydrogeological characterization of the URL site, the modelling approach used to represent this information, the hydrogeological monitoring system installed to monitor the actual drawdown conditions that develop in response to the excavation, and the procedures employed to calibrate the numerical model. Comparisons between the drawdown predictions made by the model prior to any excavation and the actual drawdowns that have been measured since shaft excavation began in May 1984 are also discussed
International Nuclear Information System (INIS)
Aoyagi, Kazuhei; Tsusaka, Kimikazu; Kondo, Keiji; Inagaki, Daisuke; Kubota, Kenji; Tokiwa, Tetsuya
2014-01-01
The authors have been conducting seismic and resistivity tomography surveys in a gallery of the Horonobe Underground Research Laboratory in order to investigate an extent of an Excavation Damaged Zone (EDZ) along time. The objective of this paper is to discuss an influence of fracture distribution and water saturation of a rock mass on variations in seismic velocity and the value of apparent resistivity in an EDZ. Based on the result of seismic tomography survey, the extent of a layer which has low seismic velocity was about 1.0 m from the gallery wall after excavation of the tomography area. From the results of resistivity tomography survey, the value of apparent resistivity has not changed remarkably along time. To investigate a relationship between variations in seismic velocity and density of fracture in the survey area, the authors built a three dimensional fracture model around the tomography area. From the comparison of seismic velocity with density of fracture, seismic velocity decreased almost linearly as the density of fracture increased. Also, it was found that density of fracture in the layer of low seismic velocity could be estimated using a simple numeric model. >From this result, seismic tomography survey and investigation of density of fracture are suitable method for evaluation of an EDZ. (author)
International Nuclear Information System (INIS)
Iwatsuki, Teruki; Ishii, Eiichi; Niizato, Tadafumi
2009-01-01
A methodology to estimate long-term hydrochemical evolution of deep underground is indispensable for the safe geological isolation of high-level radioactive waste (HLW). This study demonstrates the methodology by illustrating scenarios of past geological events, processes, and their interrelationships with present-day hydrochemical conditions. Besides, we infer long-term variations of groundwater chemistry at Horonobe, Hokkaido, Japan. The region is underlain mainly by Neogene to Quaternary marine sedimentary rocks, (the Wakkanai Formation (Fm) and the overlying Koetoi Fm: siliceous and diatomaceous mudstones). During various events in the geological past, such as deposition, compaction, uplift, and denudation, and the more recent Neotectonic activities in this area, highly permeable hydrogeological structures formed at depths not over than 400 m below ground level in the Wakkanai Fm. The hydrogeological system can be subdivided into three hydrogeological sub-systems: (1) overlying, relatively low permeability Koetoi Fm., (2) highly permeable, upper Wakkanai Fm at depths less than 400 m and (3) relatively low permeability Wakkanai Fm, at depths greater than 400 m. The present-day hydrochemical conditions in each sub-system have been influenced by hydrogeological properties and hydraulic conditions over a long period. In subsystems 1 and 2, recharging with meteoric water flushed connate seawater during uplifting and denudation during the last 1 Ma. In contrast, fossil seawater with one-third to one-half the salinity of present-day seawater has been preserved in subsystem 3. The relatively low permeability sequence in sub-system 3 was formed by the compaction of diatomaceous mudstone during subsidence prior to 1.0 Ma. After that, changes of climatic conditions and geographical features would not have influenced groundwater flow. The groundwater chemistry evolved from seawater during long-term geochemical diagenesis in a relatively closed system. The long
International Nuclear Information System (INIS)
Yokota, Hideharu; Amano, Kenji; Maekawa, Keisuke; Kunimaru, Takanori; Naemura, Yumi; Ijiri, Yuji; Motoshima, Takayuki; Suzuki, Shunichi; Teshima, Kazufumi
2013-06-01
In the Horonobe Underground Research Laboratory Project, in-situ tracer tests are valuable and important as the investigations to obtain the mass transportation data of fractures in hostrock. However, it is difficult that the in-situ tests are executed under various conditions due to long test period and the tests results are evaluated about permeable heterogeneity in a fracture and/or scale effects. In this study, a number of tracer tests are simulated in a fictitious single plate fracture generated on computer. And the transport parameters are identified by fitting one- and two-dimensional models to the breakthrough curves obtained from the simulations in order to investigate the applicability of these models to the evaluation of in-situ tracer test. As a result, one-dimensional model yields larger longitudinal dispersion length than two-dimensional model in the both cases of homogeneous and heterogeneous hydraulic conductivity fields of the fictitious fracture. This is because that the effect of transverse dispersion has to be included in the longitudinal dispersion length parameter in the one-dimensional model. It is also found that the larger dipole ratio and the larger natural groundwater flow crossing the flow generated between two boreholes make the identified longitudinal dispersion length larger. And, the longitudinal dispersion length identified from a tracer test is smaller and/or larger than the macroscopic longitudinal dispersion length identified from whole fracture. It is clarified that these are occurred by shorter or longer distance between boreholes compare to the correlation length of geostatistical heterogeneity of fictitious fracture. (author)
Application of an internet web-site of medical images in tele-radiology
International Nuclear Information System (INIS)
Wang Weizhong; Wang Hua; Xie Jingxia; Wang Songzhang; Li Xiangdong; Qian Min; Cao Huixia
2000-01-01
Objective: To build and Internet web-site of medical images for tele-education and tele-consultation. Methods: Collecting medical images of cases that fulfilled diagnostic standards for teaching and were pathologically proved. The images were digitized using digital camera and scanner. Frontpage 98, Homesite 2.5 and text editors were used for programming. Results: The web site encompasses many useful cases and was update every week. With smart and friendly interface, easy used navigation, the site runs reliably in TCP/IP environment. The site's URL is http://imager.163.net. At present, the site has received about 100 visits per week. Conclusion: The well-designed and programmed internet web site of medical images would be easily acceptable and is going to play an important role in tele-education and tele-consultation
A multi-pattern hash-binary hybrid algorithm for URL matching in the HTTP protocol.
Directory of Open Access Journals (Sweden)
Ping Zeng
Full Text Available In this paper, based on our previous multi-pattern uniform resource locator (URL binary-matching algorithm called HEM, we propose an improved multi-pattern matching algorithm called MH that is based on hash tables and binary tables. The MH algorithm can be applied to the fields of network security, data analysis, load balancing, cloud robotic communications, and so on-all of which require string matching from a fixed starting position. Our approach effectively solves the performance problems of the classical multi-pattern matching algorithms. This paper explores ways to improve string matching performance under the HTTP protocol by using a hash method combined with a binary method that transforms the symbol-space matching problem into a digital-space numerical-size comparison and hashing problem. The MH approach has a fast matching speed, requires little memory, performs better than both the classical algorithms and HEM for matching fields in an HTTP stream, and it has great promise for use in real-world applications.
Study on construction method of concrete in the underground research laboratory. 4
International Nuclear Information System (INIS)
Iriya, Keishiro; Tajima, Takatoshi; Noda, Masaru
2004-02-01
Low alkaline cement is planned to use in construction of Horonobe Underground Research Center as one of in situ experiments. These experiments will be carried out in a part of the vertical shafts and horizontal excavated tunnels. The problems in actual using should be solved and improved until starting construction. This study has been carried out in order to improve the HFSC taking the Horonobe environment into account. Model analysis and preliminary laboratory experiment on hyper alkaline alteration of bentonite and rock have been carried out. And a long term permeability experiment on procedure. (author)or the superfluous exposure dose prevention in IVRbased on results of pH measuring for 546 days and geo-chemical code. Open data and undefined reaction were pointed out in order to accomplish the model on low alkalinity cement with high pozollan content. The effects on fresh concrete properties and harden concrete due to changing properties of fly ash were investigated. Experimental basic planning in situ test of low alkaline cement in Horonobe are proposed. And finally, procedure of improvement HFSC in Horonobe construction are investigated and proposed. It is concluded that HFSC can be applied for construction work of Horonobe underground research center. (author)
LIBRA: LIgand Binding site Recognition Application.
Hung, Le Viet; Caprari, Silvia; Bizai, Massimiliano; Toti, Daniele; Polticelli, Fabio
2015-12-15
In recent years, structural genomics and ab initio molecular modeling activities are leading to the availability of a large number of structural models of proteins whose biochemical function is not known. The aim of this study was the development of a novel software tool that, given a protein's structural model, predicts the presence and identity of active sites and/or ligand binding sites. The algorithm implemented by ligand binding site recognition application (LIBRA) is based on a graph theory approach to find the largest subset of similar residues between an input protein and a collection of known functional sites. The algorithm makes use of two predefined databases for active sites and ligand binding sites, respectively, derived from the Catalytic Site Atlas and the Protein Data Bank. Tests indicate that LIBRA is able to identify the correct binding/active site in 90% of the cases analyzed, 90% of which feature the identified site as ranking first. As far as ligand binding site recognition is concerned, LIBRA outperforms other structure-based ligand binding sites detection tools with which it has been compared. The application, developed in Java SE 7 with a Swing GUI embedding a JMol applet, can be run on any OS equipped with a suitable Java Virtual Machine (JVM), and is available at the following URL: http://www.computationalbiology.it/software/LIBRAv1.zip. © The Author 2015. Published by Oxford University Press. All rights reserved. For Permissions, please e-mail: journals.permissions@oup.com.
Development of controlled drilling system
International Nuclear Information System (INIS)
Kiho, Kenzo; Miyakawa, Kimio; Suzuki, Koichi; Sunaga, Takayuki
2008-01-01
In Japan, the soft sedimentary rock of the Neogene tertiary is being focused as a host rock for the High Level Radioactive Waste (HLW) disposal. Especially, the soft sedimentary rock at the offshore, region is thought to be one of the best candidates, since there is no driving force of the underground water. The measurement and logging in the bore hole in order to check the hydro-geological and geomechanical conditions of the host rock is a very important way to examine the potentially of the disposal candidates. The CRIEPI (Central Research Institute of Electric Power Industry) has been conducting the project about the controlled drilling technology and the measurement and logging technologies in its borehole. In 2000, as the beginning year of the project, we made the conceptual design of the drilling and measuring systems, and made key tools concerning each technology on an experimental basis. We have been developing sub tools constructing drilling and measuring systems since 2000, and applying these systems to the Horonobe site recent 5 years. We will briefly report the outline of the system and the results of drilling and measurement that were carried out at the Horonobe site. (author)
International Nuclear Information System (INIS)
Merceron, Th.
2000-01-01
In December 1998, the French government decided to authorize the construction of an underground research laboratory in a clay formation at Bure near the borders of the Meuse and the Haute-Marne departments, but rejected the selection by ANDRA of a granite site located in the Vienne department to build another laboratory. The government announced then that a new granite site had to be selected as the law of December 1991 requires that more than one underground rock characterisation laboratory has to be built and operated before a decision can be made whether or not to transform one of them into a real HLW deep repository. This paper presents the historical aspects of this new granitic site prospecting and the associated consultation Mission. (author)
International Nuclear Information System (INIS)
Whitaker, S.H.; Brown, A.; Davison, C.C.; Gascoyne, M.; Lodha, G.S.; Stevenson, D.R.; Thorne, G.A.; Tomsons, D.
1994-05-01
The objective of this report is to summarize AECL's strategy for surface-based geotechnical site investigations used in screening and evaluating candidate areas and candidate sites for a nuclear fuel waste repository and for the development of geosphere models of sites. The report is one of several prepared by national nuclear fuel waste management programs for the Swedish Nuclear Fuel and Waste Management Co. (SKB) to provide international background on site investigations for SKB's R and D programme on siting.The scope of the report is limited to surface-based investigations of the geosphere, those done at surface or in boreholes drilled from surface. The report discusses AECL's investigation strategy and the methods proposed for use in surface-based reconnaissance and detailed site investigations at potential repository sites. Site investigations done for AECL's Underground Research Laboratory are used to illustrate the approach. The report also discusses AECL's strategy for developing conceptual and mathematical models of geological conditions at sites and the use of these models in developing a model (Geosphere Model) for use in assessing the performance of the disposal system after a repository is closed. Models based on the site data obtained at the URL are used to illustrate the approach. Finally, the report summarizes the lessons learned from AECL's R and D program on site investigations and mentions some recent developments in the R and D program. 120 refs, 33 figs, 7 tabs
Energy Technology Data Exchange (ETDEWEB)
Whitaker, S H; Brown, A; Davison, C C; Gascoyne, M; Lodha, G S; Stevenson, D R; Thorne, G A; Tomsons, D [AECL Research, Whiteshell Labs., Pinawa, MB (Canada)
1994-05-01
The objective of this report is to summarize AECL`s strategy for surface-based geotechnical site investigations used in screening and evaluating candidate areas and candidate sites for a nuclear fuel waste repository and for the development of geosphere models of sites. The report is one of several prepared by national nuclear fuel waste management programs for the Swedish Nuclear Fuel and Waste Management Co. (SKB) to provide international background on site investigations for SKB`s R and D programme on siting.The scope of the report is limited to surface-based investigations of the geosphere, those done at surface or in boreholes drilled from surface. The report discusses AECL`s investigation strategy and the methods proposed for use in surface-based reconnaissance and detailed site investigations at potential repository sites. Site investigations done for AECL`s Underground Research Laboratory are used to illustrate the approach. The report also discusses AECL`s strategy for developing conceptual and mathematical models of geological conditions at sites and the use of these models in developing a model (Geosphere Model) for use in assessing the performance of the disposal system after a repository is closed. Models based on the site data obtained at the URL are used to illustrate the approach. Finally, the report summarizes the lessons learned from AECL`s R and D program on site investigations and mentions some recent developments in the R and D program. 120 refs, 33 figs, 7 tabs.
Directory of Open Access Journals (Sweden)
Ju Wang
2014-04-01
Full Text Available Underground research laboratories (URLs, including “generic URLs” and “site-specific URLs”, are underground facilities in which characterisation, testing, technology development, and/or demonstration activities are carried out in support of the development of geological repositories for high-level radioactive waste (HLW disposal. In addition to the generic URL and site-specific URL, a concept of “area-specific URL”, or the third type of URL, is proposed in this paper. It is referred to as the facility that is built at a site within an area that is considered as a potential area for HLW repository or built at a place near the future repository site, and may be regarded as a precursor to the development of a repository at the site. It acts as a “generic URL”, but also acts as a “site-specific URL” to some extent. Considering the current situation in China, the most suitable option is to build an “area-specific URL” in Beishan area, the first priority region for China's high-level waste repository. With this strategy, the goal to build China's URL by 2020 may be achieved, but the time left is limited.
Energy Technology Data Exchange (ETDEWEB)
Grace, Matthew; Lowry, Thomas Stephen; Arnold, Bill Walter; James, Scott Carlton; Gray, Genetha Anne; Ahlmann, Michael
2008-08-01
Uncertainty in site characterization arises from a lack of data and knowledge about a site and includes uncertainty in the boundary conditions, uncertainty in the characteristics, location, and behavior of major features within an investigation area (e.g., major faults as barriers or conduits), uncertainty in the geologic structure, as well as differences in numerical implementation (e.g., 2-D versus 3-D, finite difference versus finite element, grid resolution, deterministic versus stochastic, etc.). Since the true condition at a site can never be known, selection of the best conceptual model is very difficult. In addition, limiting the understanding to a single conceptualization too early in the process, or before data can support that conceptualization, may lead to confidence in a characterization that is unwarranted as well as to data collection efforts and field investigations that are misdirected and/or redundant. Using a series of numerical modeling experiments, this project examined the application and use of information criteria within the site characterization process. The numerical experiments are based on models of varying complexity that were developed to represent one of two synthetically developed groundwater sites; (1) a fully hypothetical site that represented a complex, multi-layer, multi-faulted site, and (2) a site that was based on the Horonobe site in northern Japan. Each of the synthetic sites were modeled in detail to provide increasingly informative 'field' data over successive iterations to the representing numerical models. The representing numerical models were calibrated to the synthetic site data and then ranked and compared using several different information criteria approaches. Results show, that for the early phases of site characterization, low-parameterized models ranked highest while more complex models generally ranked lowest. In addition, predictive capabilities were also better with the low-parameterized models. For
International Nuclear Information System (INIS)
Umeda, Koji; Oyama, Takuya; Kurosawa, Hideki; Semba, Takeshi; Takeuchi, Shinji; Tajikara, Masayoshi; Tsuruta, Tadahiko; Yasue, Ken-ichi; Ohi, Takao; Oda, Chie; Kamei, Gento; Kobayashi, Yasushi; Sasaki, Yasuo; Sawada, Atsushi; Taniguchi, Naoki; Tanai, Kenji; Naito, Morimasa; Nakayama, Masashi; Kuno, Yoshio; Fujita, Tomoo; Honda, Akira; Mihara, Morihiro; Miyahara, Kaname; Osawa, Hideaki; Fujishima, Atsushi; Kuji, Masayoshi; Saito, Haruo; Sanada, Hiroyuki; Niizato, Tadafumi; Funaki, Hironori; Maekawa, Keisuke; Fujiwara, Kenso
2007-12-01
To increase technical reliability in geological disposal technology of high-level radioactive waste, JAEA have been conducting R and D activities in the fields in the repository engineering, performance assessment (PA) of the geological disposal system, and geoscientific study. In the field of R and D on the repository engineering, laboratory experimental studies at Tokai Research Center are carried out by engineering-scale and non-radiogenic experiments. The studies on performance assessment include more realistic model development with extensive computer analyses and acquisition of basic data concerning the chemical properties and migration behavior of radionuclides under geological disposal conditions. The information obtained from the Underground Research Laboratories (URLs) is used to provide a realistic condition of geological environments for these studies. The R and D studies are also carried out for TRU waste. A particular JAEA R and D activity is to promote the projects of two Underground Research Laboratories (URLs): one at Mizunami city, in crystalline rock and the other at Horonobe town, in sedimentary rock. In the present stage (2nd R and D phase) of the URL projects, the investigation are being carried out during the excavation of shafts and drifts. Data obtained from the investigations will serve to verify and refine the results from the surface-based investigations and characterize the evolution of the geological environment during drift excavation. The research on natural processes, such as fault and volcanic activities, is also conducted to provide better understanding of long-term stability on the geological environment. JAEA has initiated a project to develop the next generation of novel knowledge management system (KMS) to develop and manage the technical knowledge base for supporting implementers and regulators. This knowledge base includes all technical achievements by the JAEA as well as know-how and experience which have been accumulated
Field tracer transport experiments at the site of Canada's underground research laboratory
International Nuclear Information System (INIS)
Frost, L.H.; Davison, C.C.; Vandergraaf, T.T.; Scheier, N.W.; Kozak, E.T.
1997-01-01
To gain a better understanding of the processes affecting solute transport in fractured crystalline rock, groundwater tracer experiments are being performed within natural fracture domains and excavation damage zones at various scales at the site of AECL's Underground Research Laboratory (URL). The main objective of these experiments is to develop and demonstrate methods for characterizing the solute transport properties within fractured crystalline rock. Estimates of these properties are in turn being used in AECL's conceptual and numerical models of groundwater flow and solute transport through the geosphere surrounding a nuclear fuel waste disposal vault in plutonic rock of the Canadian Shield. (author)
Rutqvist, Jonny; Börgesson, Lennart; Chijimatsu, Masakazu; Hernelind, Jan; Jing, Lanru; Kobayashi, Akira; Nguyen, Son
2009-05-01
This paper presents numerical modeling of excavation-induced damage, permeability changes, and fluid-pressure responses during excavation of a test tunnel associated with the tunnel sealing experiment (TSX) at the Underground Research Laboratory (URL) in Canada. Four different numerical models were applied using a wide range of approaches to model damage and permeability changes in the excavation disturbed zone (EDZ) around the tunnel. Using in situ calibration of model parameters, the modeling could reproduce observed spatial distribution of damage and permeability changes around the tunnel as a combination of disturbance induced by stress redistribution around the tunnel and by the drill-and-blast operation. The modeling showed that stress-induced permeability increase above the tunnel is a result of micro and macrofracturing under high deviatoric (shear) stress, whereas permeability increase alongside the tunnel is a result of opening of existing microfractures under decreased mean stress. The remaining observed fracturing and permeability changes around the periphery of the tunnel were attributed to damage from the drill-and-blast operation. Moreover, a reasonably good agreement was achieved between simulated and observed excavation-induced pressure responses around the TSX tunnel for 1 year following its excavation. The simulations showed that these pressure responses are caused by poroelastic effects as a result of increasing or decreasing mean stress, with corresponding contraction or expansion of the pore volume. The simulation results for pressure evolution were consistent with previous studies, indicating that the observed pressure responses could be captured in a Biot model using a relatively low Biot-Willis’ coefficient, α ≈ 0.2, a porosity of n ≈ 0.007, and a relatively low permeability of k ≈ 2 × 10-22 m2, which is consistent with the very tight, unfractured granite at the site.
Directory of Open Access Journals (Sweden)
Susan Haigh
2007-06-01
Full Text Available Objective – To compare the use of books described by catalogue records that are enhanced with URL links to such information as dust jackets, tables of contents, sample text, and publishers’ descriptions, with the use of books described by records that are not enhanced with such links.Design – Use study.Setting – Academic library (Southeastern Louisiana University, Sims Memorial Library.Subjects – 180 records with enhancements and 180 records (different titles without enhancements.Methods – The study identified the sample of unenhanced records by conducting searches of the broad subject terms “History”, “United States”, “Education”,and “Social” and limiting the searches to books. The enhanced sample was derived in the same manner, but with additional search limiters to identify only those records that had URL enhancements. An equal sample of enhanced and unenhanced records (50 or 30 of each was tracked for each of four search terms. Only records for books that could be checked out were included, as use statistics were based on whether or not a book was borrowed. While half of the enhanced records had full‐text elements (such as descriptions that were indexed and thus searchable, the rate of use for these records was not tracked separately from the enhanced records that only had URL enhancements.Main results – Books described on records with URL enhancements for publisher descriptions, tables of contents, book reviews, or sample text had higher use than those without URL enhancements. Only 7% of titles with URLs, compared with 21% of those without, had not been borrowed. 74.67% of titles with URLs had been checked out one or two times, compared with 69.5% of those without URLs. The number of titles with enhanced records that had 3 or more checkouts was almost double the rate of unenhanced titles (18% to 9.5%.Conclusion – The authors conclude that catalogue records that have electronic links to book reviews, cover
International Nuclear Information System (INIS)
Tanaka, Tatsuya; Ando, Kenichi; Hashimoto, Shuuji; Saegusa, Hiromitsu; Takeuchi, Shinji; Amano, Kenji
2007-01-01
This study aims to establish comprehensive techniques for site descriptive modelling considering the hydraulic heterogeneity due to the Water Conducting Features in fractured rocks. The WCFs was defined by the interpretation and integration of geological and hydrogeological data obtained from the deep borehole investigation campaign in the Mizunami URL project and Regional Hydrogeological Study. As a result of surface based investigation phase, the block-scale hydrogeological descriptive model was generated using hydraulic discrete fracture networks. Uncertainties and remaining issues associated with the assumption in interpreting the data and its modelling were addressed in a systematic way. (author)
Lifescience Database Archive (English)
Full Text Available glish archive site is opened. 2010/10/01 KEGG MEDICUS ( http://www.kegg.jp/kegg/medicus/ ) is opened. About ...[ Credits ] English ]; } else if ( url.search(//en//) != -1 ) { url = url.replace(/...switchLanguage; BLAST Search Image Search Home About Archive Update History Data List Contact us KEGG MEDI...CUS Update History of This Database Date Update contents 2014/05/09 KEGG MEDICUS En...This Database Database Description Download License Update History of This Database Site Policy | Contact Us Update History of This Database - KEGG MEDICUS | LSDB Archive ...
International Nuclear Information System (INIS)
Vogt, Tobias; Mueller, Herwig R.; Vietor, Tim; Frieg, Bernd
2012-01-01
Document available in extended abstract form only. Full text of publication follows: The application of fiber-optic sensors in large experiments in underground rock laboratories (URL) and for monitoring of pilot repositories offers several advantages in contrast to conventional sensors. By means of optical fibers distributed temperature and deformation measurements can be performed without electric or mechanical components at the measurement location reducing the risk of corrosion and sensor failure. As fiber-optic strain sensors are to some extend still in a prototype stage, we focus here on Raman spectra distributed fiber-optic temperature sensing (DTS). In DTS a fiber-optic cable, which is the temperature sensor, is connected to a light reading unit that sends laser-pulses into the fiber. The backscattered light is detected with high temporal resolution. From the two-way-light-travel-time the location of backscattering is determined. For the temperature information the amplitude ratio of the Stokes and anti-Stokes signals is analyzed. The Stokes and anti- Stokes signals are the result of the Raman effect. The ratio of these signals provides a quantity that depends only on the temperature of the fiber at the location of backscatter. With commercial DTS setups it is possible to measure the temperature distribution along several kilometer long cables with a temperature resolution of 0.01 C and a spatial resolution of 1 m. Recent developments in DTS focus on better temperature precision and resolution. This advancement can be achieved by experiment-specific calibration techniques and sensor-layout as well as improved instruments. To realize high spatial resolution (cm range) wrapped fiber-optic cables can be applied. Another promising approach to monitor moisture along a fiber-optic cable installed in unconsolidated material are heatable cables. We will present a selection of the most recent advancements which may improve temperature monitoring in natural and
Directory of Open Access Journals (Sweden)
Vera Lúcia Souza Alves
2006-03-01
Full Text Available OBJETIVOS: Descrever o processo de criação de um web site educacional para enfermeiros contendo informações sobre avaliação e cuidados preventivos dos pés em pacientes com diabetes mellitus. MÉTODOS: Pesquisa aplicada desenvolvida em 2004, baseada no modelo teórico de Tronchim (1999 para a construção de web sites, composto das fases de conceitualização, desenvolvimento, implementação e avaliação. RESULTADOS: O site possui 68 páginas contendo informações, orientações, fotos e ilustrações, estruturadas em tópicos com os conceitos básicos do diabetes mellitus, pé diabético, neuropatias, doença vascular periférica, infecções, amputações, educação e orientações de enfermagem. Foi avaliado por especialistas que referendaram seu conteúdo e fizeram sugestões para seu aperfeiçoamento. CONCLUSÕES: A criação e desenvolvimento do site foram descritos, podendo ser acessado no www.unifesp.br/denf/nien na opção pesquisa.OBJETIVOS: Neste estudio los objetivos fueron desarrollar el proceso de creación de un web site educacional com informaciones sobre la evaluación y los cuidados preventivos de los pies en pacientes con diabetes mellitus y evaluar el contenido de las informaciones disponibilizadas en el web site con especialistas. MÉTODOS: Trátase de una pesquisa aplicada baseada en el modelo te'orico de Tronchim (1999, para la construcción de un web site. RESULTADOS: El site posee 68 páginas, con conceptos básicos de diabetes mellitus, pie diabético, neuropatías, enfermedad vascular periférica, infecciones, amputaciones, educación y orientaciones de enfermería. CONCLUSION: El site puede ser accesado a través de la URL: www.unifesp.br/denf/nien , en la opición pesquisa.AIM: This product consists in describe the creation process of an educational web site displaying information on evaluation and preventive care of feet in patients with diabetes mellitus also to evaluate the information content available
Digital libraries and World Wide Web sites and page persistence.
Directory of Open Access Journals (Sweden)
Wallace Koehler
1999-01-01
Full Text Available Web pages and Web sites, some argue, can either be collected as elements of digital or hybrid libraries, or, as others would have it, the WWW is itself a library. We begin with the assumption that Web pages and Web sites can be collected and categorized. The paper explores the proposition that the WWW constitutes a library. We conclude that the Web is not a digital library. However, its component parts can be aggregated and included as parts of digital library collections. These, in turn, can be incorporated into "hybrid libraries." These are libraries with both traditional and digital collections. Material on the Web can be organized and managed. Native documents can be collected in situ, disseminated, distributed, catalogueed, indexed, controlled, in traditional library fashion. The Web therefore is not a library, but material for library collections is selected from the Web. That said, the Web and its component parts are dynamic. Web documents undergo two kinds of change. The first type, the type addressed in this paper, is "persistence" or the existence or disappearance of Web pages and sites, or in a word the lifecycle of Web documents. "Intermittence" is a variant of persistence, and is defined as the disappearance but reappearance of Web documents. At any given time, about five percent of Web pages are intermittent, which is to say they are gone but will return. Over time a Web collection erodes. Based on a 120-week longitudinal study of a sample of Web documents, it appears that the half-life of a Web page is somewhat less than two years and the half-life of a Web site is somewhat more than two years. That is to say, an unweeded Web document collection created two years ago would contain the same number of URLs, but only half of those URLs point to content. The second type of change Web documents experience is change in Web page or Web site content. Again based on the Web document samples, very nearly all Web pages and sites undergo some
Database Description - Society Catalog | LSDB Archive [Life Science Database Archive metadata
Lifescience Database Archive (English)
Full Text Available ion of the academic societies in Japan (organization name, website URL, contact a...sing a category tree or a society website's thumbnail. This database is useful especially when the users are... External Links: Original website information Database maintenance site National Bioscience Database Center *The original web...site was terminated. URL of the original website - Operation start date 2008/06 Last update
Medvedeva, Irina V; Demenkov, Pavel S; Ivanisenko, Vladimir A
2017-04-01
Functional sites define the diversity of protein functions and are the central object of research of the structural and functional organization of proteins. The mechanisms underlying protein functional sites emergence and their variability during evolution are distinguished by duplication, shuffling, insertion and deletion of the exons in genes. The study of the correlation between a site structure and exon structure serves as the basis for the in-depth understanding of sites organization. In this regard, the development of programming resources that allow the realization of the mutual projection of exon structure of genes and primary and tertiary structures of encoded proteins is still the actual problem. Previously, we developed the SitEx system that provides information about protein and gene sequences with mapped exon borders and protein functional sites amino acid positions. The database included information on proteins with known 3D structure. However, data with respect to orthologs was not available. Therefore, we added the projection of sites positions to the exon structures of orthologs in SitEx 2.0. We implemented a search through database using site conservation variability and site discontinuity through exon structure. Inclusion of the information on orthologs allowed to expand the possibilities of SitEx usage for solving problems regarding the analysis of the structural and functional organization of proteins. Database URL: http://www-bionet.sscc.ru/sitex/ .
PhishScore: Hacking Phishers' Minds
Marchal, Samuel; François, Jérôme; State, Radu; Engel, Thomas
2014-01-01
Despite the growth of prevention techniques, phishing remains an important threat since the principal countermeasures in use are still based on reactive URL blacklisting. This technique is inefficient due to the short lifetime of phishing Web sites, making recent approaches relying on real-time or proactive phishing URLs detection techniques more appropriate. In this paper we introduce PhishScore, an automated real-time phishing detection system. We observed that phishing URLs usually have fe...
International Nuclear Information System (INIS)
Martin, C.D.; Christiansson, Rolf; Soederhaell, J.
2001-12-01
Over the past 25 years the international nuclear community has carried out extensive research into the deep geological disposal of nuclear waste in hard rocks. In two cases this research has resulted in the construction of dedicated underground research facilities: SKB's Aespoe Hard Rock Laboratory, Sweden and AECL's Underground Research Laboratory, Canada. Both laboratories are located in hard rocks considered representative of the Fennoscandian and Canadian Shields, respectively. This report is intended to synthesize the important rock mechanics findings from these research programs. In particular the application of these finding to assessing the stability of underground openings. As such the report draws heavily on the published results from the SKB's ZEDEX Experiment in Sweden and AECL's Mine- by Experiment in Canada. The objectives of this report are to: 1. Describe, using the current state of knowledge, the role rock engineering can play in siting and constructing a KBS-3 repository. 2. Define the key rock mechanics parameters that should be determined in order to facilitate repository siting and construction. 3. Discuss possible construction issues, linked to rock stability, that may arise during the excavation of the underground openings of a KBS-3 repository. 4. Form a reference document for the rock stability analysis that has to be carried out as a part of the design works parallel to the site investigations. While there is no unique or single rock mechanics property or condition that would render the performance of a nuclear waste repository unacceptable, certain conditions can be treated as negative factors. Outlined below are major rock mechanics issues that should be addressed during the siting, construction and closure of a nuclear waste repository in Sweden in hard crystalline rock. During the site investigations phase, rock mechanics information will be predominately gathered from examination and testing of the rock core and mapping of the
Update History of This Database - Q-TARO | LSDB Archive [Life Science Database Archive metadata
Lifescience Database Archive (English)
Full Text Available switchLanguage; BLAST Search Image Search Home About Archive Update History Data ...List Contact us Q-TARO Update History of This Database Date Update contents 2014/10/20 The URL of the portal...ption Download License Update History of This Database Site Policy | Contact Us Update History of This Database - Q-TARO | LSDB Archive ... ... site is changed. 2013/12/17 The URL of the portal site is changed. 2013/12/13 Q-TARO English archive site i...s opened. 2009/11/15 Q-TARO ( http://qtaro.abr.affrc.go.jp/ ) is opened. About This Database Database Descri
International Nuclear Information System (INIS)
Tsusaka, Kimikazu
2010-01-01
Japan Atomic Energy Agency has been excavating deep shafts through sedimentary soft rocks in Horonobe, Hokkaido. From the viewpoint of the observational construction, site engineers need a practical guide to evaluate the field measurements conducted with shaft sinking. The author analyzed the relationship among initial deformation rate, observed deformation, the ratio of the modulus of elasticity of rock mass to the initial stress, and the magnitude of inelastic behavior of rock based on convergence measurements and investigation of rock mass properties on shaft walls. As a result, the rock mass behavior classification for shaft sinking which consists of three classes was proposed. (author)
License - KEGG MEDICUS | LSDB Archive [Life Science Database Archive metadata
Lifescience Database Archive (English)
Full Text Available [ Credits ] English ]; } else if ( url.search(//en//) != -1 ) { url = url.replace(/...switchLanguage; BLAST Search Image Search Home About Archive Update History Data List Contact us KEGG MEDI...ion-NonCommercial-NoDerivs 2.1 Japan. If you use data from this database, please be sure attribute this data...whole of this database, and acquire data; and freely redistribute part or whole of the data from this databa...This Database Site Policy | Contact Us License - KEGG MEDICUS | LSDB Archive ...
Clone - ClEST | LSDB Archive [Life Science Database Archive metadata
Lifescience Database Archive (English)
Full Text Available switchLanguage; BLAST Search Image Search Home About Archive Update History Data ...le URL: ftp://ftp.biosciencedbc.jp/archive/clest/LATEST/clest_clone.zip File size: 660 KB Simple search URL ...ion Download License Update History of This Database Site Policy | Contact Us Clone - ClEST | LSDB Archive ...
Download - KEGG MEDICUS | LSDB Archive [Life Science Database Archive metadata
Lifescience Database Archive (English)
Full Text Available [ Credits ] English ]; } else if ( url.search(//en//) != -1 ) { url = url.replace(/...switchLanguage; BLAST Search Image Search Home About Archive Update History Data List Contact us KEGG MEDI...search and download 1 README README_e.html - 2 Drug kegg_medicus_drug_en.zip (5.2... MB) Simple search and download 3 Environ kegg_medicus_environ_en.zip (79 KB) Simple search and download 4 Disease kegg_medi...nload License Update History of This Database Site Policy | Contact Us Download - KEGG MEDICUS | LSDB Archive ...
tRNA - RMG | LSDB Archive [Life Science Database Archive metadata
Lifescience Database Archive (English)
Full Text Available switchLanguage; BLAST Search Image Search Home About Archive Update History Data ...File URL: ftp://ftp.biosciencedbc.jp/archive/rmg/LATEST/rmg_trna.zip File size: 1 KB Simple search URL http:...ption Download License Update History of This Database Site Policy | Contact Us tRNA - RMG | LSDB Archive ...
Baechler, S.; Lavanchy, J. M.; Armand, G.; Cruchaudet, M.
In order to investigate potential changes of the hydraulic properties of the EDZ over time in the Meuse/Haute-Marne underground research laboratory (URL), several hydraulic tests campaigns have been carried out between 2005 and 2008 in dedicated boreholes. After several test series, inconsistencies were noticed in the results, indicating, in particular cases, erratic, inexplicable property changes over time and spatial contrasts. It was therefore difficult to determine reliably potential trends of the EDZ hydraulic properties. It appeared necessary to re-evaluate both the interpretation concepts and assumptions applied to the numerical analyses of test data on the EDZ, trying to better constrain the flow model and the parameter variables. In order to improve the understanding of the geometrical, geomechanical and hydraulic properties of the EDZ, independent information from other investigation methods has been used to critically revise the conceptual model and formation parameters. In particular, results from a diffusion experiment and ultrasonic measurements allowed constraining the extent of the mechanical damaged zone around the borehole (BDZ). Storativity parameters were fitted due to their expected variability. Indeed, high storativity values can be presumed under the unsaturated conditions of the EDZ. The results of the reanalyses, performed with the numerical borehole simulator MULTISIM, demonstrated the good quality and consistency of the revised conceptual model with constrained BDZ and variable storativity. Overall the new simulation results obtained from selected test series are now very consistent. The revised conceptual model demonstrated its capacity to better represent the evolution and extension of the EDZ around a drift in Meuse/Haute-Marne URL. Further consistency checks are proposed to confirm the new model assumptions and the estimates of the single phase flow model in the EDZ.
International Nuclear Information System (INIS)
Baechler, S.; Lavanchy, J. M.; Armand, G.; Cruchaudet, M.
2011-01-01
In order to investigate potential changes of the hydraulic properties of the EDZ over time in the Meuse/Haute-Marne underground research laboratory (URL), several hydraulic tests campaigns have been carried out between 2005 and 2008 in dedicated boreholes. After several test series, inconsistencies were noticed in the results, indicating, in particular cases, erratic, inexplicable property changes over time and spatial contrasts. It was therefore difficult to determine reliably potential trends of the EDZ hydraulic properties. It appeared necessary to re-evaluate both the interpretation concepts and assumptions applied to the numerical analyses of test data on the EDZ, trying to better constrain the flow model and the parameter variables. In order to improve the understanding of the geometrical, geomechanical and hydraulic properties of the EDZ, independent information from other investigation methods has been used to critically revise the conceptual model and formation parameters. In particular, results from a diffusion experiment and ultrasonic measurements allowed constraining the extent of the mechanical damaged zone around the borehole (BDZ). Storativity parameters were fitted due to their expected variability. Indeed, high storativity values can be presumed under the unsaturated conditions of the EDZ. The results of the reanalyses, performed with the numerical borehole simulator MULTISIM, demonstrated the good quality and consistency of the revised conceptual model with constrained BDZ and variable storativity. Overall the new simulation results obtained from selected test series are now very consistent. The revised conceptual model demonstrated its capacity to better represent the evolution and extension of the EDZ around a drift in Meuse/Haute-Marne URL. Further consistency checks are proposed to confirm the new model assumptions and the estimates of the single phase flow model in the EDZ. (authors)
A web server for analysis, comparison and prediction of protein ligand binding sites.
Singh, Harinder; Srivastava, Hemant Kumar; Raghava, Gajendra P S
2016-03-25
One of the major challenges in the field of system biology is to understand the interaction between a wide range of proteins and ligands. In the past, methods have been developed for predicting binding sites in a protein for a limited number of ligands. In order to address this problem, we developed a web server named 'LPIcom' to facilitate users in understanding protein-ligand interaction. Analysis, comparison and prediction modules are available in the "LPIcom' server to predict protein-ligand interacting residues for 824 ligands. Each ligand must have at least 30 protein binding sites in PDB. Analysis module of the server can identify residues preferred in interaction and binding motif for a given ligand; for example residues glycine, lysine and arginine are preferred in ATP binding sites. Comparison module of the server allows comparing protein-binding sites of multiple ligands to understand the similarity between ligands based on their binding site. This module indicates that ATP, ADP and GTP ligands are in the same cluster and thus their binding sites or interacting residues exhibit a high level of similarity. Propensity-based prediction module has been developed for predicting ligand-interacting residues in a protein for more than 800 ligands. In addition, a number of web-based tools have been integrated to facilitate users in creating web logo and two-sample between ligand interacting and non-interacting residues. In summary, this manuscript presents a web-server for analysis of ligand interacting residue. This server is available for public use from URL http://crdd.osdd.net/raghava/lpicom .
Potential risks at an industrial site: A wind tunnel study
Czech Academy of Sciences Publication Activity Database
Jaňour, Zbyněk; Jurčáková, Klára; Brych, Karel; Dittrt, František; Dittrich, F.
2010-01-01
Roč. 88, č. 3 (2010), s. 185-190 ISSN 0957-5820 R&D Projects: GA MŠk(CZ) OC 113 Institutional research plan: CEZ:AV0Z20760514; CEZ:AV0Z20600510 Keywords : atmospheric turbulence * flow visualization * wind tunnel modeling Subject RIV: DG - Athmosphere Sciences, Meteorology Impact factor: 1.453, year: 2010 http://www.sciencedirect.com/science?_ob=ArticleURL&_udi=B8JGG-4Y7P8YF-1&_user=640952&_coverDate=05%2F31%2F2010&_rdoc=1&_fmt=high&_orig=search&_sort=d&_docanchor=&view=c&_searchStrId=1433050901&_rerunOrigin= google &_acct=C000034318&_version=1&_urlVersion=0&_userid=640952&md5=b036d2c5d747eadc03ff5697ea45e6a2
Three decades of URLS: what have we learned?
International Nuclear Information System (INIS)
Delay, Jacques; Vinsot, Agnes; Bossart, Paul; Ling, Li Xiang; Blechschmidt, Ingo; Ohlsson, Mats; Nussbaum, Christophe
2012-01-01
Document available in extended abstract form only. Twenty-six underground laboratories for the disposal of radioactive waste studies were set up in ten countries, between 1965 and 2006. They are located in a range of geological formations: argillaceous sedimentary rocks, magmatic rocks, evaporates and volcanic tuff. Some laboratories have been installed in existing constructions (tunnels or old mine galleries); others have been purpose-built. Eight have been set up at what are considered to be potential waste disposal sites, so called site specific laboratories. The others are generic rock laboratories providing the investigation methodology and characterisation tools for repository projects. The experiments conducted have a broad range of characteristics such as objectives, volume, duration, sophistication of installations, budget, and so on. The simplest ones have been carried out to make elementary measurements of temperature or pore-pressure for example. The most complex ones have replicated large or full scale disposal components under actual conditions and/or conditions simulating those that might be found in a repository. Such demonstration experiments include sealing tests, in-situ feasibility studies for waste emplacement and the improvement of engineered barrier in close proximity. These tests make it possible to simultaneous study the constructability of a disposal facility and the scientific issues such as coupled thermal, mechanical, hydraulic and chemical phenomena and processes. This paper describes how four scientific and safety relevant issues have been addressed in special purpose research laboratories focusing on the geological disposal of highly level and long-lived radioactive waste. These are: (i) the effects of heat on the engineered barriers and the geological environment, (ii) the geochemical characterization of pore water in argillaceous rocks, (iii) the diffusion and retention of radionuclides, and (iv) the full-size sealing of a waste
Locus - ASTRA | LSDB Archive [Life Science Database Archive metadata
Lifescience Database Archive (English)
Full Text Available switchLanguage; BLAST Search Image Search Home About Archive Update History Data ...URL: ftp://ftp.biosciencedbc.jp/archive/astra/LATEST/astra_locus.zip File size: 887 KB Simple search URL htt...icing type (ex. cassette) About This Database Database Description Download License Update History of This Database Site Policy | Contact Us Locus - ASTRA | LSDB Archive ...
Energy Technology Data Exchange (ETDEWEB)
Martin, C.D. [Univ. of Alberta, Edmonton (Canada); Christiansson, Rolf [Swedish Nuclear Fuel and Waste Management Co., Stockholm (Sweden); Soederhaell, J. [VBB VIAK AB, Stockholm (Sweden)
2001-12-01
Over the past 25 years the international nuclear community has carried out extensive research into the deep geological disposal of nuclear waste in hard rocks. In two cases this research has resulted in the construction of dedicated underground research facilities: SKB's Aespoe Hard Rock Laboratory, Sweden and AECL's Underground Research Laboratory, Canada. Both laboratories are located in hard rocks considered representative of the Fennoscandian and Canadian Shields, respectively. This report is intended to synthesize the important rock mechanics findings from these research programs. In particular the application of these finding to assessing the stability of underground openings. As such the report draws heavily on the published results from the SKB's ZEDEX Experiment in Sweden and AECL's Mine- by Experiment in Canada. The objectives of this report are to: 1. Describe, using the current state of knowledge, the role rock engineering can play in siting and constructing a KBS-3 repository. 2. Define the key rock mechanics parameters that should be determined in order to facilitate repository siting and construction. 3. Discuss possible construction issues, linked to rock stability, that may arise during the excavation of the underground openings of a KBS-3 repository. 4. Form a reference document for the rock stability analysis that has to be carried out as a part of the design works parallel to the site investigations. While there is no unique or single rock mechanics property or condition that would render the performance of a nuclear waste repository unacceptable, certain conditions can be treated as negative factors. Outlined below are major rock mechanics issues that should be addressed during the siting, construction and closure of a nuclear waste repository in Sweden in hard crystalline rock. During the site investigations phase, rock mechanics information will be predominately gathered from examination and testing of the rock core and
Citations to Web pages in scientific articles: the permanence of archived references.
Thorp, Andrea W; Schriger, David L
2011-02-01
We validate the use of archiving Internet references by comparing the accessibility of published uniform resource locators (URLs) with corresponding archived URLs over time. We scanned the "Articles in Press" section in Annals of Emergency Medicine from March 2009 through June 2010 for Internet references in research articles. If an Internet reference produced the authors' expected content, the Web page was archived with WebCite (http://www.webcitation.org). Because the archived Web page does not change, we compared it with the original URL to determine whether the original Web page had changed. We attempted to access each original URL and archived Web site URL at 3-month intervals from the time of online publication during an 18-month study period. Once a URL no longer existed or failed to contain the original authors' expected content, it was excluded from further study. The number of original URLs and archived URLs that remained accessible over time was totaled and compared. A total of 121 articles were reviewed and 144 Internet references were found within 55 articles. Of the original URLs, 15% (21/144; 95% confidence interval [CI] 9% to 21%) were inaccessible at publication. During the 18-month observation period, there was no loss of archived URLs (apart from the 4% [5/123; 95% CI 2% to 9%] that could not be archived), whereas 35% (49/139) of the original URLs were lost (46% loss; 95% CI 33% to 61% by the Kaplan-Meier method; difference between curves PWeb page at publication can help preserve the authors' expected information. Copyright © 2010 American College of Emergency Physicians. Published by Mosby, Inc. All rights reserved.
International Nuclear Information System (INIS)
Le Gal La Salle, Corinne; Rebeix, Romain; Lancelot, Joel; Matray, Jean-Michel; Bensenouci, Fethic; Michelot, Jean-Luc; Dauzeres, Alexandre; Wittebroodt, Charles; Frape, Shaun; ShouakarStash, Orphane
2013-01-01
Dissolved chloride in argillite pore water has been studied as a natural analogue for radionuclides potentially released from radioactive waste disposal. The Tournemire URL intersects impervious and compacted argillite. A previously obtained chloride concentration profile of intact rock is symmetric with a maximum concentration of 0.6±0.1 g/L, compared to 19 g/L for the original connate seawater. Dissolved chloride shows high δ 37 Cl values, ranging between +6 and +80/00 vs. SMOC. The modeled profile considers diffusive exchange between connate seawater and meteoric freshwater. Transport parameters were obtained by radial diffusion experiments. Numerical modeling was performed with the coupled reactive-transport code Hytec. Simulations suggest a diffusive-exchange time of 85±10 Ma for Cl, which correlates with a major erosional period. Simulated δ 37 Cl values between 1.002 and 1.003 agree with observed pore water δ 37 Cl. This study strongly suggests that the dissolved chloride profile in the argillites results from diffusive exchange and indicates that unfractured argillites can provide good confinement. (authors)
CaMELS: In silico prediction of calmodulin binding proteins and their binding sites.
Abbasi, Wajid Arshad; Asif, Amina; Andleeb, Saiqa; Minhas, Fayyaz Ul Amir Afsar
2017-09-01
Due to Ca 2+ -dependent binding and the sequence diversity of Calmodulin (CaM) binding proteins, identifying CaM interactions and binding sites in the wet-lab is tedious and costly. Therefore, computational methods for this purpose are crucial to the design of such wet-lab experiments. We present an algorithm suite called CaMELS (CalModulin intEraction Learning System) for predicting proteins that interact with CaM as well as their binding sites using sequence information alone. CaMELS offers state of the art accuracy for both CaM interaction and binding site prediction and can aid biologists in studying CaM binding proteins. For CaM interaction prediction, CaMELS uses protein sequence features coupled with a large-margin classifier. CaMELS models the binding site prediction problem using multiple instance machine learning with a custom optimization algorithm which allows more effective learning over imprecisely annotated CaM-binding sites during training. CaMELS has been extensively benchmarked using a variety of data sets, mutagenic studies, proteome-wide Gene Ontology enrichment analyses and protein structures. Our experiments indicate that CaMELS outperforms simple motif-based search and other existing methods for interaction and binding site prediction. We have also found that the whole sequence of a protein, rather than just its binding site, is important for predicting its interaction with CaM. Using the machine learning model in CaMELS, we have identified important features of protein sequences for CaM interaction prediction as well as characteristic amino acid sub-sequences and their relative position for identifying CaM binding sites. Python code for training and evaluating CaMELS together with a webserver implementation is available at the URL: http://faculty.pieas.edu.pk/fayyaz/software.html#camels. © 2017 Wiley Periodicals, Inc.
Program of experiments for the operating phase of the Underground Research Laboratory
International Nuclear Information System (INIS)
Simmons, G.R.; Bilinsky, D.M.; Davison, C.C.; Gray, M.N.; Kjartanson, B.H.; Martin, C.D.; Peters, D.A.; Lang, P.A.
1992-09-01
The Underground Research Laboratory (URL) is one of the major research and development facilities that AECL Research has constructed in support of the Canadian Nuclear Fuel Waste Management Program. The URL is a unique geotechnical research facility constructed in previously undisturbed plutonic rock, which was well characterized before construction. The site evaluation and construction phases of the URL project have been completed and the operating phase is beginning. A program of operating phase experiments that address AECL's objectives for in situ testing has been selected. These experiments were subjected to an external peer review and a subsequent review by the URL Experiment Committee in 1989. The comments from the external peer review were incorporated into the experiment plans, and the revised experiments were accepted by the URL Experiment Committee. Summaries of both reviews are presented. The schedule for implementing the experiments and the quality assurance to be applied during implementation are also summarized. (Author) (9 refs., 11 figs.)
International Nuclear Information System (INIS)
Osawa, H.; Umeki, H.; Ota, K.; Hama, K.; Sawada, A.; Takeuchi, S.; Semba, T.; Takase, H.; McKinley, I.G.
2009-01-01
As site investigation proceeds and information obtained on geological environments increases, the characterization plan has to be iteratively reviewed and modified to reflect improved understanding. Such modification would also be needed when changes occur in technical or socio-political boundary conditions. JAEA teams involved in implementation of URL projects have used a geo-synthesis data flow diagram to integrate a huge amount of practical experience in order to carry out such management functions. However, much of this experience was gained in the past, when it was possible for staff to learn by taking leading roles in novel, complex and important projects and learn by successes - and mistakes - under boundary conditions that were much more casual than they are at present. It is necessary to transfer such tacit knowledge to implementing and regulatory organizations in a practical manner before it is lost with the retirement of senior staff. An option being examined involves application of advanced technology, termed the Information Synthesis and Interpretation System (ISIS), to capture experience using Knowledge Engineering methods. This is being tested for practical applicability in an exercise involving stepwise 'optimization' of a site characterization plan. (authors)
(reprocessed)CAGE peaks - FANTOM5 | LSDB Archive [Life Science Database Archive metadata
Lifescience Database Archive (English)
Full Text Available switchLanguage; BLAST Search Image Search Home About Archive Update History Data List Contact us FANTOM...g38/mm10). Data file File name: (reprocessed)CAGE_peaks (Homo sapiens) File URL: ftp://ftp.biosciencedbc.jp/archive/fantom...)CAGE_peaks (Mus musculus) File URL: ftp://ftp.biosciencedbc.jp/archive/fantom5/d...his Database Site Policy | Contact Us (reprocessed)CAGE peaks - FANTOM5 | LSDB Archive ...
(reprocessed)pooled_ctss - FANTOM5 | LSDB Archive [Life Science Database Archive metadata
Lifescience Database Archive (English)
Full Text Available switchLanguage; BLAST Search Image Search Home About Archive Update History Data List Contact us FANTOM...e: (reprocessed)pooled_ctss (Homo sapiens) File URL: ftp://ftp.biosciencedbc.jp/archive/fantom5/datafiles/re...) File URL: ftp://ftp.biosciencedbc.jp/archive/fantom5/datafiles/reprocessed/mm10...ory of This Database Site Policy | Contact Us (reprocessed)pooled_ctss - FANTOM5 | LSDB Archive ...
Efficient Web Vulnerability Detection Tool for Sleeping Giant-Cross Site Request Forgery
Parimala, G.; Sangeetha, M.; AndalPriyadharsini, R.
2018-04-01
Now day’s web applications are very high in the rate of usage due to their user friendly environment and getting any information via internet but these web applications are affected by lot of threats. CSRF attack is one of the serious threats to web applications which is based on the vulnerabilities present in the normal web request and response of HTTP protocol. It is hard to detect but hence still it is present in most of the existing web applications. In CSRF attack, without user knowledge the unwanted actions on a reliable websites are forced to happen. So it is placed in OWASP’s top 10 Web Application attacks list. My proposed work is to do a real time scan of CSRF vulnerability attack in given URL of the web applications as well as local host address for any organization using python language. Client side detection of CSRF is depended on Form count which is presented in that given web site.
A New and Improved MPB Web Site
Warner, Brian D.
2018-01-01
The Minor Planet Bulletin home page has a new URL: http://www.MinorPlanet.info/MPB/mpb.php. The new home page features free access (data rates may apply) to almost all papers from Volume 1 (1973) to present. Also included are a basic search feature that allows finding papers by title/abstract and/or authors and links to download the MPB authors guide and cumulative indices.
Main - RPSD | LSDB Archive [Life Science Database Archive metadata
Lifescience Database Archive (English)
Full Text Available switchLanguage; BLAST Search Image Search Home About Archive Update History Data ... as rice. Data file File name: rpsd_main_sjis.zip File URL: ftp://ftp.biosciencedbc.jp/archive/rpsd/LATEST/r.../ftp.biosciencedbc.jp/archive/rpsd/LATEST/rpsd_main_utf8.zip File size: 120 KB Simple search URL http://togo...nse Update History of This Database Site Policy | Contact Us Main - RPSD | LSDB Archive ...
Protocol - RPD | LSDB Archive [Life Science Database Archive metadata
Lifescience Database Archive (English)
Full Text Available switchLanguage; BLAST Search Image Search Home About Archive Update History Data ...e version) File URL: ftp://ftp.biosciencedbc.jp/archive/rpd/LATEST/rpd_protocol_jp.zip File size: 535 KB Fil...e name: rpd_protocol_en.zip (English version) File URL: ftp://ftp.biosciencedbc.jp/archiv...tabase Database Description Download License Update History of This Database Site Policy | Contact Us Protocol - RPD | LSDB Archive ...
Energy Technology Data Exchange (ETDEWEB)
Le Gal La Salle, Corinne; Rebeix, Romain; Lancelot, Joel [Universite de Nimes / Site GIS - 30035 Nimes cedex 01 (France); Aix-Marseille Universite, CEREGE UMR7330, 13545 Aix en Provence (France); Matray, Jean-Michel [IRSN, BP17 - 92262 Fontenay-aux-Roses Cedex (France); Bensenouci, Fethic [IRSN, BP17 - 92262 Fontenay-aux-Roses Cedex (France); IDES, UMR CNRS 8148 Universite Paris-Sud - 91405 Orsay Cedex (France); Michelot, Jean-Luc [IDES, UMR CNRS 8148 Universite Paris-Sud - 91405 Orsay Cedex (France); Dauzeres, Alexandre; Wittebroodt, Charles [IRSN, BP17 - 92262 Fontenay-aux-Roses Cedex (France); Frape, Shaun; ShouakarStash, Orphane [University of Waterloo, 200 University Avenue. West Waterloo, Ontario N2L 3G (Canada)
2013-07-01
Dissolved chloride in argillite pore water has been studied as a natural analogue for radionuclides potentially released from radioactive waste disposal. The Tournemire URL intersects impervious and compacted argillite. A previously obtained chloride concentration profile of intact rock is symmetric with a maximum concentration of 0.6±0.1 g/L, compared to 19 g/L for the original connate seawater. Dissolved chloride shows high δ{sup 37}Cl values, ranging between +6 and +80/00 vs. SMOC. The modeled profile considers diffusive exchange between connate seawater and meteoric freshwater. Transport parameters were obtained by radial diffusion experiments. Numerical modeling was performed with the coupled reactive-transport code Hytec. Simulations suggest a diffusive-exchange time of 85±10 Ma for Cl, which correlates with a major erosional period. Simulated δ{sup 37}Cl values between 1.002 and 1.003 agree with observed pore water δ{sup 37}Cl. This study strongly suggests that the dissolved chloride profile in the argillites results from diffusive exchange and indicates that unfractured argillites can provide good confinement. (authors)
Coupled HM modelling of the mine-by test at Meuse-Haute-Marne (MHM) URL France
International Nuclear Information System (INIS)
Yildizdag, K.; Shao, H.; Hesser, J.; Soennke, J.; Noiret, A.
2012-01-01
Document available in extended abstract form only. In order to test the feasibility of disposing High-Level and Long-Lived Wastes (HLW-LL) in Callovo- Oxfordian clay formation (COx), the French National Radioactive Waste Management Agency (ANDRA) has carried out scientific and engineering investigations in the Meuse-Haute-Marne Underground Research Laboratory (URL) since November 1999. The COx (Figure 1) is of a special interest because of its very favourable characteristics for being a possible host rock for the disposal of radioactive waste. The project OHZ (Observation and Monitoring of the EDZ) was initiated in 2008 by ANDRA. In the framework of this project, a Mine-by experiment was performed in the niche GCS. The excavation was started on 29.01.2008. Displacement and pore pressure evolution during the excavation was measured by different sensors. Within the cooperation between BGR and ANDRA numerical calculations have been done using the code RockFlow to understand the hydraulic and mechanical (HM) coupling mechanisms of Callovo-Oxfordian clay-stone observed during the Mine-by experiment. Modelling results: With regard to the bedding of COx a transverse isotropy approach was applied. Thus the anisotropy effects caused by the bedding have been considered in coupled HM models (Massmann, 2009). Intensive parameter studies in comparison with measured deformation and pore pressure data have been conducted to reduce modelling uncertainties. Fully saturated models yield very precise results in the far field wherein excavation effect has its lower impact. Rapid decline of pore pressure and continuously increasing deformation subsequent to excavation in the near field could not be interpreted even taking shrinkage and partially saturation into consideration. During the Mine-by test, overpressures on sidewalls and reduced pressures on roof and floor were measured due to the mechanical effect on pore pressure which is induced by the bedding. Good agreement between
PhishStorm: Detecting Phishing with Streaming Analytics
Marchal , Samuel; François , Jérôme; State , Radu; Engel , Thomas
2014-01-01
International audience; Despite the growth of prevention techniques, phishing remains an important threat since the principal countermeasures in use are still based on reactive URL blacklisting. This technique is inefficient due to the short lifetime of phishing Web sites, making recent approaches relying on real-time or proactive phishing URLs detection techniques more appropriate. In this paper we introduce PhishStorm, an automated phishing detection system that can analyse in real-time any...
All 5' EST - KOME | LSDB Archive [Life Science Database Archive metadata
Lifescience Database Archive (English)
Full Text Available switchLanguage; BLAST Search Image Search Home About Archive Update History Data ...n of data contents 5' EST sequences Data file File name: CSV: kome_est_5end_all.zip File URL: ftp://ftp.biosciencedbc.jp/archiv...fasta.zip File URL: ftp://ftp.biosciencedbc.jp/archive/kome/LATEST/kome_est_5end_...se Description Download License Update History of This Database Site Policy | Contact Us All 5' EST - KOME | LSDB Archive ...
All 3' EST - KOME | LSDB Archive [Life Science Database Archive metadata
Lifescience Database Archive (English)
Full Text Available switchLanguage; BLAST Search Image Search Home About Archive Update History Data ...n of data contents 3' EST sequences Data file File name: CSV: kome_est_3end_all.zip File URL: ftp://ftp.biosciencedbc.jp/archiv...fasta.zip File URL: ftp://ftp.biosciencedbc.jp/archive/kome/LATEST/kome_est_3end_...se Description Download License Update History of This Database Site Policy | Contact Us All 3' EST - KOME | LSDB Archive ...
About Libraries - AcEST | LSDB Archive [Life Science Database Archive metadata
Lifescience Database Archive (English)
Full Text Available switchLanguage; BLAST Search Image Search Home About Archive Update History Data ...ormat text file. Data file File name: acest_library.zip File URL: ftp://ftp.biosciencedbc.jp/archive/acest/L...ATEST/acest_library.zip File size: 2KB Simple search URL http://togodb.biosciencedbc.jp/togodb/view/archiv...s Database Database Description Download License Update History of This Database Site Policy | Contact Us About Libraries - AcEST | LSDB Archive ...
Czech Academy of Sciences Publication Activity Database
Kyselý, René
2010-01-01
Roč. 37, č. 6 (2010), s. 1241-1246 ISSN 0305-4403 Institutional research plan: CEZ:AV0Z80020508 Keywords : cattle (Bos taurus) * Chalcolithic * Central Europe * loose horns * hornlessness * pathology Subject RIV: AC - Archeology, Anthropology, Ethnology Impact factor: 1.710, year: 2010 http://www.sciencedirect.com/science?_ob=ArticleURL&_udi=B6WH8-4Y3KSMB-1&_user=10&_coverDate=06%2F30%2F2010&_rdoc=1&_fmt=high&_orig=search&_origin=search&_sort=d&_docanchor=&view=c&_acct=C000050221&_version=1&_urlVersion=0&_userid=10&md5=ca7f596eb156dedf387dad34ab953fe2&searchtype=a
GPCR Mutation information - GRIPDB | LSDB Archive [Life Science Database Archive metadata
Lifescience Database Archive (English)
Full Text Available switchLanguage; BLAST Search Image Search Home About Archive Update History Data List Contact us GRI...s and exposed in molecular surface. Data file File name: gripdb_mutation_info.zip File URL: ftp://ftp.biosciencedbc.jp/archive/gri...pdb/LATEST/gripdb_mutation_info.zip File size: 766 bytes Si...mple search URL http://togodb.biosciencedbc.jp/togodb/view/gripdb_mutation_info#en Data acquisition method P... Site Policy | Contact Us GPCR Mutation information - GRIPDB | LSDB Archive ...
International Nuclear Information System (INIS)
Nishio, Kazuhisa; Osawa, Hideaki
2016-01-01
Japan Atomic Energy Agency (JAEA) has promoted the Mizunami Underground Research Laboratory (Mizunami URL) as one of generic URL to perform basic research of waste disposal technology for about twenty years. JAEA had carried out consultation activities with local people and community from 1995 when the plan of Mizunami URL opened at the time, because an early approach of JAEA caused a sense of social distrust and concern, which the study area of Mizunami URL would be candidate site of real repository. In this paper, we conducted normative analysis intended for the consultation activities from a viewpoint of procedural justice and distributed justice, used as the social psychological framework in terms of public NIMBY facility. The results show that it is important to develop local partnership, composed of representative local people and organization, at early start in the light of procedural justice and to support deliberation regarding distributive justice and so on by local partnership in the aspect of information and financial administration. (author)
2013-09-09
... site. The URL for this survey site will also be advertised separately through media and social media... information on the proposed project, contact: Laura M. Koehly, Ph.D., Senior Investigator, Social and... in health conditions and associated risk factors; The role of friends, family, media, and health...
Thieffry, D; Salgado, H; Huerta, A M; Collado-Vides, J
1998-06-01
As one of the best-characterized free-living organisms, Escherichia coli and its recently completed genomic sequence offer a special opportunity to exploit systematically the variety of regulatory data available in the literature in order to make a comprehensive set of regulatory predictions in the whole genome. The complete genome sequence of E.coli was analyzed for the binding of transcriptional regulators upstream of coding sequences. The biological information contained in RegulonDB (Huerta, A.M. et al., Nucleic Acids Res.,26,55-60, 1998) for 56 different transcriptional proteins was the support to implement a stringent strategy combining string search and weight matrices. We estimate that our search included representatives of 15-25% of the total number of regulatory binding proteins in E.coli. This search was performed on the set of 4288 putative regulatory regions, each 450 bp long. Within the regions with predicted sites, 89% are regulated by one protein and 81% involve only one site. These numbers are reasonably consistent with the distribution of experimental regulatory sites. Regulatory sites are found in 603 regions corresponding to 16% of operon regions and 10% of intra-operonic regions. Additional evidence gives stronger support to some of these predictions, including the position of the site, biological consistency with the function of the downstream gene, as well as genetic evidence for the regulatory interaction. The predictions described here were incorporated into the map presented in the paper describing the complete E.coli genome (Blattner,F.R. et al., Science, 277, 1453-1461, 1997). The complete set of predictions in GenBank format is available at the url: http://www. cifn.unam.mx/Computational_Biology/E.coli-predictions ecoli-reg@cifn.unam.mx, collado@cifn.unam.mx
In situ stress determination research study
International Nuclear Information System (INIS)
Austin, W.G.; Thompson, P.M.
1994-01-01
The objectives of this study are to evaluate and implement rock stress determination instruments and techniques developed by Atomic Energy of Canada Limited (AECL) at its Underground Research Laboratory (URL) for use in jointed rock and to continue the development of analytical and interpretation methods for stress determination results including effects of scale, structure and anisotropy. Testing and evaluation of the instruments and methods developed at URL need to be done in a similar rock type prior to underground access at the Yucca Mountain Site Characterization Project
Database Dump - fRNAdb | LSDB Archive [Life Science Database Archive metadata
Lifescience Database Archive (English)
Full Text Available List Contact us fRNAdb Database Dump Data detail Data name Database Dump DOI 10.18908/lsdba.nbdc00452-002 De... data (tab separeted text) Data file File name: Database_Dump File URL: ftp://ftp....biosciencedbc.jp/archive/frnadb/LATEST/Database_Dump File size: 673 MB Simple search URL - Data acquisition...s. Data analysis method - Number of data entries 4 files - About This Database Database Description Download... License Update History of This Database Site Policy | Contact Us Database Dump - fRNAdb | LSDB Archive ...
Database Description - NBDC NikkajiRDF | LSDB Archive [Life Science Database Archive metadata
Lifescience Database Archive (English)
Full Text Available or Name: Japan Science and Technology Agency (JST) Creator Affiliation: Contact a...e information Database maintenance site Japan Science and Technology Agency (JST) URL of the original websit
A study about long-term deformation of soft rock. 2
International Nuclear Information System (INIS)
Inoue, Hiroyuki; Yoshino, Naoto; Miyanomae, Shunichi; Mizutani, Kazuhiko; Noda, Kenji
2004-02-01
In this study, the laboratory mechanical tests of sedimentary soft rock sampled at Horonobe area in Hokkaido prefecture were conducted in order to build the confidence of Okubo model for long term deformation of sedimentary rock. And the stability of rock around tunnel in building under the condition assumed the underground of Horonobe area was examined by numerical simulation using information of boring data obtained before 2002 year. As a result, authors could obtain many values of parameter in Okubo model under various conditions. These conditions have the difference of temperature and water saturation. In addition, the life time in creep predicted by Okubo model could be compared with the real one. And numerical simulations, assuming various conditions such as stiffness of buffer material and yielding of support, had been carried out to evaluate the long-term stability of rock surrounding buffer material. Results show the decreasing tendency of time dependency of rock. (author)
Inter-disciplinary Interactions in Underground Laboratories
Wang, J. S.; Bettini, A.
2010-12-01
Many of underground facilities, ranging from simple cavities to fully equipped laboratories, have been established worldwide (1) to evaluate the impacts of emplacing nuclear wastes in underground research laboratories (URLs) and (2) to measure rare physics events in deep underground laboratories (DULs). In this presentation, we compare similarities and differences between URLs and DULs in focus of site characterization, in quantification of quietness, and in improvement of signal to noise ratios. The nuclear waste URLs are located primarily in geological medium with potentials for slow flow/transport and long isolation. The URL medium include plastic salt, hard rock, soft clay, volcanic tuff, basalt and shale, at over ~500 m where waste repositories are envisioned to be excavated. The majority of URLs are dedicated facilities excavated after extensive site characterization. The focuses are on fracture distributions, heterogeneity, scaling, coupled processes, and other fundamental issues of earth sciences. For the physics DULs, the depth/overburden thickness is the main parameter that determines the damping of cosmic rays, and that, consequently, should be larger than, typically, 800m. Radioactivity from rocks, neutron flux, and radon gas, depending on local rock and ventilation conditions (largely independent of depth), are also characterized at different sites to quantify the background level for physics experiments. DULs have been constructed by excavating dedicated experimental halls and service cavities near to a road tunnel (horizontal access) or in a mine (vertical access). Cavities at shallower depths are suitable for experiments on neutrinos from artificial source, power reactors or accelerators. Rocks stability (depth dependent), safe access, and utility supply are among factors of main concerns for DULs. While the focuses and missions of URLs and DULs are very different, common experience and lessons learned may be useful for ongoing development of new
Czech Academy of Sciences Publication Activity Database
Kyselý, René
2008-01-01
Roč. 35, č. 1 (2008), s. 143-157 ISSN 0305-4403 Institutional research plan: CEZ:AV0Z80020508 Keywords : amphibians * common frog (Rana temporaria) * prehistoric food * anatomy representation * seasonality * chalcolithic * Central Europe Subject RIV: EG - Zoology Impact factor: 1.779, year: 2008 http://www.sciencedirect.com/science?_ob=ArticleURL&_udi=B6WH8-4NT57V1-1&_user=10&_rdoc=1&_fmt=&_orig=search&_sort=d&view=c&_acct=C000050221&_version=1&_urlVersion=0&_userid=10&md5=393499f111a5c12f133425d45f4f6f01
MetExploreViz: web component for interactive metabolic network visualization.
Chazalviel, Maxime; Frainay, Clément; Poupin, Nathalie; Vinson, Florence; Merlet, Benjamin; Gloaguen, Yoann; Cottret, Ludovic; Jourdan, Fabien
2017-09-15
MetExploreViz is an open source web component that can be easily embedded in any web site. It provides features dedicated to the visualization of metabolic networks and pathways and thus offers a flexible solution to analyze omics data in a biochemical context. Documentation and link to GIT code repository (GPL 3.0 license)are available at this URL: http://metexplore.toulouse.inra.fr/metexploreViz/doc /. Tutorial is available at this URL. © The Author (2017). Published by Oxford University Press. All rights reserved. For Permissions, please email: journals.permissions@oup.com
Mine-by experiment final design report
International Nuclear Information System (INIS)
Read, R.S.; Martin, C.D.
1991-12-01
The Underground Research Laboratory (URL) Mine-by Experiment is designed to provide information on rock mass response to excavation that will be used to assess important aspects of the design of a nuclear fuel waste disposal vault in a granitic pluton. The final experiment design is the result of a multidisciplinary approach, drawing on experience gained at other sites as well as the URL, and using both internal expertise and the external consultants. The final experiment design, including details on characterization, construction, instrumentation, and numerical modelling, is presented along with final design drawings
2011-01-06
... Web site, http://www.grants.gov , in accordance with the policy directive issued by the Office of... posted at http://www.grants.gov by following the universal resource locator (URL) link included in the synopsis, or by visiting ETA's Web site at http://www.doleta.gov . DATES: Effective Date: January 6, 2011...
International Nuclear Information System (INIS)
Gascoyne, M.; Kotzer, T.
1995-09-01
This review examines isotopic methods used to determine groundwater sources, residence times and processes of geochemical evolution that have been published in the international literature, with specific reference to AECL's experience in these methods and applications to groundwaters at the Underground Research Laboratory (URL), Manitoba. The program of groundwater sampling and analysis currently being planned for the URL area over the next several years will concentrate on specific isotopic measurements that may assist in understanding the groundwater flow system at the URL site. These results will add to the existing data for the URL area and indicate which isotopes are most useful when applied to the known groundwater flow system of the URL. This program of study is especially important because it not only uses standard geochemical and isotopic measurements (e.g., major ion, trace elements, 2 H/ 18 O, 14 C, 34 S) of groundwaters, but will determine values of more exotic and unusual ratios, such as 6 Li/ 7 Li, and B 11 /B 10 , whose potential for understanding groundwater geochemical evolution is largely unknown at present. In addition, the more established but equally complex methods of isotopic analysis, to determine 3 He/ 4 He, 36 Cl/Cl and 129 I/I, will be used to assess their potential for adding to the hydrogeochemical understanding of flow paths in crystalline rock. (author). 182 refs., 11 tabs., 27 figs
... URL of this page: https://medlineplus.gov/faq/framing.html I'd like to link to MedlinePlus, ... M. encyclopedia. Our license agreements do not permit framing of their content from our site. For more ...
... GO About MedlinePlus Site Map FAQs Customer Support Health Topics Drugs & Supplements Videos & Tools Español You Are Here: Home → Medical Encyclopedia → Food additives URL of this page: //medlineplus.gov/ency/article/ ...
Antibiotic Resistance: MedlinePlus Health Topic
... GO GO About MedlinePlus Site Map FAQs Customer Support Health Topics Drugs & Supplements Videos & Tools Español You Are Here: Home → Health Topics → Antibiotic Resistance URL of this page: https://medlineplus.gov/antibioticresistance. ...
... GO About MedlinePlus Site Map FAQs Customer Support Health Topics Drugs & Supplements Videos & Tools Español You Are Here: Home → Medical Encyclopedia → Acute mountain sickness URL of this page: //medlineplus.gov/ency/article/ ...
International Nuclear Information System (INIS)
Seno, Shoji; Nakajima, Makoto; Toida, Masaru; Kunimaru, Takanori; Watanabe, Kunio; Sohail Ahmed Rai
2009-12-01
Horonobe Underground Research Center has carried out the Horonobe Underground Research Laboratory Project which is a comprehensive research project to investigate the deep geological environment within sedimentary rock. In this project, long-term observation of the pore water pressure has been conducted with monitoring systems introduced in 9 of 11 boreholes drilled in phase I (surface-based investigation). Since August 2003 the monitoring systems have been settled successively in the boreholes, and a certain amount of the pore water pressure data has been already accumulated. Using 6 borehole data (HDB-1,3,6,7,8,9) among this, this report summarized the result of a study on reciprocal relation of pore water pressure to investigate the hydrogeological environment of this site. At first, to exclude the influences of working of nature such as tide and atmospheric pressure from the source data, an analysis with Bayesian model was progressed. As the result of the estimation of these influences calculated by BAYTAP-G (Bayesian Tidal Analysis Program Grouping Model), it was found that the influence of the atmospheric pressure was comparatively large and that of tide was comparatively small. Secondly, an analysis on the reciprocal relation of the pore water pressure was carried out to investigate the relation between the different depth points of the same borehole and the relation between different boreholes. As the result of the calculations with genetic algorithm (GA) and neural network models (BPANN, GAANN), it was found that estimation by GA models was better than other models in the case where analyzing data included radical changes. And the result also showed that in regions lower than GL.-400m of HDB-3,6,7,8, the pore water pressures change in the same manner. These results indicate the effectiveness of this analysis method. (author)
... GO About MedlinePlus Site Map FAQs Customer Support Health Topics Drugs & Supplements Videos & Tools Español You Are Here: Home → Medical Encyclopedia → Calorie count - fast food URL of this page: //medlineplus.gov/ency/patientinstructions/ ...
Study on evaluation method for heterogeneous sedimentary rocks based on forward model
International Nuclear Information System (INIS)
Masui, Yasuhiro; Kawada, Koji; Katoh, Arata; Tsuji, Takashi; Suwabe, Mizue
2004-02-01
It is very important to estimate the facies distribution of heterogeneous sedimentary rocks for geological disposal of high level radioactive waste. The heterogeneousness of sedimentary rocks is due to variable distribution of grain size and mineral composition. The objective of this study is to establish the evaluation method for heterogeneous sedimentary rocks based on forward model. This study consisted of geological study for Horonobe area and the development of soft wear for sedimentary model. Geological study was composed of following items. 1. The sedimentary system for Koetoi and Wakkanai formations in Horonobe area was compiled based on papers. 2. The cores of HDB-1 were observed mainly from sedimentological view. 3. The facies and compaction property of argillaceous rocks were studied based on physical logs and core analysis data of wells. 4. The structure maps, isochrone maps, isopach maps and restored geological sections were made. The soft wear for sedimentary model to show sedimentary system on a basin scale was developed. This soft wear estimates the facies distribution and hydraulic conductivity of sedimentary rocks on three dimensions scale by numerical simulation. (author)
Energy Technology Data Exchange (ETDEWEB)
Gascoyne, M [Atomic Energy of Canada Ltd., Pinawa, MB (Canada). Whiteshell Labs.; Kotzer, T
1995-09-01
This review examines isotopic methods used to determine groundwater sources, residence times and processes of geochemical evolution that have been published in the international literature, with specific reference to AECL`s experience in these methods and applications to groundwaters at the Underground Research Laboratory (URL), Manitoba. The program of groundwater sampling and analysis currently being planned for the URL area over the next several years will concentrate on specific isotopic measurements that may assist in understanding the groundwater flow system at the URL site. These results will add to the existing data for the URL area and indicate which isotopes are most useful when applied to the known groundwater flow system of the URL. This program of study is especially important because it not only uses standard geochemical and isotopic measurements (e.g., major ion, trace elements, {sup 2}H/{sup 18}O, {sup 14}C, {sup 34}S) of groundwaters, but will determine values of more exotic and unusual ratios, such as {sup 6}Li/{sup 7}Li, and B{sup 11}/B{sup 10}, whose potential for understanding groundwater geochemical evolution is largely unknown at present. In addition, the more established but equally complex methods of isotopic analysis, to determine {sup 3}He/{sup 4}He, {sup 36}Cl/Cl and {sup 129}I/I, will be used to assess their potential for adding to the hydrogeochemical understanding of flow paths in crystalline rock. (author). 182 refs., 11 tabs., 27 figs.
75 FR 23227 - Trade Adjustment Assistance for Farmers
2010-05-03
... DEPARTMENT OF AGRICULTURE Foreign Agricultural Service Trade Adjustment Assistance for Farmers AGENCY: Foreign Agricultural Service, USDA. ACTION: Notice. The Administrator, Foreign Agricultural... be obtained at the Web site for the Trade Adjustment Assistance for Farmers program. The URL is http...
75 FR 23226 - Trade Adjustment Assistance for Farmers
2010-05-03
... DEPARTMENT OF AGRICULTURE Foreign Agricultural Service Trade Adjustment Assistance for Farmers AGENCY: Foreign Agricultural Service, USDA. ACTION: Notice. The Administrator, Foreign Agricultural... Web site for the Trade Adjustment Assistance for Farmers program. The URL is http://www.fas.usda.gov...
PSCID List - PSCDB | LSDB Archive [Life Science Database Archive metadata
Lifescience Database Archive (English)
Full Text Available switchLanguage; BLAST Search Image Search Home About Archive Update History Data ...t.zip File URL: ftp://ftp.biosciencedbc.jp/archive/pscdb/LATEST/pscdb_pscid_list.zip File size: 24.4 KB Simp...nd-binding sites About This Database Database Description Download License Update History of This Database Site Policy | Contact Us PSCID List - PSCDB | LSDB Archive ...
International Nuclear Information System (INIS)
Ababou, R.; Canamon, I.; Poutrel, A.
2010-01-01
Document available in extended abstract form only. The present work, carried out in the Underground Research Laboratory at Bure operated by Andra, focuses on the hydraulic homogenization (up-scaling) of the Excavated Damaged Zone (EDZ) around a cylindrical excavation, taking into account the specific structure of the micro-fissures and of the larger fractures induced by the excavation, as well as the permeability of the intact rock (the Callovo-Oxfordian clay-stone, 130 m thick, and located between 400 m and 600 m depth at this site). Two types of discontinuities are distinguished: (1) a statistically isotropic network of micro-fissures, and (2) a quasi-periodic set of complex shaped, curved fractures (chevron pattern). Hydraulic up-scaling are expressed in terms of effective macro-permeability tensors, and they are compared, in the final stage of this work, against in situ data, including permeability profiles along boreholes. We firstly consider a 3D stretch of a cylindrical gallery with: (i) section length L = 20 m; (ii) drift diameter = 4 m; (iii) thickness of the annular EDZ around the drift = 4 m. The domain of investigation is a 3D rectangular box of size 20 x 13 x 13 m, which encloses the drift and its EDZ. The transverse scales correspond to those of the experimental drifts and EDZ observed at the URL site. - Statistical network of micro-fissures (randomly oriented plane discs). The micro-fissures and small fractures are modeled as statistical plane discs, with randomly isotropic orientations, and radially decreasing density and diameters away from the drift wall. - Deterministic set of curved fractures ('herringbone' or 'chevron' pattern).The extensive shear fractures ('chevrons') are modeled as a periodic set of mathematical surfaces (generalized elliptical conoids) analogous to those observed in the Bure drifts The method adopted here for hydraulic homogenization of a 3D porous fractured rock is based on a &apos
Protein - TP Atlas | LSDB Archive [Life Science Database Archive metadata
Lifescience Database Archive (English)
Full Text Available switchLanguage; BLAST Search Image Search Home About Archive Update History Data ...p_atlas_protein.zip File URL: ftp://ftp.biosciencedbc.jp/archive/tp_atlas/LATEST/...story of This Database Site Policy | Contact Us Protein - TP Atlas | LSDB Archive ...
2011-01-25
... SOCIAL SECURITY ADMINISTRATION [Docket No. SSA-2011-0009] Service Contract Inventory and... providing the Web site address (URL) for the Service Contract Inventory and the corresponding point of... Law 111-117. FOR FURTHER INFORMATION CONTACT: Dennis Wilhite, Director, Office of Budget Execution and...
Disaster Preparation and Recovery - Multiple Languages
... MedlinePlus Search Search MedlinePlus GO GO About MedlinePlus Site Map FAQs Customer Support Health Topics Drugs & Supplements Videos & Tools You Are Here: Home → Multiple Languages → All Health Topics → Disaster Preparation and Recovery URL of this page: https:// ...
Lifescience Database Archive (English)
Full Text Available SH (Link to library) SHA665 (Link to dictyBase) - - - Contig-U15540-1 - (Link to Or...iginal site) - - SHA665Z 676 - - - - Show SHA665 Library SH (Link to library) Clone ID SHA665 (Link to dicty...Base) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15540-1 Original site URL http://dictycdb.b...TQIDDKTGIFDSQRFLAFNNPQAMSKYESYRIYIHPSLGY SGNAKRFKQQPDVNEKALILDGNVYDGHLNPIYNCKICTE...ACWNLLEPMHR NYYQPIQFKLPSFPDTSLPITQIDDKTGIFDSQRFLAFNNPQAMSKYESYRIYIHPSLGY SGNAKRFKQQPDVNEKALILDGNVYDGHLNPIYNCKICT
Lifescience Database Archive (English)
Full Text Available CH (Link to library) CHE687 (Link to dictyBase) - - - Contig-U16336-1 - (Link to Or...iginal site) CHE687F 622 - - - - - - Show CHE687 Library CH (Link to library) Clone ID CHE687 (Link to dicty...Base) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16336-1 Original site URL http://dictycdb.b...KFINQCINEIKEELKGDMQKKTVAVQKLTYIQ MLGFDISWASFKIVEVMSCNKFSSKRIGYLAASQSFNEGTDVIVLATHQIRKDFLSSNQS EAYLALNCLSNICT...LGFDISWASFKIVEVMSCNKFSSKRIGYLAASQSFNEGTDVIVLATHQIRKDFLSSNQS EAYLALNCLSNICTTDLARELANDILTLLSTQKTHILKRAITVLYKIF
Lifescience Database Archive (English)
Full Text Available SS (Link to library) SSA423 (Link to dictyBase) - - - - SSA423F (Link to Original s...ite) SSA423F 443 - - - - - - Show SSA423 Library SS (Link to library) Clone ID SSA423 (Link to dictyBase) Atlas ID - NBRP ID - dict...yBase ID - Link to Contig - Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/...FIIGFFLCLTVFLTFVNSSEIDHQYSLTSSINGSSSGVSNSTDNTGCGEYTSCGDCREDK GCVWCGSEGICTEGTFYGTKPLNINGACKDFMWMQCKIQGRWAILIA...VSNSTDNTGCGEYTSCGDCREDK GCVWCGSEGICTEGTFYGTKPLNINGACKDFMWMQCKIQGRWAILIAAGGAFLIIVFFFI CLCCCCCRRKKDKHYHNIQDDET
Lifescience Database Archive (English)
Full Text Available CH (Link to library) CHK172 (Link to dictyBase) - - - Contig-U11104-1 - (Link to Or...iginal site) CHK172F 626 - - - - - - Show CHK172 Library CH (Link to library) Clone ID CHK172 (Link to dicty...Base) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U11104-1 Original site URL http://dictycdb.b...HEECKTQGNNYFKQSQYMDAIRCYTQAIELSNGTIA AYYGNRAAAYLAICTKSSLQDSIKDSLKAIELERSFIKGYTRASKAYIHLAQYDQAASII VRGLVFDPRN...KMDHEECKTQGNNYFKQSQYMDAIRCYTQAIELSNGTIA AYYGNRAAAYLAICTKSSLQDSIKDSLKAIELERSFIKGYT
Lifescience Database Archive (English)
Full Text Available CH (Link to library) CHA557 (Link to dictyBase) - - - Contig-U15635-1 - (Link to Or...iginal site) CHA557F 620 - - - - - - Show CHA557 Library CH (Link to library) Clone ID CHA557 (Link to dicty...Base) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15635-1 Original site URL http://dictycdb.b...HSIEIGKVEILPNSLIGIDEDGVIQHMKSN YEDLKQLEKDVTMICTDNGINEQESVIDMGNKFLIPGFIDTHAHAPQYHNAGTGTDLPLL KWLEKYTFPVESKFKD...EIGKVEILPNSLIGIDEDGVIQHMKSN YEDLKQLEKDVTMICTDNGINEQESVIDMGNKFLIPGFIDTHAHAPQYHNAGT
Lifescience Database Archive (English)
Full Text Available SL (Link to library) SLA117 (Link to dictyBase) - - - Contig-U15540-1 - (Link to Or...iginal site) - - SLA117Z 649 - - - - Show SLA117 Library SL (Link to library) Clone ID SLA117 (Link to dicty...Base) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15540-1 Original site URL http://dictycdb.b...--EPMHRNYYQPIQFKLPSFPDTSLPITQIDDKTGIFDSQRFLAFNNPQAMSKYESYRI YIHPSLGYSGNAKRFKQQPDVNEKALILDGNVYDGHLNPIYNCKICTE...SYRI YIHPSLGYSGNAKRFKQQPDVNEKALILDGNVYDGHLNPIYNCKICTEYYQTKSYFSANP HAKGKVLLVKNNILTRVKDGGFTLSLKPMCCSGHNSHIPLYF
[Hydrogen systems analysis, education, and outreach
Energy Technology Data Exchange (ETDEWEB)
None
1998-01-01
This paper illustrates a search of web sites on the keyword, Hydrogen, and a second search combining keywords, Hydrogen and Renewable Energy. Names, addresses, and E-mail addresses or web site URLs are given for a number of companies and government or commercial organizations dealing with hydrogen fuel cells. Finally, brief summaries are given on hydrogen research projects at the National Renewable Energy Laboratory.
Update History of This Database - KOME | LSDB Archive [Life Science Database Archive metadata
Lifescience Database Archive (English)
Full Text Available List Contact us KOME Update History of This Database Date Update contents 2014/10/22 The URL of the whole da...site is opened. 2003/07/18 KOME ( http://cdna01.dna.affrc.go.jp/cDNA/ ) is opened. About This Database Dat...abase Description Download License Update History of This Database Site Policy | Contact Us Update History of This Database - KOME | LSDB Archive ...
2013-04-03
... education, training, and experience to evaluate scientific and technical information related to the design... Web site URL: http://www.ioos.noaa.gov/advisorycommittee . For the public unable to access the... upgrade of technology components of IOOS; identification of end-user communities, their needs for...
Solubility - eSOL | LSDB Archive [Life Science Database Archive metadata
Lifescience Database Archive (English)
Full Text Available switchLanguage; BLAST Search Image Search Home About Archive Update History Data ...ta file File name: esol.zip File URL: ftp://ftp.biosciencedbc.jp/archive/esol/LAT... License Update History of This Database Site Policy | Contact Us Solubility - eSOL | LSDB Archive ...
... About MedlinePlus Show Search Search MedlinePlus GO GO About MedlinePlus Site Map FAQs Customer Support Health Topics Drugs & Supplements Videos & Tools Español You Are Here: Home → Medical Encyclopedia → Port-wine stain URL of this page: //medlineplus.gov/ency/ ...
International Nuclear Information System (INIS)
Saegusa, Hiromitsu; Takeuchi, Shinji; Maekawa, Keisuke; Osawa, Hideaki; Semba, Takeshi
2011-01-01
It is important for site characterization projects to manage the decision-making process with transparency and traceability and to transfer the technical know-how accumulated during the research and development to the implementing phase and to future generations. The modeling for a geological environment is to be used to synthesize investigation results. Evaluation of the impact of uncertainties in the model is important to identify and prioritize key issues for further investigations. Therefore, a plan for site characterization should be made based on the results of the modeling. The aim of this study is to support for the planning of initial surface-based site characterization based on the technical know-how accumulated from the Mizunami Underground Research Laboratory Project and the Horonobe Underground Research Laboratory Project. These projects are broad scientific studies of the deep geological environment that are a basis for research and development for the geological disposal of high-level radioactive wastes. In this study, the work-flow of the groundwater flow modeling, which is one of the geological environment models, and is to be used for setting the area for the geological environment modeling and for groundwater flow characterization, and the related decision-making process using literature data have been summarized. (author)
Construction of full-scale shaft seals in crystalline rock
International Nuclear Information System (INIS)
Martino, J.B.; Dixon, D.A.; Onagi, D.; Kim, C-S; Holowick, B.
2011-01-01
The Underground Research Laboratory (URL) was constructed to investigate concepts related to geological disposal of used nuclear fuel. This involved investigating the rock mass by undertaking in situ experiments using a multi disciplinary technical approach. The decision was made in 2003 to close the URL. Part of the closure process involved installing seals in the access and ventilation shafts at locations where they intersected an ancient thrust fault (Fracture Zone 2 -- FZ2). FZ2 is an active hydraulic pathway in the Lac du Bonnet batholith and this feature is the dominating structural and hydrogeological feature at the URL site. Above FZ2 the groundwater has a low salinity and is dominated by surface-related processes. With increasing depth in the batholith, surface-related effects decrease and the salinity of the groundwater increases to 90 g/L total dissolved solids. The decision to install the seals was made as part of the due diligence for the site closure to ensure that the saline groundwater located at depth down strike and below the thrust fault would not enter the closed underground openings and mix with less saline shallow groundwater. The construction of each seal involved the installation of a heavily reinforced low alkalinity concrete component keyed into the surrounding rock. The concrete supported and restrained a central clay-sand component, which was capped by an unreinforced concrete component. The clay-sand component spans the exposure of the thrust fault in each shaft. This paper describes the construction of the main shaft seal and the ventilation shaft seal. The construction of the shaft seals at the URL was part of the Nuclear Legacy Liabilities Program (NLLP) being funded by Natural Resources Canada (NRCan). (author)
Construction of full-scale shaft seals in crystalline rock
Energy Technology Data Exchange (ETDEWEB)
Martino, J.B.; Dixon, D.A.; Onagi, D.; Kim, C-S; Holowick, B. [Atomic Energy of Canada Limited, Pinawa, MB (Canada)
2011-07-01
The Underground Research Laboratory (URL) was constructed to investigate concepts related to geological disposal of used nuclear fuel. This involved investigating the rock mass by undertaking in situ experiments using a multi disciplinary technical approach. The decision was made in 2003 to close the URL. Part of the closure process involved installing seals in the access and ventilation shafts at locations where they intersected an ancient thrust fault (Fracture Zone 2 -- FZ2). FZ2 is an active hydraulic pathway in the Lac du Bonnet batholith and this feature is the dominating structural and hydrogeological feature at the URL site. Above FZ2 the groundwater has a low salinity and is dominated by surface-related processes. With increasing depth in the batholith, surface-related effects decrease and the salinity of the groundwater increases to 90 g/L total dissolved solids. The decision to install the seals was made as part of the due diligence for the site closure to ensure that the saline groundwater located at depth down strike and below the thrust fault would not enter the closed underground openings and mix with less saline shallow groundwater. The construction of each seal involved the installation of a heavily reinforced low alkalinity concrete component keyed into the surrounding rock. The concrete supported and restrained a central clay-sand component, which was capped by an unreinforced concrete component. The clay-sand component spans the exposure of the thrust fault in each shaft. This paper describes the construction of the main shaft seal and the ventilation shaft seal. The construction of the shaft seals at the URL was part of the Nuclear Legacy Liabilities Program (NLLP) being funded by Natural Resources Canada (NRCan). (author)
2013-05-21
..., articulated model of partnership and coordination among the participating agencies and organizations; (2) A...). Under PROMISE, ED will fund States to develop and implement model demonstration projects (MDPs) that... the Transition to Adult Life. Retrieved from The Urban Institute Web site: www.urban.org/url.cfm?ID...
Underground Research Laboratories for Crystalline Rock and Sedimentary Rock in Japan
Energy Technology Data Exchange (ETDEWEB)
Shigeta, N.; Takeda, S.; Matsui, H.; Yamasaki, S.
2003-02-27
The Japan Nuclear Cycle Development Institute (JNC) has started two off-site (generic) underground research laboratory (URL) projects, one for crystalline rock as a fractured media and the other for sedimentary rock as a porous media. This paper introduces an overview and current status of these projects.
Images - RPSD | LSDB Archive [Life Science Database Archive metadata
Lifescience Database Archive (English)
Full Text Available switchLanguage; BLAST Search Image Search Home About Archive Update History Data ...ta file File name: rpsd_images.zip File URL: ftp://ftp.biosciencedbc.jp/archive/rpsd/LATEST/rpsd_images.zip ... History of This Database Site Policy | Contact Us Images - RPSD | LSDB Archive ...
Main - TP Atlas | LSDB Archive [Life Science Database Archive metadata
Lifescience Database Archive (English)
Full Text Available switchLanguage; BLAST Search Image Search Home About Archive Update History Data ...me: tp_atlas_en.zip File URL: ftp://ftp.biosciencedbc.jp/archive/tp_atlas/LATEST/...d License Update History of This Database Site Policy | Contact Us Main - TP Atlas | LSDB Archive ...
Main - PLACE | LSDB Archive [Life Science Database Archive metadata
Lifescience Database Archive (English)
Full Text Available switchLanguage; BLAST Search Image Search Home About Archive Update History Data ...ilable. Data file File name: place_main.zip File URL: ftp://ftp.biosciencedbc.jp/archive/place/LATEST/place_...se Update History of This Database Site Policy | Contact Us Main - PLACE | LSDB Archive ...
Lifescience Database Archive (English)
Full Text Available SS (Link to library) SSB171 (Link to dictyBase) ssb171 - - Contig-U02783-1 SSB171F ...nk to dictyBase) Atlas ID ssb171 NBRP ID - dictyBase ID - Link to Contig Contig-U02783-1 Original site URL h
2010-08-11
..., the academic community and the private sector in providing IOOS environmental information, products...-Private Use Policy is available for review at Web site URL: http://www.iooc.us . For the public unable to... Subcommittee on Ocean Science and Technology--Interagency Ocean Observation Committee Public-Private Use Policy...
Disease - MicrobeDB.jp | LSDB Archive [Life Science Database Archive metadata
Lifescience Database Archive (English)
Full Text Available switchLanguage; BLAST Search Image Search Home About Archive Update History Data ...File name: disease.tar.gz File URL: ftp://ftp.biosciencedbc.jp/archive/microbedb/...iption Download License Update History of This Database Site Policy | Contact Us Disease - MicrobeDB.jp | LSDB Archive ...
DEFF Research Database (Denmark)
Zwieb, Christian; Gorodkin, Jan; Knudsen, Bjarne
2003-01-01
Maintained at the University of Texas Health Science Center at Tyler, Texas, the tmRNA database (tmRDB) is accessible at the URL http://psyche.uthct.edu/dbs/tmRDB/tmRDB.html with mirror sites located at Auburn University, Auburn, Alabama (http://www.ag.auburn.edu/mirror/tmRDB/) and the Bioinforma......Maintained at the University of Texas Health Science Center at Tyler, Texas, the tmRNA database (tmRDB) is accessible at the URL http://psyche.uthct.edu/dbs/tmRDB/tmRDB.html with mirror sites located at Auburn University, Auburn, Alabama (http......://www.ag.auburn.edu/mirror/tmRDB/) and the Bioinformatics Research Center, Aarhus, Denmark (http://www.bioinf.au.dk/tmRDB/). The tmRDB collects and distributes information relevant to the study of tmRNA. In trans-translation, this molecule combines properties of tRNA and mRNA and binds several proteins to form the tmRNP. Related RNPs are likely...
Existing reflection seismic data re-processing
International Nuclear Information System (INIS)
Higashinaka, Motonori; Sano, Yukiko; Kozawa, Takeshi
2005-08-01
This document is to report the results of existing seismic data re-processing around Horonobe town, Hokkaido, Japan, which is a part of the Horonobe Underground Research Project. The main purpose of this re-processing is to recognize the subsurface structure of Omagari Fault and fold system around Omagari Fault. The seismic lines for re-processing are TYHR-A3 line and SHRB-2 line, which JAPEX surveyed in 1975. Applying weathering static correction using refraction analysis and noise suppression procedure, we have much enhanced seismic profile. Following information was obtained from seismic re-processing results. TYHR-A3 line: There are strong reflections, dipping to the west. These reflections are corresponding western limb of anticline to the west side of Omagari Fault. SHRB-2 line: There are strong reflections, dipping to the west, at CDP 60-140, while there are reflections, dipping to the east, to the east side of CDP 140. These reflections correspond to the western limb and the eastern limb of the anticline, which is parallel to Omagari FAULT. This seismic re-processing provides some useful information to know the geological structure around Omagari Fault. (author)
Lifescience Database Archive (English)
Full Text Available SF (Link to library) SFH450 (Link to dictyBase) - - - Contig-U13857-1 SFH450F (Link... to Original site) SFH450F 623 - - - - - - Show SFH450 Library SF (Link to library) Clone ID SFH450 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U13857-1 Original site URL http://dict...IMIIFLCLEATFDQPYHSIGGFIIVCSGYQLGQGIAGGAFSGIIPDVVHPSQSGI ASGWLGVGFSLGLLIGTILFGTLLEVKNVIHTWYLYGATIAFLGISALITICT...GTILFGTLLEVKNVIHTWYLYGATIAFLGISALITICTMHEDSND EWSFDGSLPSFFKSLHLPSSIYFNFYWVLITRFFNTLGIYMIFSFLLYFATDIIGQTNLM T
Lifescience Database Archive (English)
Full Text Available SF (Link to library) SFC488 (Link to dictyBase) - - - Contig-U10843-1 SFC488F (Link... to Original site) SFC488F 556 - - - - - - Show SFC488 Library SF (Link to library) Clone ID SFC488 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U10843-1 Original site URL http://dict...ETEITTESILGDGSFGTVYKGRCRLKDVAVKVMLKQVDQKTLTDFRKE VAIMSKIFHPNIVLFLGACTSTPGKLMICTELMKGNLESLLLDPMVKLPLITRMRMAKD...yhtht**KTMATQQQQQQQQQQQQQIKARKDIQIQQAQ SASDILGPPEISETEITTESILGDGSFGTVYKGRCRLKDVAVKVMLKQVDQKTLTDFRKE VAIMSKIFHPNIVLFLGACTSTPGKLMICT
Lifescience Database Archive (English)
Full Text Available CF (Link to library) CFH353 (Link to dictyBase) - - - Contig-U16205-1 CFH353Z (Link... to Original site) - - CFH353Z 625 - - - - Show CFH353 Library CF (Link to library) Clone ID CFH353 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16205-1 Original site URL http://dict...RDLYTVSQDVTKLAIQSAEQNGIVFLDEIDKICTSRESIKNGGDASTDGVQRDLLPI VEGCMVSTKYGQIDTSRILFIASGAFHNTKPSDLISELQGRLPIRVELKP...: ---RDLYTVSQDVTKLAIQSAEQNGIVFLDEIDKICTSRESIKNGGDASTDGVQRDLLPI VEGCMVSTKYGQIDTSRILFIASGAFHNTKPSDLISELQGRLPIR
Lifescience Database Archive (English)
Full Text Available SF (Link to library) SFF779 (Link to dictyBase) - - - Contig-U16255-1 SFF779Z (Link... to Original site) - - SFF779Z 731 - - - - Show SFF779 Library SF (Link to library) Clone ID SFF779 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16255-1 Original site URL http://dict...NATCSSLNCNAQQMSCKYVXQACHETSCCPDIPQCQIPATGGGPATGSATGQGTSGG TPGSCDKVNCPNGYICTIVNQLA...DIPQCQIPATGGGPATGSATGQGTSGG TPGSCDKVNCPNGYICTIVNQLAVCVSPSSSSSSSSSTTGSHTTTGGSTTGSH
Lifescience Database Archive (English)
Full Text Available SH (Link to library) SHL605 (Link to dictyBase) - - - Contig-U16336-1 - (Link to Or...iginal site) SHL605F 632 - - - - - - Show SHL605 Library SH (Link to library) Clone ID SHL605 (Link to dicty...Base) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16336-1 Original site URL http://dictycdb.b...VDLIRGIRNHKKNETKFINQCINEIKEELKGDMQKKTVAVQK LTYIQMLGFDISWASFKIVEVMSCNKFSSKRIGYLAASQSFNEGTDVIVLATHQIRKDFL SSNQSEAYLALNCLSNICT...KRIGYLAASQSFNEGTDVIVLATHQIRKDFL SSNQSEAYLALNCLSNICTTDLARELANDILTLLSTQKTHILKRAITVLYKIFLRYPESL RPAFPKLREKLDDPE
Lifescience Database Archive (English)
Full Text Available CH (Link to library) CHD753 (Link to dictyBase) - - - Contig-U15579-1 - (Link to Or...iginal site) - - CHD753Z 650 - - - - Show CHD753 Library CH (Link to library) Clone ID CHD753 (Link to dicty...Base) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15579-1 Original site URL http://dictycdb.b...---IQACGPDNNYQCEFVDKICNTTNDKCLVESCEIGFGCLAIPKNCNDNDPCTTDHCDP AIGCYYDKFDNCDACNAVDTCITNDLCFPRECNPRGNPPCLINPINCTSTDPCIFSYCEN GVCIPTYICT...NPRGNPPCLINPINCTSTDPCIFSYCEN GVCIPTYICTPTPSVTPTVTPTVTPTVTPTVTPTVTPTVTPTPTTTPTPSPTTVPPRPTP TPLPADPPPYDLEEGCLV
Lifescience Database Archive (English)
Full Text Available SS (Link to library) SSA581 (Link to dictyBase) - - - Contig-U12576-1 SSA581Z (Link... to Original site) - - SSA581Z 504 - - - - Show SSA581 Library SS (Link to library) Clone ID SSA581 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U12576-1 Original site URL http://dict...SARPLGVAMILIGIDDELGPQLFKVDPAGVFTGYKATAAGEK EQESTNFLEKKFKSNPQLSKDETIQMAISTLQSVLGADLKSSDLEIGICTMDNRKFVIMT DEDI...QHASARPLGVAMILIGIDDELGPQLFKVDPAGVFTGYKATAAGEK EQESTNFLEKKFKSNPQLSKDETIQMAISTLQSVLGADLKSSDLEIGICTMDNRKFVIMT D
Lifescience Database Archive (English)
Full Text Available SF (Link to library) SFI222 (Link to dictyBase) - - - Contig-U13893-1 - (Link to Or...iginal site) - - SFI222Z 716 - - - - Show SFI222 Library SF (Link to library) Clone ID SFI222 (Link to dicty...Base) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U13893-1 Original site URL http://dictycdb.b...LLSIVQLLMGEIPERNTFS QKQLKIALKPYFHLTEAVRVGDLGSFNQALEQNSDIFKSDQTFTLVQRLRSNVIKAGLKK LNTAYSRISFNDICT...SIVQLLMGEIPERNTFS QKQLKIALKPYFHLTEAVRVGDLGSFNQALEQNSDIFKSDQTFTLVQRLRSNVIKAGLKK LNTAYSRISFNDICT
Lifescience Database Archive (English)
Full Text Available SL (Link to library) SLE232 (Link to dictyBase) - - - Contig-U16255-1 SLE232F (Link... to Original site) SLE232F 614 - - - - - - Show SLE232 Library SL (Link to library) Clone ID SLE232 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16255-1 Original site URL http://dict...PSSGFTDFIPSNATCSSLNCNAQQMSCKYVQQACHETSCCPDIPQC QIPATGGGPATGSATGQGTSGGTPGSCDKVNCPNGYICTIVNQLAVCVSPSSSSSSSSST ...CHETSCCPDIPQC QIPATGGGPATGSATGQGTSGGTPGSCDKVNCPNGYICTIVNQLAVCVSPSSSSSSSSST TGSHTTTGGSTTGSHTTTGGSTTGSHTTTGGSA
Lifescience Database Archive (English)
Full Text Available VF (Link to library) VFJ144 (Link to dictyBase) - - - Contig-U12576-1 - (Link to Or...iginal site) - - VFJ144Z 698 - - - - Show VFJ144 Library VF (Link to library) Clone ID VFJ144 (Link to dicty...Base) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U12576-1 Original site URL http://dictycdb.b...IGIDDELGPQLFKVDPAGVFTGYKATAAGEKEQESTNFLEKK FKSNPQLSKDETIQMAISTLQSVLGADLKPSDLEIGICTMDNRKFVIMTDED Translated A...PQLFKVDPAGVFTGYKATAAGEKEQESTNFLEKK FKSNPQLSKDETIQMAISTLQSVLGADLKPSDLEIGICTMDNRKFVIMTDED Frame B: ---givrkyl*
Update History of This Database - PLACE | LSDB Archive [Life Science Database Archive metadata
Lifescience Database Archive (English)
Full Text Available switchLanguage; BLAST Search Image Search Home About Archive Update History Data ...List Contact us PLACE Update History of This Database Date Update contents 2016/08/22 The contact address is...s Database Database Description Download License Update History of Thi...s Database Site Policy | Contact Us Update History of This Database - PLACE | LSDB Archive ... ... changed. 2014/10/20 The URLs of the database maintenance site and the portal site are changed. 2014/07/17 PLACE English archi
International Nuclear Information System (INIS)
Tournassat, C.; Gaucher, E.; Pearson, F.J.; Mettler, S.; Wersin, P.
2005-01-01
Full text of publication follows: The Pore water Chemistry (PC-)experiment was initially designed to determine the processes that control the redox properties of pore water in the Opalinus Clay at the Mont Terri URL. However, changes in isotopic data and chemical parameters such as pH, alkalinity, dissolved methane, acetate and sulphate concentrations indicated unexpected microbial activity. The origin of the bacteria is not clear. In the light of published data, an indigenous origin cannot be ruled out. A combined biological and reactive transport model has been developed with the parallel PHAST software to simulate the processes that determine pore water chemistry. The influence of bacterial activity on the system is successfully modelled by considering different reaction pathways scenarios including aceto-genesis, methano-genesis, and methane/acetate oxidation coupled to sulphate reduction. Several conclusions can be clearly stated in the light of the simulation results: - The measured redox potentials (redox electrode) are in line with the S(-II)/S(+VI) redox system. - In the undisturbed pore water, S(-II) and S(+VI) activities are controlled by a mineral assemblage containing pyrite and a Fe carbonate (siderite or ankerite). pH is buffered by mineral phases and SO 4 2- concentration is inherited from the marine sedimentary rock. - Some local redox potentials in the sedimentary rock do not correspond to the measured redox potential; for instance, organic matter/HCO 3 - and CH 4 /HCO 3 - systems are not at equilibrium with the measured redox potential. - Redox disequilibrium can be exploited by micro-organisms as a source of energy for their metabolism. In this experiment CH 4 , acetate and other organic acids were produced and SO 4 2- was reduced to HS - . The redox properties of the system are then governed by kinetics rather than by thermodynamic equilibrium. The unexpected persistence of acetate in the borehole water is one of the consequences of these
PENGEMBANGAN SISTEM PENGENDALIAN TRAFFIC DAN WEB FILTERING PADA JARINGAN INTERNET BERBASIS HOTSPOT
Directory of Open Access Journals (Sweden)
Riska Robianto
2016-12-01
Full Text Available Utilization of Internet services to the hotspot network raises particular problems in traffic control and web filtering. Linux as an operating system that is open (open source, offers a variety of internet firewall systems to assist in the management of traffic, bandwidth, web filtering and one using Smoothwall Express to Linux which can convert a personal computer (PC to the Internet firewall reliable and stable. Smoothwall allows to integrated with the add-ons extends like AdvProxy and URL Filter to improve the performance of Smoohtwall and simplify configuration of the traffic control and web filtering. The research was conducted by collecting data from various sources related, then experiment with implementing Smoohtwall by adding add-ons extends to help administrators manage and regulate the bandwidth allocation of each client, block websites (URLs that are not needed. Based on these results bandwidth management can be divided equally and can block websites (URLs that are not needed like porn sites, warez, bad word, and also the quality of the network connection updatesites more stable.
Main - AT Atlas | LSDB Archive [Life Science Database Archive metadata
Lifescience Database Archive (English)
Full Text Available switchLanguage; BLAST Search Image Search Home About Archive Update History Data ... name: at_atlas_en.zip File URL: ftp://ftp.biosciencedbc.jp/archive/at_atlas/LATE... Database Description Download License Update History of This Database Site Policy | Contact Us Main - AT Atlas | LSDB Archive ...
Flat Files - JSNP | LSDB Archive [Life Science Database Archive metadata
Lifescience Database Archive (English)
Full Text Available switchLanguage; BLAST Search Image Search Home About Archive Update History Data ... Data file File name: jsnp_flat_files File URL: ftp://ftp.biosciencedbc.jp/archiv...his Database Database Description Download License Update History of This Database Site Policy | Contact Us Flat Files - JSNP | LSDB Archive ...
OPS index - KOME | LSDB Archive [Life Science Database Archive metadata
Lifescience Database Archive (English)
Full Text Available switchLanguage; BLAST Search Image Search Home About Archive Update History Data ...listed. Data file File name: kome_ops_index.zip File URL: ftp://ftp.biosciencedbc.jp/archive/kome/LATEST/kom...e History of This Database Site Policy | Contact Us OPS index - KOME | LSDB Archive ...
Database Description - TP Atlas | LSDB Archive [Life Science Database Archive metadata
Lifescience Database Archive (English)
Full Text Available tform for Drug Discovery, Informatics, and Structural Life Science Research Organization of Information and ...3(3):145-54. External Links: Original website information Database maintenance site National Institute of Genetics, Research Organiza...tion of Information and Systems (ROIS) URL of the original website http://www.tanpa
Patent urachus repair - slideshow
... Drugs & Supplements Videos & Tools About MedlinePlus Show Search Search MedlinePlus GO GO About MedlinePlus Site Map FAQs Customer Support Health Topics Drugs & Supplements Videos & Tools Español You Are Here: Home → Medical Encyclopedia → Patent urachus repair - series—Normal anatomy URL of this ...
... Drugs & Supplements Videos & Tools About MedlinePlus Show Search Search MedlinePlus GO GO About MedlinePlus Site Map FAQs Customer Support Health Topics Drugs & Supplements Videos & Tools Español You Are Here: Home → Medical Encyclopedia → Patent ductus arteriosus URL of this page: //medlineplus.gov/ ...
... Drugs & Supplements Videos & Tools About MedlinePlus Show Search Search MedlinePlus GO GO About MedlinePlus Site Map FAQs Customer Support Health Topics Drugs & Supplements Videos & Tools Español You Are Here: Home → Medical Encyclopedia → Patent urachus repair URL of this page: //medlineplus.gov/ ...
Body weight - Open TG-GATEs | LSDB Archive [Life Science Database Archive metadata
Lifescience Database Archive (English)
Full Text Available switchLanguage; BLAST Search Image Search Home About Archive Update History Data ...le URL: ftp://ftp.biosciencedbc.jp/archive/open-tggates/LATEST/open_tggates_body_...atabase Description Download License Update History of This Database Site Policy | Contact Us Body weight - Open TG-GATEs | LSDB Archive ...
Evidence for Enhanced Matrix Diffusion in Geological Environment
Sato, Kiminori; Fujimoto, Koichiro; Nakata, Masataka; Shikazono, Naotatsu
2013-01-01
Molecular diffusion in rock matrix, called as matrix diffusion, has been appreciated as a static process for elemental migration in geological environment that has been acknowledged in the context of geological disposal of radioactive waste. However, incomprehensible enhancement of matrix diffusion has been reported at a number of field test sites. Here, the matrix diffusion of saline water at Horonobe, Hokkaido, Japan is highlighted directly probing angstrom-scale pores on a field scale up to 1 km by positron--positronium annihilation spectroscopy. The first application of positron--positronium annihilation spectroscopy to field-scale geophysical research reveals the slight variation of angstrom-scale pores influenced by saline water diffusion with complete accuracy. We found widely interconnected 3 Å pores, which offer the pathway of saline water diffusion with the highly enhanced effective matrix diffusion coefficient of 4× 10-6 cm2 s-1. The present findings provide unambiguous evidence that the angstrom-scale pores enhance effective matrix diffusion on a field scale in geological environment.
Energy Technology Data Exchange (ETDEWEB)
Jobmann, M. (ed.) [DBE Technology GmbH, Peine (Germany)
2016-03-31
In the past, German research and development (R and D) activities regarding the disposal of radioactive waste, including spent nuclear fuel, focused mainly on domal rock salt because rock salt was the preferred host rock formation. In addition, generic R and D work regarding alternative host rocks (crystalline rocks and claystones) had been performed as well for a long time but with lower intensity. Around the year 2000, as a consequence of the moratorium on the Gorleben site, the Federal Government decided to have argillaceous rocks and crystalline rocks investigated in more detail. As Germany does not have any underground research and host rock characterization facilities, international cooperation received a high priority in the German R and D programme for high-level waste (HLW) disposal in order to increase the knowledge regarding alternative host rocks. Major cornerstones of the cooperation are joint projects and experiments conducted especially in underground research laboratories (URL) in crystalline rocks at the Grimsel Test Site (Switzerland) and the Hard Rock Laboratory (HRL) Aespoe(Sweden) and in argillaceous rocks at the URL Mont Terri (Switzerland) and Bure (France). In 2001, the topic of radioactive waste disposal was integrated into the agreement between the former Russian Ministry of Atomic Energy (Minatom, now Rosatom) and the German Ministry of Labor (BMWA), now Ministry of Economic Affairs and Energy (BMWi), on cooperation regarding R and D on the peaceful utilization of nuclear power (agreement on ''Wirtschaftlich-Technische Zusammenarbeit'' WTZ). The intention was to have a new and interesting opportunity for international R and D cooperation regarding HLW disposal in crystalline rocks and the unique possibility to perform site-specific work, to test the safety demonstration tools available, and to expand the knowledge to all aspects specific to these host rocks. Another motivation for joining this cooperation was the
Searching the protein structure database for ligand-binding site similarities using CPASS v.2
Directory of Open Access Journals (Sweden)
Caprez Adam
2011-01-01
Full Text Available Abstract Background A recent analysis of protein sequences deposited in the NCBI RefSeq database indicates that ~8.5 million protein sequences are encoded in prokaryotic and eukaryotic genomes, where ~30% are explicitly annotated as "hypothetical" or "uncharacterized" protein. Our Comparison of Protein Active-Site Structures (CPASS v.2 database and software compares the sequence and structural characteristics of experimentally determined ligand binding sites to infer a functional relationship in the absence of global sequence or structure similarity. CPASS is an important component of our Functional Annotation Screening Technology by NMR (FAST-NMR protocol and has been successfully applied to aid the annotation of a number of proteins of unknown function. Findings We report a major upgrade to our CPASS software and database that significantly improves its broad utility. CPASS v.2 is designed with a layered architecture to increase flexibility and portability that also enables job distribution over the Open Science Grid (OSG to increase speed. Similarly, the CPASS interface was enhanced to provide more user flexibility in submitting a CPASS query. CPASS v.2 now allows for both automatic and manual definition of ligand-binding sites and permits pair-wise, one versus all, one versus list, or list versus list comparisons. Solvent accessible surface area, ligand root-mean square difference, and Cβ distances have been incorporated into the CPASS similarity function to improve the quality of the results. The CPASS database has also been updated. Conclusions CPASS v.2 is more than an order of magnitude faster than the original implementation, and allows for multiple simultaneous job submissions. Similarly, the CPASS database of ligand-defined binding sites has increased in size by ~ 38%, dramatically increasing the likelihood of a positive search result. The modification to the CPASS similarity function is effective in reducing CPASS similarity scores
Update History of This Database - ASTRA | LSDB Archive [Life Science Database Archive metadata
Lifescience Database Archive (English)
Full Text Available search(/contents-en/) != -1 || url.search(/index-e.html/) != -1 ) { document.getElementById(lang).innerHTML=.../) != -1 ) { url = url.replace(-e.html,.html); document.getElementById(lang).innerHTML=[ Japanese |...en/,/jp/); document.getElementById(lang).innerHTML=[ Japanese | English ]; } else if ( url.search(//contents...//) != -1 ) { url = url.replace(/contents/,/contents-en/); document.getElementById(lang).innerHTML=[ Japanes...e(/contents-en/,/contents/); document.getElementById(lang).innerHTML=[ Japanese | English ]; } else if( url.
GOLD - MicrobeDB.jp | LSDB Archive [Life Science Database Archive metadata
Lifescience Database Archive (English)
Full Text Available search(/contents-en/) != -1 || url.search(/index-e.html/) != -1 ) { document.getElementById(lang).innerHTML=.../) != -1 ) { url = url.replace(-e.html,.html); document.getElementById(lang).innerHTML=[ Japanese |...en/,/jp/); document.getElementById(lang).innerHTML=[ Japanese | English ]; } else if ( url.search(//contents...//) != -1 ) { url = url.replace(/contents/,/contents-en/); document.getElementById(lang).innerHTML=[ Japanes...e(/contents-en/,/contents/); document.getElementById(lang).innerHTML=[ Japanese | English ]; } else if( url.
Download - TP Atlas | LSDB Archive [Life Science Database Archive metadata
Lifescience Database Archive (English)
Full Text Available search(/contents-en/) != -1 || url.search(/index-e.html/) != -1 ) { document.getElementById(lang).innerHTML=.../) != -1 ) { url = url.replace(-e.html,.html); document.getElementById(lang).innerHTML=[ Japanese |...en/,/jp/); document.getElementById(lang).innerHTML=[ Japanese | English ]; } else if ( url.search(//contents...//) != -1 ) { url = url.replace(/contents/,/contents-en/); document.getElementById(lang).innerHTML=[ Japanes...e(/contents-en/,/contents/); document.getElementById(lang).innerHTML=[ Japanese | English ]; } else if( url.
RMOS Contents - RMOS | LSDB Archive [Life Science Database Archive metadata
Lifescience Database Archive (English)
Full Text Available search(/contents-en/) != -1 || url.search(/index-e.html/) != -1 ) { document.getElementById(lang).innerHTML=.../) != -1 ) { url = url.replace(-e.html,.html); document.getElementById(lang).innerHTML=[ Japanese |...en/,/jp/); document.getElementById(lang).innerHTML=[ Japanese | English ]; } else if ( url.search(//contents...//) != -1 ) { url = url.replace(/contents/,/contents-en/); document.getElementById(lang).innerHTML=[ Japanes...e(/contents-en/,/contents/); document.getElementById(lang).innerHTML=[ Japanese | English ]; } else if( url.
Protein structure image - ConfC | LSDB Archive [Life Science Database Archive metadata
Lifescience Database Archive (English)
Full Text Available search(/contents-en/) != -1 || url.search(/index-e.html/) != -1 ) { document.getElementById(lang).innerHTML=.../) != -1 ) { url = url.replace(-e.html,.html); document.getElementById(lang).innerHTML=[ Japanese |...en/,/jp/); document.getElementById(lang).innerHTML=[ Japanese | English ]; } else if ( url.search(//contents...//) != -1 ) { url = url.replace(/contents/,/contents-en/); document.getElementById(lang).innerHTML=[ Japanes...e(/contents-en/,/contents/); document.getElementById(lang).innerHTML=[ Japanese | English ]; } else if( url.
Download - Dicty_cDB | LSDB Archive [Life Science Database Archive metadata
Lifescience Database Archive (English)
Full Text Available search(/contents-en/) != -1 || url.search(/index-e.html/) != -1 ) { document.getElementById(lang).innerHTML=.../) != -1 ) { url = url.replace(-e.html,.html); document.getElementById(lang).innerHTML=[ Japanese |...en/,/jp/); document.getElementById(lang).innerHTML=[ Japanese | English ]; } else if ( url.search(//contents...//) != -1 ) { url = url.replace(/contents/,/contents-en/); document.getElementById(lang).innerHTML=[ Japanes...e(/contents-en/,/contents/); document.getElementById(lang).innerHTML=[ Japanese | English ]; } else if( url.
Lifescience Database Archive (English)
Full Text Available search(/contents-en/) != -1 || url.search(/index-e.html/) != -1 ) { document.getElementById(lang).innerHTML=.../) != -1 ) { url = url.replace(-e.html,.html); document.getElementById(lang).innerHTML=[ Japanese |...en/,/jp/); document.getElementById(lang).innerHTML=[ Japanese | English ]; } else if ( url.search(//contents...//) != -1 ) { url = url.replace(/contents/,/contents-en/); document.getElementById(lang).innerHTML=[ Japanes...e(/contents-en/,/contents/); document.getElementById(lang).innerHTML=[ Japanese | English ]; } else if( url.
Lifescience Database Archive (English)
Full Text Available search(/contents-en/) != -1 || url.search(/index-e.html/) != -1 ) { document.getElementById(lang).innerHTML=.../) != -1 ) { url = url.replace(-e.html,.html); document.getElementById(lang).innerHTML=[ Japanese |...en/,/jp/); document.getElementById(lang).innerHTML=[ Japanese | English ]; } else if ( url.search(//contents...//) != -1 ) { url = url.replace(/contents/,/contents-en/); document.getElementById(lang).innerHTML=[ Japanes...e(/contents-en/,/contents/); document.getElementById(lang).innerHTML=[ Japanese | English ]; } else if( url.
Download - Gene Name Thesaurus | LSDB Archive [Life Science Database Archive metadata
Lifescience Database Archive (English)
Full Text Available search(/contents-en/) != -1 || url.search(/index-e.html/) != -1 ) { document.getElementById(lang).innerHTML=.../) != -1 ) { url = url.replace(-e.html,.html); document.getElementById(lang).innerHTML=[ Japanese |...en/,/jp/); document.getElementById(lang).innerHTML=[ Japanese | English ]; } else if ( url.search(//contents...//) != -1 ) { url = url.replace(/contents/,/contents-en/); document.getElementById(lang).innerHTML=[ Japanes...e(/contents-en/,/contents/); document.getElementById(lang).innerHTML=[ Japanese | English ]; } else if( url.
Lifescience Database Archive (English)
Full Text Available search(/contents-en/) != -1 || url.search(/index-e.html/) != -1 ) { document.getElementById(lang).innerHTML=.../) != -1 ) { url = url.replace(-e.html,.html); document.getElementById(lang).innerHTML=[ Japanese |...en/,/jp/); document.getElementById(lang).innerHTML=[ Japanese | English ]; } else if ( url.search(//contents...//) != -1 ) { url = url.replace(/contents/,/contents-en/); document.getElementById(lang).innerHTML=[ Japanes...e(/contents-en/,/contents/); document.getElementById(lang).innerHTML=[ Japanese | English ]; } else if( url.
Update History of This Database - ClEST | LSDB Archive [Life Science Database Archive metadata
Lifescience Database Archive (English)
Full Text Available search(/contents-en/) != -1 || url.search(/index-e.html/) != -1 ) { document.getElementById(lang).innerHTML=.../) != -1 ) { url = url.replace(-e.html,.html); document.getElementById(lang).innerHTML=[ Japanese |...en/,/jp/); document.getElementById(lang).innerHTML=[ Japanese | English ]; } else if ( url.search(//contents...//) != -1 ) { url = url.replace(/contents/,/contents-en/); document.getElementById(lang).innerHTML=[ Japanes...e(/contents-en/,/contents/); document.getElementById(lang).innerHTML=[ Japanese | English ]; } else if( url.
Update History of This Database - GRIPDB | LSDB Archive [Life Science Database Archive metadata
Lifescience Database Archive (English)
Full Text Available search(/contents-en/) != -1 || url.search(/index-e.html/) != -1 ) { document.getElementById(lang).innerHTML=.../) != -1 ) { url = url.replace(-e.html,.html); document.getElementById(lang).innerHTML=[ Japanese |...en/,/jp/); document.getElementById(lang).innerHTML=[ Japanese | English ]; } else if ( url.search(//contents...//) != -1 ) { url = url.replace(/contents/,/contents-en/); document.getElementById(lang).innerHTML=[ Japanes...e(/contents-en/,/contents/); document.getElementById(lang).innerHTML=[ Japanese | English ]; } else if( url.
Lifescience Database Archive (English)
Full Text Available search(/contents-en/) != -1 || url.search(/index-e.html/) != -1 ) { document.getElementById(lang).innerHTML=.../) != -1 ) { url = url.replace(-e.html,.html); document.getElementById(lang).innerHTML=[ Japanese |...en/,/jp/); document.getElementById(lang).innerHTML=[ Japanese | English ]; } else if ( url.search(//contents...//) != -1 ) { url = url.replace(/contents/,/contents-en/); document.getElementById(lang).innerHTML=[ Japanes...e(/contents-en/,/contents/); document.getElementById(lang).innerHTML=[ Japanese | English ]; } else if( url.
Update History of This Database - Dicty_cDB | LSDB Archive [Life Science Database Archive metadata
Lifescience Database Archive (English)
Full Text Available search(/contents-en/) != -1 || url.search(/index-e.html/) != -1 ) { document.getElementById(lang).innerHTML=.../) != -1 ) { url = url.replace(-e.html,.html); document.getElementById(lang).innerHTML=[ Japanese |...en/,/jp/); document.getElementById(lang).innerHTML=[ Japanese | English ]; } else if ( url.search(//contents...//) != -1 ) { url = url.replace(/contents/,/contents-en/); document.getElementById(lang).innerHTML=[ Japanes...e(/contents-en/,/contents/); document.getElementById(lang).innerHTML=[ Japanese | English ]; } else if( url.
Designation of organism group - Gclust Server | LSDB Archive [Life Science Database Archive metadata
Lifescience Database Archive (English)
Full Text Available search(/contents-en/) != -1 || url.search(/index-e.html/) != -1 ) { document.getElementById(lang).innerHTML=.../) != -1 ) { url = url.replace(-e.html,.html); document.getElementById(lang).innerHTML=[ Japanese |...en/,/jp/); document.getElementById(lang).innerHTML=[ Japanese | English ]; } else if ( url.search(//contents...//) != -1 ) { url = url.replace(/contents/,/contents-en/); document.getElementById(lang).innerHTML=[ Japanes...e(/contents-en/,/contents/); document.getElementById(lang).innerHTML=[ Japanese | English ]; } else if( url.
GPCR sequence information - GRIPDB | LSDB Archive [Life Science Database Archive metadata
Lifescience Database Archive (English)
Full Text Available search(/contents-en/) != -1 || url.search(/index-e.html/) != -1 ) { document.getElementById(lang).innerHTML=.../) != -1 ) { url = url.replace(-e.html,.html); document.getElementById(lang).innerHTML=[ Japanese |...en/,/jp/); document.getElementById(lang).innerHTML=[ Japanese | English ]; } else if ( url.search(//contents...//) != -1 ) { url = url.replace(/contents/,/contents-en/); document.getElementById(lang).innerHTML=[ Japanes...e(/contents-en/,/contents/); document.getElementById(lang).innerHTML=[ Japanese | English ]; } else if( url.
Download - RED II INAHO | LSDB Archive [Life Science Database Archive metadata
Lifescience Database Archive (English)
Full Text Available search(/contents-en/) != -1 || url.search(/index-e.html/) != -1 ) { document.getElementById(lang).innerHTML=.../) != -1 ) { url = url.replace(-e.html,.html); document.getElementById(lang).innerHTML=[ Japanese |...en/,/jp/); document.getElementById(lang).innerHTML=[ Japanese | English ]; } else if ( url.search(//contents...//) != -1 ) { url = url.replace(/contents/,/contents-en/); document.getElementById(lang).innerHTML=[ Japanes...e(/contents-en/,/contents/); document.getElementById(lang).innerHTML=[ Japanese | English ]; } else if( url.
Model Structure Thumbnail - SAHG | LSDB Archive [Life Science Database Archive metadata
Lifescience Database Archive (English)
Full Text Available search(/contents-en/) != -1 || url.search(/index-e.html/) != -1 ) { document.getElementById(lang).innerHTML=.../) != -1 ) { url = url.replace(-e.html,.html); document.getElementById(lang).innerHTML=[ Japanese |...en/,/jp/); document.getElementById(lang).innerHTML=[ Japanese | English ]; } else if ( url.search(//contents...//) != -1 ) { url = url.replace(/contents/,/contents-en/); document.getElementById(lang).innerHTML=[ Japanes...e(/contents-en/,/contents/); document.getElementById(lang).innerHTML=[ Japanese | English ]; } else if( url.
Update History of This Database - DB-SPIRE | LSDB Archive [Life Science Database Archive metadata
Lifescience Database Archive (English)
Full Text Available search(/contents-en/) != -1 || url.search(/index-e.html/) != -1 ) { document.getElementById(lang).innerHTML=.../) != -1 ) { url = url.replace(-e.html,.html); document.getElementById(lang).innerHTML=[ Japanese |...en/,/jp/); document.getElementById(lang).innerHTML=[ Japanese | English ]; } else if ( url.search(//contents...//) != -1 ) { url = url.replace(/contents/,/contents-en/); document.getElementById(lang).innerHTML=[ Japanes...e(/contents-en/,/contents/); document.getElementById(lang).innerHTML=[ Japanese | English ]; } else if( url.
Update History of This Database - JSNP | LSDB Archive [Life Science Database Archive metadata
Lifescience Database Archive (English)
Full Text Available search(/contents-en/) != -1 || url.search(/index-e.html/) != -1 ) { document.getElementById(lang).innerHTML=.../) != -1 ) { url = url.replace(-e.html,.html); document.getElementById(lang).innerHTML=[ Japanese |...en/,/jp/); document.getElementById(lang).innerHTML=[ Japanese | English ]; } else if ( url.search(//contents...//) != -1 ) { url = url.replace(/contents/,/contents-en/); document.getElementById(lang).innerHTML=[ Japanes...e(/contents-en/,/contents/); document.getElementById(lang).innerHTML=[ Japanese | English ]; } else if( url.
Lifescience Database Archive (English)
Full Text Available search(/contents-en/) != -1 || url.search(/index-e.html/) != -1 ) { document.getElementById(lang).innerHTML=.../) != -1 ) { url = url.replace(-e.html,.html); document.getElementById(lang).innerHTML=[ Japanese |...en/,/jp/); document.getElementById(lang).innerHTML=[ Japanese | English ]; } else if ( url.search(//contents...//) != -1 ) { url = url.replace(/contents/,/contents-en/); document.getElementById(lang).innerHTML=[ Japanes...e(/contents-en/,/contents/); document.getElementById(lang).innerHTML=[ Japanese | English ]; } else if( url.
Update History of This Database - ChIP-Atlas | LSDB Archive [Life Science Database Archive metadata
Lifescience Database Archive (English)
Full Text Available search(/contents-en/) != -1 || url.search(/index-e.html/) != -1 ) { document.getElementById(lang).innerHTML=.../) != -1 ) { url = url.replace(-e.html,.html); document.getElementById(lang).innerHTML=[ Japanese |...en/,/jp/); document.getElementById(lang).innerHTML=[ Japanese | English ]; } else if ( url.search(//contents...//) != -1 ) { url = url.replace(/contents/,/contents-en/); document.getElementById(lang).innerHTML=[ Japanes...e(/contents-en/,/contents/); document.getElementById(lang).innerHTML=[ Japanese | English ]; } else if( url.
Download - Society Catalog | LSDB Archive [Life Science Database Archive metadata
Lifescience Database Archive (English)
Full Text Available search(/contents-en/) != -1 || url.search(/index-e.html/) != -1 ) { document.getElementById(lang).innerHTML=.../) != -1 ) { url = url.replace(-e.html,.html); document.getElementById(lang).innerHTML=[ Japanese |...en/,/jp/); document.getElementById(lang).innerHTML=[ Japanese | English ]; } else if ( url.search(//contents...//) != -1 ) { url = url.replace(/contents/,/contents-en/); document.getElementById(lang).innerHTML=[ Japanes...e(/contents-en/,/contents/); document.getElementById(lang).innerHTML=[ Japanese | English ]; } else if( url.
Download - Togo Picture Gallery | LSDB Archive [Life Science Database Archive metadata
Lifescience Database Archive (English)
Full Text Available search(/contents-en/) != -1 || url.search(/index-e.html/) != -1 ) { document.getElementById(lang).innerHTML=.../) != -1 ) { url = url.replace(-e.html,.html); document.getElementById(lang).innerHTML=[ Japanese |...en/,/jp/); document.getElementById(lang).innerHTML=[ Japanese | English ]; } else if ( url.search(//contents...//) != -1 ) { url = url.replace(/contents/,/contents-en/); document.getElementById(lang).innerHTML=[ Japanes...e(/contents-en/,/contents/); document.getElementById(lang).innerHTML=[ Japanese | English ]; } else if( url.
Lifescience Database Archive (English)
Full Text Available search(/contents-en/) != -1 || url.search(/index-e.html/) != -1 ) { document.getElementById(lang).innerHTML=.../) != -1 ) { url = url.replace(-e.html,.html); document.getElementById(lang).innerHTML=[ Japanese |...en/,/jp/); document.getElementById(lang).innerHTML=[ Japanese | English ]; } else if ( url.search(//contents...//) != -1 ) { url = url.replace(/contents/,/contents-en/); document.getElementById(lang).innerHTML=[ Japanes...e(/contents-en/,/contents/); document.getElementById(lang).innerHTML=[ Japanese | English ]; } else if( url.
Lifescience Database Archive (English)
Full Text Available search(/contents-en/) != -1 || url.search(/index-e.html/) != -1 ) { document.getElementById(lang).innerHTML=.../) != -1 ) { url = url.replace(-e.html,.html); document.getElementById(lang).innerHTML=[ Japanese |...en/,/jp/); document.getElementById(lang).innerHTML=[ Japanese | English ]; } else if ( url.search(//contents...//) != -1 ) { url = url.replace(/contents/,/contents-en/); document.getElementById(lang).innerHTML=[ Japanes...e(/contents-en/,/contents/); document.getElementById(lang).innerHTML=[ Japanese | English ]; } else if( url.
Download - AcEST | LSDB Archive [Life Science Database Archive metadata
Lifescience Database Archive (English)
Full Text Available search(/contents-en/) != -1 || url.search(/index-e.html/) != -1 ) { document.getElementById(lang).innerHTML=.../) != -1 ) { url = url.replace(-e.html,.html); document.getElementById(lang).innerHTML=[ Japanese |...en/,/jp/); document.getElementById(lang).innerHTML=[ Japanese | English ]; } else if ( url.search(//contents...//) != -1 ) { url = url.replace(/contents/,/contents-en/); document.getElementById(lang).innerHTML=[ Japanes...e(/contents-en/,/contents/); document.getElementById(lang).innerHTML=[ Japanese | English ]; } else if( url.
Insert size of YAC clones - RGP physicalmap | LSDB Archive [Life Science Database Archive metadata
Lifescience Database Archive (English)
Full Text Available search(/contents-en/) != -1 || url.search(/index-e.html/) != -1 ) { document.getElementById(lang).innerHTML=.../) != -1 ) { url = url.replace(-e.html,.html); document.getElementById(lang).innerHTML=[ Japanese |...en/,/jp/); document.getElementById(lang).innerHTML=[ Japanese | English ]; } else if ( url.search(//contents...//) != -1 ) { url = url.replace(/contents/,/contents-en/); document.getElementById(lang).innerHTML=[ Japanes...e(/contents-en/,/contents/); document.getElementById(lang).innerHTML=[ Japanese | English ]; } else if( url.
Lifescience Database Archive (English)
Full Text Available search(/contents-en/) != -1 || url.search(/index-e.html/) != -1 ) { document.getElementById(lang).innerHTML=.../) != -1 ) { url = url.replace(-e.html,.html); document.getElementById(lang).innerHTML=[ Japanese |...en/,/jp/); document.getElementById(lang).innerHTML=[ Japanese | English ]; } else if ( url.search(//contents...//) != -1 ) { url = url.replace(/contents/,/contents-en/); document.getElementById(lang).innerHTML=[ Japanes...e(/contents-en/,/contents/); document.getElementById(lang).innerHTML=[ Japanese | English ]; } else if( url.
Lifescience Database Archive (English)
Full Text Available search(/contents-en/) != -1 || url.search(/index-e.html/) != -1 ) { document.getElementById(lang).innerHTML=.../) != -1 ) { url = url.replace(-e.html,.html); document.getElementById(lang).innerHTML=[ Japanese |...en/,/jp/); document.getElementById(lang).innerHTML=[ Japanese | English ]; } else if ( url.search(//contents...//) != -1 ) { url = url.replace(/contents/,/contents-en/); document.getElementById(lang).innerHTML=[ Japanes...e(/contents-en/,/contents/); document.getElementById(lang).innerHTML=[ Japanese | English ]; } else if( url.
Lifescience Database Archive (English)
Full Text Available search(/contents-en/) != -1 || url.search(/index-e.html/) != -1 ) { document.getElementById(lang).innerHTML=.../) != -1 ) { url = url.replace(-e.html,.html); document.getElementById(lang).innerHTML=[ Japanese |...en/,/jp/); document.getElementById(lang).innerHTML=[ Japanese | English ]; } else if ( url.search(//contents...//) != -1 ) { url = url.replace(/contents/,/contents-en/); document.getElementById(lang).innerHTML=[ Japanes...e(/contents-en/,/contents/); document.getElementById(lang).innerHTML=[ Japanese | English ]; } else if( url.
Experiments list - DGBY | LSDB Archive [Life Science Database Archive metadata
Lifescience Database Archive (English)
Full Text Available search(/contents-en/) != -1 || url.search(/index-e.html/) != -1 ) { document.getElementById(lang).innerHTML=.../) != -1 ) { url = url.replace(-e.html,.html); document.getElementById(lang).innerHTML=[ Japanese |...en/,/jp/); document.getElementById(lang).innerHTML=[ Japanese | English ]; } else if ( url.search(//contents...//) != -1 ) { url = url.replace(/contents/,/contents-en/); document.getElementById(lang).innerHTML=[ Japanes...e(/contents-en/,/contents/); document.getElementById(lang).innerHTML=[ Japanese | English ]; } else if( url.
Update History of This Database - GETDB | LSDB Archive [Life Science Database Archive metadata
Lifescience Database Archive (English)
Full Text Available search(/contents-en/) != -1 || url.search(/index-e.html/) != -1 ) { document.getElementById(lang).innerHTML=.../) != -1 ) { url = url.replace(-e.html,.html); document.getElementById(lang).innerHTML=[ Japanese |...en/,/jp/); document.getElementById(lang).innerHTML=[ Japanese | English ]; } else if ( url.search(//contents...//) != -1 ) { url = url.replace(/contents/,/contents-en/); document.getElementById(lang).innerHTML=[ Japanes...e(/contents-en/,/contents/); document.getElementById(lang).innerHTML=[ Japanese | English ]; } else if( url.
Download - Nikkaji-InChI Mapping Table | LSDB Archive [Life Science Database Archive metadata
Lifescience Database Archive (English)
Full Text Available search(/contents-en/) != -1 || url.search(/index-e.html/) != -1 ) { document.getElementById(lang).innerHTML=.../) != -1 ) { url = url.replace(-e.html,.html); document.getElementById(lang).innerHTML=[ Japanese |...en/,/jp/); document.getElementById(lang).innerHTML=[ Japanese | English ]; } else if ( url.search(//contents...//) != -1 ) { url = url.replace(/contents/,/contents-en/); document.getElementById(lang).innerHTML=[ Japanes...e(/contents-en/,/contents/); document.getElementById(lang).innerHTML=[ Japanese | English ]; } else if( url.
Lifescience Database Archive (English)
Full Text Available search(/contents-en/) != -1 || url.search(/index-e.html/) != -1 ) { document.getElementById(lang).innerHTML=.../) != -1 ) { url = url.replace(-e.html,.html); document.getElementById(lang).innerHTML=[ Japanese |...en/,/jp/); document.getElementById(lang).innerHTML=[ Japanese | English ]; } else if ( url.search(//contents...//) != -1 ) { url = url.replace(/contents/,/contents-en/); document.getElementById(lang).innerHTML=[ Japanes...e(/contents-en/,/contents/); document.getElementById(lang).innerHTML=[ Japanese | English ]; } else if( url.
Download - dbQSNP | LSDB Archive [Life Science Database Archive metadata
Lifescience Database Archive (English)
Full Text Available search(/contents-en/) != -1 || url.search(/index-e.html/) != -1 ) { document.getElementById(lang).innerHTML=.../) != -1 ) { url = url.replace(-e.html,.html); document.getElementById(lang).innerHTML=[ Japanese |...en/,/jp/); document.getElementById(lang).innerHTML=[ Japanese | English ]; } else if ( url.search(//contents...//) != -1 ) { url = url.replace(/contents/,/contents-en/); document.getElementById(lang).innerHTML=[ Japanes...e(/contents-en/,/contents/); document.getElementById(lang).innerHTML=[ Japanese | English ]; } else if( url.
Download - RGP gmap | LSDB Archive [Life Science Database Archive metadata
Lifescience Database Archive (English)
Full Text Available search(/contents-en/) != -1 || url.search(/index-e.html/) != -1 ) { document.getElementById(lang).innerHTML=.../) != -1 ) { url = url.replace(-e.html,.html); document.getElementById(lang).innerHTML=[ Japanese |...en/,/jp/); document.getElementById(lang).innerHTML=[ Japanese | English ]; } else if ( url.search(//contents...//) != -1 ) { url = url.replace(/contents/,/contents-en/); document.getElementById(lang).innerHTML=[ Japanes...e(/contents-en/,/contents/); document.getElementById(lang).innerHTML=[ Japanese | English ]; } else if( url.
Download - RGP physicalmap | LSDB Archive [Life Science Database Archive metadata
Lifescience Database Archive (English)
Full Text Available search(/contents-en/) != -1 || url.search(/index-e.html/) != -1 ) { document.getElementById(lang).innerHTML=.../) != -1 ) { url = url.replace(-e.html,.html); document.getElementById(lang).innerHTML=[ Japanese |...en/,/jp/); document.getElementById(lang).innerHTML=[ Japanese | English ]; } else if ( url.search(//contents...//) != -1 ) { url = url.replace(/contents/,/contents-en/); document.getElementById(lang).innerHTML=[ Japanes...e(/contents-en/,/contents/); document.getElementById(lang).innerHTML=[ Japanese | English ]; } else if( url.
Mascot search results - CREATE portal | LSDB Archive [Life Science Database Archive metadata
Lifescience Database Archive (English)
Full Text Available search(/contents-en/) != -1 || url.search(/index-e.html/) != -1 ) { document.getElementById(lang).innerHTML=.../) != -1 ) { url = url.replace(-e.html,.html); document.getElementById(lang).innerHTML=[ Japanese |...en/,/jp/); document.getElementById(lang).innerHTML=[ Japanese | English ]; } else if ( url.search(//contents...//) != -1 ) { url = url.replace(/contents/,/contents-en/); document.getElementById(lang).innerHTML=[ Japanes...e(/contents-en/,/contents/); document.getElementById(lang).innerHTML=[ Japanese | English ]; } else if( url.
Lifescience Database Archive (English)
Full Text Available search(/contents-en/) != -1 || url.search(/index-e.html/) != -1 ) { document.getElementById(lang).innerHTML=.../) != -1 ) { url = url.replace(-e.html,.html); document.getElementById(lang).innerHTML=[ Japanese |...en/,/jp/); document.getElementById(lang).innerHTML=[ Japanese | English ]; } else if ( url.search(//contents...//) != -1 ) { url = url.replace(/contents/,/contents-en/); document.getElementById(lang).innerHTML=[ Japanes...e(/contents-en/,/contents/); document.getElementById(lang).innerHTML=[ Japanese | English ]; } else if( url.
Lifescience Database Archive (English)
Full Text Available search(/contents-en/) != -1 || url.search(/index-e.html/) != -1 ) { document.getElementById(lang).innerHTML=.../) != -1 ) { url = url.replace(-e.html,.html); document.getElementById(lang).innerHTML=[ Japanese |...en/,/jp/); document.getElementById(lang).innerHTML=[ Japanese | English ]; } else if ( url.search(//contents...//) != -1 ) { url = url.replace(/contents/,/contents-en/); document.getElementById(lang).innerHTML=[ Japanes...e(/contents-en/,/contents/); document.getElementById(lang).innerHTML=[ Japanese | English ]; } else if( url.
Lifescience Database Archive (English)
Full Text Available search(/contents-en/) != -1 || url.search(/index-e.html/) != -1 ) { document.getElementById(lang).innerHTML=.../) != -1 ) { url = url.replace(-e.html,.html); document.getElementById(lang).innerHTML=[ Japanese |...en/,/jp/); document.getElementById(lang).innerHTML=[ Japanese | English ]; } else if ( url.search(//contents...//) != -1 ) { url = url.replace(/contents/,/contents-en/); document.getElementById(lang).innerHTML=[ Japanes...e(/contents-en/,/contents/); document.getElementById(lang).innerHTML=[ Japanese | English ]; } else if( url.
Transcriptome data - Air-drying stress - DGBY | LSDB Archive [Life Science Database Archive metadata
Lifescience Database Archive (English)
Full Text Available search(/contents-en/) != -1 || url.search(/index-e.html/) != -1 ) { document.getElementById(lang).innerHTML=.../) != -1 ) { url = url.replace(-e.html,.html); document.getElementById(lang).innerHTML=[ Japanese |...en/,/jp/); document.getElementById(lang).innerHTML=[ Japanese | English ]; } else if ( url.search(//contents...//) != -1 ) { url = url.replace(/contents/,/contents-en/); document.getElementById(lang).innerHTML=[ Japanes...e(/contents-en/,/contents/); document.getElementById(lang).innerHTML=[ Japanese | English ]; } else if( url.
Supplementary Data - fRNAdb | LSDB Archive [Life Science Database Archive metadata
Lifescience Database Archive (English)
Full Text Available search(/contents-en/) != -1 || url.search(/index-e.html/) != -1 ) { document.getElementById(lang).innerHTML=.../) != -1 ) { url = url.replace(-e.html,.html); document.getElementById(lang).innerHTML=[ Japanese |...en/,/jp/); document.getElementById(lang).innerHTML=[ Japanese | English ]; } else if ( url.search(//contents...//) != -1 ) { url = url.replace(/contents/,/contents-en/); document.getElementById(lang).innerHTML=[ Japanes...e(/contents-en/,/contents/); document.getElementById(lang).innerHTML=[ Japanese | English ]; } else if( url.
Download - SKIP Stemcell Database | LSDB Archive [Life Science Database Archive metadata
Lifescience Database Archive (English)
Full Text Available search(/contents-en/) != -1 || url.search(/index-e.html/) != -1 ) { document.getElementById(lang).innerHTML=.../) != -1 ) { url = url.replace(-e.html,.html); document.getElementById(lang).innerHTML=[ Japanese |...en/,/jp/); document.getElementById(lang).innerHTML=[ Japanese | English ]; } else if ( url.search(//contents...//) != -1 ) { url = url.replace(/contents/,/contents-en/); document.getElementById(lang).innerHTML=[ Japanes...e(/contents-en/,/contents/); document.getElementById(lang).innerHTML=[ Japanese | English ]; } else if( url.
Update History of This Database - RPSD | LSDB Archive [Life Science Database Archive metadata
Lifescience Database Archive (English)
Full Text Available search(/contents-en/) != -1 || url.search(/index-e.html/) != -1 ) { document.getElementById(lang).innerHTML=.../) != -1 ) { url = url.replace(-e.html,.html); document.getElementById(lang).innerHTML=[ Japanese |...en/,/jp/); document.getElementById(lang).innerHTML=[ Japanese | English ]; } else if ( url.search(//contents...//) != -1 ) { url = url.replace(/contents/,/contents-en/); document.getElementById(lang).innerHTML=[ Japanes...e(/contents-en/,/contents/); document.getElementById(lang).innerHTML=[ Japanese | English ]; } else if( url.
Lifescience Database Archive (English)
Full Text Available search(/contents-en/) != -1 || url.search(/index-e.html/) != -1 ) { document.getElementById(lang).innerHTML=.../) != -1 ) { url = url.replace(-e.html,.html); document.getElementById(lang).innerHTML=[ Japanese |...en/,/jp/); document.getElementById(lang).innerHTML=[ Japanese | English ]; } else if ( url.search(//contents...//) != -1 ) { url = url.replace(/contents/,/contents-en/); document.getElementById(lang).innerHTML=[ Japanes...e(/contents-en/,/contents/); document.getElementById(lang).innerHTML=[ Japanese | English ]; } else if( url.
Download - TMBETA-GENOME | LSDB Archive [Life Science Database Archive metadata
Lifescience Database Archive (English)
Full Text Available search(/contents-en/) != -1 || url.search(/index-e.html/) != -1 ) { document.getElementById(lang).innerHTML=.../) != -1 ) { url = url.replace(-e.html,.html); document.getElementById(lang).innerHTML=[ Japanese |...en/,/jp/); document.getElementById(lang).innerHTML=[ Japanese | English ]; } else if ( url.search(//contents...//) != -1 ) { url = url.replace(/contents/,/contents-en/); document.getElementById(lang).innerHTML=[ Japanes...e(/contents-en/,/contents/); document.getElementById(lang).innerHTML=[ Japanese | English ]; } else if( url.
Download - ClEST | LSDB Archive [Life Science Database Archive metadata
Lifescience Database Archive (English)
Full Text Available search(/contents-en/) != -1 || url.search(/index-e.html/) != -1 ) { document.getElementById(lang).innerHTML=.../) != -1 ) { url = url.replace(-e.html,.html); document.getElementById(lang).innerHTML=[ Japanese |...en/,/jp/); document.getElementById(lang).innerHTML=[ Japanese | English ]; } else if ( url.search(//contents...//) != -1 ) { url = url.replace(/contents/,/contents-en/); document.getElementById(lang).innerHTML=[ Japanes...e(/contents-en/,/contents/); document.getElementById(lang).innerHTML=[ Japanese | English ]; } else if( url.
Download - AT Atlas | LSDB Archive [Life Science Database Archive metadata
Lifescience Database Archive (English)
Full Text Available search(/contents-en/) != -1 || url.search(/index-e.html/) != -1 ) { document.getElementById(lang).innerHTML=.../) != -1 ) { url = url.replace(-e.html,.html); document.getElementById(lang).innerHTML=[ Japanese |...en/,/jp/); document.getElementById(lang).innerHTML=[ Japanese | English ]; } else if ( url.search(//contents...//) != -1 ) { url = url.replace(/contents/,/contents-en/); document.getElementById(lang).innerHTML=[ Japanes...e(/contents-en/,/contents/); document.getElementById(lang).innerHTML=[ Japanese | English ]; } else if( url.
Lifescience Database Archive (English)
Full Text Available search(/contents-en/) != -1 || url.search(/index-e.html/) != -1 ) { document.getElementById(lang).innerHTML=.../) != -1 ) { url = url.replace(-e.html,.html); document.getElementById(lang).innerHTML=[ Japanese |...en/,/jp/); document.getElementById(lang).innerHTML=[ Japanese | English ]; } else if ( url.search(//contents...//) != -1 ) { url = url.replace(/contents/,/contents-en/); document.getElementById(lang).innerHTML=[ Japanes...e(/contents-en/,/contents/); document.getElementById(lang).innerHTML=[ Japanese | English ]; } else if( url.
Download - MicrobeDB.jp | LSDB Archive [Life Science Database Archive metadata
Lifescience Database Archive (English)
Full Text Available search(/contents-en/) != -1 || url.search(/index-e.html/) != -1 ) { document.getElementById(lang).innerHTML=.../) != -1 ) { url = url.replace(-e.html,.html); document.getElementById(lang).innerHTML=[ Japanese |...en/,/jp/); document.getElementById(lang).innerHTML=[ Japanese | English ]; } else if ( url.search(//contents...//) != -1 ) { url = url.replace(/contents/,/contents-en/); document.getElementById(lang).innerHTML=[ Japanes...e(/contents-en/,/contents/); document.getElementById(lang).innerHTML=[ Japanese | English ]; } else if( url.
Download - RGP caps | LSDB Archive [Life Science Database Archive metadata
Lifescience Database Archive (English)
Full Text Available search(/contents-en/) != -1 || url.search(/index-e.html/) != -1 ) { document.getElementById(lang).innerHTML=.../) != -1 ) { url = url.replace(-e.html,.html); document.getElementById(lang).innerHTML=[ Japanese |...en/,/jp/); document.getElementById(lang).innerHTML=[ Japanese | English ]; } else if ( url.search(//contents...//) != -1 ) { url = url.replace(/contents/,/contents-en/); document.getElementById(lang).innerHTML=[ Japanes...e(/contents-en/,/contents/); document.getElementById(lang).innerHTML=[ Japanese | English ]; } else if( url.
Update History of This Database - Plabrain DB | LSDB Archive [Life Science Database Archive metadata
Lifescience Database Archive (English)
Full Text Available search(/contents-en/) != -1 || url.search(/index-e.html/) != -1 ) { document.getElementById(lang).innerHTML=.../) != -1 ) { url = url.replace(-e.html,.html); document.getElementById(lang).innerHTML=[ Japanese |...en/,/jp/); document.getElementById(lang).innerHTML=[ Japanese | English ]; } else if ( url.search(//contents...//) != -1 ) { url = url.replace(/contents/,/contents-en/); document.getElementById(lang).innerHTML=[ Japanes...e(/contents-en/,/contents/); document.getElementById(lang).innerHTML=[ Japanese | English ]; } else if( url.
Update History of This Database - RGP caps | LSDB Archive [Life Science Database Archive metadata
Lifescience Database Archive (English)
Full Text Available search(/contents-en/) != -1 || url.search(/index-e.html/) != -1 ) { document.getElementById(lang).innerHTML=.../) != -1 ) { url = url.replace(-e.html,.html); document.getElementById(lang).innerHTML=[ Japanese |...en/,/jp/); document.getElementById(lang).innerHTML=[ Japanese | English ]; } else if ( url.search(//contents...//) != -1 ) { url = url.replace(/contents/,/contents-en/); document.getElementById(lang).innerHTML=[ Japanes...e(/contents-en/,/contents/); document.getElementById(lang).innerHTML=[ Japanese | English ]; } else if( url.
Download - CREATE portal | LSDB Archive [Life Science Database Archive metadata
Lifescience Database Archive (English)
Full Text Available search(/contents-en/) != -1 || url.search(/index-e.html/) != -1 ) { document.getElementById(lang).innerHTML=.../) != -1 ) { url = url.replace(-e.html,.html); document.getElementById(lang).innerHTML=[ Japanese |...en/,/jp/); document.getElementById(lang).innerHTML=[ Japanese | English ]; } else if ( url.search(//contents...//) != -1 ) { url = url.replace(/contents/,/contents-en/); document.getElementById(lang).innerHTML=[ Japanes...e(/contents-en/,/contents/); document.getElementById(lang).innerHTML=[ Japanese | English ]; } else if( url.
Download - RGP estmap2001 | LSDB Archive [Life Science Database Archive metadata
Lifescience Database Archive (English)
Full Text Available search(/contents-en/) != -1 || url.search(/index-e.html/) != -1 ) { document.getElementById(lang).innerHTML=.../) != -1 ) { url = url.replace(-e.html,.html); document.getElementById(lang).innerHTML=[ Japanese |...en/,/jp/); document.getElementById(lang).innerHTML=[ Japanese | English ]; } else if ( url.search(//contents...//) != -1 ) { url = url.replace(/contents/,/contents-en/); document.getElementById(lang).innerHTML=[ Japanes...e(/contents-en/,/contents/); document.getElementById(lang).innerHTML=[ Japanese | English ]; } else if( url.
Update History of This Database - eSOL | LSDB Archive [Life Science Database Archive metadata
Lifescience Database Archive (English)
Full Text Available search(/contents-en/) != -1 || url.search(/index-e.html/) != -1 ) { document.getElementById(lang).innerHTML=.../) != -1 ) { url = url.replace(-e.html,.html); document.getElementById(lang).innerHTML=[ Japanese |...en/,/jp/); document.getElementById(lang).innerHTML=[ Japanese | English ]; } else if ( url.search(//contents...//) != -1 ) { url = url.replace(/contents/,/contents-en/); document.getElementById(lang).innerHTML=[ Japanes...e(/contents-en/,/contents/); document.getElementById(lang).innerHTML=[ Japanese | English ]; } else if( url.
Update History of This Database - RGP gmap | LSDB Archive [Life Science Database Archive metadata
Lifescience Database Archive (English)
Full Text Available search(/contents-en/) != -1 || url.search(/index-e.html/) != -1 ) { document.getElementById(lang).innerHTML=.../) != -1 ) { url = url.replace(-e.html,.html); document.getElementById(lang).innerHTML=[ Japanese |...en/,/jp/); document.getElementById(lang).innerHTML=[ Japanese | English ]; } else if ( url.search(//contents...//) != -1 ) { url = url.replace(/contents/,/contents-en/); document.getElementById(lang).innerHTML=[ Japanes...e(/contents-en/,/contents/); document.getElementById(lang).innerHTML=[ Japanese | English ]; } else if( url.
Energy Technology Data Exchange (ETDEWEB)
Fernandez, A.M.; Turrero, M.J.; Yllera, A.; Melon, A.M.; Sanchez, M.D.; Pena, J.; Garralon, A.; Rivas, P. [Centro de Investigaciones Energeticas, Medioambientales y Tecnologicas (CIEMAT), Dpt. of Energy Environmental Impact, Madrid (Spain); Hernan, P. [ENRESA, Madrid (Spain)
2005-07-01
Clay formations are considered as a feasible option for the disposal of high-level radioactive wastes. In order to determine their suitability for this purpose, the evaluation of the hydro-geochemistry and transport mechanisms must be undertaken. In this sense, a general understanding of the basic physical and chemical processes that govern the solute transport together with a detailed site-characterization programme is required. To reach this goal, a number of activities have been developed in the Opalinus Clay formation at the Mont Terri Underground Research Laboratory (URL) at Switzerland. In the context of some experiments (WS-C, WS-D, WS-E, GM Task, DI, etc.), the Opalinus Clay formation has been comprehensively characterized to develop a conceptual, thermodynamic and transport model of solutes. The framework of these works is the need to know the mechanism of the possible migration of radionuclides and the pore water chemistry, as essential data for the performance assessment of such argillaceous systems. (authors)
Image files - RPD | LSDB Archive [Life Science Database Archive metadata
Lifescience Database Archive (English)
Full Text Available switchLanguage; BLAST Search Image Search Home About Archive Update History Data ...ftp://ftp.biosciencedbc.jp/archive/rpd/LATEST/rpd_gel_image.zip File size: 38.5 MB Simple search URL - Data ... License Update History of This Database Site Policy | Contact Us Image files - RPD | LSDB Archive ...
Protein - AT Atlas | LSDB Archive [Life Science Database Archive metadata
Lifescience Database Archive (English)
Full Text Available switchLanguage; BLAST Search Image Search Home About Archive Update History Data ..._protein.zip File URL: ftp://ftp.biosciencedbc.jp/archive/at_atlas/LATEST/at_atla...About This Database Database Description Download License Update History of This Database Site Policy | Contact Us Protein - AT Atlas | LSDB Archive ...
Cluster - ClEST | LSDB Archive [Life Science Database Archive metadata
Lifescience Database Archive (English)
Full Text Available switchLanguage; BLAST Search Image Search Home About Archive Update History Data ...e File name: clest_cluster.zip File URL: ftp://ftp.biosciencedbc.jp/archive/clest/LATEST/clest_cluster.zip F...ownload License Update History of This Database Site Policy | Contact Us Cluster - ClEST | LSDB Archive ...
Lifescience Database Archive (English)
Full Text Available SH (Link to library) SHI867 (Link to dictyBase) - - - Contig-U11503-1 - (Link to Or...iginal site) SHI867F 646 - - - - - - Show SHI867 Library SH (Link to library) Clone ID SHI867 (Link to dicty...Base) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U11503-1 Original site URL http://dictycdb.b...fsl*iy*YMIRKSNNFSILFAIFLKIVFVVSAPLCPNSTILLNYNILTVYNSSEGC GFNNEPICTSLKDAVSRAFLLISNNSRVCIGIIGNINVTSEQITLGNYCGA...l*lsif--- Frame C: qkkqfsl*iy*YMIRKSNNFSILFAIFLKIVFVVSAPLCPNSTILLNYNILTVYNSSEGC GFNNEPICT
Lifescience Database Archive (English)
Full Text Available SS (Link to library) SSI339 (Link to dictyBase) - - - Contig-U04467-1 SSI339Z (Link... to Original site) - - SSI339Z 563 - - - - Show SSI339 Library SS (Link to library) Clone ID SSI339 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U04467-1 Original site URL http://dict...1998. 1.22 Translated Amino Acid sequence ---FTCSNNQVISSSLVSENNCIYTVEMSGNIFCPTPTPTPTPTPTPTPNPTSNVTCKSS NGISITSSDIITCIGYGQSICT...NQVISSSLVSENNCIYTVEMSGNIFCPTPTPTPTPTPTPTPNPTSNVTCKSS NGISITSSDIITCIGYGQSICTTSSGYSCETNQTNGVLKCISPDNSISCIGNQFY
Lifescience Database Archive (English)
Full Text Available CH (Link to library) CHC347 (Link to dictyBase) - - - - CHC347P (Link to Original s...ite) CHC347F 184 CHC347Z 431 CHC347P 595 - - Show CHC347 Library CH (Link to library) Clone ID CHC347 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig - Original site URL http://dictycdb.biol.ts...KRNKLIFNYKKK--- ---IGFGCLAXPKNCNDNDPCTTDHCDPAIGCYYDKFDNCDACNAVDTCITNDLCFPREC NPRGNPPCLINPINCTSTDPCIFSYCENGVCIPTYICT...KKK--- ---IGFGCLAXPKNCNDNDPCTTDHCDPAIGCYYDKFDNCDACNAVDTCITNDLCFPREC NPRGNPPCLINPINCTSTDPCIFSYCENGVCIPTYICT
Lifescience Database Archive (English)
Full Text Available SH (Link to library) SHI777 (Link to dictyBase) - - - Contig-U12085-1 - (Link to Or...iginal site) SHI777F 332 - - - - - - Show SHI777 Library SH (Link to library) Clone ID SHI777 (Link to dicty...Base) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U12085-1 Original site URL http://dictycdb.b...IKEIIQHAKEYGIRVELEIDMPGHAYSWGIGYPS VLPANFSHSIQCQPSICTNK***ikknk*kk*kniylkikkkx*kk...IKEIIQHAKEYGIRVELEIDMPGHAYSWGIGYPS VLPANFSHSIQCQPSICTNK***ikknk*kk*kniylkikkkx*kk
Lifescience Database Archive (English)
Full Text Available VH (Link to library) VHB478 (Link to dictyBase) - - - Contig-U16349-1 - (Link to Or...iginal site) - - VHB478Z 556 - - - - Show VHB478 Library VH (Link to library) Clone ID VHB478 (Link to dicty...Base) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16349-1 Original site URL http://dictycdb.b...cid sequence ---ASGSVVXQCSSVDSISNLPTXMQLFAGIKSICTEMAMDGCEKCSGNSPTTTCDVLPV YSSLCMAMPDMSQCANWTKMCSSSGQLYNSQITT...xxcxlf*trknp*kyfrkkmdsqqkrfxr*xfn*vhlsl sgxy Frame C: ---ASGSVVXQCSSVDSISNLPTXMQLFAGIKSICTEMAMDGCEKCSGNSPTTT
Lifescience Database Archive (English)
Full Text Available VS (Link to library) VSD385 (Link to dictyBase) - - - - VSD385E (Link to Original s...ite) VSD385F 523 VSD385Z 639 VSD385P 1162 VSD385E 639 Show VSD385 Library VS (Link to library) Clone ID VSD385 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig - Original site URL http://dictycd...KTKMNKFIIGFFLCLTVFLTFVNSSEIDHQYSLTSSINGSSSGVSNSTDNTGCGEYTS CGDCREDKGCVWCGSEGICTEGTFYGTKPLNINGACKDFMWMQCKIQGR...ame B: KYKTKMNKFIIGFFLCLTVFLTFVNSSEIDHQYSLTSSINGSSSGVSNSTDNTGCGEYTS CGDCREDKGCVWCGSEGICTEGTFYGTKPLNINGACKDFM
Lifescience Database Archive (English)
Full Text Available SH (Link to library) SHL102 (Link to dictyBase) - - - Contig-U11892-1 - (Link to Or...iginal site) - - SHL102Z 634 - - - - Show SHL102 Library SH (Link to library) Clone ID SHL102 (Link to dicty...Base) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U11892-1 Original site URL http://dictycdb.b...TCRXKFDNQKIHDCDWIIQGPTTPSLCANCGKICTSKCTTNYCDRDCQTVDWQSDHKL ICGLKSFKDR*detpikn*ik*...A FSTCRXKFDNQKIHDCDWIIQGPTTPSLCANCGKICTSKCTTNYCDRDCQTVDWQSDHKL ICGLKSFKDR*detpikn*ik*kkiklnnk Frame C: ---lk
Study on construction method of concrete in the underground research laboratory. 2
International Nuclear Information System (INIS)
Iriya, Keishiro; Mikami, Tetsuji; Akiyoshi, Kenji; Uegaki, Yoshiaki
2002-02-01
The underground research laboratory, which will be constructed in Horonobe, plays a role of demonstration of construction technique upon nuclear waste repositories. Low alkalinity cement is one of candidates for repositories as a cementitious material in order to prevent alteration of bentonite and rock by hyper alkaline solution. JNC has developed a low alkalinity cement (HFSC) which contains a lot of fly ash, and has studied the physical and chemical properties by laboratory test. However workability which is required for construction procedure of repositories has not been studied enough yet. This study shows if requirements in actual construction, such as shotcreting, self-compacting, and, grouting, are fulfilled, and if the workability is preferable for tunneling construction. It is demonstrated that HFSC is applicable for shotcreting by testing in a modeled tunnel. It is pointed out that re-bars have a possibility of corrosion in low alkalinity cement. In-site test for saline water which may accelerate corrosion is started by setting specimen made in last year. Analyzing and assessing will be done next year. Construction method of tunnel lining is investigated in case of applying pre-cast segments. Self-compacting concrete is adopted, since added silica-fume needs superplasticizer and its workability is very flowable. Two piece of segment were made for the section which designed for a ordinary urban tunnel. It is noted that pre-casting concrete can be made by HFSC. Super fine cement powder for grouting which indicate low alkalinity can be selected by combination of grinned lime stone powder and silica fume with grinned ordinary Portland cement. The items to be improved toward using in Horonobe construction are pointed out by results of this study and summarized a study plan is described. Major problem to be solved is delaying compressive strength generation of HFSC. It is recognized in shotcrete and self-compacting concrete. Selecting types of fly ash and
Development of Hydrologic Characterization Technology of Fault Zones
International Nuclear Information System (INIS)
Karasaki, Kenzi; Onishi, Tiemi; Wu, Yu-Shu
2008-01-01
Through an extensive literature survey we find that there is very limited amount of work on fault zone hydrology, particularly in the field using borehole testing. The common elements of a fault include a core, and damage zones. The core usually acts as a barrier to the flow across it, whereas the damage zone controls the flow either parallel to the strike or dip of a fault. In most of cases the damage zone is the one that is controlling the flow in the fault zone and the surroundings. The permeability of damage zone is in the range of two to three orders of magnitude higher than the protolith. The fault core can have permeability up to seven orders of magnitude lower than the damage zone. The fault types (normal, reverse, and strike-slip) by themselves do not appear to be a clear classifier of the hydrology of fault zones. However, there still remains a possibility that other additional geologic attributes and scaling relationships can be used to predict or bracket the range of hydrologic behavior of fault zones. AMT (Audio frequency Magneto Telluric) and seismic reflection techniques are often used to locate faults. Geochemical signatures and temperature distributions are often used to identify flow domains and/or directions. ALSM (Airborne Laser Swath Mapping) or LIDAR (Light Detection and Ranging) method may prove to be a powerful tool for identifying lineaments in place of the traditional photogrammetry. Nonetheless not much work has been done to characterize the hydrologic properties of faults by directly testing them using pump tests. There are some uncertainties involved in analyzing pressure transients of pump tests: both low permeability and high permeability faults exhibit similar pressure responses. A physically based conceptual and numerical model is presented for simulating fluid and heat flow and solute transport through fractured fault zones using a multiple-continuum medium approach. Data from the Horonobe URL site are analyzed to demonstrate the
Development of Hydrologic Characterization Technology of Fault Zones
Energy Technology Data Exchange (ETDEWEB)
Karasaki, Kenzi; Onishi, Tiemi; Wu, Yu-Shu
2008-03-31
Through an extensive literature survey we find that there is very limited amount of work on fault zone hydrology, particularly in the field using borehole testing. The common elements of a fault include a core, and damage zones. The core usually acts as a barrier to the flow across it, whereas the damage zone controls the flow either parallel to the strike or dip of a fault. In most of cases the damage zone isthe one that is controlling the flow in the fault zone and the surroundings. The permeability of damage zone is in the range of two to three orders of magnitude higher than the protolith. The fault core can have permeability up to seven orders of magnitude lower than the damage zone. The fault types (normal, reverse, and strike-slip) by themselves do not appear to be a clear classifier of the hydrology of fault zones. However, there still remains a possibility that other additional geologic attributes and scaling relationships can be used to predict or bracket the range of hydrologic behavior of fault zones. AMT (Audio frequency Magneto Telluric) and seismic reflection techniques are often used to locate faults. Geochemical signatures and temperature distributions are often used to identify flow domains and/or directions. ALSM (Airborne Laser Swath Mapping) or LIDAR (Light Detection and Ranging) method may prove to be a powerful tool for identifying lineaments in place of the traditional photogrammetry. Nonetheless not much work has been done to characterize the hydrologic properties of faults by directly testing them using pump tests. There are some uncertainties involved in analyzing pressure transients of pump tests: both low permeability and high permeability faults exhibit similar pressure responses. A physically based conceptual and numerical model is presented for simulating fluid and heat flow and solute transport through fractured fault zones using a multiple-continuum medium approach. Data from the Horonobe URL site are analyzed to demonstrate the
Characterization of chlorophyll-a over CAL-VAL site at Kavaratti in the Lakshadweep Sea
Digital Repository Service at National Institute of Oceanography (India)
Babu, K.N.; Shukla, A.K.; Matondkar, S.G.P.; Singh, S.K.; Sawant, S.S.
Registered office: Mortimer House, 37-41 Mortimer Street, London W1T 3JH, UK Marine Geodesy Publication details, including instructions for authors and subscription information: http://www.informaworld.com/smpp/title~content=t713657895 Characterization...',Marine Geodesy,32:4,345 — 354 To link to this Article: DOI: 10.1080/01490410903297733 URL: http://dx.doi.org/10.1080/01490410903297733 Full terms and conditions of use: http://www.informaworld.com/terms-and-conditions-of-access.pdf This article may be used...
Gel table - RPD | LSDB Archive [Life Science Database Archive metadata
Lifescience Database Archive (English)
Full Text Available switchLanguage; BLAST Search Image Search Home About Archive Update History Data ...d_main.zip File URL: ftp://ftp.biosciencedbc.jp/archive/rpd/LATEST/rpd_main.zip File size: 1 KB Simple searc...iption Download License Update History of This Database Site Policy | Contact Us Gel table - RPD | LSDB Archive ...
Main - KOME | LSDB Archive [Life Science Database Archive metadata
Lifescience Database Archive (English)
Full Text Available switchLanguage; BLAST Search Image Search Home About Archive Update History Data ...ntents List of datasets Data file File name: kome_main.zip File URL: ftp://ftp.biosciencedbc.jp/archive/kome...ase Database Description Download License Update History of This Database Site Policy | Contact Us Main - KOME | LSDB Archive ...
Reference - PLACE | LSDB Archive [Life Science Database Archive metadata
Lifescience Database Archive (English)
Full Text Available switchLanguage; BLAST Search Image Search Home About Archive Update History Data ...ailable. Data file File name: place_reference.zip File URL: ftp://ftp.biosciencedbc.jp/archive/place/LATEST/...ber About This Database Database Description Download License Update History of This Database Site Policy | Contact Us Reference - PLACE | LSDB Archive ...
Enhancers - FANTOM5 | LSDB Archive [Life Science Database Archive metadata
Lifescience Database Archive (English)
Full Text Available switchLanguage; BLAST Search Image Search Home About Archive Update History Data List Contact us FANTOM...d phase2.0 Data file File name: Enhancers File URL: ftp://ftp.biosciencedbc.jp/archive/fantom...load License Update History of This Database Site Policy | Contact Us Enhancers - FANTOM5 | LSDB Archive ...
CAGE_peaks_annotation - FANTOM5 | LSDB Archive [Life Science Database Archive metadata
Lifescience Database Archive (English)
Full Text Available switchLanguage; BLAST Search Image Search Home About Archive Update History Data List Contact us FANTOM...file File name: CAGE_peaks_annotation File URL: ftp://ftp.biosciencedbc.jp/archive/fantom...on Download License Update History of This Database Site Policy | Contact Us CAGE_peaks_annotation - FANTOM5 | LSDB Archive ...
DEFF Research Database (Denmark)
Andersen, Ebbe Sloth; Rosenblad, Magnus Alm; Larsen, Niels
2006-01-01
Maintained at the University of Texas Health Science Center at Tyler, Texas, the tmRNA database (tmRDB) is accessible at the URL http://psyche.uthct.edu/dbs/tmRDB/tmRDB.html with mirror sites located at Auburn University, Auburn, Alabama (http://www.ag.auburn.edu/mirror/tmRDB/) and the Royal...
pSort search result - KOME | LSDB Archive [Life Science Database Archive metadata
Lifescience Database Archive (English)
Full Text Available switchLanguage; BLAST Search Image Search Home About Archive Update History Data ...name: kome_psort_search_result.zip File URL: ftp://ftp.biosciencedbc.jp/archive/kome/LATEST/kome_psort_searc...abase Description Download License Update History of This Database Site Policy | Contact Us pSort search result - KOME | LSDB Archive ...
GeoSearcher: Location-Based Ranking of Search Engine Results.
Watters, Carolyn; Amoudi, Ghada
2003-01-01
Discussion of Web queries with geospatial dimensions focuses on an algorithm that assigns location coordinates dynamically to Web sites based on the URL. Describes a prototype search system that uses the algorithm to re-rank search engine results for queries with a geospatial dimension, thus providing an alternative ranking order for search engine…
Los sitios web como estructuras de información : un primer abordaje en los criterios de calidad
García de León, Alicia; Garrido Díaz, Adriana
2002-01-01
This article analyzes web sites as structures of information. It also establishes criteria for its evaluation through the study of aspects of: structure, fulfillment of objectives, knowledge of audience and adaptation to it, credibility, authorship, URL characteristics, sponsors and publicity, contents, interactivity, actualization, hypertext structure, graphic access of the general structure, design.
Update History of This Database - RMG | LSDB Archive [Life Science Database Archive metadata
Lifescience Database Archive (English)
Full Text Available switchLanguage; BLAST Search Image Search Home About Archive Update History Data ...List Contact us RMG Update History of This Database Date Update contents 2016/08/22 The contact address is c...dna.affrc.go.jp/ ) is opened. About This Database Database Description Download License Update Hi...story of This Database Site Policy | Contact Us Update History of This Database - RMG | LSDB Archive ... ... URL of the portal site is changed. 2013/08/07 RMG archive site is opened. 2002/09/25 RMG ( http://rmg.rice.
Update History of This Database - KAIKOcDNA | LSDB Archive [Life Science Database Archive metadata
Lifescience Database Archive (English)
Full Text Available switchLanguage; BLAST Search Image Search Home About Archive Update History Data ...List Contact us KAIKOcDNA Update History of This Database Date Update contents 2014/10/20 The URL of the dat... database ( http://sgp.dna.affrc.go.jp/EST/ ) is opened. About This Database Database Description Download License Update Hi...story of This Database Site Policy | Contact Us Update History of This Database - KAIKOcDNA | LSDB Archive ... ...abase maintenance site is changed. 2014/10/08 KAIKOcDNA English archive site is opened. 2004/04/12 KAIKOcDNA
Lifescience Database Archive (English)
Full Text Available VH (Link to library) VHK220 (Link to dictyBase) - - - - - (Link to Original site) VHK2...20F 530 - - - - - - Show VHK220 Library VH (Link to library) Clone ID VHK220 (Link to dictyBase) Atlas ID... - NBRP ID - dictyBase ID - Link to Contig - Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHK2-A/VHK2...20Q.Seq.d/ Representative seq. ID - (Link to Original site) Representative DNA sequence >VHK2...20 (VHK220Q) /CSM/VH/VHK2-A/VHK220Q.Seq.d/ AACTCTCGAGTGCAAAAAAAGTAAAGTACAAAATGGTTAATTTCA
Lifescience Database Archive (English)
Full Text Available VH (Link to library) VHK285 (Link to dictyBase) - - - - - (Link to Original site) VHK2...85F 531 - - - - - - Show VHK285 Library VH (Link to library) Clone ID VHK285 (Link to dictyBase) Atlas ID... - NBRP ID - dictyBase ID - Link to Contig - Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHK2-D/VHK2...85Q.Seq.d/ Representative seq. ID - (Link to Original site) Representative DNA sequence >VHK2...85 (VHK285Q) /CSM/VH/VHK2-D/VHK285Q.Seq.d/ AACTCTCGAGTGCAAAAAAAGTAAAGTACAAAATGGTTAATTTCA
International Nuclear Information System (INIS)
Johansen, K.; Peters, J.H.; Fitzgerald, W.R.
1998-01-01
A major international experiment, demonstrating technologies for tunnel sealing at full-scale, is being conducted at Canada's Underground Research Laboratory (URL) with participation by organizations from Canada, Japan, France and the U.S.A. Two bulkheads, one composed of high performance concrete and the other of highly compacted sand-bentonite material, have been be constructed in a tunnel in unfractured granitic rock at the URL. The Tunnel Sealing Experiment will characterize the performance of the two bulkheads under applied hydraulic pressures. The chamber between the two bulkheads will be pressurized to approximately 4 MPa, a value representative of the ambient pore pressures in the rock at a depth of 420 m. Instrumentation in the experiment monitors the seepage through and around each bulkhead as well as the changes to the pore water pressures, and hence changes to the flow directions, in the intact rock. Stresses and displacements in each bulkhead are also monitored. The objective of the experiment is to demonstrate technologies for construction of bentonite and concrete bulkheads and to quantify the performance of each bulkhead. (author)
Lifescience Database Archive (English)
Full Text Available AF (Link to library) AFJ353 (Link to dictyBase) - - - Contig-U10972-1 AFJ353P (Link... to Original site) AFJ353F 592 AFJ353Z 580 AFJ353P 1172 - - Show AFJ353 Library AF (Link to library) Clone ID AFJ353 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U10972-1 Original site URL http://dict...SISTGLPNLSGGKINTNVYSSLGNIGSGMNGSSTKDDSVSPTKKSTDHQP RKPMTKSVSMSSIGLN--- ---NYLIQSFLKQFSPEVNQFVCDAIMGNIEEICT...TNVYSSLGNIGSGMNGSSTKDDSVSPTKKSTDHQP RKPMTKSVSMSSIGLN--- ---NYLIQSFLKQFSPEVNQFVCDAIMGNIEEICTHKVGCTVVNRCIDNANP
Lifescience Database Archive (English)
Full Text Available SF (Link to library) SFA408 (Link to dictyBase) - - - Contig-U10972-1 SFA408P (Link... to Original site) SFA408F 509 SFA408Z 686 SFA408P 1195 - - Show SFA408 Library SF (Link to library) Clone ID SFA408 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U10972-1 Original site URL http://dict...YLSXDQVESIIASIKGKVIQLSKDNKGNYLIQSFLKQFSPEVNQFV CDAIMGNIEEICTHKVGCTVVNRCIDNANPEQLEKLVDKITEHSLKLVQDQFGNYVVQHL ...KDNKGNYLIQSFLKQFSPEVNQFV CDAIMGNIEEICTHKVGCTVVNRCIDNANPEQLEKLVDKITEHSLKLVQDQFGNYV
Lifescience Database Archive (English)
Full Text Available SL (Link to library) SLG821 (Link to dictyBase) - - - Contig-U15540-1 SLG821P (Link... to Original site) SLG821F 638 SLG821Z 554 SLG821P 1192 - - Show SLG821 Library SL (Link to library) Clone ID SLG821 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15540-1 Original site URL http://dict...MSPSSPICLPESPMGAQHWESGL--- ---IDDKTGIFDSQRFLAFNNPQAMSKYESYRIYIHPSLGYSGNAKRFKQQPDVNEKALI LDGNVYDGHLNPIYNCKICT...*--- ---IDDKTGIFDSQRFLAFNNPQAMSKYESYRIYIHPSLGYSGNAKRFKQQPDVNEKALI LDGNVYDGHLNPIYNCKICT
Lifescience Database Archive (English)
Full Text Available VF (Link to library) VFB866 (Link to dictyBase) - - - Contig-U16349-1 VFB866Z (Link... to Original site) - - VFB866Z 631 - - - - Show VFB866 Library VF (Link to library) Clone ID VFB866 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16349-1 Original site URL http://dict...ce ---SSVDSISNLPTTMQLFAGIKSICTEMAMDGCEKCSGNSPTTTCDVLPVYSSLCMAMP DMSQCANWTKMCSSSGQLYNSQITSDYCVASVADAVPIMRMYFH...RGCLHAIELTCSYALMLVAMTFNVALFFAV Translated Amino Acid sequence (All Frames) Frame A: ---SSVDSISNLPTTMQLFAGIKSICT
Lifescience Database Archive (English)
Full Text Available VH (Link to library) VHL364 (Link to dictyBase) - - - Contig-U16205-1 - (Link to Or...iginal site) - - VHL364Z 668 - - - - Show VHL364 Library VH (Link to library) Clone ID VHL364 (Link to dicty...Base) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16205-1 Original site URL http://dictycdb.b...mino Acid sequence ---KKVTIAEAKEIFEKQYRDLYTVSQDVTKLAIQSAEQNGIVFLDEIDKICTSRESIKN GGDASTDGVQRDLLPIVEGCMVSTKYGQ...itwyh*tyrrgykf*lxys*r*nscfrysrh*ktfk Frame B: ---KKVTIAEAKEIFEKQYRDLYTVSQDVTKLAIQSAEQNGIVFLDEIDKICTSRESIKN G
Lifescience Database Archive (English)
Full Text Available VH (Link to library) VHK472 (Link to dictyBase) - - - Contig-U16349-1 - (Link to Or...iginal site) - - VHK472Z 392 - - - - Show VHK472 Library VH (Link to library) Clone ID VHK472 (Link to dicty...Base) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16349-1 Original site URL http://dictycdb.b....10 Translated Amino Acid sequence ---CSSVDSISNLPTXMQLFAGIKSICTEMAMDGCEKCSGNSPTTT...wstlqlsnhirllcrlcc*rrsnhenvlshwylglypl*ilgtk n*psicwfmv Frame B: ---CSSVDSISNLPTXMQLFAGIKSICTEMAMDGCEKCSGNSP
Lifescience Database Archive (English)
Full Text Available CF (Link to library) CFJ816 (Link to dictyBase) - - - Contig-U16255-1 CFJ816P (Link... to Original site) CFJ816F 562 CFJ816Z 721 CFJ816P 1263 - - Show CFJ816 Library CF (Link to library) Clone ID CFJ816 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16255-1 Original site URL http://dict...ATGSATGQGTSGGTPGSCDKV NCPNGYICTIVNQLAVCVSPSSSSSSSSSTTGSHTTTGGSTTGSHTTTGGSTTGSHTTT...PATGSATGQGTSGGTPGSCDKV NCPNGYICTIVNQLAVCVSPSSSSSSSSSTTGSHTTTGGSTTGSHTTTGGSTTGSHTTTG GSTTGSHTTTGGSTTGSHTTTGGS
Lifescience Database Archive (English)
Full Text Available CF (Link to library) CFI686 (Link to dictyBase) - - - Contig-U15579-1 CFI686P (Link... to Original site) CFI686F 185 CFI686Z 445 CFI686P 610 - - Show CFI686 Library CF (Link to library) Clone ID CFI686 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15579-1 Original site URL http://dict...CYYDKFDXCXACN XVDTCXXNDLCXXRECNXRGXPPCLINPINCXSXDPCIFSYCENGVCIXTYICTPTPSVT PTVTPT...LVXXCXIGFGCXAIXKNCNXNDPXXXDXCDXXIGCYYDKFDXCXACN XVDTCXXNDLCXXRECNXRGXPPCLINPINCXSXDPCIFSYCENGVCIXTYICTPTPSVT
Lifescience Database Archive (English)
Full Text Available VH (Link to library) VHA365 (Link to dictyBase) - - - Contig-U16349-1 - (Link to Or...iginal site) - - VHA365Z 352 - - - - Show VHA365 Library VH (Link to library) Clone ID VHA365 (Link to dicty...Base) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16349-1 Original site URL http://dictycdb.b...TTGGGTACCAAGAACTGACCGTCAATTTGCTGGTTCATGGTTT sequence update 2002. 9.10 Translated Amino Acid sequence ---QLFAGIKSICT...wfmv Frame C: ---QLFAGIKSICTEMAMDGCEKCSGNSPTTTCDVLPVYSSLCMAMPDMSQCANWTKMCS SSGQLY
Lifescience Database Archive (English)
Full Text Available VF (Link to library) VFF110 (Link to dictyBase) - - - Contig-U10843-1 VFF110P (Link... to Original site) VFF110F 496 VFF110Z 306 VFF110P 802 - - Show VFF110 Library VF (Link to library) Clone ID VFF110 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U10843-1 Original site URL http://dict...AVKVMLKQVDQKTLTDF RKEVAIMSKIFHPNIVLFLGACTSTPGKLMICTELMKGNLESLL--- ---XIFKVXXNGGIXXQXIXXPQGKFQXXKSKXXRXKXLITG...VYKGRCRLKDVAVKVMLKQVDQKTLTDF RKEVAIMSKIFHPNIVLFLGACTSTPGKLMICTELMKGNLESLL--- ---qflklxxmxvfxxkxfxxpkvnskxxkv
Lifescience Database Archive (English)
Full Text Available SL (Link to library) SLE110 (Link to dictyBase) - - - Contig-U16520-1 SLE110E (Link... to Original site) - - - - - - SLE110E 237 Show SLE110 Library SL (Link to library) Clone ID SLE110 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16520-1 Original site URL http://dict...NLSEDVNLEEFVMSKDDLSGADIKAICTESGLLALRERRMRVTYXDFKKAKEKVLYR KTAGAPEGLYM*kkknqnq Translated Amino Acid sequence... (All Frames) Frame A: AKMNLSEDVNLEEFVMSKDDLSGADIKAICTESGLLALRERRMRVTYXDFKKAKEKVL
Lifescience Database Archive (English)
Full Text Available SS (Link to library) SSB322 (Link to dictyBase) - - - Contig-U03539-1 SSB322Z (Link... to Original site) - - SSB322Z 393 - - - - Show SSB322 Library SS (Link to library) Clone ID SSB322 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U03539-1 Original site URL http://dict...KGKXYILQDKQYKERGVGTIRVNKDLEEKXRIIMNAD GSKKNILNVNIFPKMKVTSPNEKTLTFIAFEDDKICTFVLIAKPEEIKNFSTVINKQISS LEVA*nfil...NAD GSKKNILNVNIFPKMKVTSPNEKTLTFIAFEDDKICTFVLIAKPEEIKNFSTVINKQISS LEVA*nfilkkkk Homology vs CSM-cDNA Score E
Lifescience Database Archive (English)
Full Text Available AH (Link to library) AHB126 (Link to dictyBase) - - - Contig-U16336-1 AHB126P (Link... to Original site) AHB126F 598 AHB126Z 500 AHB126P 1078 - - Show AHB126 Library AH (Link to library) Clone ID AHB126 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16336-1 Original site URL http://dict...RGIRNHKKNETKFINQCINEIKEELKGDMQKKTVAVQKLTYIQMLGFDI SWASFKIVEVMSCNKFSSKRIGYLAASQSFNEGTDVIVLATHQIRKDFLSSNQSEAYLAL NCLSNICT...KKNETKFINQCINEIKEELKGDMQKKTVAVQKLTYIQMLGFDI SWASFKIVEVMSCNKFSSKRIGYLAASQSFNEGTDVIVLATHQIRKDFLSSNQSEAYLAL NCLSNICT
Lifescience Database Archive (English)
Full Text Available VH (Link to library) VHC776 (Link to dictyBase) - - - Contig-U15722-1 VHC776P (Link... to Original site) VHC776F 593 VHC776Z 895 VHC776P 1468 - - Show VHC776 Library VH (Link to library) Clone ID VHC776 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15722-1 Original site URL http://dict...CDNNTGNCTCHNEXFGNSCEFTRCP LDCSTPNGTCDNNXGNCTCHNEHFGNGCEFTQCPLYCSTPNGTCDINSGICTCDN...XFGNSCEFTRCP LDCSTPNGTCDNNXGNCTCHNEHFGNGCEFTQCPLYCSTPNGTCDINSGICTCDNEHIGN GCEIKFIECKHKCSTKHGICDNDSGNCKCDTQTK
Lifescience Database Archive (English)
Full Text Available VH (Link to library) VHK477 (Link to dictyBase) - - - Contig-U11536-1 VHK477P (Link... to Original site) VHK477F 685 VHK477Z 794 VHK477P 1459 - - Show VHK477 Library VH (Link to library) Clone ID VHK477 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U11536-1 Original site URL http://dict...QIGTYSFEGKFIKKAIINGNRIVTINN KLLNENQLNSNSTITKEKDSSNQLSSFISIEIPHYDSNVLLDPSFSVLLDSNESYKNSEN SICTSKKSSKLTTAQIIAI...NQLSSFISIEIPHYDSNVLLDPSFSVLLDSNESYKNSEN SICTSKKSSKLTTAQIIAIVIVSVVFVIILALFIIVKFSKS
Lifescience Database Archive (English)
Full Text Available SF (Link to library) SFD793 (Link to dictyBase) - - - Contig-U16255-1 SFD793P (Link... to Original site) SFD793F 660 SFD793Z 689 SFD793P 1349 - - Show SFD793 Library SF (Link to library) Clone ID SFD793 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16255-1 Original site URL http://dict...ATCSSLNCNAQQMSCKYVQQACHETSC CPDIPQCQIPATGGGPATGSATGQGTSGGTPGSCDKVNCPNGYICTIVNQLAVCVSPSSS SSSSSSTTGSHTTTGGSTT...TGGGPATGSATGQGTSGGTPGSCDKVNCPNGYICTIVNQLAVCVSPSSS SSSSSSTTGSHTTTGGSTTGSHTTTGGSTTG
Lifescience Database Archive (English)
Full Text Available FC (Link to library) FC-AC21 (Link to dictyBase) - - - Contig-U15104-1 FC-AC21E (Li...nk to Original site) - - - - - - FC-AC21E 527 Show FC-AC21 Library FC (Link to library) Clone ID FC-AC21 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15104-1 Original site URL http://dict...ce KDSLDVIIFPEMVKLVGLTPNTMEKVLTYFQDNDTIDLSTFPMEIQVEQLSGKYIFICTH KQKDQRCGYCGPILVDQLRDQIKERSLEKEIQVFGTSHVGGHKY... Frames) Frame A: KDSLDVIIFPEMVKLVGLTPNTMEKVLTYFQDNDTIDLSTFPMEIQVEQLSGKYIFICTH KQ
Lifescience Database Archive (English)
Full Text Available VH (Link to library) VHI141 (Link to dictyBase) - - - Contig-U15722-1 VHI141P (Link... to Original site) VHI141F 635 VHI141Z 922 VHI141P 1537 - - Show VHI141 Library VH (Link to library) Clone ID VHI141 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15722-1 Original site URL http://dict...LDCSTPNGTCDNNTGNCTCHNEHFGNSC EFTRCPLDCSTPNGTCDNNTGNCTCHNEHFGNGCEFTQCPLYCSTPNGTCDINSGICTCD NEHIGNGCEIKFIECKHK...PNGTCDNNTGNCTCHNEHFGNGCEFTQCPLYCSTPNGTCDINSGICTCD NEHIGNGCEIKFIECKHKCSTKHGICDNDSG
Lifescience Database Archive (English)
Full Text Available VF (Link to library) VFL117 (Link to dictyBase) - G22229 DDB0204982 Contig-U10461-1... - (Link to Original site) - - VFL117Z 591 - - - - Show VFL117 Library VF (Link to library) Clone ID VFL117 (Link to dict...yBase) Atlas ID - NBRP ID G22229 dictyBase ID DDB0204982 Link to Contig Contig-U10461-1 Original site URL http://dict...GMALLRSLQNHKKNTPFQHFQDMIFKTK VLITTVSLVFICTVIEEGIYQFAFEEFSTSTSVQSNFITYLIDTTQMIVVMYILANGKFS NYILFRKVKTTSFNSNEK...k**ytkfkynn**hw Frame B: ---TSMLMDIKFGQAVGFLILLAIYCAMVIGFGMALLRSLQNHKKNTPFQHFQDMIFKTK VLITTVSLVFICT
Lifescience Database Archive (English)
Full Text Available VH (Link to library) VHC263 (Link to dictyBase) - - - Contig-U16349-1 - (Link to Or...iginal site) - - VHC263Z 429 - - - - Show VHC263 Library VH (Link to library) Clone ID VHC263 (Link to dicty...Base) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16349-1 Original site URL http://dictycdb.b...ATGG ACTCCCAAC sequence update 2002. 9.10 Translated Amino Acid sequence ---QLFAGIKSICT...kyfrkkmdsq Frame B: ---QLFAGIKSICTXMAMDGCEKCSGNSPTTTCDVLPVYSSLCMAMPDMSQCANWTKMCS
Lifescience Database Archive (English)
Full Text Available VH (Link to library) VHO201 (Link to dictyBase) - - - Contig-U12425-1 VHO201P (Link... to Original site) VHO201F 596 VHO201Z 398 VHO201P 974 - - Show VHO201 Library VH (Link to library) Clone ID VHO201 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U12425-1 Original site URL http://dict...SGSQMEIQNRRGIVNLGDYSTSR DDNPHVLTVLLKQFLRDLPEPICTNALYDLFLAASDQINFQQCKENGFEVLKKLINS...CKREXMELRIPTFVSNILNTLFLHSLGVEGLFRISGSQMEIQNRRGIVNLGDYSTSR DDNPHVLTVLLKQFLRDLPEPICT
Lifescience Database Archive (English)
Full Text Available AF (Link to library) AFI379 (Link to dictyBase) - - - Contig-U08795-1 AFI379P (Link... to Original site) AFI379F 645 AFI379Z 836 AFI379P 1471 - - Show AFI379 Library AF (Link to library) Clone ID AFI379 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U08795-1 Original site URL http://dict...ITNNYFFYFLKIFCYYYFYYHKMALVLPIFATENTLLVTENDL GRGFSVDDNGANAKKSNVYICTKEDMTTVRSITDSNKLTLINDQESLTSALNVSGELSLS YGL...KIFCYYYFYYHKMALVLPIFATENTLLVTENDL GRGFSVDDNGANAKKSNVYICTKEDMTTVRSITDSNKLTLINDQESLTSALNVSGELSLS YGLMSGKIMGEYL
Lifescience Database Archive (English)
Full Text Available SF (Link to library) SFH459 (Link to dictyBase) - - - Contig-U16336-1 SFH459P (Link... to Original site) SFH459F 606 SFH459Z 728 SFH459P 1334 - - Show SFH459 Library SF (Link to library) Clone ID SFH459 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16336-1 Original site URL http://dict...KTVAVQKLTYIQ MLGFDISWASFKIVEVMSCNKFSSKRIGYLAASQSFNEGTDVIVLATHQIRKDFLSSNQS EAYLALNCLSNICTTDLARELANDILTLLSTQKT...TVAVQKLTYIQ MLGFDISWASFKIVEVMSCNKFSSKRIGYLAASQSFNEGTDVIVLATHQIRKDFLSSNQS EAYLALNCLSNICTTDLARELANDILTLLSTQKTH
Lifescience Database Archive (English)
Full Text Available CH (Link to library) CHR591 (Link to dictyBase) - - - Contig-U11865-1 CHR591P (Link... to Original site) CHR591F 557 CHR591Z 706 CHR591P 1243 - - Show CHR591 Library CH (Link to library) Clone ID CHR591 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U11865-1 Original site URL http://dict... IDPYEIQQNKQSNNSNSNSNRNLTPNSSSPTNQRKNKQEDDDDESKLDDESDLNERFQKV VLRFREFPSLDTNLYRLQEICT...DLNERFQKV VLRFREFPSLDTNLYRLQEICTDLLHISQDFIHTVKTYGRIIIEERYLKEKTIQSRSIGG H--- ---RK
Lifescience Database Archive (English)
Full Text Available SF (Link to library) SFF125 (Link to dictyBase) - - - Contig-U16368-1 SFF125P (Link... to Original site) SFF125F 540 SFF125Z 608 SFF125P 1148 - - Show SFF125 Library SF (Link to library) Clone ID SFF125 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16368-1 Original site URL http://dict...RNQHCPHGYSCR VIKGCATCVRDARPPHNLCRGFGCPEGSHCEVLEKHPVCVRNHVPPHPPPPPQICGSVNC GPGYICTIINGHPTCIRGDGYLCNQTRCPHDYQC...ACCVPHHDGCGNIQCPWGHYCVNEHGKCRCVPHRPPPRPPVDQCRNQHCPHGYSCR VIKGCATCVRDARPPHNLCRGFGCPEGSHCEVLEKHPVCVRNHVPPHPPPPPQICGSVNC GPGYICT
Lifescience Database Archive (English)
Full Text Available VH (Link to library) VHL434 (Link to dictyBase) - - - Contig-U16336-1 VHL434P (Link... to Original site) VHL434F 546 VHL434Z 778 VHL434P 1304 - - Show VHL434 Library VH (Link to library) Clone ID VHL434 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16336-1 Original site URL http://dict...EVMSCNKFSSKRIGYLAASQSFNEGTDVIVLATHQIRKDFLS SNQSEAYLALNCLSNICTTDLARELANDILTLLSTQKTHILKRAITVLYKIFLRYPES-- - --...GFDISWASFKIVEVMSCNKFSSKRIGYLAASQSFNEGTDVIVLATHQIRKDFLS SNQSEAYLALNCLSNICTTDLARELANDILTLLSTQKTHILKRAITVLYKIFL
Lifescience Database Archive (English)
Full Text Available CH (Link to library) CHN802 (Link to dictyBase) - - - Contig-U16336-1 CHN802P (Link... to Original site) CHN802F 543 CHN802Z 788 CHN802P 1311 - - Show CHN802 Library CH (Link to library) Clone ID CHN802 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16336-1 Original site URL http://dict...ASFKIVEVMSCNKFSSKRIGYLAASQSFNEGTDVIVLATHQIRKDFLSSN QSEAYLALNCLSNICTTDLARELANDILTLLSTQKTHILKRAITVLYKIFLRYPESL...NETKFINQCINEIKEELKGDMQKKTVAVQKLTY IQMLGFDISWASFKIVEVMSCNKFSSKRIGYLAASQSFNEGTDVIVLATHQIRKDFLSSN QSEAYLALNCLSNICT
Lifescience Database Archive (English)
Full Text Available SL (Link to library) SLA340 (Link to dictyBase) - - - Contig-U16510-1 - (Link to Or...iginal site) - - SLA340Z 466 - - - - Show SLA340 Library SL (Link to library) Clone ID SLA340 (Link to dicty...Base) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16510-1 Original site URL http://dictycdb.b.... 2 Translated Amino Acid sequence ---CGKPSPIPTCTRKLSPISICIIKLCPIFICITKLCSIYICTISICIIFICIICSNYS CNYNCNYSCNYN...qpqlqlqlqlqpqpqlqpqlqpq lplkfnqktffikyhynnffnnnsikk*y*kspffl Frame C: ---CGKPSPIPTCTRKLSPISICIIKLCPIFICITKLCSIYICT
Lifescience Database Archive (English)
Full Text Available VF (Link to library) VFB713 (Link to dictyBase) - - - Contig-U16602-1 VFB713F (Link... to Original site) VFB713F 471 - - - - - - Show VFB713 Library VF (Link to library) Clone ID VFB713 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16602-1 Original site URL http://dict...ar 12.0 %: cytoplasmic 8.0 %: vacuolar 8.0 %: mitochondrial 8.0 %: endoplasmic reticulum >> predict
Database Description - PSCDB | LSDB Archive [Life Science Database Archive metadata
Lifescience Database Archive (English)
Full Text Available abase Description General information of database Database name PSCDB Alternative n...rial Science and Technology (AIST) Takayuki Amemiya E-mail: Database classification Structure Databases - Protein structure Database...554-D558. External Links: Original website information Database maintenance site Graduate School of Informat...available URL of Web services - Need for user registration Not available About This Database Database Descri...ption Download License Update History of This Database Site Policy | Contact Us Database Description - PSCDB | LSDB Archive ...
Lifescience Database Archive (English)
Full Text Available AF (Link to library) AFN878 (Link to dictyBase) - - - Contig-U15540-1 AFN878P (Link... to Original site) AFN878F 592 AFN878Z 531 AFN878P 1123 - - Show AFN878 Library AF (Link to library) Clone ID AFN878 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15540-1 Original site URL http://dict...D VNEKALILDGNVYDGHLNPIYNCKICTEYYQTKSYFSANPHAKGKVLLVKNNILTRVKDG GFTLSLKPMCCSGHNSHIPLYFHFTLTNPLTNEVVLQSLINVNVK...YESYRIYIHPSLGYSGNAKRFKQQPD VNEKALILDGNVYDGHLNPIYNCKICTEYYQTKSYFSANPHAKGKVLLVKNNILTRVKDG GFTLSLKPMCCSGHNSHIPL
Lifescience Database Archive (English)
Full Text Available AF (Link to library) AFL122 (Link to dictyBase) - - - Contig-U11144-1 AFL122P (Link... to Original site) AFL122F 837 AFL122Z 711 AFL122P 1538 - - Show AFL122 Library AF (Link to library) Clone ID AFL122 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U11144-1 Original site URL http://dict...GPSVILLDEPTSGLDASTSFYVMSALKKLAKSGRTIICTIHQPRSNIYDM FDNLLLLGDGNTIYYGKANKALEYFNANGYHCSEKTNPADFFLDLINTQVEDQADSD...TLNFYAQLKMPRDVPLKEKLQRVQDIIDEMGLNRCADTLVGTADNKIRGISGGERR RVTISIELLTGPSVILLDEPTSGLDASTSFYVMSALKKLAKSGRTIICT
Lifescience Database Archive (English)
Full Text Available VH (Link to library) VHH831 (Link to dictyBase) - - - Contig-U15722-1 VHH831P (Link... to Original site) VHH831F 586 VHH831Z 930 VHH831P 1496 - - Show VHH831 Library VH (Link to library) Clone ID VHH831 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15722-1 Original site URL http://dict...HFGNGCEFTQCPLYCSTPNGTCDINSGICTC DNEHIGNGCEIKFIECKHKCSTKHGICDNDSGNCKCDTQTKGLTCEESRLLIESLDSINS KGGTINIIGYFGNTT...STPNGTCDNNTGNCTCHNEHFGNG CEFTRCPLDCSTPNGTCDNNTGNCTCHNEHFGNGCEFTQCPLYCSTPNGTCDINSGICTC DNEHIGNGCEIKFIECKHKCST
Lifescience Database Archive (English)
Full Text Available CF (Link to library) CFE262 (Link to dictyBase) - - - Contig-U16368-1 CFE262P (Link... to Original site) CFE262F 652 CFE262Z 401 CFE262P 1053 - - Show CFE262 Library CF (Link to library) Clone ID CFE262 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16368-1 Original site URL http://dict...HRPPPRPPVDQCRNQHCPHGYSC RVIKGCATCVRDARPPHNLCRGFGCPEGSHCEVLEKHPVCVRNHVPPHPPPPPQICGSVN CGPGYICTIINGHPTCIRGDGYL...VNEHGKCRCVPHRPPPRPPVDQCRNQHCPHGYSC RVIKGCATCVRDARPPHNLCRGFGCPEGSHCEVLEKHPVCVRNHVPPHPPPPPQICGSVN CGPGYICTIING
Exploration of gaps in Bitly's spam detection and relevant counter measures
Gupta, Neha; Kumaraguru, Ponnurangam
2014-01-01
Existence of spam URLs over emails and Online Social Media (OSM) has become a growing phenomenon. To counter the dissemination issues associated with long complex URLs in emails and character limit imposed on various OSM (like Twitter), the concept of URL shortening gained a lot of traction. URL shorteners take as input a long URL and give a short URL with the same landing page in return. With its immense popularity over time, it has become a prime target for the attackers giving them an adva...
Main data - RMG | LSDB Archive [Life Science Database Archive metadata
Lifescience Database Archive (English)
Full Text Available switchLanguage; BLAST Search Image Search Home About Archive Update History Data ...ftp://ftp.biosciencedbc.jp/archive/rmg/LATEST/rmg_main.zip File size: 1 KB Simple search URL http://togodb.b... This Database Database Description Download License Update History of This Database Site Policy | Contact Us Main data - RMG | LSDB Archive ...
Alignment - SAHG | LSDB Archive [Life Science Database Archive metadata
Lifescience Database Archive (English)
Full Text Available switchLanguage; BLAST Search Image Search Home About Archive Update History Data ...e URL: ftp://ftp.biosciencedbc.jp/archive/sahg/LATEST/sahg_alignment.zip File size: 12.0 MB Simple search UR...s Database Database Description Download License Update History of This Database Site Policy | Contact Us Alignment - SAHG | LSDB Archive ...
PREIMS - AT Atlas | LSDB Archive [Life Science Database Archive metadata
Lifescience Database Archive (English)
Full Text Available switchLanguage; BLAST Search Image Search Home About Archive Update History Data ...Targeted Proteins Research Program (TPRP). Data file File name: at_atlas_preims.zip File URL: ftp://ftp.biosciencedbc.jp/archiv...base Database Description Download License Update History of This Database Site Policy | Contact Us PREIMS - AT Atlas | LSDB Archive ...
EST data - RED | LSDB Archive [Life Science Database Archive metadata
Lifescience Database Archive (English)
Full Text Available switchLanguage; BLAST Search Image Search Home About Archive Update History Data ...st.zip File URL: ftp://ftp.biosciencedbc.jp/archive/red/LATEST/red_est.zip File size: 629 KB Simple search U...ase Database Description Download License Update History of This Database Site Policy | Contact Us EST data - RED | LSDB Archive ...
Exon - ASTRA | LSDB Archive [Life Science Database Archive metadata
Lifescience Database Archive (English)
Full Text Available switchLanguage; BLAST Search Image Search Home About Archive Update History Data ...ontents Exons in variants Data file File name: astra_exon.zip File URL: ftp://ftp.biosciencedbc.jp/archive/a... About This Database Database Description Download License Update History of This Database Site Policy | Contact Us Exon - ASTRA | LSDB Archive ...
CAGE peaks - FANTOM5 | LSDB Archive [Life Science Database Archive metadata
Lifescience Database Archive (English)
Full Text Available switchLanguage; BLAST Search Image Search Home About Archive Update History Data List Contact us FANTOM...E Data file File name: CAGE_peaks File URL: ftp://ftp.biosciencedbc.jp/archive/fantom... This Database Database Description Download License Update History of This Database Site Policy | Contact Us CAGE peaks - FANTOM5 | LSDB Archive ...
ORF information - KOME | LSDB Archive [Life Science Database Archive metadata
Lifescience Database Archive (English)
Full Text Available switchLanguage; BLAST Search Image Search Home About Archive Update History Data ... File URL: ftp://ftp.biosciencedbc.jp/archive/kome/LATEST/kome_orf_infomation.zip File size: 526 KB Simple s...ut This Database Database Description Download License Update History of This Database Site Policy | Contact Us ORF information - KOME | LSDB Archive ...
AECL's underground research laboratory: technical achievements and lessons learned
International Nuclear Information System (INIS)
Ohta, M.M.; Chandler, N.A.
1997-03-01
During the development of the research program for the Canadian Nuclear Fuel Waste Management Program in the 1970's, the need for an underground facility was recognized. AECL constructed an Underground Research Laboratory (URL) for large-scale testing and in situ engineering and performance-assessment-related experiments on key aspects of deep geological disposal in a representative geological environment. Ale URL is a unique geotechnical research and development facility because it was constructed in a previously undisturbed portion of a granitic pluton that was well characterized before construction began, and because most of the shaft and experimental areas are below the water table. The specific areas of research, development and demonstration include surface and underground characterization; groundwater and solute transport; in situ rock stress conditions; temperature and time-dependent deformation and failure characteristics of rock; excavation techniques to minimize damage to surrounding rock and to ensure safe working conditions; and the performance of seals and backfills. This report traces the evolution of the URL and summarizes the technical achievements and lessons learned during its siting, design and construction, and operating phases over the last 18 years. (author)
Yu, Elmer; Miotto, Karen; Akerele, Evaristo; Montgomery, Ann; Elkashef, Ahmed; Walsh, Robert; Montoya, Ivan; Fischman, Marian W.; Collins, Joseph; McSherry, Frances; Boardman, Kathy; Davies, David K.; O’Brien, Charles P.; Ling, Walter; Kleber, Herbert; Herman, Barbara H.
2008-01-01
Context Lofexidine is an alpha-2-A noradrenergic receptor agonist that is approved in the United Kingdom for the treatment of opioid withdrawal symptoms. Lofexidine has been reported to have more significant effects on decreasing opioid withdrawal symptoms with less hypotension than clonidine. Objective To demonstrate that lofexidine is well tolerated and effective in the alleviation of observationally-defined opioid withdrawal symptoms in opioid dependent individuals undergoing medically supervised opioid detoxification as compared to placebo. Design An inpatient, Phase 3, placebo-controlled, double blind, randomized multi-site trial with three phases: (1) Opioid Agonist Stabilization Phase (days 1–3), (2) Detoxification/Medication or Placebo Phase (days 4–8), and (3) Post Detoxification/Medication Phase (days 9–11). Subjects Sixty-eight opioid dependent subjects were enrolled at three sites with 35 randomized to lofexidine and 33 to placebo. Main Outcome Measure Modified Himmelsbach Opiate Withdrawal Scale (MHOWS) on study day 5 (2nd opioid detoxification treatment day). Results Due to significant findings, the study was terminated early. On the study day 5 MHOWS, subjects treated with lofexidine had significantly lower scores (equating to fewer/less severe withdrawal symptoms) than placebo subjects (Least squares means 19.5 ± 2.1 versus 30.9 ± 2.7; p=0.0019). Lofexidine subjects had significantly better retention in treatment than placebo subjects (38.2% versus 15.2%; Log rank test p=0.01). Conclusions Lofexidine is well tolerated and more efficacious than placebo for reducing opioid withdrawal symptoms in inpatients undergoing medically supervised opioid detoxification. Trial Registration trial registry name A Phase 3 Placebo-Controlled, Double-Blind Multi-Site Trial of Lofexidine for Opiate Withdrawal, registration number NCT00032942, URL for the registry http://clinicaltrials.gov/ct/show/NCT00032942?order=4. PMID:18508207
Mapping data - KOME | LSDB Archive [Life Science Database Archive metadata
Lifescience Database Archive (English)
Full Text Available switchLanguage; BLAST Search Image Search Home About Archive Update History Data ...tional Rice Genome Sequencing Project (IRGSP) Data file File name: kome_mapping_data.zip File URL: ftp://ftp.biosciencedbc.jp/archiv...(Transcriptional Unit) About This Database Database Description Download License Update History of This Database Site Policy | Contact Us Mapping data - KOME | LSDB Archive ...
BRC - MicrobeDB.jp | LSDB Archive [Life Science Database Archive metadata
Lifescience Database Archive (English)
Full Text Available switchLanguage; BLAST Search Image Search Home About Archive Update History Data ...table). Data file File name: brc.tar.gz File URL: ftp://ftp.biosciencedbc.jp/archive/microbedb/LATEST/brc.ta...rains in JCM. About This Database Database Description Download License Update History of This Database Site Policy | Contact Us BRC - MicrobeDB.jp | LSDB Archive ...
Spot table - RPD | LSDB Archive [Life Science Database Archive metadata
Lifescience Database Archive (English)
Full Text Available switchLanguage; BLAST Search Image Search Home About Archive Update History Data ...d_spot.zip File URL: ftp://ftp.biosciencedbc.jp/archive/rpd/LATEST/rpd_spot.zip F... cDNA. (multiple entries) About This Database Database Description Download License Update History of This Database Site Policy | Contact Us Spot table - RPD | LSDB Archive ...
SRA - MicrobeDB.jp | LSDB Archive [Life Science Database Archive metadata
Lifescience Database Archive (English)
Full Text Available switchLanguage; BLAST Search Image Search Home About Archive Update History Data ...e following table). Data file File name: sra.tar.gz File URL: ftp://ftp.biosciencedbc.jp/archive/microbedb/L...t This Database Database Description Download License Update History of This Database Site Policy | Contact Us SRA - MicrobeDB.jp | LSDB Archive ...
The Data Extraction Using Distributed Crawler Inside Multi-Agent System
Directory of Open Access Journals (Sweden)
Karel Tomala
2013-01-01
Full Text Available The paper discusses the use of web crawler technology. We created an application based on standard web crawler. Our application is determined for data extraction. Primarily, the application was designed to extract data using keywords from a social network Twitter. First, we created a standard crawler, which went through a predefined list of URLs and gradually download page content of each of the URLs. Page content was then parsed and important text and metadata were stored in a database. Recently, the application was modified in to the form of the multi-agent system. The system was developed in the C# language, which is used to create web applications and sites etc. Obtained data was evaluated graphically. The system was created within Indect project at the VSB-Technical University of Ostrava.
Lifescience Database Archive (English)
Full Text Available CH (Link to library) CHA851 (Link to dictyBase) - - - Contig-U16368-1 - (Link to Or...iginal site) CHA851F 614 - - - - - - Show CHA851 Library CH (Link to library) Clone ID CHA851 (Link to dicty...Base) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16368-1 Original site URL http://dictycdb.b...TCCXXXXXXXXXX sequence update 2002.10.25 Translated Amino Acid sequence VRDARPPHNLCRGFGCPEGSHCEVLEKHPVCVRNHVPPHPPPPPQICGSVNCGPGYICT...nly*skttgttttllnlcraiism*srwn dlysstkqlyqy*ipmlpis--- Frame C: VRDARPPHNLCRGFGCPEGSHCEVLEKHPVCVRNHVPPHPPPPPQICGSVNCGPGYICT
Lifescience Database Archive (English)
Full Text Available SF (Link to library) SFF103 (Link to dictyBase) - - - Contig-U11967-1 SFF103Z (Link... to Original site) - - SFF103Z 655 - - - - Show SFF103 Library SF (Link to library) Clone ID SFF103 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U11967-1 Original site URL http://dict...nslated Amino Acid sequence ---rgsf*FLKIIITLLAYKIICTPNHMHLTRGNHETTDMNRFYGFQGEVVAKYSEMVFD LFSELFNWFPLAFVLDESF...*rkrlsnr**wfshhcflc skll*siw*swliykynxdkikittxklxtsexppmhsqk Frame C: ---rgsf*FLKIIITLLAYKIICT
Lifescience Database Archive (English)
Full Text Available VH (Link to library) VHA622 (Link to dictyBase) - - - Contig-U15767-1 VHA622P (Link... to Original site) VHA622F 458 VHA622Z 778 VHA622P 1216 - - Show VHA622 Library VH (Link to library) Clone ID VHA622 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15767-1 Original site URL http://dict...HVQVTCGGCETCSYATGKCEPDSSLCNDNNICTIDICVHEGILDGLP QGNCSNTPVDCGANDEDKCKTWSCDPTKGGCQSTPVVCEDKGKCLVGTCQPSTGQCEYSD...qisnqkmrenlf*lrelsnqilikkkefqf*ivwmpmil*ik rqelvgqmvlsiflxitklviqnlpnlvk--- ---ACNEDEKXITHVQVTCGGCETCSYATGKCEPDSSLCNDNNICT
Lifescience Database Archive (English)
Full Text Available CH (Link to library) CHF177 (Link to dictyBase) - - - Contig-U11892-1 - (Link to Or...iginal site) - - CHF177Z 395 - - - - Show CHF177 Library CH (Link to library) Clone ID CHF177 (Link to dicty...Base) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U11892-1 Original site URL http://dictycdb.b...LLLWDVQGFPCXFAVEG GQCIDPSSLKVGGKYSFIAFSTCRXKFDNQKIHDCDWIIQGPTTPSXCANCGKICTSKCT TNYCDRDXQT Translated Amino A...XKFDNQKIHDCDWIIQGPTTPSXCANCGKICTSKCT TNYCDRDXQT Homology vs CSM-cDNA Score E Sequences producing significant
Lifescience Database Archive (English)
Full Text Available AF (Link to library) AFF341 (Link to dictyBase) - - - Contig-U15579-1 AFF341P (Link... to Original site) AFF341F 158 AFF341Z 283 AFF341P 441 - - Show AFF341 Library AF (Link to library) Clone ID AFF341 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15579-1 Original site URL http://dict...GCYYDKFDNCDACNAVDXCITNDLCFPRECNPRGNPPCLINPINCTSTDP CIFSYCENGVCIPTYICTPTPSVTPTVTPXVTXTVT Translated Amino Aci...*fliikkk--- ---DHCDPAIGCYYDKFDNCDACNAVDXCITNDLCFPRECNPRGNPPCLINPINCTSTDP CIFSYCENGVCIPTYICT
Lifescience Database Archive (English)
Full Text Available CF (Link to library) CFF487 (Link to dictyBase) - - - Contig-U15579-1 CFF487P (Link... to Original site) CFF487F 143 CFF487Z 518 CFF487P 661 - - Show CFF487 Library CF (Link to library) Clone ID CFF487 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15579-1 Original site URL http://dict...CFPRECNPRGNPPCLINPINCTSTDPCIFSYCE NGVCIPTYICTPTPSVTPTVTPTVTPTVTPTVTPTVTPTVTPTPTTTPTPSPTTV Translated Amino A...ESCEIGFGCLAIPKNCNDNDPCTTDHCD PAIGCYYDKFDNCDACNAVDTCITNDLCFPRECNPRGNPPCLINPINCTSTDPCIFSYCE NGVCIPTYICTPTPSVTP
Lifescience Database Archive (English)
Full Text Available CH (Link to library) CHI134 (Link to dictyBase) - - - Contig-U11723-1 CHI134P (Link... to Original site) CHI134F 581 CHI134Z 736 CHI134P 1297 - - Show CHI134 Library CH (Link to library) Clone ID CHI134 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U11723-1 Original site URL http://dict...gl*kta*g*IIMESNKSSSHGDVSTSPSFLNNHHQFNNGGDIIPKKKKNRIMHVG SYEVGKTLGNGTFGKVKLGTNICTK...PVIEAPKTRRMSLDSR MLNGDQQSLVEKNQHMASPRTSKGIFKXSTTTTKSPEKTIIELKRSLEESGLFTKKKGPY LXLCFDEDNSVKFQIEIVKICNLDLTGIQLKRLSGDTWKYKDICT
Lifescience Database Archive (English)
Full Text Available VF (Link to library) VFM148 (Link to dictyBase) - - - Contig-U08795-1 VFM148P (Link... to Original site) VFM148F 479 VFM148Z 710 VFM148P 1169 - - Show VFM148 Library VF (Link to library) Clone ID VFM148 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U08795-1 Original site URL http://dict...YYFYYHKMALVLPIFATENTLLVTENDLGRGFS VDDNGANAKKSNVYICTKEDMTTVRSITDSNKLTLINDQESLTSALNVSGELSLSYGLMS GKIMGEYLDTSSS...(All Frames) Frame A: iylflnqk*fv*ITNNYFFYFLKIFCYYYFYYHKMALVLPIFATENTLLVTENDLGRGFS VDDNGANAKKSNVYICTKEDMTTVR
Lifescience Database Archive (English)
Full Text Available VF (Link to library) VFB590 (Link to dictyBase) - - - Contig-U09552-1 VFB590P (Link... to Original site) VFB590F 225 VFB590Z 118 VFB590P 343 - - Show VFB590 Library VF (Link to library) Clone ID VFB590 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U09552-1 Original site URL http://dict...ed Amino Acid sequence IAVVEGFMAPSELCQKIKFCSSSSSTNDFDFIGSSTTDCEICTFISGYAENFLEEXKT...--- ---riyqinkvvmxhxlhn*lxvaxivxlgxvnvkihvexix Frame C: IAVVEGFMAPSELCQKIKFCSSSSSTNDFDFIGSSTTDCEICT
Lifescience Database Archive (English)
Full Text Available CH (Link to library) CHC113 (Link to dictyBase) - - - Contig-U15579-1 CHC113P (Link... to Original site) CHC113F 198 CHC113Z 396 CHC113P 574 - - Show CHC113 Library CH (Link to library) Clone ID CHC113 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15579-1 Original site URL http://dict...nif*KLENIIKKRNKLIFNYK KK--- ---GFGCLAIPKNCNDNDPCTTDHCDPAIGCYYDKFDNCDACNAVDTCITNDLCFPRECN PRGNPPCLINPINCTSTDPCIFSYCENGVCIPTYICT...KK--- ---GFGCLAIPKNCNDNDPCTTDHCDPAIGCYYDKFDNCDACNAVDTCITNDLCFPRECN PRGNPPCLINPINCTSTDPCIFSYCENGVCIPTYICTPTPS
Lifescience Database Archive (English)
Full Text Available VH (Link to library) VHP253 (Link to dictyBase) - - - Contig-U16349-1 - (Link to Or...iginal site) - - VHP253Z 355 - - - - Show VHP253 Library VH (Link to library) Clone ID VHP253 (Link to dicty...Base) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16349-1 Original site URL http://dictycdb.b...CTTGGGTACCAAGAACTGACCGTCAATTTGCTGGTTCATGGTTTGC sequence update 2002. 9.10 Translated Amino Acid sequence ---MQLFAGIKSICT...VPIMRMYFHTGILDYILFKSWVPRTDRQFAGSWF Translated Amino Acid sequence (All Frames) Frame A: ---MQLFAGIKSICTEMAMD
Lifescience Database Archive (English)
Full Text Available VH (Link to library) VHP243 (Link to dictyBase) - - - Contig-U16236-1 - (Link to Or...iginal site) VHP243F 134 - - - - - - Show VHP243 Library VH (Link to library) Clone ID VHP243 (Link to dicty...Base) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16236-1 Original site URL http://dictycdb.b...AXXXXXXXXXX sequence update 2002.10.25 Translated Amino Acid sequence CWPTGIXKTTICT...kilsif*ynfkyyqqpkkk--- Frame B: llaywyxqnnnlyqyyyyfyl*kyflsfniilniinnpkk--- Frame C: CWPTGIXKTTICTNTTIISICKN
Lifescience Database Archive (English)
Full Text Available AF (Link to library) AFA460 (Link to dictyBase) - - - Contig-U15574-1 AFA460Z (Link... to Original site) - - AFA460Z 170 - - - - Show AFA460 Library AF (Link to library) Clone ID AFA460 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15574-1 Original site URL http://dict...date 2001. 6. 2 Translated Amino Acid sequence ---QIHQTIQVVKITLSSASSSSSSSSSSILNKTRICTYINSNSTHSLXXNIYKYKLPK T...it* Frame B: ---QIHQTIQVVKITLSSASSSSSSSSSSILNKTRICTYINSNSTHSLXXNIYKYKLPK Frame C:
Lifescience Database Archive (English)
Full Text Available VH (Link to library) VHM522 (Link to dictyBase) - - - Contig-U15767-1 VHM522P (Link... to Original site) VHM522F 575 VHM522Z 747 VHM522P 1302 - - Show VHM522 Library VH (Link to library) Clone ID VHM522 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15767-1 Original site URL http://dict...PV--- ---ITHVQVTCGGCETCSYATGKCEPDSSLCNDNNICTIDICVHEGILDGLPQGNCSNTP VDCGANDEDKCKTWSCDPTKGGCQSTPVVCEDKGKCLVGTC...rtrf q*cklss--- ---ITHVQVTCGGCETCSYATGKCEPDSSLCNDNNICTIDICVHEGILDGLPQGNCSNTP VDCGANDEDKCKTWSCDPTKGGCQSTPVVCE
Lifescience Database Archive (English)
Full Text Available VH (Link to library) VHE138 (Link to dictyBase) - - - Contig-U15767-1 VHE138P (Link... to Original site) VHE138F 569 VHE138Z 621 VHE138P 1170 - - Show VHE138 Library VH (Link to library) Clone ID VHE138 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15767-1 Original site URL http://dict...FVDNQAGDSXSAKSGKNLPIQRDIELNWNGEAYEYSNSNYFPINGQGF NDVSYP--- ---QVTCGGCETCSYATGKCEPDSSLCNDNNICT...rsi*i**fkllpn*rtrf q*ckls--- ---QVTCGGCETCSYATGKCEPDSSLCNDNNICTIDICVHEGILDGLPQGNCSNTPVDCG ANDEDKCKTWSCDPTKGG
Lifescience Database Archive (English)
Full Text Available VH (Link to library) VHD652 (Link to dictyBase) - - - Contig-U15722-1 VHD652P (Link... to Original site) VHD652F 573 VHD652Z 707 VHD652P 1260 - - Show VHD652 Library VH (Link to library) Clone ID VHD652 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15722-1 Original site URL http://dict...NYTIPCGSNSNNVLCGSYHSTVPRKYLSLGFVNGSTHSYSKDGLMITYISQDTTNDNDC KRYTTNV--- ---LVIIILVIVHAIMNILVMVVNSLNAHSIVQPPNGTCDINSGICT...i*vlflql viilflvvvivimycvdhiiqlfhasifhwdllmavhiviaktd***hiyhriqqmimia kdiqqm*--- ---LVIIILVIVHAIMNILVMVVNSLNAHSIVQPPNGTCDINSGICT
Lifescience Database Archive (English)
Full Text Available VS (Link to library) VSG614 (Link to dictyBase) - - - - VSG614F (Link to Original s...ite) VSG614F 56 - - - - - - Show VSG614 Library VS (Link to library) Clone ID VSG614 (Link to dictyBase) Atlas ID - NBRP ID - dict...yBase ID - Link to Contig - Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/V...M029513.1 IpSkn01547 Skin cDNA library Ictalurus punctatus cDNA 5', mRNA sequence
Lifescience Database Archive (English)
Full Text Available VF (Link to library) VFB603 (Link to dictyBase) - - - Contig-U16505-1 VFB603Z (Link... to Original site) - - VFB603Z 496 - - - - Show VFB603 Library VF (Link to library) Clone ID VFB603 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16505-1 Original site URL http://dict...al 4.0 %: cytoskeletal 4.0 %: vesicles of secretory system 4.0 %: endoplasmic reticulum >> prediction for VF
Lifescience Database Archive (English)
Full Text Available VF (Link to library) VFC221 (Link to dictyBase) - - - Contig-U09438-1 VFC221Z (Link... to Original site) - - VFC221Z 496 - - - - Show VFC221 Library VF (Link to library) Clone ID VFC221 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U09438-1 Original site URL http://dict... mitochondrial 8.0 %: peroxisomal 4.0 %: cytoskeletal 4.0 %: Golgi >> prediction for VFC221 is cyt 5' end se
Lifescience Database Archive (English)
Full Text Available VH (Link to library) VHL663 (Link to dictyBase) - - - Contig-U15767-1 VHL663P (Link... to Original site) VHL663F 574 VHL663Z 702 VHL663P 1256 - - Show VHL663 Library VH (Link to library) Clone ID VHL663 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15767-1 Original site URL http://dict...WPDGFKYFFVDNQAGDSESAKSGKNLPIQRDIELNWNGEAYEYSNSNYFPINGQG FNDVSYPV--- ---SYATGKCEPDSSLCNDNNICTIDICVHEGILDGLPQG...ik rqelvgqmvlsifl*itklviqnlpnlvkifqfkeiss*igmekhmniviqitsqltdkv smm*aiq--- ---SYATGKCEPDSSLCNDNNICTIDICVHEGI
Demonstrating the sealing of a deep geologic repository: the RECAP project
International Nuclear Information System (INIS)
Kuzyk, G.W.; Dixon, D.A.; Martino, J.B.; Kozak, E.T.; Bilinsky, D.M.; Thompson, P.M.
2006-01-01
Atomic Energy of Canada Limited (AECL) has operated an Underground Research Laboratory (URL) for twenty-three years (1982-2005). The URL was designed and constructed to carry out in situ geotechnical R and D needed for the Canadian Nuclear Fuel Waste Management program. The facility is now being closed, the final of several phases that have included siting, site evaluation, construction and operation. The closure phase presents a unique opportunity to develop and demonstrate the methodologies needed for closure and site restoration of a deep geologic repository for used nuclear fuel. A wealth of technical background and characterization data, dating back to before the first excavation work was carried out, are available to support closure activities. A number of closure-related activities are being proposed as part of a REpository Closure And Post-closure (RECAP) project. The RECAP project is proposed to include demonstrations of shaft and borehole sealing and monitoring as well as fracture sealing (grouting), room closure and monitoring system decommissioning, all activities that would occur when closing an actual repository. In addition to the closure-related activities, the RECAP project could provide a unique opportunity to conduct intrusion-monitoring demonstrations as part of a repository safeguards demonstration. (author)
International Nuclear Information System (INIS)
Seeska, R.; Rutenberg, M.; Lux, K.H.
2012-01-01
Document available in extended abstract form only. Seven different boreholes in the Opalinus Clay formation of the Mont Terri Underground Rock Laboratory (URL Mont Terri) have been investigated by the Clausthal University of Technology (TUC) in cooperation with different partners with time, namely the National Cooperative for the Disposal of Radioactive Waste (NAGRA), the Federal Institute for Geosciences and Natural Resources (BGR) as well as the Swiss Federal Institute of Technology Zurich (ETHZ) and the Swiss Federal Nuclear Safety Inspectorate (ENSI). Aim of the investigations was to gain a large amount of high-quality and significant information on rock mass behaviour that can be used to increase knowledge about and improve understanding of time-dependent load-bearing and deformation behaviour of Opalinus Clay including pore water influences. For this purpose, an axial borehole camera and a three-arm calliper have been used. High-quality information on the load-bearing and deformation behaviour of the investigated boreholes was generated by the measurement and monitoring techniques used in the research project. The recordings reveal great as well as occasionally unexpected differences regarding the load-bearing behaviour as well as differences regarding the hydro-mechanical behaviour of the observed boreholes. While most of the boreholes have proved to be rather stable with only partial failure of the borehole wall in some areas, a complete borehole wall collapse occurred in two of the observed boreholes. The differences regarding the borehole wall stability and also the differences between the appearances of the occurring failure mechanisms are very likely due to the different orientation, the different locations within the URL Mont Terri, and the different facies the boreholes are located in. Figure 1 shows the time-dependent development of a borehole wall instability in one of the observed boreholes in a borehole section where an increase of moisture could
Lifescience Database Archive (English)
Full Text Available SL (Link to library) SLH268 (Link to dictyBase) - - - - SLH268Z (Link to Original site) - - SLH2...68Z 640 - - - - Show SLH268 Library SL (Link to library) Clone ID SLH268 (Link to dictyBase) At...las ID - NBRP ID - dictyBase ID - Link to Contig - Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/SL/SLH2-C/SLH2...68Q.Seq.d/ Representative seq. ID SLH268Z (Link to Original site) R...epresentative DNA sequence >SLH268 (SLH268Q) /CSM/SL/SLH2-C/SLH268Q.Seq.d/ XXXXXXXXXXCTGGTGGTTATATTTCTCGTACT
Lifescience Database Archive (English)
Full Text Available SL (Link to library) SLH252 (Link to dictyBase) - - - - SLH252F (Link to Original site) SLH2...52F 158 - - - - - - Show SLH252 Library SL (Link to library) Clone ID SLH252 (Link to dictyBase) At...las ID - NBRP ID - dictyBase ID - Link to Contig - Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/SL/SLH2-C/SLH2...52Q.Seq.d/ Representative seq. ID SLH252F (Link to Original site) R...epresentative DNA sequence >SLH252 (SLH252Q) /CSM/SL/SLH2-C/SLH252Q.Seq.d/ ACAGAATGGGTAAAGTACATGGTGGTTTGAATC
Lifescience Database Archive (English)
Full Text Available SL (Link to library) SLC460 (Link to dictyBase) - - - - SLC460Z (Link to Original site) - - SLC4...60Z 333 - - - - Show SLC460 Library SL (Link to library) Clone ID SLC460 (Link to dictyBase) At...las ID - NBRP ID - dictyBase ID - Link to Contig - Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/SL/SLC4-C/SLC4...60Q.Seq.d/ Representative seq. ID SLC460Z (Link to Original site) R...epresentative DNA sequence >SLC460 (SLC460Q) /CSM/SL/SLC4-C/SLC460Q.Seq.d/ XXXXXXXXXXAATTATTATTGTGTAATTCCTGT
Lifescience Database Archive (English)
Full Text Available SL (Link to library) SLC496 (Link to dictyBase) - - - - SLC496E (Link to Original site) - - - - - - SLC4...96E 443 Show SLC496 Library SL (Link to library) Clone ID SLC496 (Link to dictyBase) At...las ID - NBRP ID - dictyBase ID - Link to Contig - Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/SL/SLC4-D/SLC4...96Q.Seq.d/ Representative seq. ID SLC496E (Link to Original site) R...epresentative DNA sequence >SLC496 (SLC496Q) /CSM/SL/SLC4-D/SLC496Q.Seq.d/ AAGAAATTTGAATCACTCCAAATCATTATCCCA
Lifescience Database Archive (English)
Full Text Available SL (Link to library) SLC449 (Link to dictyBase) - - - - SLC449Z (Link to Original site) - - SLC4...49Z 384 - - - - Show SLC449 Library SL (Link to library) Clone ID SLC449 (Link to dictyBase) At...las ID - NBRP ID - dictyBase ID - Link to Contig - Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/SL/SLC4-C/SLC4...49Q.Seq.d/ Representative seq. ID SLC449Z (Link to Original site) R...epresentative DNA sequence >SLC449 (SLC449Q) /CSM/SL/SLC4-C/SLC449Q.Seq.d/ XXXXXXXXXXGTAAAAAGGAACACCAAGCCACT
Directory of Open Access Journals (Sweden)
Adli Tıp Uzmanları Derneği ATUD
2010-12-01
Full Text Available 24th Annual San Diego International Conference on Child and Family Maltreatment January 24, 2010-January 29, 2010 San Diego C, USA URL: http://www.chadwickcenter.org/conference AAFS 62nd Annual Scientific Meeting 22 February 2010-27 February 2010 Putting Our Forensic Flouse in Order: Examining Validation and Expelling Incompetence Seattle, WA 98101 URL: www.aafs.org/default.aspPsection_id = meetings& page_id= aafs_annual_meeting 49th Annual Meeting of the US Society of Toxicology (SOT 7 March 2010-11 March 2010 Salt Lake City, Utah, USA URL: www.toxicology.org/AI/MEET/AM2010/ XIXth Mediterranean International Congress of Legal Medicine 7 April 2010-10 April 2010 Tozeur, Tunisia URL: www.aefms.org/j.med.leg.tozeur/jmml_E/index.html ESF-LiU Conference 3 May 2010-7 May 2010 Violations of Human Rights and Humanitarian Law: Investigation and Prevention of Torture and Death in Custody Linköping, Sweden URL: www.esf.org/conferences/10318 7th Annual Meeting Balkan Academy of Forensic Science 03 June 2010-06 June 2010 Tirana, Albania URL: http://www.balkanforensic.org 68th Annual Meeting of the American Society of Questioned Document Examiners (ASQDE 28 September 2010 Victoria, BC, USA URL: www.asqde.org 20th International Symposium on the Forensic Sciences (ANZFSS 5 September 2010-9 September 2010 Sydney, Australia URL: www.anzfss2010.com Bloodstain Pattern Recognition - Basic course 05 December 2011, 09 December 2011 Tbe Hague, The Netherlands URL: http://www.enfsi.eu/page.php?uid= Expert Witness Intensive Training Course - 2 Day December 8th to 9th 2011 United Kingdom /London URL: http://www.healthcareconferencesuk.co.uk/ expertwitness 6th USA Pacific Medical & Legal Conference December 13th to 20th 2011 New York /USA URL: http://www.conferences21.com/index.php? menu=home 12th Annual Pan Europe Pacific Medical & Legal Conference February 5th to 12th 2012 France /Paris URL: http://www.conferences21.com/index.php? menu=home American College of Legal
Envirion - KEGG MEDICUS | LSDB Archive [Life Science Database Archive metadata
Lifescience Database Archive (English)
Full Text Available [ Credits ] English ]; } else if ( url.search(//en//) != -1 ) { url = url.replace(/...switchLanguage; BLAST Search Image Search Home About Archive Update History Data List Contact us KEGG MEDI...y approved drugs. Data file File name: kegg_medicus_environ_en.zip File URL: ftp:...//ftp.biosciencedbc.jp/archive/kegg-medicus/LATEST/kegg_medicus_environ_en.zip File size: 79 KB Simple searc...h URL http://togodb.biosciencedbc.jp/togodb/view/kegg_medicus_environ_en Data acquisition method - Data anal
Disease - KEGG MEDICUS | LSDB Archive [Life Science Database Archive metadata
Lifescience Database Archive (English)
Full Text Available [ Credits ] English ]; } else if ( url.search(//en//) != -1 ) { url = url.replace(/...switchLanguage; BLAST Search Image Search Home About Archive Update History Data List Contact us KEGG MEDI...bling computational processing and analysis of disease data. Data file File name: kegg_medi...cus_disease_en.zip File URL: ftp://ftp.biosciencedbc.jp/archive/kegg-medicus/LATEST/kegg_medicus_d...isease_en.zip File size: 733 KB Simple search URL http://togodb.biosciencedbc.jp/togodb/view/kegg_medicus_di
Drug - KEGG MEDICUS | LSDB Archive [Life Science Database Archive metadata
Lifescience Database Archive (English)
Full Text Available [ Credits ] English ]; } else if ( url.search(//en//) != -1 ) { url = url.replace(/...switchLanguage; BLAST Search Image Search Home About Archive Update History Data List Contact us KEGG MEDI...metabolizing enzyme, and other molecular interaction network information. Data file File name: kegg_medi...cus_drug_en.zip File URL: ftp://ftp.biosciencedbc.jp/archive/kegg-medicus/LATEST/kegg_medi...cus_drug_en.zip File size: 5.2 MB Simple search URL http://togodb.biosciencedbc.jp/togodb/view/kegg_medi
Lifescience Database Archive (English)
Full Text Available SH (Link to library) SHI251 (Link to dictyBase) - - - Contig-U11819-1 - (Link to Or...iginal site) SHI251F 125 - - - - - - Show SHI251 Library SH (Link to library) Clone ID SHI251 (Link to dicty...Base) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U11819-1 Original site URL http://dictycdb.b...XX sequence update 2002.10.25 Translated Amino Acid sequence ilfqilkistnk**IKNYYVNRVYEIIIIINICT...YKKK--- Translated Amino Acid sequence (All Frames) Frame A: ilfqilkistnk**IKNYYVNRVYEIIIIINICT
Lifescience Database Archive (English)
Full Text Available SL (Link to library) SLJ344 (Link to dictyBase) - - - Contig-U16255-1 SLJ344P (Link... to Original site) SLJ344F 253 SLJ344Z 273 SLJ344P 526 - - Show SLJ344 Library SL (Link to library) Clone ID SLJ344 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16255-1 Original site URL http://dict...Amino Acid sequence GTSGGTPGSCDKVNCPNGYICTIVNQLAVCVSPSSSSSSSSSTTGSHTTTGGSTTGSHTT TGGSTTGSHTTTGGSTTGSHTTTG---...li tilffniqrlykkkkkkkkkknkp*tklkin*kk Frame B: GTSGGTPGSCDKVNCPNGYICTIVNQLAVCVSPSSSSSSSSSTTGSHTTTGGSTTGSHTT
Lifescience Database Archive (English)
Full Text Available SF (Link to library) SFC534 (Link to dictyBase) - - - Contig-U15579-1 SFC534P (Link... to Original site) SFC534F 158 SFC534Z 334 SFC534P 492 - - Show SFC534 Library SF (Link to library) Clone ID SFC534 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15579-1 Original site URL http://dict...fiyl**hymni*klenif*KLENIIKKRNKLIFNYKKK--- ---DPXIGCYYDKFDNCDACNAVDTCITNDLCFPRECNPRGXPPCLINPINCTSTDPCIF SYCENGVCIPTYICT...lfiyl**hymni*klenif*KLENIIKKRNKLIFNYKKK--- ---DPXIGCYYDKFDNCDACNAVDTCITNDLCFPRECNPRGXPPCLINPINCTSTDPCIF SYCENGVCIPTYICT
Lifescience Database Archive (English)
Full Text Available VH (Link to library) VHH756 (Link to dictyBase) - - - Contig-U15767-1 VHH756P (Link... to Original site) VHH756F 658 VHH756Z 686 VHH756P 1324 - - Show VHH756 Library VH (Link to library) Clone ID VHH756 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15767-1 Original site URL http://dict...YEYSNSNYFPINGQGF NDVSYPVPRGYVPISGESWTSMSTSTSLKGNNYNFC--- ---DSSLCNDNNICTIDICVHEGILDGLPQGNCSNTPVDCGANDEDKCKTW...*psw*fricqiw*kssnskryrvklewrsi*i**fkllpn*rtrfq *cklssskrlctnfwrildinvnfnfikg**l*fl--- ---DSSLCNDNNICTIDICVHE
Lifescience Database Archive (English)
Full Text Available VF (Link to library) VFB760 (Link to dictyBase) - - - Contig-U12286-1 VFB760P (Link... to Original site) VFB760F 474 VFB760Z 691 VFB760P 1165 - - Show VFB760 Library VF (Link to library) Clone ID VFB760 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U12286-1 Original site URL http://dict...CCACTTAATTCCAGAAGG sequence update 2001. 6. 1 Translated Amino Acid sequence LLAYWNKCQVNSCDKTTGNCKPENLKCPDRSNECLKNTGCDDLTGCKYVSICT...cmfllqsfxnplnsrr Frame C: LLAYWNKCQVNSCDKTTGNCKPENLKCPDRSNECLKNTGCDDLTGCKYVSICTDS
Lifescience Database Archive (English)
Full Text Available VS (Link to library) VSK196 (Link to dictyBase) - - - Contig-U10274-1 VSK196P (Link... to Original site) VSK196F 423 VSK196Z 453 VSK196P 876 - - Show VSK196 Library VS (Link to library) Clone ID VSK196 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U10274-1 Original site URL http://dict...TTATNAACAATTAAAAAAAA sequence update 2001. 3.22 Translated Amino Acid sequence kdgklvslkdfikdqkpivlyfypkdetsict...*NKIX--- ---KLKVGDQAPDFTCPDKDGKLVSLKDFIKDQKPIVLYFYPKDETSICTKEACEFRDKY QKFIEAGADVI
Lifescience Database Archive (English)
Full Text Available SS (Link to library) SSA564 (Link to dictyBase) - - - - SSA564F (Link to Original s...ite) SSA564F 653 - - - - - - Show SSA564 Library SS (Link to library) Clone ID SSA564 (Link to dictyBase) Atlas ID - NBRP ID - dict...yBase ID - Link to Contig - Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/...NNTLKPKQTTKGFNIGGQPGNPTN*l--- Frame C: tlkfvmplvmkictslvlvlkrstk*rklfmmenshqtldgl...bits) Value N M77492 |M77492.1 Dictyostelium discoideum glycoprotein phosphorylase 2 (glpD) gene, complete c
Lifescience Database Archive (English)
Full Text Available VF (Link to library) VFB670 (Link to dictyBase) - - - Contig-U16447-1 VFB670Z (Link... to Original site) - - VFB670Z 541 - - - - Show VFB670 Library VF (Link to library) Clone ID VFB670 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16447-1 Original site URL http://dict... 0.00 m_ : 1.00 44.0 %: nuclear 28.0 %: cytoplasmic 16.0 %: cytoskeletal 8.0 %: peroxisomal 4.0 %: mitochondrial >> predict
Lifescience Database Archive (English)
Full Text Available VF (Link to library) VFB779 (Link to dictyBase) - - - Contig-U15331-1 VFB779P (Link... to Original site) VFB779F 328 VFB779Z 402 VFB779P 730 - - Show VFB779 Library VF (Link to library) Clone ID VFB779 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15331-1 Original site URL http://dict...cuolar 4.0 %: peroxisomal 4.0 %: endoplasmic reticulum >> prediction for VFB779 i
Lifescience Database Archive (English)
Full Text Available VF (Link to library) VFB893 (Link to dictyBase) - - - Contig-U15009-1 VFB893P (Link... to Original site) VFB893F 337 VFB893Z 727 VFB893P 1064 - - Show VFB893 Library VF (Link to library) Clone ID VFB893 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15009-1 Original site URL http://dict... 4.0 %: cytoskeletal 4.0 %: vesicles of secretory system >> prediction for VFB893
Lifescience Database Archive (English)
Full Text Available VF (Link to library) VFB615 (Link to dictyBase) - - - Contig-U16602-1 VFB615F (Link... to Original site) VFB615F 636 - - - - - - Show VFB615 Library VF (Link to library) Clone ID VFB615 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16602-1 Original site URL http://dict...0 %: vesicles of secretory system 4.0 %: peroxisomal >> prediction for VFB615 is cyt 5' end seq. ID VFB615F
Database Description - FANTOM5 | LSDB Archive [Life Science Database Archive metadata
Lifescience Database Archive (English)
Full Text Available List Contact us FANTOM5 Database Description General information of database Database name FANTOM5 Alternati...me: Rattus norvegicus Taxonomy ID: 10116 Taxonomy Name: Macaca mulatta Taxonomy ID: 9544 Database descriptio...l Links: Original website information Database maintenance site RIKEN Center for Life Science Technologies, ...ilable Web services Not available URL of Web services - Need for user registration Not available About This Database Database... Description Download License Update History of This Database Site Policy | Contact Us Database Description - FANTOM5 | LSDB Archive ...
Lifescience Database Archive (English)
Full Text Available CH (Link to library) CHA362 (Link to dictyBase) - - - Contig-U15579-1 | Contig-U156... library) Clone ID CHA362 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U155...79-1 | Contig-U15687-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/C...XACNAVDTCITNDLCFPRECNPRGNPPCLINPINCTSTDPCIFSYCENGVCI PTYICTPTPSVTPTVTPTVTPTVTPTVT...GNPPCLINPINCTSTDPCIFSYCENGVCI PTYICTPTPSVTPTVTPTVTPTVTPTVTPTVTPTVTPTPTTTPTPSPTTVP
Movie collection - TogoTV | LSDB Archive [Life Science Database Archive metadata
Lifescience Database Archive (English)
Full Text Available switchLanguage; BLAST Search Image Search Home About Archive Update History Data ...ols. Data file File name: movie File URL: ftp://ftp.biosciencedbc.jp/archive/togotv/movie/ File size: 200 GB...ata entries 1169 entries - About This Database Database Description Download License Update History of This Database Site Policy | Contact Us Movie collection - TogoTV | LSDB Archive ...
Directory of Open Access Journals (Sweden)
Adli Tıp Uzmanları Derneği ATUD
2010-04-01
Full Text Available 24th Annual San Diego International Conference on Child and Family Maltreatment January 24, 2010-January 29, 2010 San Diego C, USA URL: http://www.chadwickcenter.org/conference AAFS 62nd Annual Scientific Meeting 22 February 2010-27 February 2010 Putting Our Forensic House in Order: Examining Validation and Expelling Incompetence Seattle, WA 98101 URL: www.aafs.org/default.asp?section_id=meetings&page_id= aafs_annual_meeting 49th Annual Meeting of the US Society of Toxicology (SOT 7 March 2010-11 March 2010 Salt Lake City, Utah, USA URL: www.toxicology.org/AI/MEET/AM2010/ XIXth Mediterranean International Congress of Legal Medicine 7 April 2010-10 April 2010 Tozeur, Tunisia URL: www.aefms.org/j.med.leg.tozeur/jmmlE/index.html ESF-LiU Conference 3 May 2010-7 May 2010 Violations of Human Rights and Humanitarian Law: Investigation and Prevention of Torture and Death in Custody Linköping, Sweden URL: www.esf.org/conferences/10318 7th Annual Meeting Balkan Academy of Forensic Science 03 June 2010-06 June 2010 Tirana, Albania URL: http://www.balkanforensic.org 68th Annual Meeting of the American Society of Questioned Document Examiners (ASQDE 28 September 2010 Victoria, BC, USA URL: www.asqde.org 20th International Symposium on the Forensic Sciences (ANZFSS 5 September 2010-9 September 2010 Sydney, Australia URL: www.anzfss2010.com 10th Indo Pacific Congress on Legal Medicine and Forensic Science 25 - 30 October 2010 New Delhi, India E-mail : p kchatt op adhyay@amity.edu National Association of Medical Examiners 44th Annual Meeting 1 October 2010-6 October 2010 Cleveland, OH. USA URL: www.thename.org 46. Ulusal Psikiyatri Kongresi 5\tEkim 2010-9 Ekim 2010 İzmir, Türkiye URL: http://www.psikiyatri2010.org/ 9. Adli Bilimler Kongresi 14 Ekim 2010-17 Ekim 2010 İzmir, Türkiye http://www.atud.org/ EuroForensics: Digital & Medical Forensic Sciences Conference and Exhibition March 24, 2011-March 26, 2011 Istanbul, Turkey URL: http ://www
Study on construction method of concrete in the underground research laboratory. 3
International Nuclear Information System (INIS)
Iriya, Keishiro; Mikami, Tetsuji; Takeda, Nobufumi; Akiyoshi, Kenji
2003-02-01
The Horonobe underground research laboratory project doesn't carry on only safety assessment study but also demonstration of construction technique upon nuclear waste repositories. Low alkalinity cement is one of candidates for engineered barrier in order to prevent alteration of bentonite and rock by hyper alkaline solution. JNC has developed low alkalinity cement (HFSC) which contains a lot of fly ash, and has studied the physical and chemical properties by laboratory test. Effect on variety of quality of fly ash and monitoring corrosion of rebars in off-shore condition has been studied. In-situ test for actual use of HFSC in constructing the facility was planned. The results are summarized as below. Effects of variety of flay ash upon lower pH are relatively small by testing two type of fly ash and several fly as content. Variety of fly ash effects properties of fresh concrete but its effect is not significant. And it little effects on mechanical behavior. However, it doesn't effect on properties of shotcrete. Although rebars corrode in HFSC in spite of no intrusion of chloride, increment of corrosion is not significant in half an year until an year. Applicability for structural members is demonstrated by loading test of tunnel concrete segments of HFSC. Pre-mixed HFSC can be supplied by mixing fly ash and silica fume in Sapporo and carry to Horonobe by cement truck. (author)
International Nuclear Information System (INIS)
Ishikawa, Hirohisa; Yui, Mikazu; Uchida, Masahiro; Kamei, Gento
2004-03-01
To commemorate the 10th anniversary of the ENTRY, a laboratory in JNC Tokai for R and D in the field of geological disposal of radioactive waste, an international workshop was held in JNC Tokai, during the term of Sept 22 to 24, 2003. A technical tour for the Horonobe Underground Research Laboratory site was also done before the workshop, on October 20 to 21, to deepen understanding the background of discussion in the workshop. The workshop contained two sessions. The topic of each session was 1. long-term transition of the near-field and 2. cooperation among the performance assessment, in-situ experiment, and laboratory experiment, respectively. In the session 1, we mainly discussed the thermal-hydrological-mechanical-chemical (THMC) coupled processes for the near-field performance assessment, especially focusing on chemical degradation effects by cement materials and the status of mechanistic understanding radionuclide migration. Silicate dissolution kinetic model, including smectite dissolution in a hyper alkaline solution, was also discussed. Then, we discussed a relevant linkage among laboratory experiments, model (simulation experiment) and database development, in-situ experiment and natural analogue. In the session 2, we discussed 1) methodology for understanding the site based on the surface and boreholes investigations, 2) identification of remained uncertainty after the surface and boreholes investigations, 3) the critical measurement at the surface and boreholes investigations, 4) feedback items from performance assessment to site characterization and 5) required data besides the site investigation. This report contains the minutes of discussion in the workshop. Presented materials were also appended with permission from the speakers. (author)
Lifescience Database Archive (English)
Full Text Available SF (Link to library) SFE109 (Link to dictyBase) - - - Contig-U10771-1 SFE109P (Link... to Original site) SFE109F 197 SFE109Z 630 SFE109P 827 - - Show SFE109 Library SF (Link to library) Clone ID SFE109 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U10771-1 Original site URL http://dict...anslated Amino Acid sequence elnykfhftlnttqiei*inknfllflf*fffyfqi*iqlcfilkllllptiink*INKI FLKKK--- ---VTTSQCESLIQAGVDGLRVGMGVGSICT...fkfnsvsy*nyyyyqpslink*ik ff*kk--- ---VTTSQCESLIQAGVDGLRVGMGVGSICTTQEVMACGRPQATAVFKCALYSSQYNVPI IADGGIRTIGHII
Lifescience Database Archive (English)
Full Text Available SF (Link to library) SFL482 (Link to dictyBase) - - - Contig-U15494-1 SFL482P (Link... to Original site) SFL482F 434 SFL482Z 394 SFL482P 828 - - Show SFL482 Library SF (Link to library) Clone ID SFL482 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15494-1 Original site URL http://dict...cftclww*qmcqmcp*qnrscfln*rtknr*nclqeatkrfkt ker*EIIQINVVININHFLLIKKK--- ---ICTHIEKMVQRLTYRRRLSYRTTSNATKIVKTP...KQQK DLKQKKDKKSSK*m Translated Amino Acid sequence (All Frames) Frame A: icthiekmvqrltyrrrlsyrttsnatkivktpgg
Lifescience Database Archive (English)
Full Text Available SS (Link to library) SSL592 (Link to dictyBase) - - - Contig-U14332-1 SSL592E (Link... to Original site) - - - - - - SSL592E 244 Show SSL592 Library SS (Link to library) Clone ID SSL592 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U14332-1 Original site URL http://dict...ence niyi*IYMFLTLIHLWTSKNTVIIFICTLNGI*ik*nnvkniyi*iyn*kkkkkklkn*h lvdlnktv*lyk*kkliy*k Translated Amino Acid...kqncitl*ikkinllkk Frame C: niyi*IYMFLTLIHLWTSKNTVIIFICTLNGI*ik*nnvkniyi*iyn*kkkkkklkn*h lvdlnktv*lyk*kkliy*k
Lifescience Database Archive (English)
Full Text Available CH (Link to library) CHN208 (Link to dictyBase) - - - Contig-U11696-1 - (Link to Or...iginal site) CHN208F 157 - - - - - - Show CHN208 Library CH (Link to library) Clone ID CHN208 (Link to dicty...Base) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U11696-1 Original site URL http://dictycdb.b...ces producing significant alignments: (bits) Value N AC149612 |AC149612.1 Ictalurus punctatus clone CH212-98...nuclear 20.0 %: mitochondrial 8.0 %: vacuolar 4.0 %: peroxisomal >> prediction fo
Lifescience Database Archive (English)
Full Text Available SS (Link to library) SSI473 (Link to dictyBase) - - - - SSI473Z (Link to Original s...ite) - - SSI473Z 416 - - - - Show SSI473 Library SS (Link to library) Clone ID SSI473 (Link to dictyBase) Atlas ID - NBRP ID - dict...yBase ID - Link to Contig - Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/...uences producing significant alignments: (bits) Value N M77492 |M77492.1 Dictyost...Hdk03092 Head kidney cDNA library Ictalurus punctatus cDNA 5' similar to Dual specificity phosphatase 10 (DU
Lifescience Database Archive (English)
Full Text Available CH (Link to library) CHD152 (Link to dictyBase) - - - - - (Link to Original site) C...HD152F 603 - - - - - - Show CHD152 Library CH (Link to library) Clone ID CHD152 (Link to dictyBase) Atlas ID - NBRP ID - dict...yBase ID - Link to Contig - Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/CH/CHD...Score E Sequences producing significant alignments: (bits) Value N U36937 |U36937.1 Dictyostelium discoideum...UF_IpTrk_27_j08 Trunk kidney cDNA library Ictalurus punctatus cDNA 5' similar to
Lifescience Database Archive (English)
Full Text Available SL (Link to library) SLH678 (Link to dictyBase) - - - Contig-U04159-1 SLH678E (Link... to Original site) - - - - - - SLH678E 373 Show SLH678 Library SL (Link to library) Clone ID SLH678 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U04159-1 Original site URL http://dict... producing significant alignments: (bits) Value N ( AU039970 ) Dictyostelium discoideum slug cDNA, clone SLG...865. 323 e-129 2 ( AU039381 ) Dictyostelium discoideum slug cDNA, clone SLH678. 3
Lifescience Database Archive (English)
Full Text Available SS (Link to library) SSC836 (Link to dictyBase) - - - - SSC836E (Link to Original s...ite) - - - - - - SSC836E 502 Show SSC836 Library SS (Link to library) Clone ID SSC836 (Link to dictyBase) Atlas ID - NBRP ID - dict...yBase ID - Link to Contig - Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/...t alignments: (bits) Value N M77492 |M77492.1 Dictyostelium discoideum glycoprotein phosphorylase 2 (glpD) g...ene, complete cds. 779 0.0 1 AC116984 |AC116984.2 Dictyostelium discoideum chromo
Lifescience Database Archive (English)
Full Text Available VH (Link to library) VHA386 (Link to dictyBase) - - - Contig-U11201-1 - (Link to Or...iginal site) - - VHA386Z 730 - - - - Show VHA386 Library VH (Link to library) Clone ID VHA386 (Link to dicty...Base) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U11201-1 Original site URL http://dictycdb.b...Homology vs DNA Score E Sequences producing significant alignments: (bits) Value N L08646 |L08646.1 Dict...19 1 CX835130 |AF255664_1 major vault protein [Ictalurus punctatus], mRNA sequenc
Lifescience Database Archive (English)
Full Text Available SL (Link to library) SLD420 (Link to dictyBase) - - - Contig-U16325-1 SLD420E (Link... to Original site) - - - - - - SLD420E 434 Show SLD420 Library SL (Link to library) Clone ID SLD420 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16325-1 Original site URL http://dict... 7 Homology vs DNA Score E Sequences producing significant alignments: (bits) Value N ( AF066071 ) Dict...yostelium discoideum SP85 (pspB) gene, comple... 860 0.0 1 ( AC117075 ) Dictyostelium
Update History of This Database - DGBY | LSDB Archive [Life Science Database Archive metadata
Lifescience Database Archive (English)
Full Text Available switchLanguage; BLAST Search Image Search Home About Archive Update History Data ...List Contact us DGBY Update History of This Database Date Update contents 2014/10/20 The URL of the portal s...aro.affrc.go.jp/yakudachi/yeast/index.html ) is opened. About This Database Database Description Download License Update Hi...story of This Database Site Policy | Contact Us Update History of This Database - DGBY | LSDB Archive ... ... Expression of attribution in License is updated. 2012/03/08 DGBY English archive site is opened. 2006/10/02
Lifescience Database Archive (English)
Full Text Available VF (Link to library) VFB689 (Link to dictyBase) - - - Contig-U16603-1 VFB689P (Link... to Original site) VFB689F 476 VFB689Z 663 VFB689P 1139 - - Show VFB689 Library VF (Link to library) Clone ID VFB689 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16603-1 Original site URL http://dict...mbrane 4.0 %: vesicles of secretory system 4.0 %: peroxisomal >> prediction for VFB689 is cyt 5' end seq. ID
Lifescience Database Archive (English)
Full Text Available VF (Link to library) VFB551 (Link to dictyBase) - - - Contig-U16449-1 VFB551P (Link... to Original site) VFB551F 194 VFB551Z 178 VFB551P 372 - - Show VFB551 Library VF (Link to library) Clone ID VFB551 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16449-1 Original site URL http://dict...0 %: cytoplasmic 16.0 %: cytoskeletal 12.0 %: mitochondrial 4.0 %: vacuolar 4.0 %: endoplasmic reticulum >> predict
Lifescience Database Archive (English)
Full Text Available VF (Link to library) VFB826 (Link to dictyBase) - - - Contig-U16584-1 VFB826F (Link... to Original site) VFB826F 430 - - - - - - Show VFB826 Library VF (Link to library) Clone ID VFB826 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16584-1 Original site URL http://dict... (bits) Value N AC115577 |AC115577.2 Dictyostelium discoideum chromosome 2 map 4657875-4914984 strain AX4, c...vesicles of secretory system 4.0 %: endoplasmic reticulum >> prediction for VFB82
Lifescience Database Archive (English)
Full Text Available VF (Link to library) VFB490 (Link to dictyBase) - - - Contig-U16603-1 VFB490P (Link... to Original site) VFB490F 588 VFB490Z 683 VFB490P 1271 - - Show VFB490 Library VF (Link to library) Clone ID VFB490 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16603-1 Original site URL http://dict...: extracellular, including cell wall 4.0 %: plasma membrane 4.0 %: vesicles of secretory system 4.0 %: peroxisomal >> predict
Lifescience Database Archive (English)
Full Text Available VF (Link to library) VFB838 (Link to dictyBase) - - - Contig-U14973-1 VFB838P (Link... to Original site) VFB838F 562 VFB838Z 443 VFB838P 1005 - - Show VFB838 Library VF (Link to library) Clone ID VFB838 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U14973-1 Original site URL http://dict...plasmic 12.0 %: Golgi 12.0 %: nuclear 4.0 %: plasma membrane 4.0 %: vesicles of secretory system 4.0 %: peroxisomal >> predict
Lifescience Database Archive (English)
Full Text Available VF (Link to library) VFB585 (Link to dictyBase) - - - Contig-U09875-1 VFB585Z (Link... to Original site) - - VFB585Z 664 - - - - Show VFB585 Library VF (Link to library) Clone ID VFB585 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U09875-1 Original site URL http://dict...Score E Sequences producing significant alignments: (bits) Value N AC116551 |AC116551.2 Dictyostelium discoi...ces producing significant alignments: (bits) Value AC116551_43( AC116551 |pid:none) Dictyostelium discoideum
Lifescience Database Archive (English)
Full Text Available VF (Link to library) VFB625 (Link to dictyBase) - - - Contig-U13825-1 VFB625P (Link... to Original site) VFB625F 492 VFB625Z 685 VFB625P 1177 - - Show VFB625 Library VF (Link to library) Clone ID VFB625 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U13825-1 Original site URL http://dict... %: cytoplasmic 16.0 %: nuclear 4.0 %: cytoskeletal 4.0 %: plasma membrane >> prediction for VFB625 is mit 5
Lifescience Database Archive (English)
Full Text Available VF (Link to library) VFB742 (Link to dictyBase) - - - Contig-U14919-1 VFB742P (Link... to Original site) VFB742F 590 VFB742Z 468 VFB742P 1058 - - Show VFB742 Library VF (Link to library) Clone ID VFB742 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U14919-1 Original site URL http://dict...mbrane 4.0 %: peroxisomal 4.0 %: endoplasmic reticulum >> prediction for VFB742 is cyt 5' end seq. ID VFB742
Lifescience Database Archive (English)
Full Text Available VF (Link to library) VFB817 (Link to dictyBase) - - - Contig-U16229-1 VFB817P (Link... to Original site) VFB817F 504 VFB817Z 193 VFB817P 697 - - Show VFB817 Library VF (Link to library) Clone ID VFB817 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16229-1 Original site URL http://dict...%: peroxisomal 4.0 %: endoplasmic reticulum >> prediction for VFB817 is cyt 5' end seq. ID VFB817F 5' end se
Lifescience Database Archive (English)
Full Text Available VF (Link to library) VFB720 (Link to dictyBase) - - - Contig-U16603-1 VFB720P (Link... to Original site) VFB720F 521 VFB720Z 353 VFB720P 874 - - Show VFB720 Library VF (Link to library) Clone ID VFB720 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16603-1 Original site URL http://dict...: cytoskeletal 4.0 %: vacuolar 4.0 %: vesicles of secretory system >> prediction for VFB720 is nuc 5' end se
Lifescience Database Archive (English)
Full Text Available VF (Link to library) VFB644 (Link to dictyBase) - - - Contig-U10683-1 VFB644F (Link... to Original site) VFB644F 519 - - - - - - Show VFB644 Library VF (Link to library) Clone ID VFB644 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U10683-1 Original site URL http://dict...7 9 AC116920 |AC116920.2 Dictyostelium discoideum chromosome 2 map 3879572-407176... %: nuclear 8.0 %: mitochondrial 4.0 %: cytoskeletal 4.0 %: vesicles of secretory system >> predict
Lifescience Database Archive (English)
Full Text Available VF (Link to library) VFB868 (Link to dictyBase) - - - Contig-U15649-1 VFB868F (Link... to Original site) VFB868F 110 - - - - - - Show VFB868 Library VF (Link to library) Clone ID VFB868 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15649-1 Original site URL http://dict...c 4.0 %: cytoskeletal >> prediction for VFB868 is nuc 5' end seq. ID VFB868F 5' end seq. >VFB868F.Seq TATTAA
Lifescience Database Archive (English)
Full Text Available VF (Link to library) VFB804 (Link to dictyBase) - - - Contig-U13849-1 VFB804P (Link... to Original site) VFB804F 150 VFB804Z 637 VFB804P 787 - - Show VFB804 Library VF (Link to library) Clone ID VFB804 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U13849-1 Original site URL http://dict... nuclear 4.0 %: cytoskeletal 4.0 %: vacuolar 4.0 %: plasma membrane 4.0 %: vesicles of secretory system >> predict
Lifescience Database Archive (English)
Full Text Available CH (Link to library) CHR241 (Link to dictyBase) - - - Contig-U10843-1 | Contig-U131... library) Clone ID CHR241 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U108...43-1 | Contig-U13148-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/C...ilyhtht**KTMATQQQQQQQQQQQQQIKARKDIQIQQ AQSASDILGPPEISETEITTESILGDGSFGTVYKGRCRLKDVAVKVMLKQVDQKTLTDFR KEVAIMSKIFHPNIVLFLGACTSTPGKLMICT...PPEISETEITTESILGDGSFGTVYKGRCRLKDVAVKVMLKQVDQKTLTDFR KEVAIMSKIFHPNIVLFLGACTSTPGKLMICTELMKGNLVSLLLDPMVKLPLITRM
Lifescience Database Archive (English)
Full Text Available VH (Link to library) VHJ417 (Link to dictyBase) - G23450 DDB0202154 Contig-U12507-1...brary) Clone ID VHJ417 (Link to dictyBase) Atlas ID - NBRP ID G23450 dictyBase ID DDB0202154 Link to Contig ...Contig-U12507-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHJ4-...LLSAVSDSSVQSLSSSI--- ---IDEIKQSVFGATAIIGQSKYIMEGQLSLLKGVVASTKKDLFIYLFKDCIICTEINSN...QSKYIMEGQLSLLKGVVASTKKDLFIYLFKDCIICTEINSN YQKDGSNNNNNNNNNNSNNSNSNSSSNNSGSNNSSNNNSPNNLTPKKQTFKSLSTSSSTP NNLSQ
Lifescience Database Archive (English)
Full Text Available VF (Link to library) VFH641 (Link to dictyBase) - - - Contig-U16151-1 VFH641E (Link... Clone ID VFH641 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16151-1 Original site URL http://dict...KLLGVQTQAKQTRATWKIVVGDGAGAVTFKLATNGGTTEGDFTTTLTSKVLS GSDPKEVGTYYMDVTVPTGTTCTGTNGICT...KLLGVQTQAKQTRATWKIVVGDGAGAVTFKLATNGGTTEGDFTTTLTSKVLS GSDPKEVGTYYMDVTVPTGTTCTGTNGICT...nificant alignments: (bits) Value N AC116984 |AC116984.2 Dictyostelium discoideum
Lifescience Database Archive (English)
Full Text Available switchLanguage; BLAST Search Image Search Home About Archive Update History Data List Contact us FANTOM... JASPAR) Data file File name: Motifs File URL: ftp://ftp.biosciencedbc.jp/archive/fantom5/datafiles/phase1.3...tabase Database Description Download License Update History of This Database Site Policy | Contact Us Results of de-novo and Motif activity analyses - FANTOM5 | LSDB Archive ...
Database Description - GenLibi | LSDB Archive [Life Science Database Archive metadata
Lifescience Database Archive (English)
Full Text Available ve name Gene Linker to bibliography DOI 10.18908/lsdba.nbdc01093-000 Creator Creator Name: Japan Science and Technology...mouse and rat genes. License CC BY-SA Detail Background and funding Name: JST (Japan Science and Technology ... site Japan Science and Technology Agency URL of the original website http://gene.biosciencedbc.jp/ Operatio...me(s): Journal: External Links: Original website information Database maintenance
Lifescience Database Archive (English)
Full Text Available SH (Link to library) SHE695 (Link to dictyBase) - G22060 DDB0217012 Contig-U12072-1...brary) Clone ID SHE695 (Link to dictyBase) Atlas ID - NBRP ID G22060 dictyBase ID DDB0217012 Link to Contig ...Contig-U12072-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/SH/SHE6-...CPISDCSDHGYCDTSIGKC NCDSSHQGAGCEMDLVSCPTSNKAICSGWGTCNNQTGICTCDANRVGSDCSGISCPVPNC NGNGNCDTTVGQCSCDPSHQGANCEMN...IGKC NCDSSHQGAGCEMDLVSCPTSNKAICSGWGTCNNQTGICTCDANRVGSDCSGISCPVPNC NGNGNCDTTVGQCSCDPSHQGANCEMNFVSCPTPNRSVCSGWGTCNNQTGICT
Lifescience Database Archive (English)
Full Text Available VH (Link to library) VHK221 (Link to dictyBase) - - - - VHK221P (Link to Original site) VHK221F 603 VHK2...21Z 724 VHK221P 1307 - - Show VHK221 Library VH (Link to library) Clone ID VHK221 (Link... to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig - Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHK2...-A/VHK221Q.Seq.d/ Representative seq. ID VHK221P (Link to... Original site) Representative DNA sequence >VHK221 (VHK221Q) /CSM/VH/VHK2-A/VHK221Q.Seq.d/ AACTCTCGAGTGCAAA
Lifescience Database Archive (English)
Full Text Available VH (Link to library) VHK211 (Link to dictyBase) - - - - VHK211P (Link to Original site) VHK211F 605 VHK2...11Z 118 VHK211P 703 - - Show VHK211 Library VH (Link to library) Clone ID VHK211 (Link ...to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig - Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHK2...-A/VHK211Q.Seq.d/ Representative seq. ID VHK211P (Link to ...Original site) Representative DNA sequence >VHK211 (VHK211Q) /CSM/VH/VHK2-A/VHK211Q.Seq.d/ AACTCTCGAGTGCAAAA
Lifescience Database Archive (English)
Full Text Available VH (Link to library) VHK279 (Link to dictyBase) - - - - VHK279P (Link to Original site) VHK279F 619 VHK2...79Z 149 VHK279P 748 - - Show VHK279 Library VH (Link to library) Clone ID VHK279 (Link ...to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig - Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHK2...-D/VHK279Q.Seq.d/ Representative seq. ID VHK279P (Link to ...Original site) Representative DNA sequence >VHK279 (VHK279Q) /CSM/VH/VHK2-D/VHK279Q.Seq.d/ AACTCTCGAGTGCAAAA
Lifescience Database Archive (English)
Full Text Available VF (Link to library) VFK273 (Link to dictyBase) - - - Contig-U16028-1 | Contig-U16311-1 VFK2...73P (Link to Original site) VFK273F 633 VFK273Z 575 VFK273P 1188 - - Show VFK273 Library VF (Link to library) Clone ID VFK2...028-1 | Contig-U16311-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VF/VFK2-D/VFK2...73Q.Seq.d/ Representative seq. ID VFK273P (Link to Original site) Representative DNA sequence >VFK273 (VFK2...73Q) /CSM/VF/VFK2-D/VFK273Q.Seq.d/ AAATCTTTATTAATATTTTTCAAAATAAATAAATAAATAAATTAAAAATGAAAGTTTTAT
Lifescience Database Archive (English)
Full Text Available SL (Link to library) SLH292 (Link to dictyBase) - G01986 DDB0185621 Contig-U15046-1 SLH2...92P (Link to Original site) SLH292F 431 SLH292Z 307 SLH292P 738 - - Show SLH292 Library SL (Link to library) Clone ID SLH2...ontig-U15046-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/SL/SLH2-D/SLH2...92Q.Seq.d/ Representative seq. ID SLH292P (Link to Original site) Representative DNA sequence >SLH292 (SLH292Q) /CSM/SL/SLH2...-D/SLH292Q.Seq.d/ ATTTTCTATACAAATAAAAAAAAAAAAAAAAAAAAAAAATAAAAATAAAAATAAAAATAA AAATTTAA
Lifescience Database Archive (English)
Full Text Available SL (Link to library) SLH282 (Link to dictyBase) - - - Contig-U10985-1 | Contig-U15908-1 SLH2...82P (Link to Original site) SLH282F 506 SLH282Z 455 SLH282P 961 - - Show SLH282 Library SL (Link to library) Clone ID SLH2...85-1 | Contig-U15908-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/SL/SLH2-D/SLH2...82Q.Seq.d/ Representative seq. ID SLH282P (Link to Original site) Representative DNA sequence >SLH282 (SLH2...82Q) /CSM/SL/SLH2-D/SLH282Q.Seq.d/ GGTTTTTAAAACTATTGATACTGAAGAGAATGGAATTATATCAATAACACAATTAAGACA
Lifescience Database Archive (English)
Full Text Available SL (Link to library) SLH249 (Link to dictyBase) - G24226 DDB0215670 Contig-U04170-1 SLH2...49E (Link to Original site) - - - - - - SLH249E 689 Show SLH249 Library SL (Link to library) Clone ID SLH2...riginal site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/SL/SLH2-C/SLH249Q.Seq.d/ ...Representative seq. ID SLH249E (Link to Original site) Representative DNA sequence >SLH249 (SLH249Q) /CSM/SL/SLH2-C/SLH2...re E Sequences producing significant alignments: (bits) Value SLH249 (SLH249Q) /CSM/SL/SLH2-C/SLH2
Lifescience Database Archive (English)
Full Text Available SL (Link to library) SLH274 (Link to dictyBase) - G22493 DDB0218769 Contig-U04171-1 SLH2...74F (Link to Original site) SLH274F 340 - - - - - - Show SLH274 Library SL (Link to library) Clone ID SLH2...riginal site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/SL/SLH2-D/SLH274Q.Seq.d/ ...Representative seq. ID SLH274F (Link to Original site) Representative DNA sequence >SLH274 (SLH274Q) /CSM/SL/SLH2-D/SLH2...core E Sequences producing significant alignments: (bits) Value SLH274 (SLH274Q) /CSM/SL/SLH2-D/SLH274Q.Seq.
Lifescience Database Archive (English)
Full Text Available SL (Link to library) SLH238 (Link to dictyBase) - G22491 DDB0188118 Contig-U04168-1 SLH2...38F (Link to Original site) SLH238F 383 - - - - - - Show SLH238 Library SL (Link to library) Clone ID SLH2...riginal site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/SL/SLH2-B/SLH238Q.Seq.d/ ...Representative seq. ID SLH238F (Link to Original site) Representative DNA sequence >SLH238 (SLH238Q) /CSM/SL/SLH2-B/SLH2...e E Sequences producing significant alignments: (bits) Value SLH238 (SLH238Q) /CSM/SL/SLH2-B/SLH2
Lifescience Database Archive (English)
Full Text Available FC (Link to library) FC-AI17 (Link to dictyBase) - - - Contig-U15690-1 FC-AI17P (Li...nk to Original site) FC-AI17F 587 FC-AI17Z 626 FC-AI17P 1212 - - Show FC-AI17 Library FC (Link to library) Clone ID FC-AI...nal site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI17Q.Seq.d/ Representative seq. ID FC-AI...17P (Link to Original site) Representative DNA sequence >FC-AI17 (FC-AI17Q) /CSM/FC/FC-AI/FC-AI...slated Amino Acid sequence ANIATVGDFLKADTVVPKMIITYNKRKQGTDYLKAVIGPILSNVIKQELNLELKPNLVYA AIISEQEIRTGEKSTLDRNV
Lifescience Database Archive (English)
Full Text Available FC (Link to library) FC-AI18 (Link to dictyBase) - - - Contig-U15590-1 FC-AI18P (Li...nk to Original site) FC-AI18F 621 FC-AI18Z 703 FC-AI18P 1324 - - Show FC-AI18 Library FC (Link to library) Clone ID FC-AI...nal site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI18Q.Seq.d/ Representative seq. ID FC-AI...18P (Link to Original site) Representative DNA sequence >FC-AI18 (FC-AI18Q) /CSM/FC/FC-AI/FC-AI...AVWPLIPGYERA DGEKQYPVAAMLCNFTKPTPTTPSLLTHDEVVTFFHEFGHVMHNMSTKVHYSMFSGTSVE RDFVECPSQLFEFWCWNKDVLVNKLSGHXKDHSKKLPTDLVERMIAAKNLNVAI
Lifescience Database Archive (English)
Full Text Available FC (Link to library) FC-AI15 (Link to dictyBase) - G01730 DDB0214993 Contig-U15123-1 FC-AI...15E (Link to Original site) - - - - - - FC-AI15E 856 Show FC-AI15 Library FC (Link to library) Clone ID FC-AI...3-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI15Q.Se...q.d/ Representative seq. ID FC-AI15E (Link to Original site) Representative DNA sequence >FC-AI15 (FC-AI15Q) /CSM/FC/FC-AI/FC-AI...AAAAAAAATA sequence update 1996.12.24 Translated Amino Acid sequence kt*riyi*KMMIKYITIAILFIASLVKADLQFSLCPTCV
Lifescience Database Archive (English)
Full Text Available FC (Link to library) FC-AI24 (Link to dictyBase) - - - - FC-AI24Z (Link to Original site) - - FC-AI...24Z 693 - - - - Show FC-AI24 Library FC (Link to library) Clone ID FC-AI24 (Link to dictyBas...e) Atlas ID - NBRP ID - dictyBase ID - Link to Contig - Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI...24Q.Seq.d/ Representative seq. ID FC-AI24Z (Link to Original s...ite) Representative DNA sequence >FC-AI24 (FC-AI24Q) /CSM/FC/FC-AI/FC-AI24Q.Seq.d/ XXXXXXXXXXAAATTAGAAAACAAA
Lifescience Database Archive (English)
Full Text Available SL (Link to library) SLC465 (Link to dictyBase) - G01923 DDB0190872 Contig-U14177-1 SLC4...65P (Link to Original site) SLC465F 725 SLC465Z 393 SLC465P 1118 - - Show SLC465 Library SL (Link to library) Clone ID SLC4...Contig-U14177-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/SL/SLC4-C/SLC4...65Q.Seq.d/ Representative seq. ID SLC465P (Link to Original site) Representative DNA sequence >SLC465 (SLC465Q) /CSM/SL/SLC4...-C/SLC465Q.Seq.d/ CGTTAACAGATTTTAATATTACTAATATTGTAGAAAATGATTTTAAATAAAGTAGCAAAA TGTTATG
Lifescience Database Archive (English)
Full Text Available SL (Link to library) SLC405 (Link to dictyBase) - - - Contig-U11279-1 | Contig-U16243-1 SLC4...05P (Link to Original site) SLC405F 536 SLC405Z 439 SLC405P 975 - - Show SLC405 Library SL (Link to library) Clone ID SLC4...79-1 | Contig-U16243-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/SL/SLC4-A/SLC4...05Q.Seq.d/ Representative seq. ID SLC405P (Link to Original site) Representative DNA sequence >SLC405 (SLC4...05Q) /CSM/SL/SLC4-A/SLC405Q.Seq.d/ ATAACTAATAAAATGTCATTCAATTCAAGAATTGAAACTATTTCTCGCCACTTAAGCACT
Lifescience Database Archive (English)
Full Text Available SL (Link to library) SLC426 (Link to dictyBase) - G01922 DDB0233225 Contig-U14991-1 SLC4...26E (Link to Original site) SLC426F 335 SLC426Z 320 SLC426P 655 SLC426E 335 Show SLC426 Library SL (Lin...Contig Contig-U14991-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/SL/SLC4-B/SLC4...26Q.Seq.d/ Representative seq. ID SLC426E (Link to Original site) Representative DNA sequence >SLC426 (SLC4...26Q) /CSM/SL/SLC4-B/SLC426Q.Seq.d/ AAATAATAAATAGTAAATAATAAATAATAATAAATAATAATAATAATATTTNAAAATGGG
Lifescience Database Archive (English)
Full Text Available SL (Link to library) SLC492 (Link to dictyBase) - - - Contig-U10734-1 | Contig-U12865-1 SLC4...92P (Link to Original site) SLC492F 645 SLC492Z 550 SLC492P 1195 - - Show SLC492 Library SL (Link to library) Clone ID SLC4...734-1 | Contig-U12865-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/SL/SLC4-D/SLC4...92Q.Seq.d/ Representative seq. ID SLC492P (Link to Original site) Representative DNA sequence >SLC492 (SLC4...92Q) /CSM/SL/SLC4-D/SLC492Q.Seq.d/ AAAAAAAAAATATACAAATAATGAATAAATTTTTAGCTTTGTTATTTGTTTTAGCTTTGT
Lifescience Database Archive (English)
Full Text Available SL (Link to library) SLC432 (Link to dictyBase) - - - Contig-U09715-1 | Contig-U16382-1 SLC4...32P (Link to Original site) SLC432F 633 SLC432Z 188 SLC432P 821 - - Show SLC432 Library SL (Link to library) Clone ID SLC4...15-1 | Contig-U16382-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/SL/SLC4-B/SLC4...32Q.Seq.d/ Representative seq. ID SLC432P (Link to Original site) Representative DNA sequence >SLC432 (SLC4...32Q) /CSM/SL/SLC4-B/SLC432Q.Seq.d/ ATTAAATTAAATAAAAAATAAAAATGGATGGTGAAGATGTTCAAGCTTTAGTTATTGATA
Lifescience Database Archive (English)
Full Text Available SL (Link to library) SLC424 (Link to dictyBase) - G01086 DDB0231665 Contig-U08784-1 SLC4...24P (Link to Original site) SLC424F 169 SLC424Z 538 SLC424P 707 - - Show SLC424 Library SL (Link to library) Clone ID SLC4...ontig-U08784-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/SL/SLC4-A/SLC4...24Q.Seq.d/ Representative seq. ID SLC424P (Link to Original site) Representative DNA sequence >SLC424 (SLC424Q) /CSM/SL/SLC4...-A/SLC424Q.Seq.d/ GGATATTATAATTTCAAATTAAGTTTTATAAATTTGAAATAATATTGAAAAAAAAAAAAA ATAAAAAA
Leveraging httpModules for Better ASPNET Applications
Love, Chris
2008-01-01
This Wrox Blox explains how to create different types of custom modules for ASP.NET web sites. Custom ASP.NET Modules are a great way to program advanced features to your web site. This Wrox blox discusses the difference between a custom httpModule and the Global.asax file. It also covers the steps in the ASP.NET pipeline. The examples include using a custom module to configure a site's initial settings, a background worker thread, and an IP blocker. Other examples show how to add content to the content being sent to the client, URL Rewriting, and a custom error handler. Table of Contents Intr
Site specific information in site selection
International Nuclear Information System (INIS)
Aeikaes, T.; Hautojaervi, A.
1998-01-01
The programme for the siting of a deep repository for final disposal of spent nuclear fuel was started already in 1983 and is carried out today by Posiva Oy which continues the work started by Teollisuuden Voima Oy. The programme aims at site selection by the end of the year 2000. The programme has progressed in successive interim stages with defined goals. After an early phase for site identification, five sites were selected in 1987 for preliminary site characterisation. Three of these were selected and judged to be best suited for the more detailed characterisation in 1992. An additional new site was included into the programme based on a separate feasibility study in the beginning of 1997. Since the year 1983 several safety assessments together with technical plans of the facility have been completed. When approaching the site selection the needs for more detailed consideration of the site specific properties in the safety assessment have been increased. The Finnish regulator STUK has published a proposal for general safety requirements for the final disposal of spent nuclear fuel in Finland. This set of requirements has been projected to be used in conjunction of the decision making by the end 2000. Based on the site evaluation all sites can provide a stable environment and there is evidence that the requirements for the longevity of the canister can be fulfilled at each site. In this manner the four candidate sites do not differ too much from each other. The main difference between the sites is in the salinity of the deep groundwater. The significance of differences in the salinity for the long-term safety cannot be defined yet. The differences may contribute to the discussion of the longevity of the bentonite buffer and also to the modelling of the groundwater flow and transport. The use of the geosphere as a transport barrier is basically culminated on the questions about sparse but fast flow routes and 'how bad channeling can be'. To answer these questions
MedlinePlus Connect: How it Works
... Connect → How it Works URL of this page: https://medlineplus.gov/connect/howitworks.html MedlinePlus Connect: How ... will change.) Old URLs New URLs Web Application https://apps.nlm.nih.gov/medlineplus/services/mpconnect.cfm? ...
... MedlinePlus Connect in Use URL of this page: https://medlineplus.gov/connect/users.html MedlinePlus Connect in ... will change.) Old URLs New URLs Web Application https://apps.nlm.nih.gov/medlineplus/services/mpconnect.cfm? ...
MedlinePlus Connect: Web Service
... MedlinePlus Connect → Web Service URL of this page: https://medlineplus.gov/connect/service.html MedlinePlus Connect: Web ... will change.) Old URLs New URLs Web Application https://apps.nlm.nih.gov/medlineplus/services/mpconnect.cfm? ...
MedlinePlus Connect: Web Application
... MedlinePlus Connect → Web Application URL of this page: https://medlineplus.gov/connect/application.html MedlinePlus Connect: Web ... will change.) Old URLs New URLs Web Application https://apps.nlm.nih.gov/medlineplus/services/mpconnect.cfm? ...
MedlinePlus Connect: Technical Information
... MedlinePlus Connect → Technical Information URL of this page: https://medlineplus.gov/connect/technical.html MedlinePlus Connect: Technical ... will change.) Old URLs New URLs Web Application https://apps.nlm.nih.gov/medlineplus/services/mpconnect.cfm? ...
MedlinePlus Connect: Linking Patient Portals and Electronic Health Records to Health Information
... Here: Home → MedlinePlus Connect URL of this page: https://medlineplus.gov/connect/overview.html MedlinePlus Connect Linking ... will change.) Old URLs New URLs Web Application https://apps.nlm.nih.gov/medlineplus/services/mpconnect.cfm? ...
MedlinePlus Connect: Email List
... MedlinePlus Connect → Email List URL of this page: https://medlineplus.gov/connect/emaillist.html MedlinePlus Connect: Email ... will change.) Old URLs New URLs Web Application https://apps.nlm.nih.gov/medlineplus/services/mpconnect.cfm? ...
Site organization and site arrangement
International Nuclear Information System (INIS)
Boissonnet, B.; Macqueron, J.F.
1976-01-01
The present paper deals with criteria for the choice of a production unit or power plant site, the organization and development of a site in terms of its particular characteristics and takes into account personnel considerations in site organizations as well as the problem of integrating the architecture into the environment. (RW) [de
Lifescience Database Archive (English)
Full Text Available VF (Link to library) VFB568 (Link to dictyBase) - G23244 DDB0217993 Contig-U02062-1...ary VF (Link to library) Clone ID VFB568 (Link to dictyBase) Atlas ID - NBRP ID G23244 dictyBase ID DDB02179...93 Link to Contig Contig-U02062-1 | Contig-U11831-1 Original site URL http://dict...TELLY NNFYNTAEPITDEIIGFDLRKYLNFELFTYDYILGRELNQYNNSGCSGCSGCSSSSSSSS SSGGDDGRKNNKKYITQFDTILKELIKQLSFNICTNFSDRD...STELLY NNFYNTAEPITDEIIGFDLRKYLNFELFTYDYILGRELNQYNNSGCSGCSGCSSSSSSSS SSGGDDGRKNNKKYITQFDTILKELIKQLSFNICTNFSDR
Lifescience Database Archive (English)
Full Text Available SF (Link to library) SFH236 (Link to dictyBase) - G00315 DDB0191340 Contig-U16349-1...brary) Clone ID SFH236 (Link to dictyBase) Atlas ID - NBRP ID G00315 dictyBase ID DDB0191340 Link to Contig ...Contig-U16349-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/SF/SFH2-...VDCVTNSSDASCTNFQYPLANITADINNL CGSMPYMPVCTIQQSCNQESSTSGICDPFSILGDSCLHDMPGMSG--- ---ASGSVVEQCSSVDSISNLPTTMQLFAGIKSICT...ii yvvaclicqfvpfnnhviknpqqvvfvihsqflvivvfticqa*vv--- ---ASGSVVEQCSSVDSISNLPTTMQLFAGIKSICTEMAMDGCEKCSGNSPTTTC
Lifescience Database Archive (English)
Full Text Available VF (Link to library) VFC148 (Link to dictyBase) - G00403 DDB0215559 Contig-U08747-1...rary) Clone ID VFC148 (Link to dictyBase) Atlas ID - NBRP ID G00403 dictyBase ID DDB0215559 Link to Contig C...ontig-U08747-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VF/VFC1-B...STEITHLAIPSNSNIK IIEGGAYIPANVKHCLLLDGFNQPLEPGFLAPTITHLHICTIKTPLLVGSIPNGVTDLFL HDGFSEPISQDIIPPSVQNLYLCDIKLPFK...it--- ---LMKSXFIIHSKSINXAKKPKRVQFGDKVFTYYNKDENNGIISTEITHLAIPSNSNIK IIEGGAYIPANVKHCLLLDGFNQPLEPGFLAPTITHLHICT
Lifescience Database Archive (English)
Full Text Available SH (Link to library) SHE365 (Link to dictyBase) - G23163 DDB0185626 Contig-U11298-1...ary SH (Link to library) Clone ID SHE365 (Link to dictyBase) Atlas ID - NBRP ID G23163 dictyBase ID DDB01856...26 Link to Contig Contig-U11298-1 | Contig-U13252-1 Original site URL http://dict...VEIAFSDKTPSIAVEAIRLVSIMSTL DLLDESDVQKICTLYLVDQPEISKAAGGLIFSKYLLSTQTKIDTTLSNIINSTSAASTTS GQHARKKSKTTNLTSADLDE...PSIAVEAIRLVSIMSTL DLLDESDVQKICTLYLVDQPEISKAAGGLIFSKYLLSTQTKIDTTLSNIINSTSAASTTS GQHARKKSKTTNLTSADLDEQQQQQISSQ
(reprocessed)CAGE_peaks_annotation - FANTOM5 | LSDB Archive [Life Science Database Archive metadata
Lifescience Database Archive (English)
Full Text Available switchLanguage; BLAST Search Image Search Home About Archive Update History Data List Contact us FANTOM...: ftp://ftp.biosciencedbc.jp/archive/fantom5/datafiles/reprocessed/hg38_latest/extra/CAGE_peaks_annotation/ ...e URL: ftp://ftp.biosciencedbc.jp/archive/fantom5/datafiles/reprocessed/mm10_latest/extra/CAGE_peaks_annotat...te History of This Database Site Policy | Contact Us (reprocessed)CAGE_peaks_annotation - FANTOM5 | LSDB Archive ...
Lifescience Database Archive (English)
Full Text Available VF (Link to library) VFC278 (Link to dictyBase) - - - Contig-U13504-1 VFC278E (Link... Clone ID VFC278 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U13504-1 Original site URL http://dict...0.0 %: mitochondrial 4.0 %: plasma membrane >> prediction for VFC278 is cyt 5' end seq. ID VFC278F 5' end se
A study about the long-term stability of sedimentary rock
International Nuclear Information System (INIS)
Yoshino, Naoto; Miyanomae, Shun-ichi; Inoue, Hiroyuki; Nashimoto, Yutaka
2005-02-01
In this paper, following two issues were examined and estimated, (1) the influence of near field condition factor to the dynamical behavior of sedimentary soft rock, (2) the long term estimation of the dynamical behavior considering the condition of Horonobe area. As the study about the influence of near field condition factor to the dynamical behavior of sedimentary soft rock, the thermal factor was focused on and the laboratory tests using test pieces which were sampled in Horonobe area were carried out under the water temperature were 20 degrees and 80 degrees. As a result, the time dependence parameter in variable-compliance-type constitutive-equation could be obtained. And comparison between creep property under 20 degrees and 80 degrees was conducted. In addition, the general properties of sedimentary soft rock under several conditions were identified by the survey of the literature. And the way how to confirm the dynamical properties of sedimentary soft rock with in-situ test were presented. For the study on the short-term and long-term stability of rock surrounding buffer materials, numerical simulations were carried out assuming several conditions. The direction of disposal tunnels and the ratio of rock strength by initial stress were estimated to be the main factor affecting the short-term stability of rock. Time dependency of rock and the stiffness of buffer material were estimated to be the main factor affecting the long-term stability of rock. (author)
Lifescience Database Archive (English)
Full Text Available SS (Link to library) SSB721 (Link to dictyBase) ssb721 G20804 DDB0230090 Contig-U04...594-1 SSB721E (Link to Original site) - - - - - - SSB721E 549 Show SSB721 Library SS (Link to library) Clone ID SSB721 (Link to dict...yBase) Atlas ID ssb721 NBRP ID G20804 dictyBase ID DDB0230090 Link to Contig Contig-...U04594-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/SS/SSB7-A/SSB72...quence update 1997.11.25 Translated Amino Acid sequence NDINSIVCKANSQCPTSHICTSSNKCIIKYSSKVGEKCTDSPLQCRVFNGEI
Lifescience Database Archive (English)
Full Text Available SL (Link to library) SLG865 (Link to dictyBase) - G22488 DDB0184443 Contig-U04159-1... SLG865E (Link to Original site) - - - - - - SLG865E 373 Show SLG865 Library SL (Link to library) Clone ID SLG865 (Link to dict...yBase) Atlas ID - NBRP ID G22488 dictyBase ID DDB0184443 Link to Contig Contig-U04159-1 O...riginal site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/SL/SLG8-C/SLG865Q.Seq.d/ ...quence update 1998. 6.28 Translated Amino Acid sequence KAQLETDLKNICTLVPSNITMECKF
Lifescience Database Archive (English)
Full Text Available VF (Link to library) VFB113 (Link to dictyBase) - - - Contig-U16478-1 VFB113P (Link... to Original site) VFB113F 584 VFB113Z 643 VFB113P 1227 - - Show VFB113 Library VF (Link to library) Clone ID VFB113 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16478-1 Original site URL http://dict...rlstttrlptttrlptttrlstttr lptttrlptttrlptttrlptttrlsttrlstttrlstswctswctswictrygswissr llcwynhs*l*t*c*sfkksn...sequence. 42 5e-29 8 U03413 |U03413.1 Dictyostelium discoideum AX2 calcium binding protein mRNA, complete cd
Lifescience Database Archive (English)
Full Text Available CF (Link to library) CFE213 (Link to dictyBase) - - - Contig-U16381-1 CFE213F (Link... to Original site) CFE213F 111 - - - - - - Show CFE213 Library CF (Link to library) Clone ID CFE213 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16381-1 Original site URL http://dict... E Sequences producing significant alignments: (bits) Value N AC115685 |AC115685.1 Dict...yostelium discoideum chromosome 2 map 4718821-4752388 strain AX4, complete sequence. 80 9e-24 3 X51892 |X51892.1 Dict
Lifescience Database Archive (English)
Full Text Available SS (Link to library) SSF210 (Link to dictyBase) - - - Contig-U16581-1 SSF210P (Link... to Original site) SSF210F 183 SSF210Z 197 SSF210P 380 - - Show SSF210 Library SS (Link to library) Clone ID SSF210 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16581-1 Original site URL http://dict...nt alignments: (bits) Value N D16417 |D16417.1 Dictyostelium discoideum mRNA. 339...01670 Skin cDNA library Ictalurus punctatus cDNA 5' similar to Ictacalcin, mRNA s
Lifescience Database Archive (English)
Full Text Available VF (Link to library) VFI196 (Link to dictyBase) - - - Contig-U16512-1 - (Link to Or...iginal site) - - VFI196Z 168 - - - - Show VFI196 Library VF (Link to library) Clone ID VFI196 (Link to dicty...Base) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16512-1 Original site URL http://dictycdb.b...ces. 40 8.8 1 CK407044 |CK407044.1 AUF_IfLvr_212_p04 Ictalurus furcatus liver cDNA library Ictalurus furcatu...%: nuclear 36.0 %: mitochondrial 16.0 %: cytoplasmic 4.0 %: cytoskeletal >> prediction for VFI196 is nuc 5'
Lifescience Database Archive (English)
Full Text Available VF (Link to library) VFC171 (Link to dictyBase) - - - Contig-U16478-1 VFC171P (Link... to Original site) VFC171F 482 VFC171Z 633 VFC171P 1115 - - Show VFC171 Library VF (Link to library) Clone ID VFC171 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16478-1 Original site URL http://dict...ptttrlptt trlstttrlptttrlptttrlptttrlptttrlsttrlxtttrlstswctswctswictr ygswissrllcwynhs*l*t*c*sfkksnerywyk*i...ologous to C-terminal repeat sequence of rhodopsin and synaptophysin. 88 1e-15 3 X54062 |X54062.1 Dictyostel
Lifescience Database Archive (English)
Full Text Available VS (Link to library) VSE812 (Link to dictyBase) - - - Contig-U14773-1 VSE812E (Link... to Original site) - - - - - - VSE812E 721 Show VSE812 Library VS (Link to library) Clone ID VSE812 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U14773-1 Original site URL http://dict...re E Sequences producing significant alignments: (bits) Value N L08391 |L08391.1 Dict...9 AF401554_1( AF401554 |pid:none) Ictalurus punctatus ribosomal prot... 132 1e-29 protein update 2009. 7.31