WorldWideScience

Sample records for hordeum

  1. Two New American Species of Hordeum (Poaceae)

    DEFF Research Database (Denmark)

    Bothmer, Roland Von; Jacobsen, Niels; Bagger Jørgensen, Rikke

    1985-01-01

    Two new species of Hordeum are described, viz. the diploid H. erectifolium, native to Argentina, and H. guatemalense, native to Guatemala.......Two new species of Hordeum are described, viz. the diploid H. erectifolium, native to Argentina, and H. guatemalense, native to Guatemala....

  2. Phylogenetic analysis of the genus Hordeum using repetitive DNA sequences

    DEFF Research Database (Denmark)

    Svitashev, S.; Bryngelsson, T.; Vershinin, A.

    1994-01-01

    A set of six cloned barley (Hordeum vulgare) repetitive DNA sequences was used for the analysis of phylogenetic relationships among 31 species (46 taxa) of the genus Hordeum, using molecular hybridization techniques. In situ hybridization experiments showed dispersed organization of the sequences...

  3. Evaluation of genetic diversity in barley (Hordeum vulgare L.) from ...

    African Journals Online (AJOL)

    User

    2015-06-03

    Jun 3, 2015 ... were kernel weight per spike and thousand seed weight. ...... Ser. Biol. 17:65-70. CSA (2010) Area and production of crops (private peasant holdings, ... (Hordeum vulgare L.) landraces in variable production system,. Ethiopia.

  4. Heterologous expression of Hordeum vulgare cysteine protease in yeast

    DEFF Research Database (Denmark)

    Rosenkilde, Anne Lind; Dionisio, Giuseppe; Holm, Preben B

    Cysteine Proteases accounts for more than 90 % of the total proteolytic activity in the degradation of barley seed storage proteins during germination. Several Cysteine proteases have been identified in barley. One of the key enzymes, Hordeum vulgare endoprotease B2 (HvEPB2) was cloned with and w......Cysteine Proteases accounts for more than 90 % of the total proteolytic activity in the degradation of barley seed storage proteins during germination. Several Cysteine proteases have been identified in barley. One of the key enzymes, Hordeum vulgare endoprotease B2 (HvEPB2) was cloned...

  5. Taxonomy, Variation, and Relationships in the Hordeum parodii Group (Poaceae)

    DEFF Research Database (Denmark)

    Von Bothmer, R.; Jacobsen, N.; Bagger Jørgensen, Rikke

    1986-01-01

    The Hordeum parodii group contains three species, viz. H. parodii Covas (6x), H. tetraploidum Covas (4x), and H. fuegianum Bothmer, Jacobsen, et Jorgensen, sp. nov. (4x). The former two species mainly occur in C and S Argentina, while H. fuegianum is native to Tierra del Fuego. All three species...

  6. Genomic restructuring in Hordeum chilense durum wheat hybrids ...

    Indian Academy of Sciences (India)

    ANDREIA DELGADO

    4John Innes Centre, Norwich Research Park, Norwich NR4 7UH, UK. 5Departament of Genetics and Biotechnology, University of Tras-os-Montes and Alto ... [Delgado A., Carvalho A., Martín A. C., Martín A. and Lima-Brito J. 2017 Genomic restructuring in F1 Hordeum chilense × durum ...... Academic Press, Burlington,.

  7. Molecular characterization of barley ( Hordeum vulgare L.) genome ...

    African Journals Online (AJOL)

    The present work aimed to select drought tolerant barley (Hordeum vulgare L.) cultivars through identification of stress genes responsible for drought tolerance. Several barley genotypes were tested for drought resistance using specific molecular markers, nine out of all the genotypes were chosen for this study; five out of ...

  8. Evaluation of genetic diversity in barley ( Hordeum vulgare L.) from ...

    African Journals Online (AJOL)

    This study aimed to determine the genetic diversity and relationships among barley varieties (Hordeum vulgare L.) growing at Wollo Highland areas by using hordein and agro-morphological traits. Twenty (20) varieties were laid down in randomized complete block design (RCBD) design with three replications; they were ...

  9. Genetic diversity in barley landraces (Hordeum vulgare L. subsp.

    Indian Academy of Sciences (India)

    Genetic diversity in barley landraces (Hordeum vulgare L. subsp. vulgare) originated from Crescent Fertile region as detected by seed storage proteins. RIM MZID FARHAT CHIBANI RAYDA BEN AYED MOHSEN HANANA JOELLE BREIDI RABIH KABALAN SAMIH EL-HAJJ HASSAN MACHLAB AHMED REBAI LAMIS ...

  10. Genetic analysis on the competitive ability of barley ( Hordeum ...

    African Journals Online (AJOL)

    Genetic analysis on the competitive ability of barley ( Hordeum vulgare L.) recombinant inbred lines intercropped with oat ( Avena sativa L.) weeds. ... Furthermore, the commonly used herbicide price is soaring from time to time and out of the reach of the poor farmers in the developing countries. Therefore, this method is an ...

  11. Hordeum vulgare cysteine protease heterologous expressed in yeast

    DEFF Research Database (Denmark)

    Rosenkilde, Anne Lind; Dionisio, Giuseppe; Holm, Preben Bach

    , (Hordeum vulgare) endoprotease B2 (HvEPB2) was cloned with and without the 5 amino acid C-terminal sequence into the Pichia pastoris expression vector pPICZ Aα and electrotransformed into Pichia pastoris strain SDM1163. Heterologous protein production was induced with 2% MeOH and the protein expression...

  12. Triple Hybridization with Cultivated Barley (Hordeum vulgare L.)

    DEFF Research Database (Denmark)

    Bothmer, R. von; Claesson, L.; Flink, J.

    1989-01-01

    A crossing programme for trispecific hybridization including cultivated barely (Hordeum vulgare L.) as the third parent was carried out. The primary hybrids comprised 11 interspecific combinations, each of which had either H. jabatum or H. lechleri as one of the parents. The second parent...

  13. Development and Meiosis of Three Interspecific Hybrids with Cultivated Barley (Hordeum vulgare L.)

    DEFF Research Database (Denmark)

    Von Bothmer, R.; Flink, J.; Linde-Laursen, Ib

    1986-01-01

    The development and meiosis of three interspecific hybrids between cultivated barley (Hordeum vulgare L.) and H. secalinum Schreb., H. tetraploidum Covas, and H. parodii Covas, respectively, were studied. All three hybrid combinations developed very slowly vegetatively. Meiosis of the hybrids...

  14. Haploid Barley from the Intergeneric Cross Hordeum vulgare x Psathyrostachys fragilis

    DEFF Research Database (Denmark)

    Bothmer, Roland; Jacobsen, Niels; Bagger Jørgensen, Rikke

    1984-01-01

    The intergeneric hybrid Hordeum vulgare x Psathyrostachys fragilis was fairly easily obtained. During each growing season the intermediate, perennial hybrid yielded haploid tillers of H. vulgare. Late in one season few, hybrid tillers headed. The morphology, cytology and enzymatic patterns...

  15. Giemsa C-banded karyotypes of Hordeum taxa from North America

    DEFF Research Database (Denmark)

    Linde-Laursen, Ib; Bothmer, R. von; Jacobsen, N.

    1986-01-01

    submetacentrics than previously reported in Hordeum distinguished the genomes of H. arizonicum and H. brachyantherum (4x) from Newfoundland. A partial inactivation of the nucleolus organizers of one parental genome in interspecific hybrids is considered more common than generally appreciated....

  16. Submergence tolerance in Hordeum marinum

    DEFF Research Database (Denmark)

    Pedersen, Ole; Malik, Al I.; Colmer, Timothy D.

    2010-01-01

    Floodwaters differ markedly in dissolved CO(2), yet the effects of CO(2) on submergence responses of terrestrial plants have rarely been examined. The influence of dissolved CO(2) on underwater photosynthesis and growth was evaluated for three accessions of the wetland plant Hordeum marinum Huds....... All three accessions tolerated complete submergence, but only when in CO(2) enriched floodwater. Plants submerged for 7 days in water at air equilibrium (18 mM CO(2)) suffered loss of biomass, whereas those with 200 mM CO(2) continued to grow. Higher underwater net photosynthesis at 200 mM CO(2......) increased by 2.7- to 3.2-fold sugar concentrations in roots of submerged plants, compared with at air equilibrium CO(2). Leaf gas films enhancing gas exchange with floodwater, lack of a shoot elongation response conserving tissue sugars and high tissue porosity (24-31% in roots) facilitating internal O(2...

  17. Lipid and sugar profiles of various barley cultivars (Hordeum vulgare

    Directory of Open Access Journals (Sweden)

    Pastor Kristian A.

    2015-01-01

    Full Text Available The lipid components and soluble sugars in flour samples of different cultivars of barley (Hordeum vulgare, involving winter malting barley, winter forage barley, spring barley, and hulless barley, were identified. Fatty acids were extracted from flour samples with n-hexane, and derivatized into volatile methyl esters, using TMSH (trimethylsulfonium hydroxide in methanol. Soluble sugars were extracted from defatted and dried samples of barley flour with 96% ethanol, and further derivatized into the corresponding trimethylsilyl (TMS oximes, using hydroxylamine hydrochloride solution and BSTFA (N,O-bis-(trimethylsilyl-trifluoroacetamide. The hexane and alcoholic extracts of barley cultivars were analyzed by GC-MS system. Lipid and sugar compositions were very similar in all barley cultivars. Therefore, multivariate analysis was applied to numerical values of automatically integrated areas of the identified fatty acid methyl esters and TMS oximes of soluble sugars. The application of hierarchical cluster analysis showed a great similarity between the investigated flour samples of barley cultivars, according to their fatty acid content (0.96. Also, significant, but somewhat less similarity was observed regarding the content of soluble sugars (0.70. These preliminary results indicate the possibility of distinguishing flour made of barley, regardless of the variety, from flours made of other cereal species, just by the analysis of the contents of fatty acids and soluble sugars.[Projekat Ministarstva nauke Republike Srbije, br. TR 31066

  18. High capacity of plant regeneration from callus of interspecific hybrids with cultivated barley (Hordeum vulgare L.)

    DEFF Research Database (Denmark)

    Bagger Jørgensen, Rikke; Jensen, C. J.; Andersen, B.

    1986-01-01

    Callus was induced from hybrids between cultivated barley (Hordeum vulgare L. ssp. vulgare) and ten species of wild barley (Hordeum L.) as well as from one backcross line ((H. lechleri .times. H. vulgare) .times. H. vulgare). Successful callus induction and regeneration of plants were achieved from...... explants of young spikes on the barley medium J 25-8. The capacity for plant regeneration was dependent on the wild parental species. In particular, combinations with four related wild species, viz. H. jubatum, H. roshevitzii, H. lechleri, and H. procerum, regenerated high numbers of plants from calli....

  19. The genetics and mechanism of avoidance of rust infection in Hordeum chilense

    NARCIS (Netherlands)

    Vaz Patto, M.C.

    2001-01-01

    Hordeum chilense is a perennial species occurring in Chile and Argentina. This wild barley species shows a very wide range of variation of morphological and agronomic characters and crosses easily with other members of the Triticeae

  20. Morphology and AFLP markers suggest three Hordeum chilense ecotypes that differ in avoidance to rust fungi

    NARCIS (Netherlands)

    Vaz Patto, M.C.; Aardse, A.; Buntjer, J.; Rubiales, D.; Martin, A.; Niks, R.E.

    2001-01-01

    In Hordeum chilense Roem. & Schult., a high variation in the level of avoidance to infection of barley leaf rust (Puccinia hordei Otth) occurs. Probably resulting from the properties of the stomata, the rust germ tube overgrows stomata, and the infection process fails in an early stage. In the

  1. Cytogenetisch en embryologisch onderzoek aan kruisingen tussen Hordeum vulgare en H. bulbosum

    NARCIS (Netherlands)

    Lange, W.

    1969-01-01

    Crosses between barley (Hordeum vulgare) and bulbous barleygrass ( H.bulbosum) could be valuable for the transfer of such properties as resistance to cold or diseases from H. bulbosum to H. vulgare. From the literature it was known that difficulties arose in the cross: seed abortion necessitating

  2. Relationships in the barley genus (Hordeum): An electrophoretic examination of proteins

    DEFF Research Database (Denmark)

    Bagger Jørgensen, Rikke

    1986-01-01

    The relationships between all known Hordeum species except H. guatemalense were inferred from the electrophoresis of the six enzyme systems Got, 6-Pgd, Mdh, Idh, .alpha.- and.beta.- amylases. A total of eleven loci were scored for in these systems. Maximum likelihood clusters and Wagner networks...

  3. AFLP genetic polymorphism in wild barley (Hordeum spontaneum) populations in Israel

    NARCIS (Netherlands)

    Turpeinen, T.; Vanhala, T.; Nevo, E.; Nissila, E.

    2003-01-01

    The genetic diversity produced by the amplified fragment length polymorphism (AFLP) method was studied in 94 genotypes of wild barley, Hordeum spontaneum (C. Koch) Thell., originating from ten ecologically and geographically different locations in Israel. Eight primer pairs produced 204 discernible

  4. Regrowth in Barley (Hordeum vulgare L.) and Rye (Secale cereale L.)

    DEFF Research Database (Denmark)

    Christiansen, J L; Jørgensen, Johannes Ravn; Jørnsgård, B

    1998-01-01

    Regrowth after cutting at four development stages, from heading to grain maturity, was investigated in a pot experiment containing three rye and four barley varieties (including 2 Hordeum spontaneum lines). Regrowth in the barley varieties decreased strongly from heading to grain maturity. Rye ge...

  5. Complex Interspecific Hybridization in Barley (Hordeum vulgare L.) and the Possible Occurrence of Apomixis

    DEFF Research Database (Denmark)

    Bothmer, R. von; Bengtsson, M.; Flink, J.

    1988-01-01

    Several complex hybrids were produced from the combination [(Hordeum lechleri, 6 .times. .times. H. procerum, 6 .times.) .times. H. vulgare, 2 .times.]. Crosses with six diploid barley lines resulted in triple hybrids, most of which had a full complement of barley chromosomes (no. 1-7), but were...

  6. Hordein Variation in Wild (Hordeum Spontaneum) and Cultivated (H. Vulgare) Barley

    DEFF Research Database (Denmark)

    Doll, Hans; Brown, A. H. D.

    1979-01-01

    The storage protein hordein contains two major groups of polypeptides which are highly polymorphic in barley, and in its evolutionary progenitor Hordeum spontaneum Koch. Crosses between the two species showed that the complex electrophoretic phenotypes within the two groups of polypeptides are go...

  7. Characterization of senscence-associated NAC transcription factors in Barley (Hordeum Vulgare L.)

    DEFF Research Database (Denmark)

    Podzimska, Dagmara Agata

    , such as yield, biomass production and nutrient quality, and NAC (NAM, ATAF1/2 and CUC2) transcription factors are promising targets for the breeding. The aim of this thesis was thus to assess the role of NAC transcription factors in regulation of senescence in barley (Hordeum vulgare L.) and to contribute...

  8. NAC Transcription Factors of Barley (Hordeum vulgare L.) and their Involvement in Leaf Senescence

    DEFF Research Database (Denmark)

    Wagner, Michael

    parts of the senescence process. The specific aims of this study were therefore (1) to establish and characterise the NAC transcription factors of the model cereal crop barley (Hordeum vulgare L.) (2) to identify and study putative barley NAC transcription factors involved in the regulation of leaf...

  9. Geography of genetic differentiation in the barley wild relative Hordeum vulgare subsp. spontaneum in Jordan

    Science.gov (United States)

    Informed collecting, conservation, monitoring and utilization of genetic diversity require knowledge of the distribution and structure of genetic variation occurring in a species. Hordeum vulgare subsp. spontaneum (K. Koch) Thell., a primary wild relative of barley, is an important source of genetic...

  10. Structure of Hordeum vulgare NADPH-dependent thioredoxin reductase 2. Unwinding the reaction mechanism

    DEFF Research Database (Denmark)

    Kirkensgaard, Kristine Groth; Hägglund, Per; Finnie, Christine

    2009-01-01

    to the active form. Here, the first crystal structure of a cereal NTR, HvNTR2 from Hordeum vulgare (barley), is presented, which is also the first structure of a monocot plant NTR. The structure was determined at 2.6 A resolution and refined to an R (cryst) of 19.0% and an R (free) of 23.8%. The dimeric protein...

  11. Effects of ultraviolet radiation on viability of isolated Beta vulgaris and Hordeum vulgare protoplasts

    International Nuclear Information System (INIS)

    Bornman, J.F.; Bjoern, L.O.; Bornman, C.H.

    1982-01-01

    Estimates of viability as measured by vital straining with fluorescein diacetate were carried out on freshly isolated and partially aged (16-hour-old) Beta vulgaris and Hordeum vulgare mesophyll protoplasts following irradiation with UV-B. Damage to the photosynthetic system by UV-B was determined by delayed light emission (DLE). In the case of freshly isolated Protoplasts Beta was approximately 30% more susceptible than Hordeum following 3h irradiation, with viability decreasing from 90% to 40%. After storage of protoplasts on ice for 16 h UV-B radiation markedly depressed viability in both species, but in the case of Hordeum there was a substantial initial loss of nearly 70% in viability over the first hour of irradiation. The first 10 min of UV-B radiation decreased the intensity of DLE by 40% without appreciably affecting the decay rate. Longer treatment times did not give a proportional effect so that even after 60 min of UV-B the inhibition did not exceed 60%. This suggested that although the enzyme system responsible for FDA hydrolysis may be partially inactivated (viability was 75-80% as compared with 90% in the control), the UV-B did not penetrate the innermost parts of the chloroplasts, but left some thylakoids undamaged. (orig.)

  12. Untangling nucleotide diversity and evolution of the H genome in polyploid Hordeum and Elymus species based on the single copy of nuclear gene DMC1.

    Directory of Open Access Journals (Sweden)

    Dongfa Sun

    Full Text Available Numerous hybrid and polypoid species are found within the Triticeae. It has been suggested that the H subgenome of allopolyploid Elymus (wheatgrass species originated from diploid Hordeum (barley species, but the role of hybridization between polyploid Elymus and Hordeum has not been studied. It is not clear whether gene flow across polyploid Hordeum and Elymus species has occurred following polyploid speciation. Answering these questions will provide new insights into the formation of these polyploid species, and the potential role of gene flow among polyploid species during polyploid evolution. In order to address these questions, disrupted meiotic cDNA1 (DMC1 data from the allopolyploid StH Elymus are analyzed together with diploid and polyploid Hordeum species. Phylogenetic analysis revealed that the H copies of DMC1 sequence in some Elymus are very close to the H copies of DMC1 sequence in some polyploid Hordeum species, indicating either that the H genome in theses Elymus and polyploid Hordeum species originated from same diploid donor or that gene flow has occurred among them. Our analysis also suggested that the H genomes in Elymus species originated from limited gene pool, while H genomes in Hordeum polyploids have originated from broad gene pools. Nucleotide diversity (π of the DMC1 sequences on H genome from polyploid species (π = 0.02083 in Elymus, π = 0.01680 in polyploid Hordeum is higher than that in diploid Hordeum (π = 0.01488. The estimates of Tajima's D were significantly departure from the equilibrium neutral model at this locus in diploid Hordeum species (P<0.05, suggesting an excess of rare variants in diploid species which may not contribute to the origination of polyploids. Nucleotide diversity (π of the DMC1 sequences in Elymus polyploid species (π = 0.02083 is higher than that in polyploid Hordeum (π = 0.01680, suggesting that the degree of relationships between two parents of a polyploid might be a factor

  13. Chromosomal organization of repetitive DNAs in Hordeum bogdanii and H. brevisubulatum (Poaceae

    Directory of Open Access Journals (Sweden)

    Quanwen Dou

    2016-10-01

    Full Text Available Molecular karyotypes of H. bogdanii Wilensky, 1918 (2n = 14, and H. brevisubulatum Link, 1844 ssp. brevisubulatum (2n = 28, were characterized by physical mapping of several repetitive sequences. A total of 18 repeats, including all possible di- or trinucleotide SSR (simple sequence repeat motifs and satellite DNAs, such as pAs1, 5S rDNA, 45S rDNA, and pSc119.2, were used as probes for fluorescence in situ hybridization on root-tip metaphase chromosomes. Except for the SSR motifs AG, AT and GC, all the repeats we examined produced detectable hybridization signals on chromosomes of both species. A detailed molecular karyotype of the I genome of H. bogdanii is described for the first time, and each repetitive sequence is physically mapped. A high degree of chromosome variation, including aneuploidy and structural changes, was observed in H. brevisubulatum. Although the distribution of repeats in the chromosomes of H. brevisubulatum is different from that of H. bogdanii, similar patterns between the two species imply that the autopolyploid origin of H. brevisubulatum is from a Hordeum species with an I genome. A comparison of the I genome and the other Hordeum genomes, H, Xa and Xu, shows that colocalization of motifs AAC, ACT and CAT and colocalization of motifs AAG and AGG are characteristic of the I genome. In addition, we discuss the evolutionary significance of repeats in the genome during genome differentiation.

  14. QTL mapping provides evidence for lack of association of the avoidance of leaf rust in Hordeum chilense with stomata density

    NARCIS (Netherlands)

    Vaz Patto, M.C.; Rubiales, D.; Martin, A.; Hernandez, P.; Lindhout, W.H.; Niks, R.E.; Stam, P.

    2003-01-01

    In cereals, rust fungi are among the most harmful pathogens. Breeders usually rely on short-lived hypersensitivity resistance. As an alternative, "avoidance" may be a more durable defence mechanism to protect plants to rust fungi. In Hordeum chilense avoidance is based on extensive wax covering of

  15. Characterization and partial purification of beta-1,3-D-glucan (callose) synthase from barley (Hordeum vulgare) leaves

    DEFF Research Database (Denmark)

    Pedersen, L.H.; Jacobsen, S.; Hejgaard, J.

    1993-01-01

    The plasma membrane bound beta-1,3-D-glucan (callose) synthase. assumed to be involved in the resistance to the powdery mildew fungus (Erysiphe graminis f.sp. hordei), was partially purified from a microsomal fraction of green barley leaves (Hordeum vulgare L.). Plasma membranes were enriched...

  16. Separate Location of Parental Chromosomes in Squashed Metaphases of Hybrid between Hordeum vulgare L. and Four Polyploid, Alien Species

    DEFF Research Database (Denmark)

    Jensen, J.; Linde-Laursen, Ib

    1984-01-01

    In 38 squashed, somatic metaphases of four hybrids between diploid Hordeum vulgare and two tetra-and two hexaploid alien species, each of the H. vulgare chromosomes was identifed, and differentiated from the chromosomes of the other parental species, by its Giemsa C-banding pattern. The H. vulgare...

  17. Biosynthesis of the leucine derived α-, β- and γ-hydroxynitrile glucosides in barley (Hordeum vulgare L.)

    DEFF Research Database (Denmark)

    Knoch, Eva; Motawie, Mohammed Saddik; Olsen, Carl Erik

    2016-01-01

    Barley (Hordeum vulgare L.) produces five leucine-derived hydroxynitrile glucosides (HNGs), of which only epiheterodendrin is a cyanogenic glucoside. The four non-cyanogenic HNGs are the β-HNG epidermin and the γ-HNGs osmaronin, dihydroosmaronin and sutherlandin. By analyzing 247 spring barley...

  18. Proteomic response of Hordeum vulgare cv. Tadmor and Hordeum marinum to salinity stress: Similarities and differences between a glycophyte and a halophyte

    Directory of Open Access Journals (Sweden)

    Lucie Maršálová

    2016-08-01

    Full Text Available Response to a high salinity treatment of 300 mM NaCl was studied in a cultivated barley Hordeum vulgare Syrian cultivar Tadmor and in a halophytic wild barley Hordeum marinum. Differential salinity tolerance of H. marinum and H. vulgare is underlied by qualitative and quantitative differences in proteins involved in a variety of biological processes. The major aim was to identify proteins underlying differential salinity tolerance between the two barley species. Analyses of plant water content, osmotic potential and accumulation of proline and dehydrin proteins under high salinity revealed a relatively higher water saturation deficit in H. marinum than in H. vulgare while H. vulgare had lower osmotic potential corresponding with high levels of proline and dehydrins. Analysis of proteins soluble upon boiling isolated from control and salt-treated crown tissues revealed similarities as well as differences between H. marinum and H. vulgare. The similar salinity responses of both barley species lie in enhanced levels of stress-protective proteins such as defence-related proteins from late-embryogenesis abundant (LEA family, several chaperones from heat shock protein (HSP family, and others such as GrpE. However, there have also been found significant differences between H. marinum and H. vulgare salinity response indicating an active stress acclimation in H. marinum while stress damage in H. vulgare. An active acclimation to high salinity in H. marinum is underlined by enhanced levels of several stress-responsive transcription factors from basic leucine zipper (bZIP and nascent polypeptide-associated complex (NAC families. In salt-treated H. marinum, enhanced levels of proteins involved in energy metabolism such as glycolysis, ATP metabolism, and photosynthesis-related proteins indicate an active acclimation to enhanced energy requirements during an establishment of novel plant homeostasis. In contrast, changes at proteome level in salt-treated H

  19. Differential Antioxidative Responses to Water Deficit Among four Barley (Hordeum vulgare L. Genotypes

    Directory of Open Access Journals (Sweden)

    Z Amini

    2013-08-01

    Full Text Available Future climate changes are expected to increase risks of drought, which already represent the most common stress factor for stable barley (Hordeum vulgare L. production in Iran. Up to now, extensive research projects have been done to study effects of drought stress on the antioxidant enzyme activity. While there is a few works of such studies on the field condition. In order to study of water deficit effects on the antioxidant enzymes activities as a secondary stress, we evaluate the effects of mild and severe drought stress on activities of antioxidative enzymes including superoxide dismutases, ascorbate peroxidase, catalase and peroxidase, among four barley genotypes, differing in the capacity to maintain the grain yield under drought condition during beginning on anthesis, kernel watery ripe and late milk stages under field condition. Results showed that drought increased the activity of antioxidant enzymes in all genotypes. At beginning of anthesis, POX activity of Q22 was higher than it in other genotypes ( P

  20. Zinc blotting assay for detection of zinc binding prolamin in barley (Hordeum vulgare) grain

    DEFF Research Database (Denmark)

    Uddin, Mohammad Nasir; Nielsen, Ane Langkilde-Lauesen; Vincze, Eva

    2014-01-01

    In plants, zinc is commonly found bound to proteins. In barley (Hordeum vulgare), major storage proteins are alcohol-soluble prolamins known as hordeins, and some of them have the potential to bind or store zinc. 65Zn overlay and blotting techniques have been widely used for detecting zinc......-binding protein. However, to our knowledge so far this zinc blotting assay has never been applied to detect a prolamin fraction in barley grains. A radioactive zinc (65ZnCl2) blotting technique was optimized to detect zinc-binding prolamins, followed by development of an easy-to-follow nonradioactive colorimetric...... zinc blotting method with a zinc-sensing dye, dithizone. Hordeins were extracted from mature barley grain, separated by SDS-PAGE, blotted on a membrane, renatured, overlaid, and probed with zinc; subsequently, zinc-binding specificity of certain proteins was detected either by autoradiography or color...

  1. Comparison of foliar anatomy of ten bread wheat (triticum, poaceae) and ten barley (hordeum, poaceae) cultivars

    International Nuclear Information System (INIS)

    Ardic, M.; Sezer, O.; Ozgdsd, K.; Yaylaci, O. K.; Koyuncu, O.; Olgun, M.; Bascdftcd, Z. B.; Ayter, N. G.

    2015-01-01

    The aim of this study is to determine anatomical differences and classification of leaf and leaf cell characteristics (cuticle thickness, upper epidermis thickness, lower epidermis thickness, mesophyll thickness, parenchyma thickness and leaf thickness) between 10 bread wheat cultivars (Triticum aestivum L.) and 10 barley cultivars (Hordeum vulgare L.). Classification of leaf characteristics in bread wheat and barley cultivars and relationship between leaf characteristics are made by principal component and correlation analyses. Highest thickness belongs to W8 Mufitbey cultivar in mesophyll and lower epidermis and W1 Sonmez 01 cultivar have the lowest thickness of upper epidermis in bread wheat. In Barley, B1 Ince cultivar has highest leaf thickness mesophyll and parenchyma; lowest thickness of cuticle is included B7 Cumhuriyet 50 cultivar. All other cultivars have homogenous contents of leaf characteristics. (author)

  2. Interkingdom signaling: The role of homoserine lactones in early responses and resistance in barley (Hordeum vulgare L.)

    OpenAIRE

    Rankl, Simone

    2017-01-01

    N-Acyl-D/L-homoserine lactones (AHLs) are produced as microbial signaling compounds during bacterial intra- and inter-specific communication in the rhizosphere. Thus, plants are naturally exposed to these compounds and respond with tissue-specific reactions. In the present study the impact of AHLs on the monocot barley (Hordeum vulgare L.) was investigated. The treatment with C8- and C12- homoserine lactones (HSL) resulted in root and shoot biomass gain as well as in the formation of lat...

  3. Resistance genes in barley (Hordeum vulgare L.) and their identification with molecular markers.

    Science.gov (United States)

    Chełkowski, Jerzy; Tyrka, Mirosław; Sobkiewicz, Andrzej

    2003-01-01

    Current information on barley resistance genes available from scientific papers and on-line databases is summarised. The recent literature contains information on 107 major resistance genes (R genes) against fungal pathogens (excluding powdery mildew), pathogenic viruses and aphids identified in Hordeum vulgare accessions. The highest number of resistance genes was identified against Puccinia hordei, Rhynchosporium secalis, and the viruses BaYMV and BaMMV, with 17, 14 and 13 genes respectively. There is still a lot of confusion regarding symbols for R genes against powdery mildew. Among the 23 loci described to date, two regions Mla and Mlo comprise approximately 31 and 25 alleles. Over 50 R genes have already been localised and over 30 mapped on 7 barley chromosomes. Four barley R genes have been cloned recently: Mlo, Rpg1, Mla1 and Mla6, and their structures (sequences) are available. The paper presents a catalogue of barley resistance gene symbols, their chromosomalocation and the list of available DNA markers useful in characterising cultivars and breeding accessions.

  4. Farmers without borders-genetic structuring in century old barley (Hordeum vulgare).

    Science.gov (United States)

    Forsberg, N E G; Russell, J; Macaulay, M; Leino, M W; Hagenblad, J

    2015-02-01

    The geographic distribution of genetic diversity can reveal the evolutionary history of a species. For crop plants, phylogeographic patterns also indicate how seed has been exchanged and spread in agrarian communities. Such patterns are, however, easily blurred by the intense seed trade, plant improvement and even genebank conservation during the twentieth century, and discerning fine-scale phylogeographic patterns is thus particularly challenging. Using historical crop specimens, these problems are circumvented and we show here how high-throughput genotyping of historical nineteenth century crop specimens can reveal detailed geographic population structure. Thirty-one historical and nine extant accessions of North European landrace barley (Hordeum vulgare L.), in total 231 individuals, were genotyped on a 384 single nucleotide polymorphism assay. The historical material shows constant high levels of within-accession diversity, whereas the extant accessions show more varying levels of diversity and a higher degree of total genotype sharing. Structure, discriminant analysis of principal components and principal component analysis cluster the accessions in latitudinal groups across country borders in Finland, Norway and Sweden. FST statistics indicate strong differentiation between accessions from southern Fennoscandia and accessions from central or northern Fennoscandia, and less differentiation between central and northern accessions. These findings are discussed in the context of contrasting historical records on intense within-country south to north seed movement. Our results suggest that although seeds were traded long distances, long-term cultivation has instead been of locally available, possibly better adapted, genotypes.

  5. Soil fertility status and nutrients provided to spring barley (Hordeum distichon L. by pig slurry

    Directory of Open Access Journals (Sweden)

    Melisa Gómez-Garrido

    2014-03-01

    Full Text Available Nutrient recycling using pig slurry is a common agricultural practice to manage the ever-increasing amounts of wastes from the pig industry. This study was conducted in the southeast of Spain to quantify the enrichments in major (N, P, K, Mg and minor (Zn, Fe, Cu, and Mn nutrients in soils amended with D1-170 kg N ha-1 (European Union legislated dose or D2-340 kg N ha-1, and understand the influence of pig slurry on yield and nutrient uptake in two crop seasons of spring barley (Hordeum distichon L. Compared to control, D2 increased NO3--N by 11.4X to 109 mg kg-1, Olsen-P by 6.9X to 423 mg kg-1, exchange K (2.5X to 1.6 cmol+ kg-1, Mg (1.7X to 1.8 cmol+ kg-1, diethylene-triamine pentaacetic acid (DTPA-Zn (94X to 18.2 mg kg-1, and Fe (2X to 11.3 mg kg-1. Available NO3--N, Olsen-P, and DTPA-Zn have the best correlations with crop yield and nutrient uptake. These results indicate that the assessment of soil fertility status at 1-mo after pig slurry addition provides a good indicator for potential yield and uptake of barley. However, it is suggested that leachates should be monitored to effectively manage potential releases of nitrate and phosphate into the environment.

  6. Binding of paraquat to cell walls of paraquat resistant and susceptible biotypes of Hordeum glaucum

    International Nuclear Information System (INIS)

    Alizadeh, H.M.; Preston, C.; Powles, S.B.

    1997-01-01

    Full text: Paraquat is a widely used, non-selective, light activated contact herbicide acting as a photosystem electron acceptor. Resistance to paraquat in weed species has occurred in Australia and world-wide following extensive use of this herbicide. The mechanism of resistance to paraquat in 'Hordeum glaucum' is correlated with reduced herbicide translocation and may be due to sequestration of herbicide away from its site of action by either binding to cell walls or other means. We measured paraquat binding to a cell wall fraction in resistant and susceptible biotypes of H. glaucum to determine whether differences in binding of paraquat to cell walls could explain herbicide resistance. The cell wall fraction was isolated from leaves of resistant and susceptible biotypes and incubated with 14 C-labelled paraquat. Of the total paraquat - absorbed by a cell wall preparation, about 80% remains strongly bind to the cell wall and doesn't readily exchange with solution in the absence of divalent cations. Divalent cations (Ca 2+ ,putrescine and paraquat) can competitively exchange for paraquat tightly bound to the cell wall. From kinetic experiments it seems that there are two types of binding sites in the cell wall with different affinities for paraquat. No significant differences between cell wall, characteristics of resistant and susceptible biotypes of H. glaucum have been found in any of our experiments. Therefore, increased binding of paraquat to the cell wall appears not to be a mechanism for exclusion of paraquat in resistant biotype

  7. Geography of Genetic Structure in Barley Wild Relative Hordeum vulgare subsp. spontaneum in Jordan.

    Science.gov (United States)

    Thormann, Imke; Reeves, Patrick; Reilley, Ann; Engels, Johannes M M; Lohwasser, Ulrike; Börner, Andreas; Pillen, Klaus; Richards, Christopher M

    2016-01-01

    Informed collecting, conservation, monitoring and utilization of genetic diversity requires knowledge of the distribution and structure of the variation occurring in a species. Hordeum vulgare subsp. spontaneum (K. Koch) Thell., a primary wild relative of barley, is an important source of genetic diversity for barley improvement and co-occurs with the domesticate within the center of origin. We studied the current distribution of genetic diversity and population structure in H. vulgare subsp. spontaneum in Jordan and investigated whether it is correlated with either spatial or climatic variation inferred from publically available climate layers commonly used in conservation and ecogeographical studies. The genetic structure of 32 populations collected in 2012 was analyzed with 37 SSRs. Three distinct genetic clusters were identified. Populations were characterized by admixture and high allelic richness, and genetic diversity was concentrated in the northern part of the study area. Genetic structure, spatial location and climate were not correlated. This may point out a limitation in using large scale climatic data layers to predict genetic diversity, especially as it is applied to regional genetic resources collections in H. vulgare subsp. spontaneum.

  8. Evaluation of barley (hordeum vulgare l.) germplasm for high forage production under salt stress

    International Nuclear Information System (INIS)

    Saleem, A.; Qurainy, F.A.; Akram, N.A.

    2014-01-01

    To explore high biomass producing salt tolerant cultivars of a potential forage crop barley (Hordeum vulgare L.), 30-day old plants of 105 different accessions from different origin were subjected to saline and non-saline (control) conditions for 45 days. Salinity stress (150 mM NaCl) markedly suppressed plant growth (shoot and/or root fresh and dry weights), chlorophyll pigments (a and b), internal CO/sub 2/ concentration, stomatal conductance, rate of transpiration and photosynthesis, while a considerable salt-induced increase was observed in all fluorescence related attributes including efficiency of photosystem-II (Fv/Fm), co-efficient of non-photochemical quenching (QN), photochemical quenching (QP), and non-photochemical quenching (NPQ) in all 105 accessions of barley. The response of all 105 barley accessions to salt stress varied significantly for all the morpho-physiological attributes determined in the present study. Overall, on the basis of shoot and root dry weights, accessions, 4050, 4053, 4056, 4163, 4228, 4229, 4244, 4245, 4290, 4414, 4415, 4427, 4452, Mahali, Jesto, 4165, 4229, 4249, 4405, 4409, 4426, 4456, and Giza 123 were found superior while accessions, 4245, 4158, 4166, 4246, 4406, 4423, 4441, 4442 4447, 4453 and 4458 inferior under saline conditions. (author)

  9. Complete chloroplast genome sequences of Hordeum vulgare, Sorghum bicolor and Agrostis stolonifera, and comparative analyses with other grass genomes

    Science.gov (United States)

    Saski, Christopher; Lee, Seung-Bum; Fjellheim, Siri; Guda, Chittibabu; Jansen, Robert K.; Luo, Hong; Tomkins, Jeffrey; Rognli, Odd Arne; Clarke, Jihong Liu

    2009-01-01

    Comparisons of complete chloroplast genome sequences of Hordeum vulgare, Sorghum bicolor and Agrostis stolonifera to six published grass chloroplast genomes reveal that gene content and order are similar but two microstructural changes have occurred. First, the expansion of the IR at the SSC/IRa boundary that duplicates a portion of the 5′ end of ndhH is restricted to the three genera of the subfamily Pooideae (Agrostis, Hordeum and Triticum). Second, a 6 bp deletion in ndhK is shared by Agrostis, Hordeum, Oryza and Triticum, and this event supports the sister relationship between the subfamilies Erhartoideae and Pooideae. Repeat analysis identified 19–37 direct and inverted repeats 30 bp or longer with a sequence identity of at least 90%. Seventeen of the 26 shared repeats are found in all the grass chloroplast genomes examined and are located in the same genes or intergenic spacer (IGS) regions. Examination of simple sequence repeats (SSRs) identified 16–21 potential polymorphic SSRs. Five IGS regions have 100% sequence identity among Zea mays, Saccharum officinarum and Sorghum bicolor, whereas no spacer regions were identical among Oryza sativa, Triticum aestivum, H. vulgare and A. stolonifera despite their close phylogenetic relationship. Alignment of EST sequences and DNA coding sequences identified six C–U conversions in both Sorghum bicolor and H. vulgare but only one in A. stolonifera. Phylogenetic trees based on DNA sequences of 61 protein-coding genes of 38 taxa using both maximum parsimony and likelihood methods provide moderate support for a sister relationship between the subfamilies Erhartoideae and Pooideae. PMID:17534593

  10. The Influence of Processing by Impulse Pressure on the Productivity of the Don Barley (Hordeum vulgare L.

    Directory of Open Access Journals (Sweden)

    Pavlova Violetta Aleksandrovna

    2014-04-01

    Full Text Available Plant productivity is the important indicator, which determines the amount of yield. The productivity of plants depends on the number of bruchids per plant and on the weight of 1000 bruchids. The article studies the influence of impulse pressure of various magnitudes on plant productivity of Don barley (Hordeum vulgare L.. It was found that the pressure of 17 MPa was the most effective for increasing the productivity. Impulse pressure of other magnitudes also had influence on the productivity of Don barley.

  11. Identification of two key genes controlling chill haze stability of beer in barley (Hordeum vulgare L).

    Science.gov (United States)

    Ye, Lingzhen; Huang, Yuqing; Dai, Fei; Ning, Huajiang; Li, Chengdao; Zhou, Meixue; Zhang, Guoping

    2015-06-11

    In bright beer, haze formation is a serious quality problem, degrading beer quality and reducing its shelf life. The quality of barley (Hordeum vulgare L) malt, as the main raw material for beer brewing, largely affects the colloidal stability of beer. In this study, the genetic mechanism of the factors affecting beer haze stability in barley was studied. Quantitative trait loci (QTL) analysis of alcohol chill haze (ACH) in beer was carried out using a Franklin/Yerong double haploid (DH) population. One QTL, named as qACH, was detected for ACH, and it was located on the position of about 108 cM in chromosome 4H and can explain about 20 % of the phenotypic variation. Two key haze active proteins, BATI-CMb and BATI-CMd were identified by proteomics analysis. Bioinformatics analysis showed that BATI-CMb and BATI-CMd had the same position as qACH in the chromosome. It may be deduced that BATI-CMb and BATI-CMd are candidate genes for qACH, controlling colloidal stability of beer. Polymorphism comparison between Yerong and Franklin in the nucleotide and amino acid sequence of BATI-CMb and BATI-CMd detected the corresponding gene specific markers, which could be used in marker-assisted selection for malt barley breeding. We identified a novel QTL, qACH controlling chill haze of beer, and two key haze active proteins, BATI-CMb and BATI-CMd. And further analysis showed that BATI-CMb and BATI-CMd might be the candidate genes associated with beer chill haze.

  12. Dawn and Dusk Set States of the Circadian Oscillator in Sprouting Barley (Hordeum vulgare Seedlings.

    Directory of Open Access Journals (Sweden)

    Weiwei Deng

    Full Text Available The plant circadian clock is an internal timekeeper that coordinates biological processes with daily changes in the external environment. The transcript levels of clock genes, which oscillate to control circadian outputs, were examined during early seedling development in barley (Hordeum vulgare, a model for temperate cereal crops. Oscillations of clock gene transcript levels do not occur in barley seedlings grown in darkness or constant light but were observed with day-night cycles. A dark-to-light transition influenced transcript levels of some clock genes but triggered only weak oscillations of gene expression, whereas a light-to-dark transition triggered robust oscillations. Single light pulses of 6, 12 or 18 hours induced robust oscillations. The light-to-dark transition was the primary determinant of the timing of subsequent peaks of clock gene expression. After the light-to-dark transition the timing of peak transcript levels of clock gene also varied depending on the length of the preceding light pulse. Thus, a single photoperiod can trigger initiation of photoperiod-dependent circadian rhythms in barley seedlings. Photoperiod-specific rhythms of clock gene expression were observed in two week old barley plants. Changing the timing of dusk altered clock gene expression patterns within a single day, showing that alteration of circadian oscillator behaviour is amongst the most rapid molecular responses to changing photoperiod in barley. A barley EARLY FLOWERING3 mutant, which exhibits rapid photoperiod-insensitive flowering behaviour, does not establish clock rhythms in response to a single photoperiod. The data presented show that dawn and dusk cues are important signals for setting the state of the circadian oscillator during early development of barley and that the circadian oscillator of barley exhibits photoperiod-dependent oscillation states.

  13. Structure of Hordeum vulgare NADPH-dependent thioredoxin reductase 2. Unwinding the reaction mechanism

    Energy Technology Data Exchange (ETDEWEB)

    Kirkensgaard, Kristine G. [Carlsberg Laboratory (Denmark); Enzyme and Protein Chemistry, Department of Systems BioIogy, Technical University of Denmark (Denmark); Hägglund, Per; Finnie, Christine; Svensson, Birte [Enzyme and Protein Chemistry, Department of Systems BioIogy, Technical University of Denmark (Denmark); Henriksen, Anette, E-mail: anette@crc.dk [Carlsberg Laboratory (Denmark)

    2009-09-01

    The first crystal structure of a cereal NTR, a protein involved in seed development and germination, has been determined. The structure is in a conformation that excludes NADPH binding and indicates that a domain reorientation facilitated by Trx binding precedes NADPH binding in the reaction mechanism. Thioredoxins (Trxs) are protein disulfide reductases that regulate the intracellular redox environment and are important for seed germination in plants. Trxs are in turn regulated by NADPH-dependent thioredoxin reductases (NTRs), which provide reducing equivalents to Trx using NADPH to recycle Trxs to the active form. Here, the first crystal structure of a cereal NTR, HvNTR2 from Hordeum vulgare (barley), is presented, which is also the first structure of a monocot plant NTR. The structure was determined at 2.6 Å resolution and refined to an R{sub cryst} of 19.0% and an R{sub free} of 23.8%. The dimeric protein is structurally similar to the structures of AtNTR-B from Arabidopsis thaliana and other known low-molecular-weight NTRs. However, the relative position of the two NTR cofactor-binding domains, the FAD and the NADPH domains, is not the same. The NADPH domain is rotated by 25° and bent by a 38% closure relative to the FAD domain in comparison with AtNTR-B. The structure may represent an intermediate between the two conformations described previously: the flavin-oxidizing (FO) and the flavin-reducing (FR) conformations. Here, analysis of interdomain contacts as well as phylogenetic studies lead to the proposal of a new reaction scheme in which NTR–Trx interactions mediate the FO to FR transformation.

  14. High-throughput transcriptome analysis of barley (Hordeum vulgare) exposed to excessive boron.

    Science.gov (United States)

    Tombuloglu, Guzin; Tombuloglu, Huseyin; Sakcali, M Serdal; Unver, Turgay

    2015-02-15

    Boron (B) is an essential micronutrient for optimum plant growth. However, above certain threshold B is toxic and causes yield loss in agricultural lands. While a number of studies were conducted to understand B tolerance mechanism, a transcriptome-wide approach for B tolerant barley is performed here for the first time. A high-throughput RNA-Seq (cDNA) sequencing technology (Illumina) was used with barley (Hordeum vulgare), yielding 208 million clean reads. In total, 256,874 unigenes were generated and assigned to known peptide databases: Gene Ontology (GO) (99,043), Swiss-Prot (38,266), Clusters of Orthologous Groups (COG) (26,250), and the Kyoto Encyclopedia of Genes and Genomes (KEGG) (36,860), as determined by BLASTx search. According to the digital gene expression (DGE) analyses, 16% and 17% of the transcripts were found to be differentially regulated in root and leaf tissues, respectively. Most of them were involved in cell wall, stress response, membrane, protein kinase and transporter mechanisms. Some of the genes detected as highly expressed in root tissue are phospholipases, predicted divalent heavy-metal cation transporters, formin-like proteins and calmodulin/Ca(2+)-binding proteins. In addition, chitin-binding lectin precursor, ubiquitin carboxyl-terminal hydrolase, and serine/threonine-protein kinase AFC2 genes were indicated to be highly regulated in leaf tissue upon excess B treatment. Some pathways, such as the Ca(2+)-calmodulin system, are activated in response to B toxicity. The differential regulation of 10 transcripts was confirmed by qRT-PCR, revealing the tissue-specific responses against B toxicity and their putative function in B-tolerance mechanisms. Copyright © 2014. Published by Elsevier B.V.

  15. Structure of Hordeum vulgare NADPH-dependent thioredoxin reductase 2. Unwinding the reaction mechanism

    International Nuclear Information System (INIS)

    Kirkensgaard, Kristine G.; Hägglund, Per; Finnie, Christine; Svensson, Birte; Henriksen, Anette

    2009-01-01

    The first crystal structure of a cereal NTR, a protein involved in seed development and germination, has been determined. The structure is in a conformation that excludes NADPH binding and indicates that a domain reorientation facilitated by Trx binding precedes NADPH binding in the reaction mechanism. Thioredoxins (Trxs) are protein disulfide reductases that regulate the intracellular redox environment and are important for seed germination in plants. Trxs are in turn regulated by NADPH-dependent thioredoxin reductases (NTRs), which provide reducing equivalents to Trx using NADPH to recycle Trxs to the active form. Here, the first crystal structure of a cereal NTR, HvNTR2 from Hordeum vulgare (barley), is presented, which is also the first structure of a monocot plant NTR. The structure was determined at 2.6 Å resolution and refined to an R cryst of 19.0% and an R free of 23.8%. The dimeric protein is structurally similar to the structures of AtNTR-B from Arabidopsis thaliana and other known low-molecular-weight NTRs. However, the relative position of the two NTR cofactor-binding domains, the FAD and the NADPH domains, is not the same. The NADPH domain is rotated by 25° and bent by a 38% closure relative to the FAD domain in comparison with AtNTR-B. The structure may represent an intermediate between the two conformations described previously: the flavin-oxidizing (FO) and the flavin-reducing (FR) conformations. Here, analysis of interdomain contacts as well as phylogenetic studies lead to the proposal of a new reaction scheme in which NTR–Trx interactions mediate the FO to FR transformation

  16. Characterization of Gene Candidates for Vacuolar Sodium Transport from Hordeum Vulgare

    KAUST Repository

    Scheu, Arne Hagen August

    2017-05-01

    Soil salinity is a major abiotic stress for land plants, and multiple mechanisms of salt tolerance have evolved. Tissue tolerance is one of these mechanisms, which involves the sequestration of sodium into the vacuole to retain low cytosolic sodium concentrations. This enables the plant to maintain cellular functions, and ultimately maintain growth and yield. However, the molecular components involved in tissue tolerance remain elusive. Several candidate genes for vacuolar sodium sequestration have recently been identified by proteome analysis of vacuolar membranes purified from the salt-tolerant cereal Hordeum vulgare (barley). In this study, I aimed to characterize these candidates in more detail. I successfully cloned coding sequences for the majority of candidate genes with primers designed based on the barley reference genome sequence. During the course of this study a newer genome sequence with improved annotations was published, to which I also compared my observations. To study the candidate genes, I used the heterologous expression system Saccharomyces cerevisiae (yeast). I used several salt sensitive yeast strains (deficient in intrinsic sodium transporters) to test whether the candidate genes would affect their salt tolerance by mediating the sequestration of sodium into the yeast vacuole. I observed a reduction in growth upon expression for several of the gene candidate under salt-stress conditions. However, confocal microscopy suggests that most gene products are subject to degradation, and did not localize to the vacuolar membrane (tonoplast). Therefore, growth effects cannot be linked to protein function without further evidence. Various potential causes are discussed, including inaccuracies in the genome resource used as reference for primer design and issues inherent to the model system. Finally, I make suggestions on how to proceed to further characterize the candidate genes and hopefully identify novel sodium transporters from barley.

  17. Genome-Wide Association Mapping of Stem Rust Resistance in Hordeum vulgare subsp. spontaneum.

    Science.gov (United States)

    Sallam, Ahmad H; Tyagi, Priyanka; Brown-Guedira, Gina; Muehlbauer, Gary J; Hulse, Alex; Steffenson, Brian J

    2017-10-05

    Stem rust was one of the most devastating diseases of barley in North America. Through the deployment of cultivars with the resistance gene Rpg1 , losses to stem rust have been minimal over the past 70 yr. However, there exist both domestic (QCCJB) and foreign (TTKSK aka isolate Ug99) pathotypes with virulence for this important gene. To identify new sources of stem rust resistance for barley, we evaluated the Wild Barley Diversity Collection (WBDC) (314 ecogeographically diverse accessions of Hordeum vulgare subsp. spontaneum ) for seedling resistance to four pathotypes (TTKSK, QCCJB, MCCFC, and HKHJC) of the wheat stem rust pathogen ( Puccinia graminis f. sp. tritici , Pgt ) and one isolate (92-MN-90) of the rye stem rust pathogen ( P. graminis f. sp. secalis , Pgs ). Based on a coefficient of infection, the frequency of resistance in the WBDC was low ranging from 0.6% with HKHJC to 19.4% with 92-MN-90. None of the accessions was resistant to all five cultures of P. graminis A genome-wide association study (GWAS) was conducted to map stem rust resistance loci using 50,842 single-nucleotide polymorphic markers generated by genotype-by-sequencing and ordered using the new barley reference genome assembly. After proper accounting for genetic relatedness and structure among accessions, 45 quantitative trait loci were identified for resistance to P. graminis across all seven barley chromosomes. Three novel loci associated with resistance to TTKSK, QCCJB, MCCFC, and 92-MN-90 were identified on chromosomes 5H and 7H, and two novel loci associated with resistance to HKHJC were identified on chromosomes 1H and 3H. These novel alleles will enhance the diversity of resistance available for cultivated barley. Copyright © 2017 Sallam et al.

  18. Detection of QTLs for seedling characteristics in barley (Hordeum vulgare L.) grown under hydroponic culture condition.

    Science.gov (United States)

    Wang, Qifei; Sun, Genlou; Ren, Xifeng; Wang, Jibin; Du, Binbin; Li, Chengdao; Sun, Dongfa

    2017-11-07

    Seedling characteristics play significant roles in the growth and development of barley (Hordeum vulgare L.), including stable stand establishment, water and nutrients uptake, biotic resistance and abiotic stresses, and can influence yield and quality. However, the genetic mechanisms underlying seedling characteristics in barley are largely unknown and little research has been done. In the present work, 21 seedling-related characteristics are assessed in a barley double haploid (DH) population, grown under hydroponic conditions. Of them, leaf age (LAG), shoot height (SH), maximum root length (MRL), main root number (MRN) and seedling fresh weight (SFW) were investigated at the 13th, 20th, 27th, and 34th day after germination. The objectives were to identify quantitative trait loci (QTLs) underlying these seedling characteristics using a high-density linkage map and to reveal the QTL expression pattern by comparing the QTLs among four different seedling growth stages. A total of 70 QTLs were distributed over all chromosomes except 4H, and, individually, accounted for 5.01%-77.78% of phenotypic variation. Out of the 70 detected QTLs, 23 showed a major effect on 14 seedling-related characteristics. Ten co-localized chromosomal regions on 2H (five regions), 3H (two regions) and 7H (three regions) involved 39 QTLs (55.71%), each simultaneously influenced more than one trait. Meanwhile, 9 co-localized genomic regions involving 22 QTLs for five seedling characteristics (LAG, SH, MRL, MRN and SFW) at the 13th, 20th, 27th and 34th day-old seedling were common for two or more growth stages of seedling. QTL in the vicinity of Vrs1 locus on chromosome 2H with the favorable alleles from Huadamai 6 was found to have the largest main effects on multiple seedling-related traits. Six QTL cluster regions associated with 16 seedling-related characteristics were observed on chromosome 2H, 3H and 7H. The majority of the 29 regions identified for five seedling characteristics were

  19. Molecular dynamics simulations revealed structural differences among WRKY domain-DNA interaction in barley (Hordeum vulgare).

    Science.gov (United States)

    Pandey, Bharati; Grover, Abhinav; Sharma, Pradeep

    2018-02-12

    The WRKY transcription factors are a class of DNA-binding proteins involved in diverse plant processes play critical roles in response to abiotic and biotic stresses. Genome-wide divergence analysis of WRKY gene family in Hordeum vulgare provided a framework for molecular evolution and functional roles. So far, the crystal structure of WRKY from barley has not been resolved; moreover, knowledge of the three-dimensional structure of WRKY domain is pre-requisites for exploring the protein-DNA recognition mechanisms. Homology modelling based approach was used to generate structures for WRKY DNA binding domain (DBD) and its variants using AtWRKY1 as a template. Finally, the stability and conformational changes of the generated model in unbound and bound form was examined through atomistic molecular dynamics (MD) simulations for 100 ns time period. In this study, we investigated the comparative binding pattern of WRKY domain and its variants with W-box cis-regulatory element using molecular docking and dynamics (MD) simulations assays. The atomic insight into WRKY domain exhibited significant variation in the intermolecular hydrogen bonding pattern, leading to the structural anomalies in the variant type and differences in the DNA-binding specificities. Based on the MD analysis, residual contribution and interaction contour, wild-type WRKY (HvWRKY46) were found to interact with DNA through highly conserved heptapeptide in the pre- and post-MD simulated complexes, whereas heptapeptide interaction with DNA was missing in variants (I and II) in post-MD complexes. Consequently, through principal component analysis, wild-type WRKY was also found to be more stable by obscuring a reduced conformational space than the variant I (HvWRKY34). Lastly, high binding free energy for wild-type and variant II allowed us to conclude that wild-type WRKY-DNA complex was more stable relative to variants I. The results of our study revealed complete dynamic and structural information

  20. Tolerance of Hordeum marinum accessions to O2 deficiency, salinity and these stresses combined

    Science.gov (United States)

    Malik, Al Imran; English, Jeremy Parker; Colmer, Timothy David

    2009-01-01

    Background and Aims When root-zone O2 deficiency occurs together with salinity, regulation of shoot ion concentrations is compromised even more than under salinity alone. Tolerance was evaluated amongst 34 accessions of Hordeum marinum, a wild species in the Triticeae, to combined salinity and root-zone O2 deficiency. Interest in H. marinum arises from the potential to use it as a donor for abiotic stress tolerance into wheat. Methods Two batches of 17 H. marinum accessions, from (1) the Nordic Gene Bank and (2) the wheat belt of Western Australia, were exposed to 0·2 or 200 mol m−3 NaCl in aerated or stagnant nutrient solution for 28–29 d. Wheat (Triticum aestivum) was included as a sensitive check species. Growth, root porosity, root radial O2 loss (ROL) and leaf ion (Na+, K+, Cl−) concentrations were determined. Key Results Owing to space constraints, this report is focused mainly on the accessions from the Nordic Gene Bank. The 17 accessions varied in tolerance; relative growth rate was reduced by 2–38 % in stagnant solution, by 8–42 % in saline solution (aerated) and by 39–71 % in stagnant plus saline treatment. When in stagnant solution, porosity of adventitious roots was 24–33 %; salinity decreased the root porosity in some accessions, but had no effect in others. Roots grown in stagnant solution formed a barrier to ROL, but variation existed amongst accessions in apparent barrier ‘strength’. Leaf Na+ concentration was 142–692 µmol g−1 d. wt for plants in saline solution (aerated), and only increased to 247–748 µmol g−1 d. wt in the stagnant plus saline treatment. Leaf Cl− also showed only small effects of stagnant plus saline treatment, compared with saline alone. In comparison with H. marinum, wheat was more adversely affected by each stress alone, and particularly when combined; growth reductions were greater, adventitious root porosity was 21 %, it lacked a barrier to ROL, leaf K+ declined to lower levels, and leaf Na+ and

  1. Differential responses of two Egyptian barley (Hordeum vulgare L.) cultivars to salt stress.

    Science.gov (United States)

    Elsawy, Hayam I A; Mekawy, Ahmad Mohammad M; Elhity, Mahmoud A; Abdel-Dayem, Sherif M; Abdelaziz, Maha Nagy; Assaha, Dekoum V M; Ueda, Akihiro; Saneoka, Hirofumi

    2018-06-01

    Although barley (Hordeum vulgare L.) is considered a salt tolerant crop species, productivity of barley is affected differently by ionic, osmotic, and oxidative stresses resulting from a salty rhizosphere. The current study was conducted to elucidate the mechanism of salt tolerance in two barley cultivars, Giza128 and Giza126. The two cultivars were exposed to 200 mM NaCl hydroponically for 12 days. Although both cultivars accumulated a large amount of Na + in their leaves with similar concentrations, the growth of Giza128 was much better than that of Giza126, as measured by maintaining a higher dry weight, relative growth rate, leaf area, and plant height. To ascertain the underlying mechanisms of this differential tolerance, first, the relative expression patterns of the genes encoding Na + /H + antiporters (NHX) and the associated proton pumps (V-PPase and V-ATPase) as well as the gene encoding the plasma membrane PM H + -ATPase were analyzed in leaf tissues. Salt stress induced higher HvNHX1 expression in Giza128 (3.3-fold) than in Giza126 (1.9-fold), whereas the expression of the other two genes, HvNHX2 and HvNHX3, showed no induction in either cultivar. The expression of HvHVP1 and HvHVA was higher in Giza128 (3.8- and 2.1-fold, respectively) than in Giza126 (1.6- and 1.1-fold, respectively). The expression of the PM H + -ATPase (ha1) gene was induced more in Giza128 (8.8-fold) than in Giza126 (1.8-fold). Second, the capacity for ROS detoxification was assessed using the oxidative stress biomarkers electrolyte leakage ratio (ELR) and the concentrations of malondialdehyde (MDA) and hydrogen peroxide (H 2 O 2 ), and these parameters sharply increased in Giza126 leaves by 66.5%, 42.8% and 50.0%, respectively, compared with those in Giza128 leaves. The antioxidant enzyme (CAT, APX, sPOD, GR, and SOD) activities were significantly elevated by salt treatment in Giza128 leaves, whereas in Giza126, these activities were not significantly altered. Overall, the

  2. Progenitor-derivative relationships of Hordeum polyploids (Poaceae, Triticeae inferred from sequences of TOPO6, a nuclear low-copy gene region.

    Directory of Open Access Journals (Sweden)

    Jonathan Brassac

    Full Text Available Polyploidization is a major mechanism of speciation in plants. Within the barley genus Hordeum, approximately half of the taxa are polyploids. While for diploid species a good hypothesis of phylogenetic relationships exists, there is little information available for the polyploids (4×, 6× of Hordeum. Relationships among all 33 diploid and polyploid Hordeum species were analyzed with the low-copy nuclear marker region TOPO6 for 341 Hordeum individuals and eight outgroup species. PCR products were either directly sequenced or cloned and on average 12 clones per individual were included in phylogenetic analyses. In most diploid Hordeum species TOPO6 is probably a single-copy locus. Most sequences found in polyploid individuals phylogenetically cluster together with sequences derived from diploid species and thus allow the identification of parental taxa of polyploids. Four groups of sequences occurring only in polyploid taxa are interpreted as footprints of extinct diploid taxa, which contributed to allopolyploid evolution. Our analysis identifies three key species involved in the evolution of the American polyploids of the genus. (i All but one of the American tetraploids have a TOPO6 copy originating from the Central Asian diploid H. roshevitzii, the second copy clustering with different American diploid species. (ii All hexaploid species from the New World have a copy of an extinct close relative of H. californicum and (iii possess the TOPO6 sequence pattern of tetraploid H. jubatum, each with an additional copy derived from different American diploids. Tetraploid H. bulbosum is an autopolyploid, while the assumed autopolyploid H. brevisubulatum (4×, 6× was identified as allopolyploid throughout most of its distribution area. The use of a proof-reading DNA polymerase in PCR reduced the proportion of chimerical sequences in polyploids in comparison to Taq polymerase.

  3. Development of cost-effective Hordeum chilense DNA markers: molecular aids for marker-assisted cereal breeding.

    Science.gov (United States)

    Hernández, P; Dorado, G; Ramírez, M C; Laurie, D A; Snape, J W; Martín, A

    2003-01-01

    Hordeum chilense is a potential source of useful genes for wheat breeding. The use of this wild species to increase genetic variation in wheat will be greatly facilitated by marker-assisted introgression. In recent years, the search for the most suitable DNA marker system for tagging H. chilense genomic regions in a wheat background has lead to the development of RAPD and SCAR markers for this species. RAPDs represent an easy way of quickly generating suitable introgression markers, but their use is limited in heterogeneous wheat genetic backgrounds. SCARs are more specific assays, suitable for automatation or multiplexing. Direct sequencing of RAPD products is a cost-effective approach that reduces labour and costs for SCAR development. The use of SSR and STS primers originally developed for wheat and barley are additional sources of genetic markers. Practical applications of the different marker approaches for obtaining derived introgression products are described.

  4. Cytogenetic effect of low dose gamma-radiation in Hordeum vulgare seedlings: non-linear dose-effect relationship.

    Science.gov (United States)

    Geras'kin, Stanislav A; Oudalova, Alla A; Kim, Jin Kyu; Dikarev, Vladimir G; Dikareva, Nina S

    2007-03-01

    The induction of chromosome aberrations in Hordeum vulgare germinated seeds was studied after ionizing irradiation with doses in the range of 10-1,000 mGy. The relationship between the frequency of aberrant cells and the absorbed dose was found to be nonlinear. A dose-independent plateau in the dose range from about 50 to 500 mGy was observed, where the level of cytogenetic damage was significantly different from the spontaneous level. The comparison of the goodness of the experimental data fitting with mathematical models of different complexity, using the most common quantitative criteria, demonstrated the advantage of a piecewise linear model over linear and polynomial models in approximating the frequency of cytogenetical disturbances. The results of the study support the hypothesis of indirect mechanisms of mutagenesis induced by low doses. Fundamental and applied implications of these findings are discussed.

  5. Variation in the leaf sodium content of the Hordeum vulgare (barley) cultivar Maythorpe and its derived mutant cv. Golden Promise

    International Nuclear Information System (INIS)

    Forster, B.P.; Pakniyat, H.; Macaulay, M.; Matheson, W.; Phillips, M.S.; Thomas, W.T.B.; Powell, W.

    1994-01-01

    Tests for shoot and root sodium content were carried out on various barley cultivars (Hordeum vulgare) and experimental lines including wild barley (H. spontaneum) and derivatives. Lines were grown in hydroculture with and without the addition of salt (NaCl), and sodium concentrations in shoots and roots were determined. Variation in shoot sodium content was found between the various lines; in contrast, no significant differences were found between the lines tested for root sodium content. The most significant finding was the variation in shoot sodium content between the two cultivars Golden Promise and Maythorpe. Golden Promise is a direct gamma-ray induced mutant of the cultivar Maythorpe and the reduced shoot sodium content of Golden Promise can be attributed to radiation treatment. (author)

  6. Nitrogen uptake by Azospirillum brasilense inoculated barley (Hordeum vulgare L.) as influenced by N and P fertilization

    International Nuclear Information System (INIS)

    Negi, Mahima; Tilak, K.V.B.R.; Sachdev, M.S.

    1991-01-01

    Response of barley (Hordeum vulgare L.) in a sandy-loam soil under potted conditions revealed that application of nitrogen and phosphorus increased the population of Azospirillium in the barley rhizosphere. A two fold increase was observed in the Azospirillium population at 80 days compared to that at 40 days of plant growth. The unsterilized inoculated roots had more population than the surface sterilized inoculated roots. Increased drymatter production of barley was obtained in A. brasilense inoculated N 0 P 1 (0 kg N and 30 kg P 2 O 5 ha -1 ) treatment than uninoculated control. Also N and P uptake was higher in A. brasilense inoculated plants in the presence of both N and P fertilizers. The 15 N data revealed that at harvest nearly 36 per cent of the total N uptake was from the nitrogen fixed by A. brasilense irrespective of P treatment. (author). 16 refs., 4 tabs

  7. Catabolism of (+/-)-abscisic acid by excised leaves of Hordeum vulgare L. cv Dyan and its modification by chemical and environmental factors

    International Nuclear Information System (INIS)

    Cowan, A.K.; Railton, I.D.

    1987-01-01

    Excised light-grown leaves and etiolated leaves of Hordeum vulgare L. cv Dyan catabolized applied (+/-)-[2- 14 C]abscisic acid ([+/-]-[2- 14 C]ABA) to phaseic acid (PA), dihydrophaseic acid (DPA), and 2'-hydroxymethyl ABA (2'-HMABA). Identification of these catabolites was made by microchemical methods and by combined capillary gas chromatography-mass spectrometry (GC-MS) following high dose feeds of nonlabeled substrate to leaves. Circular dichroism analysis revealed that 2'-HMABA was derived from the (-) enantiomer of ABA. Refeeding studies were used to confirm the catabolic route. The methyl ester of (+/-)-[2 14 C]-ABA was hydrolyzed efficiently by light-grown leaves of H. vulgare. Leaf age played a significant role in (+/-)-ABA catabolism, with younger leaves being less able than their older counterparts to catabolize this compound. The catabolism of (+/-)-ABA was inhibited markedly in water-stressed Hordeum leaves which was characterized by a decreased incorporation of label into 2'-HMABA, DPA, and conjugates. The specific, mixed function oxidase inhibitor, ancymidol, did not inhibit, dramatically (+/-)-ABA catabolism in light-grown leaves of Hordeum whereas the 80s ribosome, translational inhibitor, cycloheximide, inhibited this process markedly. The 70s ribosome translational inhibitors, lincomycin and chloramphenicol, were less effective than cycloheximide in inhibiting (+/-)-ABA catabolism, implying that cytoplasmic protein synthesis is necessary for the catabolism of (+/-)-ABA in Hordeum leaves whereas chloroplast protein synthesis plays only a minor role. This further suggests that the enzymes involved in (+/-)-ABA catabolism in this plant are cytoplasmically synthesized and are turned-over rapidly, although the enzyme responsible for glycosylating (+/-)-ABA itself appeared to be stable

  8. Resistance of Hordeum chilense against loose smuts of wheat and barley (Ustilago tritici and U. nuda) and its expression in amphiploids with wheat

    OpenAIRE

    Rubiales, Diego; Moral, Ana

    2011-01-01

    Hordeum chilense is wild barley with high potential for cereal breeding purposes given its high crossability with other members of the Triticeae tribe. It is resistant to loose smuts of wheat (Ustilago tritici). The resistance is expressed in xTritordeum amphipoids, offering perspectives for its utilization both in tritordeum breeding and for its transfer to wheat. H. chilense and tritordeums are also resistant to barley loose smut (U. nuda). © 2010 Blackwell Verlag GmbH.

  9. Bioaccumulation of cadmium by spring barley (Hordeum vulgare L. and its effect on selected physiological and morphological parameters

    Directory of Open Access Journals (Sweden)

    Miriama Kopernická

    2016-01-01

    Full Text Available Heavy metals and other toxic elements in the environment, mainly located in soil and groundwater, have a significant effect on plant and its productivity that has a huge attention in recent years. Accumulation of heavy metals in soil cause toxicity to plants, and contaminate the food chain. The industrial areas, as well as developing countries have been contaminated with high concentration of heavy metals. Main sources of contamination are mining and other industrial processes, as well as military and or lanfills, sludge dumps or waste disposal sites. The heavy metals are very dangerous to environment and pose serious danger to public health by entering throught the food chain or into drinking water. Phytoextraction is one way how to remove the contaminants from soil by plants. Phytoextraction of heavy metals is a technology that has been studied for several years. It is more ecological and cheaper way how to clean our environment.Several plant species are known becauce they hyperaccumulate a high contents of metals from the soil. The accumulators are mainly herbaceous species, crops and nowadays angiosperm trees with a high growth such as poplars or willows. We have focused on the determination of some morphological (lenght and weight of roots and biomass and physiological (contents of dry mass and number of lief stomata characteristics and the determination of the bioaccumulation factor and the translocation factor of cadmium by spring barley (Hordeum vulgare L.. Imprints of leaves were evaluated using an optical microscope Axiostar Plus, Carl Zeiss, lens CP Achromat 40x/0.65, eyepiece PI 10x / 18, Canon Utilities Software Zoom Browser EX 4.6 and hardware Acer Travel Mate 4600, Canon Power Shot A95. The density of stomata was evaluated on an area of 1 mm2. Samples of the dried plants (leaves and roots were mineralized by acid digestion using microwave digestion device MARS X - press 5. The end of determination to obtain the cadmium content was

  10. Variation of Qingke (Hordeum vulgare linn.var.nudum Hook.f) induced by space flight treatment

    International Nuclear Information System (INIS)

    Li Xin; Peng Zhengsong; Yang Jun

    2007-01-01

    108 Dry seeds of Qingke (Hordeum vulgate linn. var. nudum Hook. f) were carried into space by recoverable satellite. after wards, the seeds were germinated into 108 seedlings at room temperature, and root tips were observed with Night microscope, and results and normal mitotic division was found without microkemel at interphase or chromosome bridges at anaphase, which means that chromosomal structure change didn't occur in Qingke seeds during space flight. To investigate whether there were morphology variations taken place, the seedlings were transplanted into field and managed normal. All of plants grew as strong as normal Qingke plants (CK) by eye abservation, except two plants showed abnormal inflorescence morphology, which had two spikes on one tiller. 21 SSR markers on 7 linkage groups were used to analysis the polymorphism of genomic DNA for these Qingke plants. No polymorphism was detected with 20 SSR markers among 63 plants investigated. But varied electrophoretic bands were tested in 10 plants using the marker HVM54 on chromosome 2H, and all the 10 plants showed uniform electrophoretypes. It was concluded that the DNA of the Qingke could be changed during space flight. (authors)

  11. Barley (Hordeum vulgare) circadian clock genes can respond rapidly to temperature in an EARLY FLOWERING 3-dependent manner

    Science.gov (United States)

    Ford, Brett; Deng, Weiwei; Clausen, Jenni; Oliver, Sandra; Boden, Scott; Hemming, Megan; Trevaskis, Ben

    2016-01-01

    An increase in global temperatures will impact future crop yields. In the cereal crops wheat and barley, high temperatures accelerate reproductive development, reducing the number of grains per plant and final grain yield. Despite this relationship between temperature and cereal yield, it is not clear what genes and molecular pathways mediate the developmental response to increased temperatures. The plant circadian clock can respond to changes in temperature and is important for photoperiod-dependent flowering, and so is a potential mechanism controlling temperature responses in cereal crops. This study examines the relationship between temperature, the circadian clock, and the expression of flowering-time genes in barley (Hordeum vulgare), a crop model for temperate cereals. Transcript levels of barley core circadian clock genes were assayed over a range of temperatures. Transcript levels of core clock genes CCA1, GI, PRR59, PRR73, PRR95, and LUX are increased at higher temperatures. CCA1 and PRR73 respond rapidly to a decrease in temperature whereas GI and PRR59 respond rapidly to an increase in temperature. The response of GI and the PRR genes to changes in temperature is lost in the elf3 mutant indicating that their response to temperature may be dependent on a functional ELF3 gene. PMID:27580625

  12. Long-term agricultural fertilization alters arbuscular mycorrhizal fungal community composition and barley (Hordeum vulgare) mycorrhizal carbon and phosphorus exchange.

    Science.gov (United States)

    Williams, Alwyn; Manoharan, Lokeshwaran; Rosenstock, Nicholas P; Olsson, Pål Axel; Hedlund, Katarina

    2017-01-01

    Agricultural fertilization significantly affects arbuscular mycorrhizal fungal (AMF) community composition. However, the functional implications of community shifts are unknown, limiting understanding of the role of AMF in agriculture. We assessed AMF community composition at four sites managed under the same nitrogen (N) and phosphorus (P) fertilizer regimes for 55 yr. We also established a glasshouse experiment with the same soils to investigate AMF-barley (Hordeum vulgare) nutrient exchange, using carbon ( 13 C) and 33 P isotopic labelling. N fertilization affected AMF community composition, reducing diversity; P had no effect. In the glasshouse, AMF contribution to plant P declined with P fertilization, but was unaffected by N. Barley C allocation to AMF also declined with P fertilization. As N fertilization increased, C allocation to AMF per unit of P exchanged increased. This occurred with and without P fertilization, and was concomitant with reduced barley biomass. AMF community composition showed no relationship with glasshouse experiment results. The results indicate that plants can reduce C allocation to AMF in response to P fertilization. Under N fertilization, plants allocate an increasing amount of C to AMF and receive relatively less P. This suggests an alteration in the terms of P-C exchange under N fertilization regardless of soil P status. © 2016 The Authors. New Phytologist © 2016 New Phytologist Trust.

  13. The Effect of Trichoderma harzianum and Cadmium on Tolerance Index and Yield of Barley (Hordeum vulgare L.

    Directory of Open Access Journals (Sweden)

    F. Taghavi Ghasemkheyli

    2015-01-01

    Full Text Available To investigate the effect of Trichoderma harzianum, as a bioabsorbant to ameliorate the harmful effects of cadmium (Cd on growth and yield of barley (Hordeum vulgare L. variety ‘Sahra’, a factorial pot experiment based on completely randomized design with three replicates was conducted. Trichoderma harzianum withtwo levels (with and without inoculation and cadmium nitrate with four levels (0, 50, 100 and 150 mg.L-1 were the treatments. Results of ANOVA revealed that there was a significant interaction between Trichoderma and cadmium nitrate in terms of biological yield, straw yield, harvest index, spike number per plant and seed number per spike. Mean comparisons showed that Trichoderma inoculation at all Cd levels significantly improved both biological and straw yields. Trichoderma at 50 and 100 mg.L-1 of Cd also increased the spike number per plant (up to 120 and 66%, respectively significantly. Increasing Cd levels decreased seed yield (19%, 1000 seed weight (18%, partitioning coefficient (57% and tolerance index (23% significantly. Inoculation of Trichoderma into growth medium had a significant effect on seed yield and tolerance index (up to 17 and 22%, respectively. In conclusion, Trichoderma harzianum inoculation at lower concentrations of Cd (50 and 100 mg.L-1 could be effective to improve growth parameters of barley plant.

  14. Enhanced Pb Absorption by Hordeum vulgare L. and Helianthus annuus L. Plants Inoculated with an Arbuscular Mycorrhizal Fungi Consortium.

    Science.gov (United States)

    Arias, Milton Senen Barcos; Peña-Cabriales, Juan José; Alarcón, Alejandro; Maldonado Vega, María

    2015-01-01

    The effect of an arbuscular mycorrhizal fungi (AMF) consortium conformed by (Glomus intraradices, Glomus albidum, Glomus diaphanum, and Glomus claroideum) on plant growth and absorption of Pb, Fe, Na, Ca, and (32)P in barley (Hordeum vulgare L.) and sunflower (Helianthus annuus L.) plants was evaluated. AMF-plants and controls were grown in a substrate amended with powdered Pb slag at proportions of 0, 10, 20, and 30% v/v equivalent to total Pb contents of 117; 5,337; 13,659, and 19,913 mg Pb kg(-1) substrate, respectively. Mycorrhizal root colonization values were 70, 94, 98, and 90%, for barley and 91, 97, 95, and 97%, for sunflower. AMF inoculum had positive repercussions on plant development of both crops. Mycorrhizal barley absorbed more Pb (40.4 mg Pb kg(-1)) shoot dry weight than non-colonized controls (26.5 mg Pb kg(-1)) when treated with a high Pb slag dosage. This increase was higher in roots than shoots (650.0 and 511.5 mg Pb kg(-1) root dry weight, respectively). A similar pattern was found in sunflower. Plants with AMF absorbed equal or lower amounts of Fe, Na and Ca than controls. H. vulgare absorbed more total P (1.0%) than H. annuus (0.9%). The arbuscular mycorrizal consortium enhanced Pb extraction by plants.

  15. Genetic Transformation of Hordeum vulgare ssp. spontaneum for the Development of a Transposon-Based Insertional Mutagenesis System.

    Science.gov (United States)

    Cardinal, Marie-Josée; Kaur, Rajvinder; Singh, Jaswinder

    2016-10-01

    Domestication and intensive selective breeding of plants has triggered erosion of genetic diversity of important stress-related alleles. Researchers highlight the potential of using wild accessions as a gene source for improvement of cereals such as barley, which has major economic and social importance worldwide. Previously, we have successfully introduced the maize Ac/Ds transposon system for gene identification in cultivated barley. The objective of current research was to investigate the response of Hordeum vulgare ssp. spontaneum wild barley accessions in tissue culture to standardize parameters for introduction of Ac/Ds transposons through genetic transformation. We investigated the response of ten wild barley genotypes for callus induction, regenerative green callus induction and regeneration of fertile plants. The activity of exogenous Ac/Ds elements was observed through a transient assay on immature wild barley embryos/callus whereby transformed embryos/calli were identified by the expression of GUS. Transient Ds expression bombardment experiments were performed on 352 pieces of callus (3-5 mm each) or immature embryos in 4 genotypes of wild barley. The transformation frequency of putative transgenic callus lines based on transient GUS expression ranged between 72 and100 % in wild barley genotypes. This is the first report of a transformation system in H. vulgare ssp. spontaneum.

  16. Mapping and validation of major quantitative trait loci for kernel length in wild barley (Hordeum vulgare ssp. spontaneum).

    Science.gov (United States)

    Zhou, Hong; Liu, Shihang; Liu, Yujiao; Liu, Yaxi; You, Jing; Deng, Mei; Ma, Jian; Chen, Guangdeng; Wei, Yuming; Liu, Chunji; Zheng, Youliang

    2016-09-13

    Kernel length is an important target trait in barley (Hordeum vulgare L.) breeding programs. However, the number of known quantitative trait loci (QTLs) controlling kernel length is limited. In the present study, we aimed to identify major QTLs for kernel length, as well as putative candidate genes that might influence kernel length in wild barley. A recombinant inbred line (RIL) population derived from the barley cultivar Baudin (H. vulgare ssp. vulgare) and the long-kernel wild barley genotype Awcs276 (H.vulgare ssp. spontaneum) was evaluated at one location over three years. A high-density genetic linkage map was constructed using 1,832 genome-wide diversity array technology (DArT) markers, spanning a total of 927.07 cM with an average interval of approximately 0.49 cM. Two major QTLs for kernel length, LEN-3H and LEN-4H, were detected across environments and further validated in a second RIL population derived from Fleet (H. vulgare ssp. vulgare) and Awcs276. In addition, a systematic search of public databases identified four candidate genes and four categories of proteins related to LEN-3H and LEN-4H. This study establishes a fundamental research platform for genomic studies and marker-assisted selection, since LEN-3H and LEN-4H could be used for accelerating progress in barley breeding programs that aim to improve kernel length.

  17. Effect of Quantity and Distribution of Rainfalls on Hordeum murinum L. Growth and Development Efecto de la Cantidad y Distribución de las Precipitaciones en el Crecimiento y Desarrollo de Hordeum murinum L.

    Directory of Open Access Journals (Sweden)

    Myrna Johnston B

    2009-06-01

    Full Text Available The growth and development of Hordeum murinum L. seeds growing with extreme pluviometric regimes in cool greenhouse conditions were evaluated. Seven treatments according to quantity and distribution of real rainfalls of the semiarid zone of the Metropolitan Region, Chile were applied: rainy-late, normal-late, dry-early, rainy-normal, normal-early and dry-late, plus a reference without water stress, at 2/3 field capacity. The experimental design was randomized complete blocks with five replicate pots. Seeds produced in the last year were sown in pots with disinfected soil leaving the more uniform plants after emergence. Evaluations were made of phytomass production, spearing shoots of roots, the quantity of floral stems and seeds, their total weight and the proportion of seed annex structures, and the viability and germination capacity of seeds. The life cycle of dry years was shortest and with the least dry shoot matter production, the rainy-normal and normal-late years had similar dry root matter production, therefore the most important factor was rainfall distribution. All the reproductive growth values were lower than the reference. There was no seed production in both distributions of dry years and in the normal-early. There were only differences in late distributions, there were no differences among treatments in seed quality. Thus, H. murinum uses its resources principally for seed production and late distributions determined seed production.Se evaluó el desarrollo de plantas de Hordeum murinum sometidas a regímenes pluviométricos simulados en invernadero frío. En un diseño de bloques completos al azar con cinco repeticiones, se establecieron tratamientos según cantidad y distribución de las precipitaciones reales del secano de la Región Metropolitana, Chile: lluvioso-tardío, normal-tardío, seco-temprano, lluvioso-normal, normal-temprano, seco-tardío y uno de referencia sin restricción hídrica. Se sembraron semillas del a

  18. Species-Level Phylogeny and Polyploid Relationships in Hordeum (Poaceae) Inferred by Next-Generation Sequencing and In Silico Cloning of Multiple Nuclear Loci.

    Science.gov (United States)

    Brassac, Jonathan; Blattner, Frank R

    2015-09-01

    Polyploidization is an important speciation mechanism in the barley genus Hordeum. To analyze evolutionary changes after allopolyploidization, knowledge of parental relationships is essential. One chloroplast and 12 nuclear single-copy loci were amplified by polymerase chain reaction (PCR) in all Hordeum plus six out-group species. Amplicons from each of 96 individuals were pooled, sheared, labeled with individual-specific barcodes and sequenced in a single run on a 454 platform. Reference sequences were obtained by cloning and Sanger sequencing of all loci for nine supplementary individuals. The 454 reads were assembled into contigs representing the 13 loci and, for polyploids, also homoeologues. Phylogenetic analyses were conducted for all loci separately and for a concatenated data matrix of all loci. For diploid taxa, a Bayesian concordance analysis and a coalescent-based dated species tree was inferred from all gene trees. Chloroplast matK was used to determine the maternal parent in allopolyploid taxa. The relative performance of different multilocus analyses in the presence of incomplete lineage sorting and hybridization was also assessed. The resulting multilocus phylogeny reveals for the first time species phylogeny and progenitor-derivative relationships of all di- and polyploid Hordeum taxa within a single analysis. Our study proves that it is possible to obtain a multilocus species-level phylogeny for di- and polyploid taxa by combining PCR with next-generation sequencing, without cloning and without creating a heavy load of sequence data. © The Author(s) 2015. Published by Oxford University Press, on behalf of the Society of Systematic Biologists.

  19. A flavonoid mutant of barley (Hordeum vulgare L.) exhibits increased sensitivity to UV-B radiation in the primary leaf

    International Nuclear Information System (INIS)

    Reuber, S.; Bornman, J.F.; Weissenböck, G.

    1996-01-01

    The aim of the present investigation was to define the role of soluble flavonoids as UV-B protectants in the primary leaf of barley (Hordeum vulgare L.). For this purpose we used a mutant line (Ant 287) from the Carlsberg collection of proanthocyanidin-free barley containing only 7% of total extractable flavonoids in the primary leaf as compared to the mother variety (Hiege 550/75). Seven-day-old leaves from plants grown under high visible light with or without supplementary UV-B radiation were used for the determination of UV-B sensitivity. UV-B-induced changes were assessed from parameters of chlorophyll fluorescence of photosystem II, including initial and maximum fluorescence, apparent quantum yield, and photochemical and non-photochemical quenching. A quartz fibre-optic microprobe was used to evaluate the amount of potentially harmful UV-B (310 nm radiation) penetrating into the leaf as a direct consequence of flavonoid deficiency. Our data indicate an essential role of flavonoids in UV-B protection of barley primary leaves. In leaves of the mutant line grown under supplementary UV-B, an increase in 310nm radiation in the mesophyll and a strong decrease in the quantum yield of photosynthesis were observed as compared to the corresponding mother variety. Primary leaves of liege responded to supplementary UV-B radiation with a 30% increase in the major flavonoid saponarin and a 500% increase in the minor compound lutonarin. This is assumed to be an efficient protective response since no changes in variable chlorophyll fluorescence were apparent. In addition, a further reduction in UV-B penetration into the mesophyll was recorded in these leaves

  20. Effect of soil nutrients reserves and level of fertilisation on production parameters of spring barley (Hordeum vulgare L.

    Directory of Open Access Journals (Sweden)

    Petr Škarpa

    2006-01-01

    Full Text Available The effect of three different doses of basic fertilisers and a subsequent pre-sowing supplementary fertilisation on production parameters (yield of grain, number of spikes, and thousand grains weight was evaluated using experimental data obtained within the framework of a one-year pot experiment with spring barley (Hordeum vulgare L. established at the Department of Agrochemistry and Plant Nutrition, Faculty of Agronomy, Mendel University of Agriculture and Forestry Brno in 2003. Results of statistical analysis indicated that the yield of grain was significantly influenced by different doses of fertilisers especially on sandy soils. As compared with control, the second highest dose of fertilisers (i.e. 83 kg N, 31 kg P and 92 kg K.ha–1 increased the yield by 91.7 % and the third one (i.e. 113 kg N, 43 kg P and 125 kg K.ha–1 even by 124.8 %. This increase in the grain yield was positively affected above all by increasing doses of nitrogen fertilisers. A pre-sowing application of P, K and Mg showed also a positive effect on grain yield not only on sandy but above all on clay soils (as compared with non-fertilised control, this increase ranged from 40.6 to 50.2%. Fertilisation showed also a marked effect on the number of spikes. This factor showed a similar trend as the yield of grain. The thousand grains weight was not significantly influenced on both soil types. This value was increased (by 2.9% to 14.8% after the application of fertilisers prior to sowing but the difference was statistically non-significant.

  1. Allelic variation, alternative splicing and expression analysis of Psy1 gene in Hordeum chilense Roem. et Schult.

    Directory of Open Access Journals (Sweden)

    Cristina Rodríguez-Suárez

    Full Text Available BACKGROUND: The wild barley Hordeum chilense Roem. et Schult. is a valuable source of genes for increasing carotenoid content in wheat. Tritordeums, the amphiploids derived from durum or common wheat and H. chilense, systematically show higher values of yellow pigment colour and carotenoid content than durum wheat. Phytoene synthase 1 gene (Psy1 is considered a key step limiting the carotenoid biosynthesis, and the correlation of Psy1 transcripts accumulation and endosperm carotenoid content has been demonstrated in the main grass species. METHODOLOGY/PRINCIPAL FINDINGS: We analyze the variability of Psy1 alleles in three lines of H. chilense (H1, H7 and H16 representing the three ecotypes described in this species. Moreover, we analyze Psy1 expression in leaves and in two seed developing stages of H1 and H7, showing mRNA accumulation patterns similar to those of wheat. Finally, we identify thirty-six different transcripts forms originated by alternative splicing of the 5' UTR and/or exons 1 to 5 of Psy1 gene. Transcripts function is tested in a heterologous complementation assay, revealing that from the sixteen different predicted proteins only four types (those of 432, 370, 364 and 271 amino acids, are functional in the bacterial system. CONCLUSIONS/SIGNIFICANCE: The large number of transcripts originated by alternative splicing of Psy1, and the coexistence of functional and non functional forms, suggest a fine regulation of PSY activity in H. chilense. This work is the first analysis of H. chilense Psy1 gene and the results reported here are the bases for its potential use in carotenoid enhancement in durum wheat.

  2. TaMSH7: A cereal mismatch repair gene that affects fertility in transgenic barley (Hordeum vulgare L.

    Directory of Open Access Journals (Sweden)

    Langridge Peter

    2007-12-01

    Full Text Available Abstract Background Chromosome pairing, recombination and DNA repair are essential processes during meiosis in sexually reproducing organisms. Investigating the bread wheat (Triticum aestivum L. Ph2 (Pairing homoeologous locus has identified numerous candidate genes that may have a role in controlling such processes, including TaMSH7, a plant specific member of the DNA mismatch repair family. Results Sequencing of the three MSH7 genes, located on the short arms of wheat chromosomes 3A, 3B and 3D, has revealed no significant sequence divergence at the amino acid level suggesting conservation of function across the homoeogroups. Functional analysis of MSH7 through the use of RNAi loss-of-function transgenics was undertaken in diploid barley (Hordeum vulgare L.. Quantitative real-time PCR revealed several T0 lines with reduced MSH7 expression. Positive segregants from two T1 lines studied in detail showed reduced MSH7 expression when compared to transformed controls and null segregants. Expression of MSH6, another member of the mismatch repair family which is most closely related to the MSH7 gene, was not significantly reduced in these lines. In both T1 lines, reduced seed set in positive segregants was observed. Conclusion Results presented here indicate, for the first time, a distinct functional role for MSH7 in vivo and show that expression of this gene is necessary for wild-type levels of fertility. These observations suggest that MSH7 has an important function during meiosis and as such remains a candidate for Ph2.

  3. Molecular characterization of barley (Hordeum vulgare L. accessions of the Serbian GeneBank by SSR fingerprinting

    Directory of Open Access Journals (Sweden)

    Šurlan-Momirović Gordana

    2013-01-01

    Full Text Available Molecular diversity of 145 barley (Hordeum vulgare subsp. vulgare L. accessions from the Serbian GenBank was assessed by single sequence repeats (SSR markers. A set of 15 SSRs, covering all chromosomes of the diploid barley genome with 2-3 SSR markers per chromosome, with a range of 4-18 alleles per locus were used. In total, 15 loci and 119 alleles were detected, with an average of 7.93 alleles per locus. The Polymorphic information content value ranged from 0.220 to 0.782 with a mean value of 0.534. Regarding the growth habit and row type groups, gene diversity was comparatively higher for the spring (0.616 and six-rowed accessions (0.616 than for the winter and two- rowed accessions (0.322 and 0.478, respectively. Analysis of molecular variance showed that all sources of variation were significant (P < 0.01, but the between-group component was predominant (76.85% for growth habit and 89.45% for row type. Unweighted Pair Group Method with Arithmetic Mean (UPGMA cluster analysis based on the shared allele distance (DSA matrix estimated on the SSR data assigned the genotypes into two clusters - the first smaller consisting of the six 6-rowed spring cultivars and the second comprising six subclusters. Genotype MBR1012 was separated from all other genotypes that constitute UPGMA tree. The associations of genotypes belonging to different growth habit and row type groups were assessed using Principal Coordinate Analysis revealing separation of winter growth habit group from facultative one. The use of the STRUCTURE clustering algorithm allowed the identification of 2 subpopulations of genotypes. [Projekat Ministarstva nauke Republike Srbije, br. TR31092

  4. Adaptive microclimatic structural and expressional dehydrin 1 evolution in wild barley, Hordeum spontaneum, at 'Evolution Canyon', Mount Carmel, Israel.

    Science.gov (United States)

    Yang, Zujun; Zhang, Tao; Bolshoy, Alexander; Beharav, Alexander; Nevo, Eviatar

    2009-05-01

    'Evolution Canyon' (ECI) at Lower Nahal Oren, Mount Carmel, Israel, is an optimal natural microscale model for unravelling evolution in action highlighting the twin evolutionary processes of adaptation and speciation. A major model organism in ECI is wild barley, Hordeum spontaneum, the progenitor of cultivated barley, which displays dramatic interslope adaptive and speciational divergence on the 'African' dry slope (AS) and the 'European' humid slope (ES), separated on average by 200 m. Here we examined interslope single nucleotide polymorphism (SNP) sequences and the expression diversity of the drought resistant dehydrin 1 gene (Dhn1) between the opposite slopes. We analysed 47 plants (genotypes), 4-10 individuals in each of seven stations (populations) in an area of 7000 m(2), for Dhn1 sequence diversity located in the 5' upstream flanking region of the gene. We found significant levels of Dhn1 genic diversity represented by 29 haplotypes, derived from 45 SNPs in a total of 708 bp sites. Most of the haplotypes, 25 out of 29 (= 86.2%), were represented by one genotype; hence, unique to one population. Only a single haplotype was common to both slopes. Genetic divergence of sequence and haplotype diversity was generally and significantly different among the populations and slopes. Nucleotide diversity was higher on the AS, whereas haplotype diversity was higher on the ES. Interslope divergence was significantly higher than intraslope divergence. The applied Tajima D rejected neutrality of the SNP diversity. The Dhn1 expression under dehydration indicated interslope divergent expression between AS and ES genotypes, reinforcing Dhn1 associated with drought resistance of wild barley at 'Evolution Canyon'. These results are inexplicable by mutation, gene flow, or chance effects, and support adaptive natural microclimatic selection as the major evolutionary divergent driving force.

  5. Effects of Cerium and Titanium Oxide Nanoparticles in Soil on the Nutrient Composition of Barley (Hordeum vulgare L. Kernels

    Directory of Open Access Journals (Sweden)

    Filip Pošćić

    2016-06-01

    Full Text Available The implications of metal nanoparticles (MeNPs are still unknown for many food crops. The purpose of this study was to evaluate the effects of cerium oxide (nCeO2 and titanium oxide (nTiO2 nanoparticles in soil at 0, 500 and 1000 mg·kg−1 on the nutritional parameters of barley (Hordeum vulgare L. kernels. Mineral nutrients, amylose, β-glucans, amino acid and crude protein (CP concentrations were measured in kernels. Whole flour samples were analyzed by ICP-AES/MS, HPLC and Elemental CHNS Analyzer. Results showed that Ce and Ti accumulation under MeNPs treatments did not differ from the control treatment. However, nCeO2 and nTiO2 had an impact on composition and nutritional quality of barley kernels in contrasting ways. Both MeNPs left β-glucans unaffected but reduced amylose content by approximately 21%. Most amino acids and CP increased. Among amino acids, lysine followed by proline saw the largest increase (51% and 37%, respectively. Potassium and S were both negatively impacted by MeNPs, while B was only affected by 500 mg nCeO2·kg−1. On the contrary Zn and Mn concentrations were improved by 500 mg nTiO2·kg−1, and Ca by both nTiO2 treatments. Generally, our findings demonstrated that kernels are negatively affected by nCeO2 while nTiO2 can potentially have beneficial effects. However, both MeNPs have the potential to negatively impact malt and feed production.

  6. Evaluation of phytotoxicity effect of olive mill wastewater treated by different technologies on seed germination of barley (Hordeum vulgare L.).

    Science.gov (United States)

    Rusan, Munir J M; Albalasmeh, Ammar A; Zuraiqi, Said; Bashabsheh, Mohammad

    2015-06-01

    Olive-mill wastewater (OMW) is a by-product effluent of olive oil extraction process that is produced in large amount in the Mediterranean region. OMW is believed to induce phytotoxic effect on organisms including seed germination and plant growth. The objective of this study was to evaluate the impact of untreated and treated OMW with different techniques on seed germination of barley (Hordeum vulgare L.). The following treatments were investigated: (1) tap water (control); (2) OMW treated by aerobic biological technology in a Jacto Reactor (JR); (3) OMW treated by solar fenton oxidation (SFO); (4) OMW treated by microfiltration followed by nanofiltration (MF+NF); (5) OMW treated by microfiltration followed by reverse osmosis (MF+RO) process; (6) diluted OMW with tap water (25 % OMW); (7) diluted OMW with tap water (50 % OMW); (8) diluted OMW with tap water (75 % OMW); and (9) untreated OMW (100 % OMW). A germination test was conducted in an incubator at temperature of 23 (∘)C. In each petri dish, a filter paper was mounted and ten seeds of barley were placed on the filter paper. Five milliliter of water were added to each petri dish. The seed germination was determined by counting the number of germinated seeds to calculate the percentage of germination (G %). Germination rate index (GRI), seed vigor index (SVI), and phytotoxicity index (PI) were also calculated. Then, the dry weights and lengths of the shoots and the roots of the germinated seeds were measured. The results show that 100, 75, and 50 %OMW were very phytotoxic and completely prohibited seed germination. However, phytotoxicity decreased significantly following treatments of OMW with all techniques investigated and by the 25 % OMW dilution, as results of removing the phenols and other phytotoxic organic compounds from the OMW or by diluting it. This was evidenced by relative enhancement of the dry weights and lengths of shoot and root as well as the G %, GRI, SVG, and PI. It was concluded that if

  7. Development of T. aestivum L.-H. californicum alien chromosome lines and assignment of homoeologous groups of Hordeum californicum chromosomes.

    Science.gov (United States)

    Fang, Yuhui; Yuan, Jingya; Wang, Zhangjun; Wang, Haiyan; Xiao, Jin; Yang, Zhixi; Zhang, Ruiqi; Qi, Zengjun; Xu, Weigang; Hu, Lin; Wang, Xiu-E

    2014-08-20

    Hordeum californicum (2n = 2x = 14, HH) is resistant to several wheat diseases and tolerant to lower nitrogen. In this study, a molecular karyotype of H. californicum chromosomes in the Triticum aestivum L. cv. Chinese Spring (CS)-H. californicum amphidiploid (2n = 6x = 56, AABBDDHH) was established. By genomic in situ hybridization (GISH) and multicolor fluorescent in situ hybridization (FISH) using repetitive DNA clones (pTa71, pTa794 and pSc119.2) as probes, the H. californicum chromosomes could be differentiated from each other and from the wheat chromosomes unequivocally. Based on molecular karyotype and marker analyses, 12 wheat-alien chromosome lines, including four disomic addition lines (DAH1, DAH3, DAH5 and DAH6), five telosomic addition lines (MtH7L, MtH1S, MtH1L, DtH6S and DtH6L), one multiple addition line involving H. californicum chromosome H2, one disomic substitution line (DSH4) and one translocation line (TH7S/1BL), were identified from the progenies derived from the crosses of CS-H. californicum amphidiploid with common wheat varieties. A total of 482 EST (expressed sequence tag) or SSR (simple sequence repeat) markers specific for individual H. californicum chromosomes were identified, and 47, 50, 45, 49, 21, 51 and 40 markers were assigned to chromosomes H1, H2, H3, H4, H5, H6 and H7, respectively. According to the chromosome allocation of these markers, chromosomes H2, H3, H4, H5, and H7 of H. californicum have relationship with wheat homoeologous groups 5, 2, 6, 3, and 1, and hence could be designated as 5H(c), 2H(c), 6H(c), 3H(c) and 1H(c), respectively. The chromosomes H1 and H6 were designated as 7H(c) and 4H(c), respectively, by referring to SSR markers located on rye chromosomes. Copyright © 2014 Institute of Genetics and Developmental Biology, Chinese Academy of Sciences, and Genetics Society of China. Published by Elsevier Ltd. All rights reserved.

  8. A Spectrophotometric Assay for Robust Viability Testing of Seed Batches Using 2,3,5-Triphenyl Tetrazolium Chloride: Using Hordeum vulgare L. as a Model

    Directory of Open Access Journals (Sweden)

    Laura Lopez Del Egido

    2017-05-01

    Full Text Available A comparative analysis was carried out of published methods to assess seed viability using 2,3,5-triphenyltetrazolium chloride (TTC based assays of seed batches. The tests were carried out on seeds of barley (Hordeum vulgare cv. Optic as a model. We established that 10% [w/v] trichloroacetic acid (TCA/methanol is superior to the acetone and methanol-only based methods: allowing the highest recovery of formazan and the lowest background optical density (OD readings, across seed lots comprising different ratios of viable and dead seeds. The method allowed a linear-model to accurately capture the statistically significant relationship between the quantity of formazan that could be extracted using the method we developed and the seed temperature-response, and seed viability as a function of artificially aged seed lots. Other quality control steps are defined to help ensure the assay is robust and these are reported in a Standard Operating Procedure.

  9. Comparative analyses of genetic/epigenetic diversities and structures in a wild barley species (Hordeum brevisubulatum) using MSAP, SSAP and AFLP.

    Science.gov (United States)

    Shan, X H; Li, Y D; Liu, X M; Wu, Y; Zhang, M Z; Guo, W L; Liu, B; Yuan, Y P

    2012-08-17

    We analyzed genetic diversity and population genetic structure of four artificial populations of wild barley (Hordeum brevisubulatum); 96 plants collected from the Songnen Prairie in northeastern China were analyzed using amplified fragment length polymorphism (AFLP), specific-sequence amplified polymorphism (SSAP) and methylation-sensitive amplified polymorphism (MSAP) markers. Indices of (epi-)genetic diversity, (epi-)genetic distance, gene flow, genotype frequency, cluster analysis, PCA analysis and AMOVA analysis generated from MSAP, AFLP and SSAP markers had the same trend. We found a high level of correlation in the artificial populations between MSAP, SSAP and AFLP markers by the Mantel test (r > 0.8). This is incongruent with previous findings showing that there is virtually no correlation between DNA methylation polymorphism and classical genetic variation; the high level of genetic polymorphism could be a result of epigenetic regulation. We compared our results with data from natural populations. The population diversity of the artificial populations was lower. However, different from what was found using AFLP and SSAP, based on MSAP results the methylation polymorphism of the artificial populations was not significantly reduced. This leads us to suggest that the DNA methylation pattern change in H. brevisubulatum populations is not only related to DNA sequence variation, but is also regulated by other controlling systems.

  10. Development and validation of a terrestrial biotic ligand model predicting the effect of cobalt on root growth of barley (Hordeum vulgare)

    International Nuclear Information System (INIS)

    Lock, K.; De Schamphelaere, K.A.C.; Becaus, S.; Criel, P.; Van Eeckhout, H.; Janssen, C.R.

    2007-01-01

    A Biotic Ligand Model was developed predicting the effect of cobalt on root growth of barley (Hordeum vulgare) in nutrient solutions. The extent to which Ca 2+ , Mg 2+ , Na + , K + ions and pH independently affect cobalt toxicity to barley was studied. With increasing activities of Mg 2+ , and to a lesser extent also K + , the 4-d EC50 Co2+ increased linearly, while Ca 2+ , Na + and H + activities did not affect Co 2+ toxicity. Stability constants for the binding of Co 2+ , Mg 2+ and K + to the biotic ligand were obtained: log K CoBL = 5.14, log K MgBL = 3.86 and log K KBL = 2.50. Limited validation of the model with one standard artificial soil and one standard field soil showed that the 4-d EC50 Co2+ could only be predicted within a factor of four from the observed values, indicating further refinement of the BLM is needed. - Biotic Ligand Models are not only a useful tool to assess metal toxicity in aquatic systems but can also be used for terrestrial plants

  11. Low-Resolution Structure of the Full-Length Barley (Hordeum vulgare) SGT1 Protein in Solution, Obtained Using Small-Angle X-Ray Scattering

    Science.gov (United States)

    Taube, Michał; Pieńkowska, Joanna R.; Jarmołowski, Artur; Kozak, Maciej

    2014-01-01

    SGT1 is an evolutionarily conserved eukaryotic protein involved in many important cellular processes. In plants, SGT1 is involved in resistance to disease. In a low ionic strength environment, the SGT1 protein tends to form dimers. The protein consists of three structurally independent domains (the tetratricopeptide repeats domain (TPR), the CHORD- and SGT1-containing domain (CS), and the SGT1-specific domain (SGS)), and two less conserved variable regions (VR1 and VR2). In the present study, we provide the low-resolution structure of the barley (Hordeum vulgare) SGT1 protein in solution and its dimer/monomer equilibrium using small-angle scattering of synchrotron radiation, ab-initio modeling and circular dichroism spectroscopy. The multivariate curve resolution least-square method (MCR-ALS) was applied to separate the scattering data of the monomeric and dimeric species from a complex mixture. The models of the barley SGT1 dimer and monomer were formulated using rigid body modeling with ab-initio structure prediction. Both oligomeric forms of barley SGT1 have elongated shapes with unfolded inter-domain regions. Circular dichroism spectroscopy confirmed that the barley SGT1 protein had a modular architecture, with an α-helical TPR domain, a β-sheet sandwich CS domain, and a disordered SGS domain separated by VR1 and VR2 regions. Using molecular docking and ab-initio protein structure prediction, a model of dimerization of the TPR domains was proposed. PMID:24714665

  12. A Novel QTL for Powdery Mildew Resistance in Nordic Spring Barley (Hordeum vulgare L. ssp. vulgare) Revealed by Genome-Wide Association Study.

    Science.gov (United States)

    Bengtsson, Therése; Åhman, Inger; Manninen, Outi; Reitan, Lars; Christerson, Therese; Due Jensen, Jens; Krusell, Lene; Jahoor, Ahmed; Orabi, Jihad

    2017-01-01

    The powdery mildew fungus, Blumeria graminis f. sp. hordei is a worldwide threat to barley ( Hordeum vulgare L. ssp. vulgare ) production. One way to control the disease is by the development and deployment of resistant cultivars. A genome-wide association study was performed in a Nordic spring barley panel consisting of 169 genotypes, to identify marker-trait associations significant for powdery mildew. Powdery mildew was scored during three years (2012-2014) in four different locations within the Nordic region. There were strong correlations between data from all locations and years. In total four QTLs were identified, one located on chromosome 4H in the same region as the previously identified mlo locus and three on chromosome 6H. Out of these three QTLs identified on chromosome 6H, two are in the same region as previously reported QTLs for powdery mildew resistance, whereas one QTL appears to be novel. The top NCBI BLASTn hit of the SNP markers within the novel QTL predicted the responsible gene to be the 26S proteasome regulatory subunit, RPN1, which is required for innate immunity and powdery mildew-induced cell death in Arabidopsis . The results from this study have revealed SNP marker candidates that can be exploited for use in marker-assisted selection and stacking of genes for powdery mildew resistance in barley.

  13. Imaging of fast chlorophyll fluorescence induction curve (OJIP) parameters, applied in a screening study with wild barley (Hordeum spontaneum) genotypes under heat stress.

    Science.gov (United States)

    Jedmowski, Christoph; Brüggemann, Wolfgang

    2015-10-01

    We quantified the influence of heat stress (HS) on PSII by imaging of parameters of the fast chlorophyll fluorescence (CF) induction (OJIP) kinetic of 20 genotypes of wild barley (Hordeum spontaneum) covering a broad geographical spectrum. We developed a standardised screening procedure, allowing a repetitive fluorescence measurement of leaf segments. The impact of HS was quantified by calculating a Heat Resistance Index (HRI), derived from the decrease of the Performance Index (PI) caused by HS treatment and following recovery. For the genotype showing the lowest HRI, reduced maximum quantum yield (φP0) and increased relative variable fluorescence of the O-J phase (K-Peak) were detected after HS, whereas the basal fluorescence (F0) remained stable. An additional feature was a lowered fraction of active (QA-reducing) reaction centres (RCs). The disturbances disappeared after one day of recovery. Spatial heterogeneities of fluorescence parameters were detected, as the negative effect of HS was stronger in the leaf areas close to the leaf tip. The results of this study prove that chlorophyll fluorescence imaging (CFI) is suitable for the detection of HS symptoms and that imaging of JIP-Test parameters should be considered in future screening and phenotyping studies aiming for the characterisation of plant genotypes. Copyright © 2015 Elsevier B.V. All rights reserved.

  14. Interactions and Toxicity of Cu-Zn mixtures to Hordeum vulgare in Different Soils Can Be Rationalized with Bioavailability-Based Prediction Models.

    Science.gov (United States)

    Qiu, Hao; Versieren, Liske; Rangel, Georgina Guzman; Smolders, Erik

    2016-01-19

    Soil contamination with copper (Cu) is often associated with zinc (Zn), and the biological response to such mixed contamination is complex. Here, we investigated Cu and Zn mixture toxicity to Hordeum vulgare in three different soils, the premise being that the observed interactions are mainly due to effects on bioavailability. The toxic effect of Cu and Zn mixtures on seedling root elongation was more than additive (i.e., synergism) in soils with high and medium cation-exchange capacity (CEC) but less than additive (antagonism) in a low-CEC soil. This was found when we expressed the dose as the conventional total soil concentration. In contrast, antagonism was found in all soils when we expressed the dose as free-ion activities in soil solution, indicating that there is metal-ion competition for binding to the plant roots. Neither a concentration addition nor an independent action model explained mixture effects, irrespective of the dose expressions. In contrast, a multimetal BLM model and a WHAM-Ftox model successfully explained the mixture effects across all soils and showed that bioavailability factors mainly explain the interactions in soils. The WHAM-Ftox model is a promising tool for the risk assessment of mixed-metal contamination in soils.

  15. Response of the rhizosphere prokaryotic community of barley (Hordeum vulgare L.) to elevated atmospheric CO2 concentration in open-top chambers.

    Science.gov (United States)

    Szoboszlay, Márton; Näther, Astrid; Mitterbauer, Esther; Bender, Jürgen; Weigel, Hans-Joachim; Tebbe, Christoph C

    2017-08-01

    The effect of elevated atmospheric CO 2 concentration [CO 2 ] on the diversity and composition of the prokaryotic community inhabiting the rhizosphere of winter barley (Hordeum vulgare L.) was investigated in a field experiment, using open-top chambers. Rhizosphere samples were collected at anthesis (flowering stage) from six chambers with ambient [CO 2 ] (approximately 400 ppm) and six chambers with elevated [CO 2 ] (700 ppm). The V4 region of the 16S rRNA gene was PCR-amplified from the extracted DNA and sequenced on an Illumina MiSeq instrument. Above-ground plant biomass was not affected by elevated [CO 2 ] at anthesis, but plants exposed to elevated [CO 2 ] had significantly higher grain yield. The composition of the rhizosphere prokaryotic communities was very similar under ambient and elevated [CO 2 ]. The dominant taxa were Bacteroidetes, Actinobacteria, Alpha-, Gamma-, and Betaproteobacteria. Elevated [CO 2 ] resulted in lower prokaryotic diversity in the rhizosphere, but did not cause a significant difference in community structure. © 2017 The Authors. MicrobiologyOpen published by John Wiley & Sons Ltd.

  16. Use of Co speciation and soil properties to explain variation in Co toxicity to root growth of barley (Hordeum vulgare L.) in different soils

    International Nuclear Information System (INIS)

    Mico, C.; Li, H.F.; Zhao, F.J.; McGrath, S.P.

    2008-01-01

    The influence of soil properties on the bioavailability and toxicity of Co to barley (Hordeum vulgare L.) root elongation was investigated. Ten soils varying widely in soil properties were amended with seven doses of CoCl 2 . Soil properties greatly influenced the expression of Co toxicity. The effective concentration of added Co causing 50% inhibition (EC 50 ) ranged from 45 to 863 mg kg -1 , representing almost 20-fold variation among soils. Furthermore, we investigated Co toxicity in relation to Co concentrations and free Co 2+ activity in soil solution. The EC 50 values showed variation among soils of 17- and 29-fold, based on the Co concentration in soil solution and free Co 2+ activity, respectively. Single regressions were carried out between Co toxicity threshold values and selected soil properties. Models obtained showed that soil effective cation exchange capacity (eCEC) and exchangeable calcium were the most consistent single predictors of the EC 50 values based on soil added Co. - Soil eCEC and exchangeable Ca were found to be the best predictors of the toxicity threshold values of Co to barley root growth on different soils

  17. Localisation of genes for resistance against ¤Blumeria graminis¤ f.sp. ¤hordei¤ and ¤Puccinia graminis¤ in a cross between a barley cultivar and a wild barley (¤Hordeum vulgare¤ ssp. ¤spontaneum¤) line

    DEFF Research Database (Denmark)

    Backes, G.; Madsen, L.H.; Jaiser, H.

    2003-01-01

    The aims of this investigation have been to map new (quantitative) resistance genes against powdery mildew, caused by Blumeria graminis f.sp. hordei L., and leaf rust, caused by Puccinia hordei L., in a cross between the barley (Hordeum vulgare ssp. vulgare) cultivar "Vada" and the wild barley...... (Hordeum vulgare ssp. spontaneum) line "1B-87" originating from Israel. The population consisted of 121 recombinant inbred lines. Resistance against leaf rust and powdery mildew was tested on detached leaves. The leaf rust isolate "I-80" and the powdery mildew isolate "Va-4", respectively, were used...

  18. Fungos e micotoxinas em grãos de cevada (Hordeum vulgare L.) cervejeira, descontaminação pelo gás ozônio e segurança de cervejas artesanais

    OpenAIRE

    Piacentini, Karim Cristina

    2015-01-01

    Dissertação (mestrado) - Universidade Federal de Santa Catarina, Centro de Ciências Agrárias, Programa de Pós-Graduação em Ciência dos Alimentos, Florianópolis, 2015. A cevada (Hordeum vulgare L sp. vulgare) é considerada um dos cereais mais importantes no contexto mundial. Atualmente, uma preocupação latente da indústria cervejeira é o crescimento de fungos filamentosos nos grãos, que acorre devido ao manejo inadequado da matéria prima durante o armazenamento (excesso de umidade), a conde...

  19. Evaluation of the allelopathic potential of water-soluble compounds of barley (Hordeum vulgare L. subsp.vulgare and great brome (Bromus diandrus Roth. using a modified bioassay

    Directory of Open Access Journals (Sweden)

    Bouhaouel, I.

    2016-01-01

    Full Text Available Description of the subject. The present study focuses on the description of the allelopathic interactions between wild and crop species that may occur in a given ecosystem. Objectives. The objective is the evaluation of the allo- and autoinhibition activity of root exudates of barley (Hordeum vulgare L. subsp. vulgare and great brome (Bromus diandrus Roth. seedlings by water-soluble allelochemicals. Method. The allelopathic activities of five Tunisian barley genotypes (modern varieties and landraces, one Saudi Arabian barley landrace and great brome were assessed using a modified laboratory bioassay named "seedling-after-seedling agar method". Results. The barley or the great brome reduced, to a greater extent, the root growth compared to the shoot growth of receiver species. The response of the root system architecture of the great brome towards barley root exudates was studied in detail. All the measured root traits were highly sensitive to the presence of barley. In our conditions, the allelopathic activity of barley root exudates had no apparent relationship with the size of the root and a prominent action of genetic determinants in the allelopathic potential between genotypes is proposed. The alloinhibitory activity of barley or great brome root exudates deferred between the receiver species but was always higher than the autoinhibition potential. The autoinhibition in barley proved to depend on whether the genotypes used as donor and receiver are identical or different, suggesting a specific interaction of allelochemicals with the receiver plant. These molecules seem to be the main actors in the allelopathic barley potential as external factors such variations of pH have no evident relevance in the inhibition process. Conclusions. Barley and great brome exude molecules in their surroundings. This affects the growth of the receiver plants, suggesting that these compounds might contribute to the plant community dynamics.

  20. Transgenic barley (Hordeum vulgare L.) expressing the wheat aluminium resistance gene (TaALMT1) shows enhanced phosphorus nutrition and grain production when grown on an acid soil.

    Science.gov (United States)

    Delhaize, Emmanuel; Taylor, Phillip; Hocking, Peter J; Simpson, Richard J; Ryan, Peter R; Richardson, Alan E

    2009-06-01

    Barley (Hordeum vulgare L.), genetically modified with the Al(3+) resistance gene of wheat (TaALMT1), was compared with a non-transformed sibling line when grown on an acidic and highly phosphate-fixing ferrosol supplied with a range of phosphorus concentrations. In short-term pot trials (26 days), transgenic barley expressing TaALMT1 (GP-ALMT1) was more efficient than a non-transformed sibling line (GP) at taking up phosphorus on acid soil, but the genotypes did not differ when the soil was limed. Differences in phosphorus uptake efficiency on acid soil could be attributed not only to the differential effects of aluminium toxicity on root growth between the genotypes, but also to differences in phosphorus uptake per unit root length. Although GP-ALMT1 out-performed GP on acid soil, it was still not as efficient at taking up phosphorus as plants grown on limed soil. GP-ALMT1 plants grown in acid soil possessed substantially smaller rhizosheaths than those grown in limed soil, suggesting that root hairs were shorter. This is a probable reason for the lower phosphorus uptake efficiency. When grown to maturity in large pots, GP-ALMT1 plants produced more than twice the grain as GP plants grown on acid soil and 80% of the grain produced by limed controls. Expression of TaALMT1 in barley was not associated with a penalty in either total shoot or grain production in the absence of Al(3+), with both genotypes showing equivalent yields in limed soil. These findings demonstrate that an important crop species can be genetically engineered to successfully increase grain production on an acid soil.

  1. Improving phenolic bioactive-linked anti-hyperglycemic functions of dark germinated barley sprouts (Hordeum vulgare L.) using seed elicitation strategy.

    Science.gov (United States)

    Ramakrishna, Ramnarain; Sarkar, Dipayan; Manduri, Avani; Iyer, Shreyas Ganesan; Shetty, Kalidas

    2017-10-01

    Sprouts of cereal grains, such as barley ( Hordeum vulgare L.), are a good source of beneficial phenolic bioactives. Such health relevant phenolic bioactives of cereal sprouts can be targeted to manage chronic hyperglycemia and oxidative stress commonly associated with type 2 diabetes (T2D). Therefore improving phenolic bioactives by stimulating plant endogenous defense responses such as protective pentose phosphate pathway (PPP) during sprouting has significant merit. Based on this metabolic rationale, this study aimed to enhance phenolic bioactives and associated antioxidant and anti-hyperglycemic functions in dark germinated barley sprouts using exogenous elicitor treatments. Dark-germinated sprouts of two malting barley cultivars (Pinnacle and Celebration), treated with chitosan oligosaccharide (COS) and marine protein hydrolysate (GP), were evaluated. Total soluble phenolic content (TSP), phenolic acid profiles, total antioxidant activity (TA) and in vitro inhibitory activities of hyperglycemia relevant α-amylase and α-glucosidase enzymes of the dark germinated barley sprouts were evaluated at day 2, 4, and 6 post elicitor treatments. Overall, TSP content, TA, and α-amylase inhibitory activity of dark germinated barley sprouts decreased, while α-glucosidase inhibitory activity and gallic acid content increased from day 2 to day 6. Among barley cultivars, high phenolic antioxidant-linked anti-hyperglycemic bioactives were observed in Celebration. Furthermore, GP and COS seed elicitor treatments in selective doses improved T2D relevant phenolic-linked anti-hyperglycemic bioactives of barley spouts at day 6. Therefore, such seed elicitation approach can be strategically used to develop bioactive enriched functional food ingredients from cereal sprouts targeting chronic hyperglycemia and oxidative stress linked to T2D.

  2. A Substantial Fraction of Barley (Hordeum vulgare L. Low Phytic Acid Mutations Have Little or No Effect on Yield across Diverse Production Environments

    Directory of Open Access Journals (Sweden)

    Victor Raboy

    2015-04-01

    Full Text Available The potential benefits of the low phytic acid (lpa seed trait for human and animal nutrition, and for phosphorus management in non-ruminant animal production, are well documented. However, in many cases the lpa trait is associated with impaired seed or plant performance, resulting in reduced yield. This has given rise to the perception that the lpa trait is tightly correlated with reduced yield in diverse crop species. Here we report a powerful test of this correlation. We measured grain yield in lines homozygous for each of six barley (Hordeum vulgare L. lpa mutations that greatly differ in their seed phytic acid levels. Performance comparisons were between sibling wild-type and mutant lines obtained following backcrossing, and across two years in five Idaho (USA locations that greatly differ in crop yield potential. We found that one lpa mutation (Hvlpa1-1 had no detectable effect on yield and a second (Hvlpa4-1 resulted in yield losses of only 3.5%, across all locations. When comparing yields in three relatively non-stressful production environments, at least three lpa mutations (Hvlpa1-1, Hvlpa3-1, and Hvlpa4-1 typically had yields similar to or within 5% of the wild-type sibling isoline. Therefore in the case of barley, lpa mutations can be readily identified that when simply incorporated into a cultivar result in adequately performing lines, even with no additional breeding for performance within the lpa line. In conclusion, while some barley lpa mutations do impact field performance, a substantial fraction appears to have little or no effect on yield.

  3. An eceriferum locus, cer-zv, is associated with a defect in cutin responsible for water retention in barley (Hordeum vulgare) leaves.

    Science.gov (United States)

    Li, Chao; Wang, Aidong; Ma, Xiaoying; Pourkheirandish, Mohammad; Sakuma, Shun; Wang, Ning; Ning, Shunzong; Nevo, Eviatar; Nawrath, Christiane; Komatsuda, Takao; Chen, Guoxiong

    2013-03-01

    Drought limits plant growth and threatens crop productivity. A barley (Hordeum vulgare) ethylene imine-induced monogenic recessive mutant cer-zv, which is sensitive to drought, was characterized and genetically mapped in the present study. Detached leaves of cer-zv lost 34.2 % of their initial weight after 1 h of dehydration. The transpiration was much higher in cer-zv leaves than in wild-type leaves under both light and dark conditions. The stomata of cer-zv leaves functioned normally, but the cuticle of cer-zv leaves showed increased permeability to ethanol and toluidine blue dye. There was a 50-90 % reduction in four major cutin monomers, but no reduction in wax loads was found in the cer-zv mutant as compared with the wild type. Two F(2) mapping populations were established by the crosses of 23-19 × cer-zv and cer-zv × OUH602. More polymorphisms were found in EST sequences between cer-zv and OUH602 than between cer-zv and 23-19. cer-zv was located in a pericentromeric region on chromosome 4H in a 10.8 cM interval in the 23-19 × cer-zv map based on 186 gametes tested and a 1.7 cM interval in the cer-zv × OUH602 map based on 176 gametes tested. It co-segregated with EST marker AK251484 in both maps. The results indicated that the cer-zv mutant is defective in cutin, which might be responsible for the increased transpiration rate and drought sensitivity, and that the F(2) of cer-zv × OUH602 might better facilitate high resolution mapping of cer-zv.

  4. Variabilidad espacial de la materia orgánica en un suelo dedicado al cultivo de cebada maltera (Hordeum distichum L.

    Directory of Open Access Journals (Sweden)

    Judith Prieto Méndez

    2014-01-01

    Full Text Available El contenido de materia orgánica (MO en suelos es una de las propiedades de mayor interés debido a su papel en la estructura y a su reconocida influencia en la dinámica de solutos. Su caracterización es por tanto, un aspecto de gran interés. Los contenidos de MO en suelos dedicados al cultivo de cebada maltera ( Hordeum distichum L. son relativamente bajos, por lo que la incertidumbre y posibles errores del método analítico pueden condicionar estudios de variabilidad espacial. En este trabajo se elaboró y validó un método de análisis de la MO de acuerdo con los criterios de la Norma ISO-17025 y se diseñó un control de calidad, incluyendo un estudio de la variabilidad que la metodología introduce en los resultados. Con la metodología desarrollada se ha llevado a cabo un muestreo previo y un muestreo final de 39 y 248 muestras representativas de una parcela dedicada al cultivo de cebada maltera del municipio de Apan, al sur del estado de Hidalgo, México, cuyo fin fue evaluar el número de muestras necesarias que han de tomarse para caracterizar este suelo y esta propiedad (MO. El trabajo se completó con un estudio geoestadístico de los valores de MO, con lo que pueden extraerse conclusiones para planes de muestreo futuros, desarrollo de modelos de simulación a escala de campo y aplicación práctica de problemas de fertilización.

  5. Chromosomal characterization of the three subgenomes in the polyploids of Hordeum murinum L.: new insight into the evolution of this complex.

    Directory of Open Access Journals (Sweden)

    Ángeles Cuadrado

    Full Text Available Hordeum murinum L. is a species complex composed of related taxa, including the subspecies glaucum, murinum and leporinum. However, the phylogenetic relationships between the different taxa and their cytotypes, and the origin of the polyploid forms, remain points of controversy. The present work reports a comparative karyotype analysis of seven accessions of the H. murinum complex representing all subspecies and cytotypes. The karyotypes were determined by examining the distribution of the repetitive Triticeae DNA sequences pTa71, pTa794, pSc119.2, pAs1 and pHch950, the simple sequence repeats (SSRs (AG10, (AAC5, (AAG5, (ACT5, (ATC5, and (CCCTAAA3 via in situ hybridization. The chromosomes of the three subgenomes involved in the polyploids were identified. All tetraploids of all subspecies shared the same two subgenomes (thus suggesting them to in fact belong to the same taxon, the result of hybridization between two diploid ancestors. One of the subgenomes present in all tetraploids of all subspecies was found to be very similar (though not identical to the chromosome complement of the diploid glaucum. The hexaploid form of leporinum came about through a cross between a tetraploid and a third diploid form. Exclusively bivalent associations among homologous chromosomes were observed when analyzing pollen mother cells of tetraploid taxa. In conclusion, the present results identify all the individual chromosomes within the H. murinum complex, reveal its genome structure and phylogeny, and explain the appearance of the different cytotypes. Three cryptic species are proposed according to ploidy level that may deserve full taxonomic recognition.

  6. A proteomics approach to study the molecular basis of enhanced salt tolerance in barley (Hordeum vulgare L.) conferred by the root mutualistic fungus Piriformospora indica.

    Science.gov (United States)

    Alikhani, Mehdi; Khatabi, Behnam; Sepehri, Mozhgan; Nekouei, Mojtaba Khayam; Mardi, Mohsen; Salekdeh, Ghasem Hosseini

    2013-06-01

    Piriformospora indica is a root-interacting mutualistic fungus capable of enhancing plant growth, increasing plant resistance to a wide variety of pathogens, and improving plant stress tolerance under extreme environmental conditions. Understanding the molecular mechanisms by which P. indica can improve plant tolerance to stresses will pave the way to identifying the major mechanisms underlying plant adaptability to environmental stresses. We conducted greenhouse experiments at three different salt levels (0, 100 and 300 mM NaCl) on barley (Hordeum vulgare L.) cultivar "Pallas" inoculated with P. indica. Based on the analysis of variance, P. indica had a significant impact on the barley growth and shoot biomass under normal and salt stress conditions. P. indica modulated ion accumulation in colonized plants by increasing the foliar potassium (K(+))/sodium (Na(+)) ratio, as it is considered a reliable indicator of salt stress tolerance. P. indica induced calcium (Ca(2+)) accumulation and likely influenced the stress signal transduction. Subsequently, proteomic analysis of the barley leaf sheath using two-dimensional electrophoresis resulted in detection of 968 protein spots. Of these detected spots, the abundance of 72 protein spots changed significantly in response to salt treatment and P. indica-root colonization. Mass spectrometry analysis of responsive proteins led to the identification of 51 proteins. These proteins belonged to different functional categories including photosynthesis, cell antioxidant defense, protein translation and degradation, energy production, signal transduction and cell wall arrangement. Our results showed that P. indica induced a systemic response to salt stress by altering the physiological and proteome responses of the plant host.

  7. Phylogenetic and comparative gene expression analysis of barley (Hordeum vulgare)WRKY transcription factor family reveals putatively retained functions betweenmonocots and dicots

    Energy Technology Data Exchange (ETDEWEB)

    Mangelsen, Elke; Kilian, Joachim; Berendzen, Kenneth W.; Kolukisaoglu, Uner; Harter, Klaus; Jansson, Christer; Wanke, Dierk

    2008-02-01

    WRKY proteins belong to the WRKY-GCM1 superfamily of zinc finger transcription factors that have been subject to a large plant-specific diversification. For the cereal crop barley (Hordeum vulgare), three different WRKY proteins have been characterized so far, as regulators in sucrose signaling, in pathogen defense, and in response to cold and drought, respectively. However, their phylogenetic relationship remained unresolved. In this study, we used the available sequence information to identify a minimum number of 45 barley WRKY transcription factor (HvWRKY) genes. According to their structural features the HvWRKY factors were classified into the previously defined polyphyletic WRKY subgroups 1 to 3. Furthermore, we could assign putative orthologs of the HvWRKY proteins in Arabidopsis and rice. While in most cases clades of orthologous proteins were formed within each group or subgroup, other clades were composed of paralogous proteins for the grasses and Arabidopsis only, which is indicative of specific gene radiation events. To gain insight into their putative functions, we examined expression profiles of WRKY genes from publicly available microarray data resources and found group specific expression patterns. While putative orthologs of the HvWRKY transcription factors have been inferred from phylogenetic sequence analysis, we performed a comparative expression analysis of WRKY genes in Arabidopsis and barley. Indeed, highly correlative expression profiles were found between some of the putative orthologs. HvWRKY genes have not only undergone radiation in monocot or dicot species, but exhibit evolutionary traits specific to grasses. HvWRKY proteins exhibited not only sequence similarities between orthologs with Arabidopsis, but also relatedness in their expression patterns. This correlative expression is indicative for a putative conserved function of related WRKY proteins in mono- and dicot species.

  8. Red:far-red light conditions affect the emission of volatile organic compounds from barley (Hordeum vulgare), leading to altered biomass allocation in neighbouring plants

    Science.gov (United States)

    Kegge, Wouter; Ninkovic, Velemir; Glinwood, Robert; Welschen, Rob A. M.; Voesenek, Laurentius A. C. J.; Pierik, Ronald

    2015-01-01

    Background and Aims Volatile organic compounds (VOCs) play various roles in plant–plant interactions, and constitutively produced VOCs might act as a cue to sense neighbouring plants. Previous studies have shown that VOCs emitted from the barley (Hordeum vulgare) cultivar ‘Alva’ cause changes in biomass allocation in plants of the cultivar ‘Kara’. Other studies have shown that shading and the low red:far-red (R:FR) conditions that prevail at high plant densities can reduce the quantity and alter the composition of the VOCs emitted by Arabidopsis thaliana, but whether this affects plant–plant signalling remains unknown. This study therefore examines the effects of far-red light enrichment on VOC emissions and plant–plant signalling between ‘Alva’ and ‘Kara’. Methods The proximity of neighbouring plants was mimicked by supplemental far-red light treatment of VOC emitter plants of barley grown in growth chambers. Volatiles emitted by ‘Alva’ under control and far-red light-enriched conditions were analysed using gas chromatography–mass spectrometry (GC-MS). ‘Kara’ plants were exposed to the VOC blend emitted by the ‘Alva’ plants that were subjected to either of the light treatments. Dry matter partitioning, leaf area, stem and total root length were determined for ‘Kara’ plants exposed to ‘Alva’ VOCs, and also for ‘Alva’ plants exposed to either control or far-red-enriched light treatments. Key Results Total VOC emissions by ‘Alva’ were reduced under low R:FR conditions compared with control light conditions, although individual volatile compounds were found to be either suppressed, induced or not affected by R:FR. The altered composition of the VOC blend emitted by ‘Alva’ plants exposed to low R:FR was found to affect carbon allocation in receiver plants of ‘Kara’. Conclusions The results indicate that changes in R:FR light conditions influence the emissions of VOCs in barley, and that these altered emissions

  9. Red:far-red light conditions affect the emission of volatile organic compounds from barley (Hordeum vulgare), leading to altered biomass allocation in neighbouring plants.

    Science.gov (United States)

    Kegge, Wouter; Ninkovic, Velemir; Glinwood, Robert; Welschen, Rob A M; Voesenek, Laurentius A C J; Pierik, Ronald

    2015-05-01

    Volatile organic compounds (VOCs) play various roles in plant-plant interactions, and constitutively produced VOCs might act as a cue to sense neighbouring plants. Previous studies have shown that VOCs emitted from the barley (Hordeum vulgare) cultivar 'Alva' cause changes in biomass allocation in plants of the cultivar 'Kara'. Other studies have shown that shading and the low red:far-red (R:FR) conditions that prevail at high plant densities can reduce the quantity and alter the composition of the VOCs emitted by Arabidopsis thaliana, but whether this affects plant-plant signalling remains unknown. This study therefore examines the effects of far-red light enrichment on VOC emissions and plant-plant signalling between 'Alva' and 'Kara'. The proximity of neighbouring plants was mimicked by supplemental far-red light treatment of VOC emitter plants of barley grown in growth chambers. Volatiles emitted by 'Alva' under control and far-red light-enriched conditions were analysed using gas chromatography-mass spectrometry (GC-MS). 'Kara' plants were exposed to the VOC blend emitted by the 'Alva' plants that were subjected to either of the light treatments. Dry matter partitioning, leaf area, stem and total root length were determined for 'Kara' plants exposed to 'Alva' VOCs, and also for 'Alva' plants exposed to either control or far-red-enriched light treatments. Total VOC emissions by 'Alva' were reduced under low R:FR conditions compared with control light conditions, although individual volatile compounds were found to be either suppressed, induced or not affected by R:FR. The altered composition of the VOC blend emitted by 'Alva' plants exposed to low R:FR was found to affect carbon allocation in receiver plants of 'Kara'. The results indicate that changes in R:FR light conditions influence the emissions of VOCs in barley, and that these altered emissions affect VOC-mediated plant-plant interactions. © The Author 2015. Published by Oxford University Press on

  10. Efeitos de potenciais de água no solo, em diferentes estádios fenológicos da cultura da cevada (Hordeum vulgare L. Effects of soil water potentials at different phenological phases of barley crop (Hordeum vulgare L.

    Directory of Open Access Journals (Sweden)

    M.A. Urchei

    1994-12-01

    Full Text Available Objetivando avaliar os efeitos de défices hídricos, em três estádios fonológicos da cultura da cevada (Hordeum vulgare L., foi conduzido experimento em vasos, com delineamento em blocos ao acaso. Foram utilizados nove tratamentos decorrentes da combinação dos potenciais mínimos de água no solo de -0,05, -0,20 e -1,50 MPa, com os estádios fenológicos de máximo perfilhamento, florescimento e grão leitoso, permanecendo uniformizados durante o restante do ciclo, entre os potenciais de -0,01 a -0,05 MPa. Os resultados de produção, peso e teor de proteína dos grãos, tamanho de espigas, número total e número de espigas chochas, mostraram que os efeitos de défices hídricos variaram com a intensidade, duração e estádio fenológico da cultura, onde o estádio de florescimento mostrou-se mais sensível ao défice de água. A ocorrência de défice hídrico intenso, em cada um dos estádios, bem como ciclos repetidos de défices moderados ou intensos, levaram à diminuições significativas na produção de grãos, além de ocorrer tendência ao aumento do teor de protema dos grãos. O manejo da irrigação na cultura da cevada, quando se busca a máxima eficiência no uso da água, deve levar em conta os diferentes estádios fenológicos.The experiment was carried out under greenhouse conditions, with the objective of evaluating the effects of water deficits in three phenological phases of barley crop (Hordeum vulgare L.. Pots were arranged in a randomized block design with nine treatments. They originated from the combination of minimum soil water potentials of -0,05, -0,20 and -1,50 MPa, with the phenological phases of maximum tillering, flowering and milky grain, having been hold uniformly along the rest of the cycle, between -0,01 and -0,05 MPa potentials. Weight of grain, protein content, spike sizes, spike total number and number of hollow spikes, showed that water deficit effects varied with the intensity, duration and

  11. Hydrotime Analysis of Yellow Sweetclover (Melilotus officinalis (L. Lam., Wild Mustard (Sinapis arvensis L. and Barley (Hordeum vulgare L. Seed Germination

    Directory of Open Access Journals (Sweden)

    A. Derakhshan

    2017-01-01

    Full Text Available Introduction: Seed germination is one of the key stages in the life cycle of plants that can ultimately affect their fitness in the environment. The temporal pattern of seed germination is extremely depended on the soil water potential (Ψ of the germination medium, as this determines the equilibrium water content of the seed. As for temperature, there is a minimum Ψ that must be exceeded in order for seeds complete germination, and seeds in a population vary in the value of this minimum or base Ψ. The germination of a seed population in response to the reduced water potential is modeled using the hydrotime model. According to this model, the time to germination for a given seed fraction (g is inversely related to the difference between the current seed Ψ and the base water potential (Ψb for that fraction (Ψb(g. The hydrotime model functions are well in matching both the timing and the percentage of germination of seed populations in relation to their Ψ environment. In addition, the model outputs which are significant physiologically and ecologically and the parameters of the model can be used to characterize the properties of seed populations. Normal distribution of Ψb among seeds within a population is one of the assumptions of the hydrotime model. However, this assumption may not be met in many species and thus can result in poor predictions. We tried to investigate empirically the validity of this assumption, to compare the fit of alternative distributions and make recommendations to improve germination modeling procedures. Materials and Methods: Seed germination of Melilotus officinalis, Sinapis arvensis and Hordeum vulgare were tested across a range of water potentials (0, -0.2, -0.4, -0.6 and -0.8 MPa for M. officinalis and S. arvensis and 0, -0.3, -0.6, -0.9, -1.2 and -1.5 MPa for H. vulgare and germination responses were described by the hydrotime models based on twelve statistical functions including Normal, Beta, Gamma

  12. Salinity tolerance in barley (hordeum vulgare l.): effects of varying NaCl, K/sup +/ Na/sup +/ and NaHCO/sub 3/ levels on cultivars differing in tolerance

    International Nuclear Information System (INIS)

    Mahmood, K.

    2011-01-01

    Although barley (Hordeum vulgare L.) is regarded as salt tolerant among crop plants, its growth and plant development is severely affected by ionic and osmotic stresses in salt-affected soils. To elucidate the tolerance mechanism, growth and ion uptake of three barley cultivars, differing in salt tolerance, were examined under different levels of NaCl, K/sup +/ Na/sup +/ and NaHCO/sub 3/ in the root medium. The cultivars differed greatly in their responses to varying root medium conditions. Plant growth was more adversely affected by NaHCO/sub 3/ than NaCl. In general, biomass yields were comparable under control and 100 mM NaCl. However, growth of all three cultivars was significantly inhibited by NaHCO/sub 3/ even at low concentration (10 mM). Improved K/sup +/ supply in saline medium increased K/sup +/ uptake and growth of less tolerant cultivars. K/sup +/ uptake was more adversely affected by NaHCO/sub 3/ than NaCl salinity. Selective K/sup +/ uptake and lower Cl/sup -/ in shoots seemed to be associated with the growth responses. K application would help better growth of these cultivars on K-deficient saline-sodic soils and under irrigation with poor quality water having high Residual Sodium Carbonate (RSC) and/or Sodium Adsorption Ratio (SAR). (author)

  13. Direct Effects of Physcion, Chrysophanol, Emodin, and Pachybasin on Germination and Appressorium Formation of the Barley ( Hordeum vulgare L.) Powdery Mildew Fungus Blumeria graminis f. sp. hordei (DC.) Speer.

    Science.gov (United States)

    Hildebrandt, Ulrich; Marsell, Alexander; Riederer, Markus

    2018-04-04

    Several anthraquinone derivatives are active components of fungicidal formulations particularly effective against powdery mildew fungi. The antimildew effect of compounds such as physcion and chrysophanol is largely attributed to host plant defense induction. However, so far a direct fungistatic/fungicidal effect of anthraquinone derivatives on powdery mildew fungi has not been unequivocally demonstrated. By applying a Formvar-based in vitro system we demonstrate a direct, dose-dependent effect of physcion, chrysophanol, emodin, and pachybasin on conidial germination and appressorium formation of Blumeria graminis f. sp. hordei (DC.) Speer, the causative agent of barley ( Hordeum vulgare L.) powdery mildew. Physcion was the most effective among the tested compounds. At higher doses, physcion mainly inhibited conidial germination. At lower rates, however, a distinct interference with appressorium formation became discernible. Physcion and others may act by modulating both the infection capacity of the powdery mildew pathogen and host plant defense. Our results suggest a specific arrangement of substituents at the anthraquinone backbone structure being crucial for the direct antimildew effect.

  14. Development and Validation of a Reversed-Phase Liquid Chromatography Method for the Simultaneous Determination of Indole-3-Acetic Acid, Indole-3-Pyruvic Acid, and Abscisic Acid in Barley (Hordeum vulgare L.).

    Science.gov (United States)

    Nakurte, Ilva; Keisa, Anete; Rostoks, Nils

    2012-01-01

    A simple, sensitive, precise, and specific reverse HPLC method was developed and validated for the determination of plant hormones in barley (Hordeum vulgare L.). The method includes extraction in aqueous organic solvent followed by solid-phase extraction, sample evaporation, and reversed-phase HPLC analysis in a general purpose UV-visible (abscisic acid (ABA)) and fluorescence detection (indole-3-acetic acid (IAA) and indole-3-pyruvic acid (IPA)), high-performance liquid chromatography system. The separation was carried out on Zorbax Eclipse XDB C8 column (150  ×  4.6  mm I.D) with a mobile phase composed of methanol and 1% acetic acid (60 : 40 v/v) in isocratic mode at a flow rate of 1 ml min(-1). The detection was monitored at 270 nm (ABA) and at 282 nm (Ex) and 360 nm (Em) (IAA, IPA). The developed method was validated in terms of accuracy, precision, linearity, limit of detection, limit of quantification, and robustness. The determined validation parameters are in the commonly acceptable ranges for that kind of analysis.

  15. Japon Balığı (Carassius Auratus L. 1758) ve Arpa Bitkisinin (Hordeum Vulgare L.) Gelişimi ve Su Kalitesinin İyileştirilmesi Üzerine Aquaponik Sistemin Etkileri

    OpenAIRE

    KESKİNBALTA, Mehmet Anıl; HAMZAOĞLU, Gökhan; ÇELİK, Meryem Yeşim; DERNEKBAŞI, Seval

    2015-01-01

    Bu araştırmada, Japon balığı (Carassius auratus L. 1758) ve arpa bitkisi (Hordeum vulgare L.) kullanılarak model bir akuaponik sistem oluşturulmuştur. Araştırma süresince arpa bitkisinin suyun nitrit, nitrat ve fosfat değerlerinde yaptığı değişim ve balıkların gelişimi üzerindeki etkilerinin belirlenmesi amaçlanmıştır. 30 günlük araştırma süresince günlük olarak pH, sıcaklık ve oksijen değerleri ölçülmüştür. Haftalık olarak bitki yetiştirme yatağına giren ve bitkiden süzülen suyun nitrit (NO2...

  16. Japon Balığı (Carassius auratus L. 1758) ve Arpa Bitkisinin (Hordeum vulgare L.) Gelişimi ve Su Kalitesinin İyileştirilmesi Üzerine Aquaponik Sistemin Etkileri

    OpenAIRE

    KESKİNBALTA, Mehmet; HAMZAOĞLU, Gökhan; ÇELİK, Meryem; DERNEKBAŞI, Seval

    2015-01-01

    Bu araştırmada, Japon balığı (Carassius auratus L. 1758) ve arpa bitkisi (Hordeum vulgare L.) kullanılarak model bir akuaponik sistem oluşturulmuştur. Araştırma süresince arpa bitkisinin suyun nitrit, nitrat ve fosfat değerlerinde yaptığı değişim ve balıkların gelişimi üzerindeki etkilerinin belirlenmesi amaçlanmıştır. 30 günlük araştırma süresince günlük olarak pH, sıcaklık ve oksijen değerleri ölçülmüştür. Haftalık olarak bitki yetiştirme yatağına giren ve bitkiden süzülen suyun nitrit (NO2...

  17. Population genetic structure analysis in endangered Hordeum ...

    African Journals Online (AJOL)

    Administrator

    2011-09-07

    Sep 7, 2011 ... populations are grown by few local farmers in low-input farming systems. Based on 117 random ... Triticeae of the Poaceae (Graminae) family found throughout the ... populations and phylogeography is made easy by the.

  18. (Hordeum Vulgare) Crop Coefficient and Comparative Assessment

    African Journals Online (AJOL)

    Bheema

    The second prerequisite for sustainable use of water was developing/ ... Following the construction of .... pond capacity, the irrigation method, soil type, major crops grown in the area, and the ... determines the viability of any irrigation project. .... lack of awareness, lack of skill, technology and lack of adequate knowledge in ...

  19. Radiosensitivity study of cultured barley (hordeum vulgare)

    International Nuclear Information System (INIS)

    Wang Cailian; Shen Mei; Xu Gang; Zhao Kongnan; Chen Qiufang

    1991-07-01

    For studying the radioactivity, forty seven varieties of dormant barley seeds were irradiated with various doses (0 ∼ 400 Gy) of 137 Cs γ-rays. The results showed that the dose-effects relations of seedling growth inhibition could be fitted by an equation of F(D) = 1 - (1 - e -a 1 D ) N , and the dose-effects of cell-nucleus, the frequency of root tip cell with chromosome aberations and peroxidase isoenzyme band could be expressed by a linear regression equation Y = A + B · X. The radioactivity of naked barley was much higher than of covered barley. According to different radiosensitivities the varieties studied could be divided into five types i.e. extreme resistant, resistant, intermediate, sensitive, and extreme sensitive. The results also showed that there was close relationship between the DNA content of cell-nucleus, peroxidase isoenzyme zymogram and radioactivity. The radiosensitivty was proportional to the DNA content. The volume of cell-nucleus varied inversly as D 50 of nucleus volume and no obvious correlation with the D 50 of seedling growth inhibition

  20. Chromosome aberration assays in barley (Hordeum vulgare)

    Energy Technology Data Exchange (ETDEWEB)

    Constantin, M J [Univ. of Tennessee, Knoxville; Nilan, R A

    1982-01-01

    Barley is an exceellent organism for studies of induced chromosome aberrations because of its few (2n = 2x = 14) relatively large chromosomes. Root-tip and shoot-tip cells have been used extensively for the study of ionizing radiation-induced chromosome aberrations. The general procedures are well known, the technology is simple and easy to learn, and the assays are relatively quick and inexpensive. Both root tips and shoot tips can be used for the study of chemical mutagens as well as ionizing radiations. Pollen mother cells are well suited for studying the effects of mutagens on meiotic chromosomes. The literature review for the Gene-Tox Program reported on 61 chemicals tested for their effects on barley chromosomes. Of these, 90% were reported to be either positive or positive dose-related, while 7% were negative and 3% were questionable. Barley assays based on chromosomal aberrations are useful to detect the clastogenic potency of chemicals under laboratory conditions. Indications are that the data from barley can be used to corroborate data obtained from other organisms. Among the classes of chemicals assayed were: alcohols and phenols; alkaloids; epoxides; alkyl sulfates; amides and sulfonamides; aromatic amines; aryl halides; aziridines; alkenes; carbamates; hydroazides; nitroaromatics; nitrosamides; nitrosources; phenothiazines; and polycyclic aromatic hydrocarbons.

  1. Chemical weed control in barley (hordeum vulgare)

    International Nuclear Information System (INIS)

    Sarwar, M.; Hassan, S.W.; Abid, A.A.

    2008-01-01

    Effect of two different pre-emergence herbicides i.e. Terbutryn (lgron-500FW) A, 1.01.25 kg a.t. ha/sup -1/ and Flurochloridone (Racer-25 CS) a 0.31, 0.37, 0.44, 0.50 and 0.56 Kg a.i. ha/sup -1/ on weeds and yield of barley wad studied under field conditions hb/sup -1/. All the herbicides significantly reduce the dry weight of weed Maximum reduction (70%) was observed in terbutryn a 1.0 Kg a.i. ha/sup -1/ Growth and yield parameters like number of spike lets per spike. Number of grams per spike. 1000-grain weight. Biological yield. Grain yield straw yield and harvest index showed significant response to various herbicides doses under study. Application of Flurochloridone (Racer-25 (CS) a 0.44 kg a.i. ha/sup -1/ and Terbutryn (lgran-500 FW) a 1.0 kg a.i). The data further revealed that in general all herbicide application treatments exhibited superior performance in respect of growth and yield over control. (author)

  2. Genetic diversity in barley landraces (Hordeum vulgare L. subsp ...

    Indian Academy of Sciences (India)

    SDS-PAGE was performed to separate the extracted pro- teins by using 12% separating and 5% stacking gels with a. Mini Protean System from Bio-Rad according to Laemmli modified method (Laemmli 1970). In this study, we adopted constant current electrophoresis instead of constant voltage. The loading of sample was ...

  3. Genetic Variability in Barley (Hordeum vulgare l.) Landraces from ...

    African Journals Online (AJOL)

    segregating progenies with maximum genetic variability for selection. .... cultivar Clipper applied in slots of the first two, the tenth, and the last ... solution (50 ml glacial acetic acid, 200 ml methanol and 250 ml distilled water) ...... Adelaide, South.

  4. Radiosensitivities of cultured barley of different type (Hordeum vulgare)

    International Nuclear Information System (INIS)

    Wang Cailian; Shen Mei; Xu Gang; Zhao Kongnan

    1990-01-01

    The dormant seeds (with 13% moisture) of 47 barley varieties were irradiated with various doses (0-40 krad) of 137 Cs γ-rays. The radiosensitivities of naked barley was significantly higher than that of hulled barley. The sensitive coefficients of seedling height were 0.04945 and 0.03667 for naked barley and hulled barley, respectively. The radiosensitivity of four-row naked barley was significantly higher than that of two-row hulled barley and six-row hulled barley. 47 varieties studied could be divided into five types with different radiosensitivities, i.e. extreme resistant, resistant, intermediate, sensitive and extreme sensitive. It was also found that the dose-effect curves of cell nucleus volume had a peal at 30 krad

  5. Isolating Barley ( Hordeum vulgare L.) B1 Hordein Gene Promoter ...

    African Journals Online (AJOL)

    Promoters play the most important role in determining the temporal and spatial expression pattern and transcript level of a gene. Some strong constitutive promoters, such as cauliflower mosaic virus 35s promoter, are widely used in plant genetic engineering research. However, the expression levels of the foreign genes in ...

  6. Genetic diversity in barley landraces (Hordeum vulgare L. subsp ...

    Indian Academy of Sciences (India)

    its nutritional value and low glycemic index (Ullrich 2011). Lebanon belongs to the ... Rim Mzid and Farhat Chibani contributed equally to this work. biochemical accomplished ..... environment interaction of hordein content. J. Cereal Sci. 34,.

  7. DNA replication after mutagenic treatment in Hordeum vulgare.

    Science.gov (United States)

    Kwasniewska, Jolanta; Kus, Arita; Swoboda, Monika; Braszewska-Zalewska, Agnieszka

    2016-12-01

    The temporal and spatial properties of DNA replication in plants related to DNA damage and mutagenesis is poorly understood. Experiments were carried out to explore the relationships between DNA replication, chromatin structure and DNA damage in nuclei from barley root tips. We quantitavely analysed the topological organisation of replication foci using pulse EdU labelling during the S phase and its relationship with the DNA damage induced by mutagenic treatment with maleic hydrazide (MH), nitroso-N-methyl-urea (MNU) and gamma ray. Treatment with mutagens did not change the characteristic S-phase patterns in the nuclei; however, the frequencies of the S-phase-labelled cells after treatment differed from those observed in the control cells. The analyses of DNA replication in barley nuclei were extended to the micronuclei induced by mutagens. Replication in the chromatin of the micronuclei was rare. The results of simultanous TUNEL reaction to identify cells with DNA strand breaks and the labelling of the S-phase cells with EdU revealed the possibility of DNA replication occurring in damaged nuclei. For the first time, the intensity of EdU fluorescence to study the rate of DNA replication was analysed. Copyright © 2016 Elsevier B.V. All rights reserved.

  8. Effect Of Feeding Hordeum jabatum Hay Supplemented With ...

    African Journals Online (AJOL)

    There were no differences (P>0.05) in the dry matter, organic matter, neutral detergent fibre, acid detergent fibre and hemicellulose intake among treatments. There were however, significant (P<0.05) differences in the digestibility of nutrients among treatments. It was concluded that dried leaves of Leucaena leucocephala ...

  9. Powdery Mildew Resistance in 268 Entries of Hordeum vulgare

    DEFF Research Database (Denmark)

    Jiang, W.M.; Jørgensen, Jørgen Helms; Torp, J

    1984-01-01

    A collection of 24 'Spontaneum' barley [H. vulgare ssp. spontaneum] entries and one comprising 244 Ethiopian barleys [H. vulgare ssp. vulgare] were tested for resistance to 4 powdery mildew [used by Erysiphe graminis f. sp. hordei] cultures that carried genes for virulence corresponding to most...

  10. A weed suppressive index for spring barley (Hordeum vulgare) varieties

    DEFF Research Database (Denmark)

    Hansen, P K; Kristensen, K; Willas, J

    2008-01-01

    A screening programme for crop variety competitiveness would ideally be based on only a few, non-destructive measurements of key growth traits. In this study we measured the weed suppressive ability of 79 varieties of spring barley in two ways: (i) directly, by weed coverage assessments under wee...

  11. Diversity in Indian barley (Hordeum vulgare) cultivars and ...

    Indian Academy of Sciences (India)

    tinguish varieties of crop plants and establish their purity as a prerequisite for any ... of genetic material in germplasm collection and as a general guide for the choice ... Sixty-nine barley cultivars were grown under field condi- tions in three ...

  12. Isolating Barley (Hordeum vulgare L.) B1 Hordein Gene Promoter ...

    African Journals Online (AJOL)

    Yomi

    2012-04-10

    Apr 10, 2012 ... proline and glutamine (Piston et al., 2004). The four main groups of ... account for approximately 50% of the total protein in the. *Corresponding author. ..... inheritance, chromosomal location, and population dynamics. PNAS,.

  13. Comparison of stability statistics for yield in barley (Hordeum vulgare ...

    African Journals Online (AJOL)

    STORAGESEVER

    2010-03-15

    Mar 15, 2010 ... statistics and yield indicated that only TOP method would be useful for simultaneously selecting for high yield and ... metric stability methods; i) they reduce the bias caused by outliers, ii) ...... Biometrics, 43: 45-53. Sabaghnia N ...

  14. Registration of Food Barley (Hordeum vulgare L.) Variety HB 1307 ...

    African Journals Online (AJOL)

    Six-rowed food type barley, HB 1307, was developed by Holetta Agricultural Research Center (HARC) from a cross between a landrace line and exotic germplasm (Awra gebs-1 x IBON93/91) and released in 2006 for mid and high altitude areas. The three consecutive years\\' (2002-2004) tests proved its superiority in grain ...

  15. Identification of a Phytase Gene in Barley (Hordeum vulgare L.)

    Science.gov (United States)

    Dai, Fei; Qiu, Long; Ye, Lingzhen; Wu, Dezhi; Zhou, Meixue; Zhang, Guoping

    2011-01-01

    Background Endogenous phytase plays a crucial role in phytate degradation and is thus closely related to nutrient efficiency in barley products. The understanding of genetic information of phytase in barley can provide a useful tool for breeding new barley varieties with high phytase activity. Methodology/Principal Findings Quantitative trait loci (QTL) analysis for phytase activity was conducted using a doubled haploid population. Phytase protein was purified and identified by the LC-ESI MS/MS Shotgun method. Purple acid phosphatase (PAP) gene was sequenced and the position was compared with the QTL controlling phytase activity. A major QTL for phytase activity was mapped to chromosome 5 H in barley. The gene controlling phytase activity in the region was named as mqPhy. The gene HvPAP a was mapped to the same position as mqPhy, supporting the colinearity between HvPAP a and mqPhy. Conclusions/Significance It is the first report on QTLs for phytase activity and the results showed that HvPAP a, which shares a same position with the QTL, is a major phytase gene in barley grains. PMID:21533044

  16. Identification of a phytase gene in barley (Hordeum vulgare L..

    Directory of Open Access Journals (Sweden)

    Fei Dai

    Full Text Available BACKGROUND: Endogenous phytase plays a crucial role in phytate degradation and is thus closely related to nutrient efficiency in barley products. The understanding of genetic information of phytase in barley can provide a useful tool for breeding new barley varieties with high phytase activity. METHODOLOGY/PRINCIPAL FINDINGS: Quantitative trait loci (QTL analysis for phytase activity was conducted using a doubled haploid population. Phytase protein was purified and identified by the LC-ESI MS/MS Shotgun method. Purple acid phosphatase (PAP gene was sequenced and the position was compared with the QTL controlling phytase activity. A major QTL for phytase activity was mapped to chromosome 5 H in barley. The gene controlling phytase activity in the region was named as mqPhy. The gene HvPAP a was mapped to the same position as mqPhy, supporting the colinearity between HvPAP a and mqPhy. CONCLUSIONS/SIGNIFICANCE: It is the first report on QTLs for phytase activity and the results showed that HvPAP a, which shares a same position with the QTL, is a major phytase gene in barley grains.

  17. Latent manganese deficiency increases transpiration in barley (Hordeum vulgare).

    Science.gov (United States)

    Hebbern, Christopher A; Laursen, Kristian Holst; Ladegaard, Anne H; Schmidt, Sidsel B; Pedas, Pai; Bruhn, Dan; Schjoerring, Jan K; Wulfsohn, Dvoralai; Husted, Søren

    2009-03-01

    To investigate if latent manganese (Mn) deficiency leads to increased transpiration, barley plants were grown for 10 weeks in hydroponics with daily additions of Mn in the low nM range. The Mn-starved plants did not exhibit visual leaf symptoms of Mn deficiency, but Chl a fluorescence measurements revealed that the quantum yield efficiency of PSII (F(v)/F(m)) was reduced from 0.83 in Mn-sufficient control plants to below 0.5 in Mn-starved plants. Leaf Mn concentrations declined from 30 to 7 microg Mn g(-1) dry weight in control and Mn-starved plants, respectively. Mn-starved plants had up to four-fold higher transpiration than control plants. Stomatal closure and opening upon light/dark transitions took place at the same rate in both Mn treatments, but the nocturnal leaf conductance for water vapour was still twice as high in Mn-starved plants compared with the control. The observed increase in transpiration was substantiated by (13)C-isotope discrimination analysis and gravimetric measurement of the water consumption, showing significantly lower water use efficiency in Mn-starved plants. The extractable wax content of leaves of Mn-starved plants was approximately 40% lower than that in control plants, and it is concluded that the increased leaf conductance and higher transpirational water loss are correlated with a reduction in the epicuticular wax layer under Mn deficiency.

  18. Cell size and cell number in dwarf mutants of barley (Hordeum vulgare)

    International Nuclear Information System (INIS)

    Blonstein, A.D.; Gale, M.D.

    1984-01-01

    Sixteen height mutants, induced by sodium azide treatment of the two-rowed barley variety Proctor, have been used to investigate the relationship between the extent and nature of stem shortening with alterations in cell size and cell number, and the pleiotropic effects of dwarfing genes on vegetative development and agronomic performance. The studies on epidermal cell number and cell length in the developmentally earliest and latest elongated vegetative tissues - the coleoptile and peduncle resprectively - suggest that cell number may be the primary determinant of plant height. One semi-prostrate and one erectoides mutant are used to illustrate different cell number/cell size strategies and their relationships with gibberellin sensitivity, growth rate and lodging resistance are discussed. (author)

  19. Orientation of Germ Tubes of Puccinia hordei on the Hordeum chilense Leaf Surface

    NARCIS (Netherlands)

    Vaz Patto, M.C.; Niks, R.E.

    2000-01-01

    The directional growth of urediospores germ tubes along the transverse axis of a cereal's leaf is considered to be a response to stimuli from the plant surface. In order to find out if the germ tube growth is directed towards stomata, and if the cuticular wax layer plays a role in this orientated

  20. Effect of herbicide clomazone on photosynthetic processes in primary barley (Hordeum vulgare L.) leaves

    Czech Academy of Sciences Publication Activity Database

    Kaňa, R.; Špundová, M.; Ilík, P.; Lazár, D.; Klem, K.; Tomek, P.; Nauš, J.; Prášil, Ondřej

    2004-01-01

    Roč. 78, - (2004), s. 161-170 ISSN 0048-3575 R&D Projects: GA ČR GA522/00/1274; GA ČR GP522/01/P098 Institutional research plan: CEZ:AV0Z5020903 Keywords : clomazone * herbicide * photosynthesis Subject RIV: ED - Physiology Impact factor: 1.133, year: 2004

  1. Effect of low doses of gamma radiation on barley's (Hordeum Vulgare L.) susceptibility to cochliobolus sativus

    International Nuclear Information System (INIS)

    Jawher, M.; Arabi, I. E.

    1998-03-01

    Two barley genotypes (Tadmor, W12291), and one promising line selected in AECS (76) were exposed to 60 cobalt gamma radiation. The doses used were: 0, 10, 15, 20, 30, 40 and 50 Gy. Susceptibility assessments were scored using a rating scale extending from 1 (highly resistant) to 5 (very susceptible) according to the percentage of infected area at subcrown interodes. In general, doses of 10, 15, 20 and 30 Gy increased the resistance to the pathogen Cochliobolus sativus by 56.29%, 58.29%, 54.57% and 49.71% respectively. The genotypes did not response similarly to the irradiation. The best response was obtained with c.v Tadmor. (author)

  2. Latent manganese deficiency increases transpiration in barley (Hordeum vulgare)

    DEFF Research Database (Denmark)

    Hebbern, Christopher Alan; Laursen, Kristian Holst; Ladegaard, Anne Hald

    2009-01-01

    To investigate if latent manganese (Mn) deficiency leads to increased transpiration, barley plants were grown for 10 weeks in hydroponics with daily additions of Mn in the low nM range. The Mn-starved plants did not exhibit visual leaf symptoms of Mn deficiency, but Chl a fluorescence measurements...

  3. A study on the qualitative and quantitative traits of barley (Hordeum ...

    African Journals Online (AJOL)

    user

    Key words: Qualitative and quantitative, barley, narbon vetch, weed, dry land. ... and biomass production (Baishya and Sharma, 1990; ..... pakistan. Digitalverlag gmbh, germany. 157: 1-5. Pisulewska E, Hanczowski P, Pisulewski P (2003).

  4. Bioaccessible mineral content of malted finger millet (Eleusine coracana), wheat (Triticum aestivum), and barley (Hordeum vulgare).

    Science.gov (United States)

    Platel, Kalpana; Eipeson, Sushma W; Srinivasan, Krishnapura

    2010-07-14

    Malted grains are extensively used in weaning and geriatric foods. Malting generally improves the nutrient content and digestibility of foods. The present investigation examined the influence of malting of finger millet, wheat, and barley on the bioaccessibility of iron, zinc, calcium, copper, and manganese. Malting increased the bioaccessibility of iron by >3-fold from the two varieties of finger millet and by >2-fold from wheat, whereas such a beneficial influence was not seen in barley. The bioaccessibility of zinc from wheat and barley increased to an extent of 234 and 100%, respectively, as a result of malting. However, malting reduced the bioaccessibility of zinc from finger millet. Malting marginally increased the bioaccessibility of calcium from white finger millet and wheat. Whereas malting did not exert any influence on bioaccessibility of copper from finger millet and wheat, it significantly decreased (75%) the same from barley. Malting did increase the bioaccessibility of manganese from brown finger millet (17%) and wheat (42%). Thus, malting could be an appropriate food-based strategy to derive iron and other minerals maximally from food grains.

  5. Effects of aerial pollutants on cereal growth. [Hordeum vulgare var. Maris Otter

    Energy Technology Data Exchange (ETDEWEB)

    1975-01-01

    Winter barley, var. Maris Otter, was grown at Woburn Experimental Farm in three closed plastic chambers with either filtered, ambient or sulfur dioxide-polluted air. The mean sulfur dioxide levels were 7.2 ..mu..g m/sup -3/, 37 ..mu..g m/sup -3/ for the filtered and ambient chambers respectively. In the field the mean value was 51.5 ..mu..g m/sup -3/ . Temperature and relative humidity in these closed houses differed from the outside. No visible damage occurred on any of the plants grown in the filtered or ambient air. In the fumigated chamber a high dose of sulfur dioxide was given for one week (19-25 April 1975), producing a mean concentration of 951 ..mu..g m/sup -3/, at the four-leaf stage. It caused severe necrosis of the leaves. The plants subsequently recovered and no further fumigations were given. At final harvest these plants were not significantly lower in total dry weight and grain weight from the ambient plants. The dry matter yield of the plants grown in filtered air was higher than that of plants in ambient air.

  6. Improving nitrogen use efficiency in barley (Hordeum vulgare L.) through the cisgenic approach

    DEFF Research Database (Denmark)

    Kichey, Thomas Michel René; Holme, Inger; Møller, Inge Skrumsager

    2009-01-01

    into the pGreenII binary vector. The genes have been inserted into barley by Agrobacterium-mediated transformation using the hygromycin phosphotransferase gene for selection of transformed lines on hygromycin. In this system, the resistance gene is placed on the helper plasmid pSoup allowing for separate...

  7. Malt quality of 4 barley (Hordeum vulgare L.) grain varieties grown ...

    African Journals Online (AJOL)

    user

    2011-01-31

    Jan 31, 2011 ... Grain flour starch pasting and malt qualities were analyzed. .... bags and stored in a cool place (ca. ... Pasting properties of four malting barely varieties grain flour starches and the effect of three fungicide (propiconazole) spray.

  8. Retardation of senescence by UV-A light in barley (Hordeum vulgare L.) leaf segments

    International Nuclear Information System (INIS)

    Cuello, J.; Sanchez, M.D.; Sabater, B.

    1994-01-01

    The effects of low intensity (0.9–2.2 W m −2 ) UV-A radiation on barley leaf senescence were investigated. UV-A inhibited chlorophyll loss and caused increases in membrane permeability and chloroplast endopeptidases associated with senescence. The treatment of leaf segments with UV-A changed the type of proteins synthesized by chloroplasts, stimulating the synthesis of some specific polypeptides. It is concluded that the senescence of detached leaves provides an appropriate system for investigating effects of low UV-A intensities which are probably mediated by synthesis of specific proteins. (author)

  9. Giemsa C-banding Karyotypes of Two Subspecies of Hordeum brevisubulatum from China

    DEFF Research Database (Denmark)

    Linde-Laursen, Ib; Bothmer, R.

    1984-01-01

    . Nucleolar organizer region polymorphisms were demonstrated through silver nitrate staining of nucleoli. C-banding patterns corroborated that tetra- and hexaploid cytotypes of subsp.turkestanicum form an autopolyploid series. Reliable identification ofH. brevisubulatum taxa based on cytological criteria...

  10. Catalase activity of a crude enzyme preparation from iron-chlorotic barley (Hordeum vulgaris) seedlings

    Energy Technology Data Exchange (ETDEWEB)

    Kotaka, S; Krueger, A P; Andriese, P C

    1964-12-19

    An attempt is made to investigate the effect of Fe-EDTA on catalase activity of the enzyme preparation from iron-chlorotic barley. It has been observed that the addition of iron in the form of iron-potassium-ethylene-tetraacetate to cell-free extracts prepared from barley seedlings which had developed chlorosis produced a marked increase in the catalase activity of the extracts. Results are presented which indicate that the pattern of increase in catalase activity is related to the extent of chlorosis. 7 references, 3 figures.

  11. Involvement of ABA in induction of secondary dormancy in barley (Hordeum vulgare L.) seeds.

    Science.gov (United States)

    Leymarie, Juliette; Robayo-Romero, Maria Emilia; Gendreau, Emmanuel; Benech-Arnold, Roberto L; Corbineau, Françoise

    2008-12-01

    At harvest, barley seeds are dormant because their germination is difficult above 20 degrees C. Incubation of primary dormant seeds at 30 degrees C, a temperature at which they do not germinate, results in a loss of their ability to germinate at 20 degrees C. This phenomenon which corresponds to an induction of a secondary dormancy is already observed after a pre-treatment at 30 degrees C as short as 4-6 h, and is optimal after 24-48 h. It is associated with maintenance of a high level of embryo ABA content during seed incubation at 30 degrees C, and after seed transfer at 20 degrees C, while ABA content decreases rapidly in embryos of primary dormant seeds placed directly at 20 degrees C. Induction of secondary dormancy also results in an increase in embryo responsiveness to ABA at 20 degrees C. Application of ABA during seed treatment at 30 degrees C has no significant additive effect on the further germination at 20 degrees C. In contrast, incubation of primary dormant seeds at 20 degrees C for 48 and 72 h in the presence of ABA inhibits further germination on water similarly to 24-48 h incubation at 30 degrees C. However fluridone, an inhibitor of ABA synthesis, applied during incubation of the grains at 30 degrees C has only a slight effect on ABA content and secondary dormancy. Expression of genes involved in ABA metabolism (HvABA8'OH-1, HvNCED1 and HvNCED2) was studied in relation to the expression of primary and secondary dormancies. The results presented suggest a specific role for HvNCED1 and HvNCED2 in regulation of ABA synthesis in secondary seed dormancy.

  12. Barley (Hordeum vulgare L.) cysteine proteases: heterologous expression, purification and characterization

    DEFF Research Database (Denmark)

    Rosenkilde, Anne Lind; Dionisio, Giuseppe; Holm, Preben Bach

    2011-01-01

    During germination of barley seeds, mobilization of protein is essential and cysteine proteases accounts for more than 90 % of the total proteolytic activity in the degradation of barley seed storage proteins. Cysteine proteases exist as pro-enzyme and is activated through reduction of the active...... site cysteines and by removal of the pro-domain. The complement of cysteine proteases is comprehensive and for detailed studies of the individual components of this complement, a fast and efficient eukaryotic expression platform is highly desirable. A cDNA clone of the barley key cysteine endoprotease...

  13. Luteibacter rhizovicinus MIMR1 promotes root development in barley (Hordeum vulgare L.) under laboratory conditions.

    Science.gov (United States)

    Guglielmetti, Simone; Basilico, Roberto; Taverniti, Valentina; Arioli, Stefania; Piagnani, Claudia; Bernacchi, Andrea

    2013-11-01

    In order to preserve environmental quality, alternative strategies to chemical-intensive agriculture are strongly needed. In this study, we characterized in vitro the potential plant growth promoting (PGP) properties of a gamma-proteobacterium, named MIMR1, originally isolated from apple shoots in micropropagation. The analysis of the 16S rRNA gene sequence allowed the taxonomic identification of MIMR1 as Luteibacter rhizovicinus. The PGP properties of MIMR1 were compared to Pseudomonas chlororaphis subsp. aurantiaca DSM 19603(T), which was selected as a reference PGP bacterium. By means of in vitro experiments, we showed that L. rhizovicinus MIMR1 and P. chlororaphis DSM 19603(T) have the ability to produce molecules able to chelate ferric ions and solubilize monocalcium phosphate. On the contrary, both strains were apparently unable to solubilize tricalcium phosphate. Furthermore, the ability to produce 3-indol acetic acid by MIMR1 was approximately three times higher than that of DSM 19603(T). By using fluorescent recombinants of strains MIMR1 and DSM 19603(T), we also demonstrated that both bacteria are able to abundantly proliferate and colonize the barley rhizosphere, preferentially localizing on root tips and in the rhizoplane. Finally, we observed a negative effect of DSM 19603(T) on barley seed germination and plant growth, whereas MIMR1, compared to the control, determined a significant increase of the weight of aerial part (+22 %), and the weight and length of roots (+53 and +32 %, respectively). The results obtained in this work make L. rhizovicinus MIMR1 a good candidate for possible use in the formulation of bio-fertilizers.

  14. Modification of mutation process in radiated seeds oat (Avena sativa L.) and barley (Hordeum vulgare L.)

    International Nuclear Information System (INIS)

    Shishlov, M.P.

    2007-01-01

    The results of a long-term investigations for experimental mutagenesis of oats and barley are reported in the article. It was found the problem of modification of a mutant process to spread spectrum and increase the general induction frequency and display of macro- and micro mutations. Application as modificators of salts the heavy metals, inhibitors of nuclein, protein synthesis and energy returned processes and also doses spectrum and its strength of gamma-radiation and ultrasound allowed to increase the general frequency of mutant induction of barley and oats on 1-2 order. On the base of evaluation of correlative links between the attributes variability in M1 and M2 generations it was formulated a conception of guarantied creation of mutant forms of the grain crops. (authors)

  15. Microarray Analysis of Late Response to Boron Toxicity in Barley (Hordeum vulgare L.) Leaves

    NARCIS (Netherlands)

    Oz, M.T.; Yilmaz, R.; Eyidogan, F.; Graaff, de L.H.; Yucel, M.; Oktem, H.A.

    2009-01-01

    DNA microarrays, being high-density and high-throughput, allow quantitative analyses of thousands of genes and their expression patterns in parallel. In this study, Barley1 GereChip was used to investigate transcriptome changes associated with boron (B) toxicity in a sensitive barley cultivar

  16. Diversity in boron toxicity tolerance of Australian barley (Hordeum vulgare L.) genotypes.

    Science.gov (United States)

    Hayes, Julie E; Pallotta, Margaret; Garcia, Melissa; Öz, Mehmet Tufan; Rongala, Jay; Sutton, Tim

    2015-09-26

    Boron (B) is an important micronutrient for plant growth, but is toxic when levels are too high. This commonly occurs in environments with alkaline soils and relatively low rainfall, including many of the cereal growing regions of southern Australia. Four major genetic loci controlling tolerance to high soil B have been identified in the landrace barley, Sahara 3771. Genes underlying two of the loci encode the B transporters HvBot1 and HvNIP2;1. We investigated sequence and expression level diversity in HvBot1 and HvNIP2;1 across barley germplasm, and identified five novel coding sequence alleles for HvBot1. Lines were identified containing either single or multiple copies of the Sahara HvBot1 allele. We established that only the tandemly duplicated Sahara allele conferred B tolerance, and this duplicated allele was found only in a set of nine lines accessioned in Australian collections as Sahara 3763-3771. HvNIP2;1 coding sequences were highly conserved across barley germplasm. We identified the likely causative SNP in the 5'UTR of Sahara HvNIP2;1, and propose that the creation of a small upstream open reading frame interferes with HvNIP2;1 translation in Sahara 3771. Similar to HvBot1, the tolerant HvNIP2;1 allele was unique to the Sahara barley accessions. We identified a new source of the 2H B tolerance allele controlling leaf symptom development, in the landrace Ethiopia 756. Ethiopia 756, as well as the cultivar Sloop Vic which carries both the 2H and HvBot1 B tolerance alleles derived from Sahara 3771, may be valuable as alternative parents in breeding programs targeted to high soil B environments. There is significant diversity in B toxicity tolerance among contemporary Australian barley varieties but this is not related to variation at any of the four known B tolerance loci, indicating that novel, as yet undiscovered, sources of tolerance exist.

  17. Environmental, phenotypic and genetic variation of wild barley (Hordeum spontaneum) from Israel

    NARCIS (Netherlands)

    Vanhala, T.; Rijn, C.P.E.; Buntjer, J.; Stam, P.; Nevo, E.; Poorter, H.; Eeuwijk, van F.A.

    2004-01-01

    Wild relatives of crop plants offer an attractive gene pool for cultivar improvement. We evaluated genetic and phenotypic variation for a set of 72 Israeli accessions of wild barley from 21 populations. These populations were grouped further into four ecotypes. In addition, environmental variables

  18. Diversity for seedling vigor in wild barley (hordeum vulgare L. subs. simpatina) germplasm

    International Nuclear Information System (INIS)

    Tyagi, K.; Park, M.R.; Lee, H.J.; Lee, C.A.; Rehman, S.; Steffenson, B.; Lee, K.J.; Yun, S.J.

    2011-01-01

    Seedling vigor is important for improving stand establishment of barley crops, particularly in arid regions and areas where the soil temperature is low at sowing time. Three hundred and fifteen wild barley accessions from the Wild Barley Diversity Collection (WBDC) were evaluated for nine seedling vigor traits in a poly house and growth chamber under hydroponic conditions. The accessions exhibited significant differences for all traits investigated. Traits showing greatest phenotypic variation were seedling visual score, plant height, shoot fresh weight, shoot dry weight and shoot length. Seed weight exhibited the least variation. Seed weight was significantly correlated with visual seedling score and shoot and seedling fresh and dry weight. Correlation analysis showed that the visual seedling score was a reliable method for estimating seedling vigor in wild barley. The first three principal components (PC) explained 82.3% of the variation present in the WBDC with PC1(54.0%) associated with shoot fresh weight, shoot dry weight, seedling dry weight, seedling fresh weight, shoot length and seedling length. Accessions from the southwest portion of the Fertile Crescent, like WBDC020 (Turkey), WBDC238 (Jordan) and WBDC244 (Jordan) exhibited the highest positive values for most of the plant vigor traits investigated. These wild barley accessions likely carry alleles that will be useful for the improvement of plant vigor traits in cultivated barley. (author)

  19. The composite water and solute transport of barley (Hordeum vulgare) roots: effect of suberized barriers.

    Science.gov (United States)

    Ranathunge, Kosala; Kim, Yangmin X; Wassmann, Friedrich; Kreszies, Tino; Zeisler, Viktoria; Schreiber, Lukas

    2017-03-01

    Roots have complex anatomical structures, and certain localized cell layers develop suberized apoplastic barriers. The size and tightness of these barriers depend on the growth conditions and on the age of the root. Such complex anatomical structures result in a composite water and solute transport in roots. Development of apoplastic barriers along barley seminal roots was detected using various staining methods, and the suberin amounts in the apical and basal zones were analysed using gas chromatography-mass spectometry (GC-MS). The hydraulic conductivity of roots ( Lp r ) and of cortical cells ( Lp c ) was measured using root and cell pressure probes. When grown in hydroponics, barley roots did not form an exodermis, even at their basal zones. However, they developed an endodermis. Endodermal Casparian bands first appeared as 'dots' as early as at 20 mm from the apex, whereas a patchy suberin lamellae appeared at 60 mm. The endodermal suberin accounted for the total suberin of the roots. The absolute amount in the basal zone was significantly higher than in the apical zone, which was inversely proportional to the Lp r . Comparison of Lp r and Lp c suggested that cell to cell pathways dominate for water transport in roots. However, the calculation of Lp r from Lp c showed that at least 26 % of water transport occurs through the apoplast. Roots had different solute permeabilities ( P sr ) and reflection coefficients ( σ sr ) for the solutes used. The σ sr was below unity for the solutes, which have virtually zero permeability for semi-permeable membranes. Suberized endodermis significantly reduces Lp r of seminal roots. The water and solute transport across barley roots is composite in nature and they do not behave like ideal osmometers. The composite transport model should be extended by adding components arranged in series (cortex, endodermis) in addition to the currently included components arranged in parallel (apoplastic, cell to cell pathways). © The Author 2017. Published by Oxford University Press on behalf of the Annals of Botany Company.

  20. Durable resistance to net blotch and agronomic performance in some barley mutants [Hordeum vulgare L.; Syria

    International Nuclear Information System (INIS)

    Arabi, M.I.E.

    2004-01-01

    Seeds from the net blotch (Pyrenophora teres) susceptible cultivar Thibaut were treated by gamma ray radiation and subsequently evaluated for reaction to the pathogen in the M2-M5 generations. Grain yield and agronomic characteristics of putative mutants were compared with Thibaut in two different locations. Genetic variation among some mutant lines/cv Thibaut was estimated using Amplified Fragment Length Polymorphism (AFLP) markers. Sixteen mutant lines and their mother cultivar Thibaut were analyzed with 14 EcoR1-Mse1 primer combinations. A total number of 504 AFLP bands were analyzed for each pair mutant/Thibaut. Narrow genetic variation among all genotypes was detected with an average of genetic similarity of 0.96. Cluster analysis with the entire AFLP data divided all genotypes into two major groups. The resistant mutant lines were grouped in one subcluster with 0.98 similarity index. Some resistant mutant lines to net blotch with good agronomic performances were produced [it

  1. Effect of gamma irradiation (60CO) on quatitative characters of barley (Hordeum vulgare)

    International Nuclear Information System (INIS)

    Santana, T.C.; Gonzalez, F.C.

    1984-01-01

    Seeds od f a barley line were irradiated with doses ranging from O to 64 Kr of gamma radiation for three consecutive generations (R1,R2 and R3). From these, several mutant generations were obtained in the field, planting at a commercial density and without selection. (M.A.C.) [pt

  2. Impact of mineral fertilizers on common winter barley (Hordeum vulgare L. agrophytocenosis development

    Directory of Open Access Journals (Sweden)

    Я. М. Мукан

    2014-04-01

    Full Text Available In 2011 to 2013 a study was completed for the impact of varying rates of fertilizing onto the indices of productivity for barley agrophytocenosis of Helios and Commandor, in particular, such its components as a number of productive stems, number of seeds per ear, potential biological activity of ear and photosynthetic apparatus. It is found that the level of spring barley agrophytocenosis productivity is subject both to varietal peculiarities and the rate of mineral fertilizer application. When applying N 60P 60K 60 і N 90P 90K 90 the highest potential and biological productivity of Helios and Commandor was recorder as compared against the control. Impact of varying application rates for fertilizers onto the components of ear biological productivity has been scrutinized. The qualitative composition of ear is a clear expression of variety phenotype and identifies the level of biological yield for spring barley. Application of N 60 P 60 K 60 і N 90 P 90 K 90 mineral fertilizers fairly increased the average leaf surface, photosynthetic lead capacity of varieties in 2 to 2.5 times, as well as FAR efficiency coefficient in 1.5 to 2.0 times as against control that thus contributed to the development of highest biological yield of Helios variety phytomass at the level of 14.9 to 15.0, grain – 7.8 to 8.0 ton per ha and, respectively, 12.7 and 7.5 tons per ha for Comandor variety.

  3. Construction of a map-based reference genome sequence for barley, Hordeum vulgare L.

    Czech Academy of Sciences Publication Activity Database

    Beier, S.; Himmelbach, A.; Colmsee, C.; Zhang, X. Q.; Barrero, R. A.; Hastie, A.; Šimková, Hana; Staňková, Helena; Vrána, Jan; Chan, S.; Zhou, G.; Poland, J.; Bellgard, M. I.; Houben, A.; Doležel, Jaroslav; Ayling, S.; Lonardi, S.; Scholz, U.; Stein, N.; Mascher, M.

    2017-01-01

    Roč. 4, APR 27 (2017), č. článku 170044. ISSN 2052-4463 R&D Projects: GA MŠk(CZ) LO1204 Institutional support: RVO:61389030 Keywords : BACTERIAL ARTIFICIAL CHROMOSOMES * PHYSICAL MAP * LIBRARIES Subject RIV: EB - Genetics ; Molecular Biology OBOR OECD: Plant sciences, botany Impact factor: 4.836, year: 2016

  4. Malt quality of 4 barley (Hordeum vulgare L.) grain varieties grown ...

    African Journals Online (AJOL)

    user

    2011-01-31

    Jan 31, 2011 ... 76.6 to 79.7%). The varieties had a pasting- time and -temperature (Ti) of 4.7 to 5.0 min and 64.7 to .... 16°C) (Termaks chamber KBP 6395F, Bergen, Norway). Each .... varieties in the peak viscosity is in part attributed to the.

  5. Characterization of Gene Candidates for Vacuolar Sodium Transport from Hordeum Vulgare

    KAUST Repository

    Scheu, Arne Hagen August

    2017-01-01

    Various potential causes are discussed, including inaccuracies in the genome resource used as reference for primer design and issues inherent to the model system. Finally, I make suggestions on how to proceed to further characterize the candidate genes and hopefully identify novel sodium transporters from barley.

  6. Lysine-Rich Proteins in High-Lysine Hordeum Vulgare Grain

    DEFF Research Database (Denmark)

    Ingversen, J.; Køie, B.

    1973-01-01

    The salt-soluble proteins in barley grain selected for high-lysine content (Hiproly, CI 7115 and the mutants 29 and 86) and of a control (Carlsberg II) with normal lysine content, contain identical major proteins as determined by MW and electrophoretic mobility. The concentration of a protein gro...

  7. Transformation of barley (Hordeum vulgare L.) by Agrobacterium tumefaciens infection of in vitro cultured ovules

    DEFF Research Database (Denmark)

    Holme, Inger; Brinch-Pedersen, Henrik; Lange, Mette

    2012-01-01

    Agrobacterium-mediated transformation of in vitro cultured barley ovules is an attractive alternative to well-established barley transformation methods of immature embryos. The ovule culture system can be used for transformation with and without selection and has successfully been used to transfo...

  8. Identification and isoforms specificity of barley (Hordeum vulgare) grain proteinaceous inhibitors of commercial feed protease

    DEFF Research Database (Denmark)

    Dionisio, Giuseppe; Brinch-Pedersen, Henrik

    2016-01-01

    Protease is commonly used as feed additive. Ronozyme® ProAct, a subtilisin-like serine feed protease is different from the already characterized Bacillus subtilisin-like serine protease. When used in wheat and barley based feed, its degree of efficiency differs according to the cultivar in analys...

  9. Frequency of Aneuploids in Progenies of Autotriploid Barley, Hordeum Vulgare L

    DEFF Research Database (Denmark)

    Sandfær, J.

    1979-01-01

    Chromosome counts of 863 progeny plants originating from 68 autotriploid barley plants revealed a considerable variation in chromosome numbers ranging from the diploid number (2n= 14) to 2n= 39. The most frequent groups were plants with 15 and 16 chromosomes each constituting about 27% of all pro...

  10. Mycoflora Of Barley Hordeum Vulgare L. At Different Locations In Hail Area- Saudi Arabia

    Directory of Open Access Journals (Sweden)

    Elham S. Dawood

    2015-05-01

    Full Text Available Abstract 400 grain samples collected from barley fields in Hail area at the northern part of Saudi Arabia was used for this study. Isolation and identification of seed-borne fungi were conducted according to standard tests described by the International Seed Testing Association ISTA using YGCA medium. A total of 265 of external mycoflora and 517 of internal mycoflora were grouped into five fungal genera namely Aspergillus Alternaria Penillium Fusarium and Ulocladium spp. were isolated. Comparsion between frequencies and relative densities of external and internal mycoflora was carried out among the species of the predominant genera. Aspergillus flavus and A. niger reaveled high Fr. and RD of external mycoflora A. flavus Fr.60.9 - 40.5 RD 48.3 - 40.9and A. niger Fr. 52.7- 48.6- and RD 38.7- 41.9 as external internal mycoflora mycoflora respectively. All the species of Ulocladium and Alternaria were predominant as internal mycoflora .The most predominant species of Ulocladium and Alternaria were U. atrium Fr 89 -75.5and RD -79- 62.5 as internal external mycoflora respectively and Alternaria alternate Fr. 60 - 46.6 and RD. 55-32.3as externalinternal mycoflora respectively.

  11. Identification of traits and QTLs contributing to salt tolerance in barley (Hordeum vulgare L.)

    NARCIS (Netherlands)

    Nguyen Viet Long, L.

    2012-01-01

    Salinity is the most severe abiotic stress perceived by plants and affects about 800 million hectares of land worldwide, including 20% of the world’s highly productive irrigated land. Significant crop yield losses are observed due to salinity. Salinization is increasing because of poor

  12. AFLP marker linked to water-stress-tolerant bulks in barley (Hordeum vulgare L.

    Directory of Open Access Journals (Sweden)

    A. Altinkut

    2003-01-01

    Full Text Available The amplified fragment length polymorphism (AFLP assay is an efficient method for the identification of molecular markers, useful in the improvement of numerous crop species. Bulked Segregant Analysis (BSA was used to identify AFLP markers associated with water-stress tolerance in barley, as this would permit rapid selection of water-stress tolerant genotypes in breeding programs. AFLP markers linked to water-stress tolerance was identified in two DNA pools (tolerant and sensitive, which were established using selected F2 individuals resulting from a cross between water-stress-tolerant and sensitive barley parental genotypes, based on their paraquat (PQ tolerance, leaf size, and relative water content (RWC. All these three traits were previously shown to be associated with water-stress tolerance in segregating F2 progeny of the barley cross used in a previous study. AFLP analysis was then performed on these DNA pools, using 40 primer pairs to detect AFLP fragments that are present/absent, respectively, in the two pools and their parental lines. One separate AFLP fragment, which was present in the tolerant parent and in the tolerant bulk, but absent in the sensitive parent and in the sensitive bulk, was identified. Polymorphism of the AFLP marker was tested among tolerant and sensitive F2 individuals. The presence of this marker that is associated with water-stress tolerance will greatly enhance selection for paraquat and water-stress tolerant genotypes in future breeding programs.

  13. Entwicklung transgener Gerste (Hordeum vulgare L.) mit dem Ziel der Lysin- und Threoninanreicherung im Endosperm

    OpenAIRE

    Ibrahim, Ahmed Shawky Ahmed

    2006-01-01

    An efficient Agrobacterium-mediated barley transformation system was established with a transformation rate of 13.4 % on average. Towards improving the nutritional value of barley, a set of novel transformation vectors was developed including the dapA and lysC genes encoding the feed-back-inhibition insensitive form of the dihydrodipicolinate synthase (DHDPS) and aspartate kinase (AK) respectively. Both genes under the control of the endosperm-specific D-hordein promoter or the constitutive u...

  14. Analysis of chlorophyll mutations induced by γ-rays in barley (hordeum vulgare)

    International Nuclear Information System (INIS)

    Wang Cailian; Shen Mei; Xu Gang; Zhao Kongnan; Chen Qiufang

    1991-06-01

    Thirty varieties of dormant barley seeds were irradiated with 137 Cs γ-rays. Dose-effect relations of chlorophyll mutation frequency in M 2 seedling and differences resulting from cultured types or radiosensitive types were investigated. Experimental results show that the relations between chlorophyll mutation frequency and doses can be fitted by a linear regression equation Y = A + BX. According to analysis of covariance, there is no considerable difference in various cultured types, but the difference of five different radiosensitive types is remarkable. The sensitive and intermediate types need much lower doses than other types to induce maximum chlorophyll mutation

  15. BIOCHEMICAL COMPOSITION AND NUTRITIONAL EVALUATION OF BARLEY RIHANE (HORDEUM VULGARE L.).

    Science.gov (United States)

    Lahouar, Lamia; Ghrairi, Fatma; El Arem, Amira; Medimagh, Sana; El Felah, Mouledi; Salem, Hichem Ben; Achour, Lotfi

    2017-01-01

    Many experimental studies have suggested an important role for barley Rihane(BR)in the prevention of colon cancer and cardiovascular diseases. The objective of this study was to evaluate the physico-chemical properties and nutritional characterizations of BR compared to other varieties grown in Tunisia (Manel, Roho and Tej). Total, insoluble and soluble dietary fiber(β-glucan), total protein, ash and some minerals of BR and Tunisian barley varieties were determined. The results revealed that BR is good source of dietary fiber mainly β-glucan compared to the other varieties. This variety is a relatively rich source of phosphorous and potassium and it contains many important unsaturated fatty acids. BR has higher nutritional value than other varieties. Barley Rihane has significant nutritional characterizations compared to others Tunisian barleys varieties. Abbreviations: BR, Barley Rihane; LDL, low density lipoprotein; HDL, high density lipoprotein; AOM, azoxymethane; TBV, Tunisian barley varieties; TGW, thousand grain weight; SW, weight specific; TDF, total dietary fiber; IDF, insoluble dietary fiber; SDF, soluble dietary fiber; DM, Dry Matter.

  16. Cell wall polysaccharides hydrolysis of malting barley (Hordeum vulgare L.: a review

    Directory of Open Access Journals (Sweden)

    Jamar, C.

    2011-01-01

    Full Text Available Malting quality results from the different steps of the malting process. Malting uses internal changes of the seed occurring during germination, such as enzymes synthesis, to obtain a good hydrolysis process and the components required. Among the three main hydrolytic events observed, that are namely starch degradation, cell wall breakdown and protein hydrolysis, an efficient cell wall polysaccharides hydrolysis is an essential condition for a final product of quality. Indeed, because of the physical barrier of the cell wall, cell wall polysaccharides hydrolysis is one of the first steps expected from the process to gain access to the cell components. Moreover, viscosity problem and haze formation in malting industry are related to their presence during the process when inefficient degradation occurs, leading to increased production time and cost. Understanding the key elements in cell wall degradation is important for a better control. (1-3,1-4-β-glucans and arabinoxylans are the main constituents of cell wall. (1-3,1-4-β-glucans are unbranched chains of β-D-glucopyranose residues with β-(1,3 linkages and β-(1,4 linkages. Arabinoxylan consists in a backbone of D-xylanopyranosyl units linked by β-(1-4 bonds connected to single L-arabinofuranose by α-(1→2 or α-(1→3-linkages. Degradation of (1-3,1-4-β-glucans is processed by the (1-3,1-4-β-glucanases, the β-glucosidases and the β-glucane exohydrolases. It seems that the (1-3-β-glucanases are also involved. Arabinoxylans are mainly decomposed by (1-4-β-xylan endohydrolase, arabinofuranosidase and β-xylosidase.

  17. Hordein gene dose effects in triploid endosperm of barley (Hordeum vulgare L.

    Directory of Open Access Journals (Sweden)

    Perović Dragan

    2009-01-01

    Full Text Available The presence of two maternal chromosome sets in triploid barley endosperm allows the distinction of maternal and paternal hordein bands in an electrophoregram: the maternal bands are stronger due to the higher gene dose. In the F1 generation there are differences between reciprocal crosses and in the F2 generation all 16 classes that are theoretically possible for a pair of polymorphic loci can be distinguished. This full classification is rarely possible in genetic studies, and allows more accurate estimates of recombination rates. Two hordein gene clusters (Hor1 and Hor2, corresponding to hordein C and hordein B respectively were analyzed in hybrids obtained by crossing two winter barley cultivars Partizan and HWV-247. Hordein separation was performed by acid-polyacrylamide gel electrophoresis at pH 3.2 (A-PAGE. A set of most informative bands of B and C hordeins was selected in each cross by two criteria: (1 presence or absence of bands in the parents and (2 signal strength to allow doses scoring. The average genetic distance between Hor1 and Hor2 loci was 11 cM. Distances in male and female maps were not significantly different, suggesting a similar recombination rate in male and female meiosis.

  18. Phosphorus acquisition by barley (Hordeum vulgare L. at suboptimal soil temperature

    Directory of Open Access Journals (Sweden)

    Kari Ylivainio

    2012-12-01

    Full Text Available We studied the effects of soil temperature (8 ºC and 15 ºC on barley growth, barley phosphorus (P uptake and soil P solubility. Barley was grown in a pot experiment in two soils with different P fertilization histories for 22 years. The availability of P was estimated by using 33P-labeled fertilizer and calculating L-values. After cultivation for 22 years at ambient soil temperature without P fertilization (-P, soil L-value had decreased compared to soil that received annual P fertilization (P+. Low soil temperature further reduced the L-values, more in the -P soil than in the +P soil. Our results demonstrated that P fertilization can only partially ameliorate poor growth at low soil temperatures. Thus, applying ample fertilization to compensate for poor growth at low soil temperatures would increase the P content and solubility in the soil, but plant uptake would remain inhibited by cold.

  19. Malt quality of 4 barley ( Hordeum vulgare L.) grain varieties grown ...

    African Journals Online (AJOL)

    propiconazole) spray intervals (7, 14, 21 day) and no spray control were arranged in a RCBD in 4 replications to assess net blotch (Pyrenophora teres) effect on malt quality. The varieties were grown at Holetta agricultural research center in 2005, ...

  20. Growth and yield of barley (Hordeum vulgare L.) as affected by ...

    African Journals Online (AJOL)

    Bheema

    (2003) reported that about 65% of grain yield variability in barley was attributed to ... of those of the respective non-stressed environments (Cantero-Martínez et ... production stability of barley (Fekadu and Skjelvåg, 2002) and nitrogen and phosphorus are .... of SAS version 9.1 for analysis of variance of non-orthogonal data.

  1. Development and characterization of polymorphic EST based SSR markers in barley (Hordeum vulgare).

    Science.gov (United States)

    Jo, Won-Sam; Kim, Hye-Yeong; Kim, Kyung-Min

    2017-08-01

    In barley, breeding using good genetic characteristics can improve the quality or quantity of crop characters from one generation to the next generation. The development of effective molecular markers in barley is crucial for understanding and analyzing the diversity of useful alleles. In this study, we conducted genetic relationship analysis using expressed sequence tag-simple sequence repeat (EST-SSR) markers for barley identification and assessment of barley cultivar similarity. Seeds from 82 cultivars, including 31 each of naked and hulled barley from the Korea Seed and Variety Service and 20 of malting barley from the RDA-Genebank Information Center, were analyzed in this study. A cDNA library of the cultivar Gwanbori was constructed for use in analysis of genetic relationships, and 58 EST-SSR markers were developed and characterized. In total, 47 SSR markers were employed to analyze polymorphisms. A relationship dendrogram based on the polymorphism data was constructed to compare genetic diversity. We found that the polymorphism information content among the examined cultivars was 0.519, which indicates that there is low genetic diversity among Korean barley cultivars. The results obtained in this study may be useful in preventing redundant investment in new cultivars and in resolving disputes over seed patents. Our approach can be used by companies and government groups to develop different cultivars with distinguishable markers. In addition, the developed markers can be used for quantitative trait locus analysis to improve both the quantity and the quality of cultivated barley.

  2. Some Root Traits of Barley (Hordeum vulgare L. as Affected by Mycorrhizal Symbiosis under Drought Stress

    Directory of Open Access Journals (Sweden)

    R. Bayani

    2016-05-01

    Full Text Available The effect of drought stress and mycorrhizal symbiosis on the colonization, root and leaf phosphorous content, root and leaf phosphatase activity, root volume and area as well as shoot dry weight of a variety of hulless barley were evaluated using a completely randomized experimental design (CRD with 3 replications. Treatments were three levels of drought stress of 30, 60 and 90% field capacity and two levels of mycorrhizal with and without inoculation. According to the results, the highest value of leaf phosphorous (1.54 mg/g was observed at mycorrhizal symbiosis against severe drought treatment. Root phosphatase activity was highest (297.9 OD min -1 FW-1 at severe drought stress with mycorrhizal symbiosis which in comparison with mild stress in the presence of mycorrhiza showed 16.6 fold increasing. The control and non-mycorrhizal symbiosis treatments had highest root dry weight (0.091 g. The lowest root volume (0.016 cm2 observed at mycorrhizal symbiosis × severe drought treatment. Generally, Inoculation of barley seed with mycorrhiza at severe water stress could transport more phosphorous to shoot, especially leaf via inducing of leaf and root phosphatase activity. Also, in addition to supply of nutrient sources especially phosphorous for plant, mycorrhizal symbiosis could play an important role in withstanding water stress in plant via increasing of root dry weight and area.

  3. Transformation of different barley (Hordeum vulgare L.) cultivars by Agrobacterium tumefaciens infection of in vitro cultured ovules

    DEFF Research Database (Denmark)

    Holme, Inger Bæksted; Brinch-Pedersen, Henrik; Lange, Mette

    2008-01-01

    , and compared that to the data for the model cultivar, Golden Promise. Subsequently, we analyzed the transformation efficiencies of the four cultivars using the protocol for Agrobacterium infection of ovules, previously developed for Golden Promise. Agrobacterium tumefaciens strain AGL0, carrying the binary...

  4. Carbon nanofibers suppress fungal inhibition of seed germination of maize (Zea mays) and barley (Hordeum vulgare L.) crop

    Science.gov (United States)

    Joshi, Anjali; Sharma, Arti; Nayyar, Harsh; Verma, Gaurav; Dharamvir, Keya

    2015-08-01

    Carbon nanofibers (CNFs) are one of allotropes of carbon, consists of graphene layers arrangement in the form of stacked cones or like a cup diameter in nanometer and several millimeters in length. Their extraordinary mechanical, chemical and electronic properties are due to their small size. CNFs have been successfully applied in field of medicine in variety of diagnostic methods. They proven to be an excellent system for drug delivery, tissue regeneration, biosensor etc. This research focuses the applications of CNFs in all fields of Agriculture. In the we treated some fungal disease seed of maize and barley using functionalised CNFs. We find that the tested seeds grow just as well as the healthy seeds whereas the untreated fungal disease seeds, by themselves show very poor germination and seedling growth. This simple experiment shows the extraordinary ability of Carbon nanofibers in carrying effectively inside the germinated seeds.

  5. Analysis of molecular diversity, population structure and linkage disequilibrium in a worldwide survey of cultivated barley germplasm (Hordeum vulgare L.

    Directory of Open Access Journals (Sweden)

    Ganal Martin W

    2006-01-01

    Full Text Available Abstract Background The goal of our study was a systematic survey of the molecular diversity in barley genetic resources. To this end 953 cultivated barley accessions originating from all inhabited continents except Australia were genotyped with 48 SSR markers. Molecular diversity was evaluated with routine statistics (allelic richness, gene diversity, allele frequency, heterozygosity and unique alleles, Principal Coordinate Analysis (PCoA, and analysis of genome-wide linkage disequilibrium. Results A genotyping database for 953 cultivated barley accessions profiled with 48 SSR markers was established. The PCoA revealed structuring of the barley population with regard to (i geographical regions and (ii agronomic traits. Geographic origin contributed most to the observed molecular diversity. Genome-wide linkage disequilibrium (LD was estimated as squared correlation of allele frequencies (r2. The values of LD for barley were comparable to other plant species (conifers, poplar, maize. The pattern of intrachromosomal LD with distances between the genomic loci ranging from 1 to 150 cM revealed that in barley LD extended up to distances as long as 50 cM with r2 > 0.05, or up to 10 cM with r2 > 0.2. Few loci mapping to different chromosomes showed significant LD with r2 > 0.05. The number of loci in significant LD as well as the pattern of LD were clearly dependent on the population structure. The LD in the homogenous group of 207 European 2-rowed spring barleys compared to the highly structured worldwide barley population was increased in the number of loci pairs with r2 > 0.05 and had higher values of r2, although the percentage of intrachromosomal loci pairs in significant LD based on P 0.80 provided higher LD values as compared to 19 low polymorphic loci (PIC Conclusion A global population of cultivated barley accessions was highly structured. Clustering highlighted the accessions with the same geographic origin, as well as accessions possessing similar agronomic characters. LD in barley extended up to 50 cM, and was strongly dependent on the population structure. The data on LD were summarized as a genome-wide LD map for barley.

  6. Evaluation of drought tolerance and yield capacity of barley (hordeum vulgare) genotypes under irrigated and water-stressed conditions

    International Nuclear Information System (INIS)

    Khokhar, M.I.; Silva, J.A.T.D

    2012-01-01

    Twelve barley genotypes developed through different selection methods were evaluated under drought and irrigated conditions. The results of a correlation matrix revealed highly significant associations between Grain Yield (Yp) and Mean Productivity (MP), Stress Tolerance Index (STI), Geometric Mean Productivity (GMP) and Yield Index (Yi) under irrigated conditions while the Mean Productivity (MP), Yield Stability Index (Yi), Stress Tolerance Index (STI), Geometric Mean Productivity (GMP) and Yield Index (Yi) had a high response under stressed condition. Based on a principal component analysis, Geometric Mean Productivity (GMP), Mean Productivity (MP) and Stress Tolerance Index (STI) were considered to be the best parameters for selection of drought-tolerant genotypes. The 2-row barley genotypes B-07023 and B-07021 performed better in yield response under drought conditions and were more stable under stress conditions. Furthermore, drought stress reduced the yield of some genotypes while others were tolerant to drought, suggesting genetic variability in this material for drought tolerance. (author)

  7. Induction by chromium ions of chitinases and polyamines in barley (Hordeum vulgare L.) and rape (Brassica napus L. ssp. oleifera)

    DEFF Research Database (Denmark)

    Jacobsen, S.; Hauschild, M.Z.; Rasmussen, U.

    1992-01-01

    Barley and rape seedlings were grown in hydroponic culture with increasing concentrations of CrO3 (Cr(VI)) or CrCl3 (Cr(III)). The chitinase activity and the concentrations of putrescine, spennidine and spermine were determined in the third leaf of barley seed-lings and in the second leaf of rape...

  8. Overexpression of Cytokinin Dehydrogenase Genes in Barley (Hordeum vulgare cv. Golden Promise) Fundamentally Affects Morphology and Fertility

    Czech Academy of Sciences Publication Activity Database

    Mřížová, K.; Jiskrová, E.; Vyroubalová, Š.; Novák, Ondřej; Ohnoutková, L.; Pospíšilová, H.; Frébort, I.; Harwood, W.A.; Galuszka, P.

    2013-01-01

    Roč. 8, č. 11 (2013) E-ISSN 1932-6203 Grant - others:GA MŠk(CZ) ED0007/01/01 Program:ED Institutional research plan: CEZ:AV0Z50380511 Keywords : MASS-SPECTROMETRY * TRANSGENIC BARLEY * ARABIDOPSIS Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 3.534, year: 2013

  9. On the mechanism of differential modification of oxygen dependent and independent radiation damage in Hordeum vulgare by caffeine

    International Nuclear Information System (INIS)

    Sah, N.K.; Kesavan, P.C.

    1986-01-01

    Barley seeds (IB65) of 4 per cent moisture content were irradiated in vacuo with 350 Gy gamma radiation and post-treated with or without caffeine under oxygenated and oxygen-free conditions. 8-day old seedling height was measured, chromosomal aberrations in 48 hr old shoot-tips were scored and DNA synthesis was assayed by tritiated thymidine incorporation studies at 12, 24 and 36 hr after hydration (these hrs coincide with the first three S-phases). Caffeine has been found to reduce the level of radiation-induced seedling injury and chromosomal aberration and to enhance the magnitude of DNA synthesis under oxygenated condition. The level of seedling injury and chromosomal aberration and the magnitude of DNA synthesis are, however, enhanced under oxygen-free condition by caffeine. (author)

  10. Comportamiento Agronómico de seis variedades de Cebada (Hordeum Vulgare en tres localidades, Provincia de Santa Elena.

    Directory of Open Access Journals (Sweden)

    Néstor Orrala B

    2015-10-01

    Full Text Available En la península de Santa Elena de mayo a diciembre, las temperaturas giran alrededor de 22 ºC, , lo que podría ser un medio adecuado para muchos cultivos andinos. El estudio exploratorio tuvo como objetivo verificar el comportamiento agronómico de variedades de cebada: Terán, Cañicapa 03, Clipper , Grit, Metcalfe y Scarlett en tres ambientes de la provincia de Santa Elena. Variables evaluadas: germinación, ahijamiento, encañado, espigado, maduración, altura de planta, número de macollos, longitud de espiga, cantidad de granos llenos y vanos, peso 1 000 semillas, rendimiento por hectárea, más análisis económico. Los resultados concluyen que las etapas fenológicas son más cortas en la Costa que en la Sierra, pudiéndose afirmar que el ciclo vegetativo de los germoplasmas está determinado por la interacción genotipo-ambiente y por las características varietales de cada cultivar. Las variedades Metcalfe, Scarlett y Clipper alcanzan rendimientos entre 3,55 y 4,35 toneladas por hectárea. El costo de producción por hectárea es mayor con relación a la sierra, lo que se explica en el mayor uso del recurso agua.Palabras claves: Cebada, comportamiento, variedades, épocas, adaptación.

  11. Transcriptome assembly and analysis of Tibetan Hulless Barley (Hordeum vulgare L. var. nudum developing grains, with emphasis on quality properties.

    Directory of Open Access Journals (Sweden)

    Xin Chen

    Full Text Available BACKGROUND: Hulless barley is attracting increasing attention due to its unique nutritional value and potential health benefits. However, the molecular biology of the barley grain development and nutrient storage are not well understood. Furthermore, the genetic potential of hulless barley has not been fully tapped for breeding. METHODOLOGY/PRINCIPAL FINDINGS: In the present study, we investigated the transcriptome features during hulless barley grain development. Using Illumina paired-end RNA-Sequencing, we generated two data sets of the developing grain transcriptomes from two hulless barley landraces. A total of 13.1 and 12.9 million paired-end reads with lengths of 90 bp were generated from the two varieties and were assembled to 48,863 and 45,788 unigenes, respectively. A combined dataset of 46,485 All-Unigenes were generated from two transcriptomes with an average length of 542 bp, and 36,278 among were annotated with gene descriptions, conserved protein domains or gene ontology terms. Furthermore, sequences and expression levels of genes related to the biosynthesis of storage reserve compounds (starch, protein, and β-glucan were analyzed, and their temporal and spatial patterns were deduced from the transcriptome data of cultivated barley Morex. CONCLUSIONS/SIGNIFICANCE: We established a sequences and functional annotation integrated database and examined the expression profiles of the developing grains of Tibetan hulless barley. The characterization of genes encoding storage proteins and enzymes of starch synthesis and (1-3;1-4-β-D-glucan synthesis provided an overview of changes in gene expression associated with grain nutrition and health properties. Furthermore, the characterization of these genes provides a gene reservoir, which helps in quality improvement of hulless barley.

  12. Carbon nanofibers suppress fungal inhibition of seed germination of maize (Zea mays) and barley (Hordeum vulgare L.) crop

    International Nuclear Information System (INIS)

    Joshi, Anjali; Sharma, Arti; Nayyar, Harsh; Verma, Gaurav; Dharamvir, Keya

    2015-01-01

    Carbon nanofibers (CNFs) are one of allotropes of carbon, consists of graphene layers arrangement in the form of stacked cones or like a cup diameter in nanometer and several millimeters in length. Their extraordinary mechanical, chemical and electronic properties are due to their small size. CNFs have been successfully applied in field of medicine in variety of diagnostic methods. They proven to be an excellent system for drug delivery, tissue regeneration, biosensor etc. This research focuses the applications of CNFs in all fields of Agriculture. In the we treated some fungal disease seed of maize and barley using functionalised CNFs. We find that the tested seeds grow just as well as the healthy seeds whereas the untreated fungal disease seeds, by themselves show very poor germination and seedling growth. This simple experiment shows the extraordinary ability of Carbon nanofibers in carrying effectively inside the germinated seeds

  13. SiO2 nanomaterial as a tool to improve Hordeum vulgare L. tolerance to nano-NiO stress.

    Science.gov (United States)

    Soares, Cristiano; Branco-Neves, Simão; de Sousa, Alexandra; Azenha, Manuel; Cunha, Ana; Pereira, Ruth; Fidalgo, Fernanda

    2018-05-01

    This work was designed to assess the potential role of silicon dioxide nanomaterial (nano-SiO 2 ) in enhancing barley's tolerance to nickel oxide nanomaterial (nano-NiO). For this purpose, plants were grown for 14days under nano-NiO (120mgkg -1 ) single and co-exposure with nano-SiO 2 (3mgkg -1 ). The exposure of barley to nano-NiO caused a significant decrease in growth-related parameters and induced a negative response on the photosynthetic apparatus. However, upon nano-SiO 2 co-exposure, the inhibitory effects of nano-NiO were partially reduced, with lower reductions in fresh and dry biomass, and with the recovery of the photosynthesis-related parameters. Plants growing under nano-NiO stress showed an overproduction of superoxide anion (O 2 .- ), which favored the occurrence of oxidative stress and the enhancement of lipid peroxidation (LP), but the co-treatment with nano-SiO 2 reverted this tendency, generally lowering or maintaining the levels of LP and stimulating the redox pathway of thiols. The evaluation of the antioxidant (AOX) system revealed that nano-NiO induced the accumulation of proline, along with a decrease in ascorbate in leaves. Furthermore, superoxide dismutase (SOD) activity was significantly enhanced and catalase (CAT) and ascorbate peroxidase (APX) seemed to have a pivotal role in H 2 O 2 detoxification in leaves and roots, respectively. The response of the AOX system was even more prominent upon nano-SiO 2 co-exposure, reinforcing the ameliorating functions of this nanomaterial. Overall, the present study highlighted the protective role of nano-SiO 2 in barley plants under nano-NiO stress, possibly due to the Si-mediated protection against oxidative stress, by a more proactive performance of the plant AOX system. Copyright © 2017 Elsevier B.V. All rights reserved.

  14. The Effects of Micro Elements of Iron and Zinc on Morphological Characteristics of Mycorrhized Barley (Hordeum vulgare L.

    Directory of Open Access Journals (Sweden)

    Shahab Khaghani

    2016-06-01

    Full Text Available Deficiency of micro-nutrients in human diet may cause health problems. To increase the amount of these elements in the edible parts of the plants would eliminate the incidence of these health problems. Thus, the effects of iron and zinc on seed yield and morphological characteristics of mycorrhized barley (cv. Bahman root was studied in Karaj, Iran, during growing season of 2013-14. It was carried out in afactorial experiment based on randomized complete block design with three replications. Treatments consisted two levels of mycorrhiza, non-inoculation (M0 and inoculation with 10 kg/ha of Glomus intraradices (M1, and three levels of iron from Fe-EDDHA (Sequestrene138 as control (F0, 2.5 kg/ha (F1 and 5kg/ha (F2 and three levels of zinc as zinc sulphate (ZnSO4 as control (Z0, 25 kg/ha (Z1 and 50 kg/ha (Z2. The results showed that application of mycorrhiza increased parameters like total root length (TRL, root length density (RLD, specific root length (SLR, root colonization percentage and grain yield by 900.6 cm, 0.52 cm/cm3, 1738.1 cm/g, 5.41% and 1ton/ha respectively. Mean comparisons also revealed that using iron, mycorrhiza and without Zn application increased levels of root dry weight (RDW by 2.81 g.

  15. The fifth leaf and spike organs of barley (Hordeum vulgare L.) display different physiological and metabolic responses to drought stress.

    Science.gov (United States)

    Hein, Jordan A; Sherrard, Mark E; Manfredi, Kirk P; Abebe, Tilahun

    2016-11-09

    Photosynthetic organs of the cereal spike (ear) provide assimilate for grain filling, but their response to drought is poorly understood. In this study, we characterized the drought response of individual organs of the barley spike (awn, lemma, and palea) and compared them with a vegetative organ (fifth leaf). Understanding differences in physiological and metabolic responses between the leaf and spike organs during drought can help us develop high yielding cultivars for environments where terminal drought is prevalent. We exposed barley plants to drought by withholding water for 4 days at the grain filling stage and compared changes in: (1) relative water content (RWC), (2) osmotic potential (Ψ s ), (3) osmotic adjustment (OA), (4) gas exchange, and (5) metabolite content between organs. Drought reduced RWC and Ψ s in all four organs, but the decrease in RWC was greater and there was a smaller change in Ψ s in the fifth leaf than the spike organs. We detected evidence of OA in the awn, lemma, and palea, but not in the fifth leaf. Rates of gas exchange declined more rapidly in the fifth leaf than awn during drought. We identified 18 metabolites but, only ten metabolites accumulated significantly during drought in one or more organs. Among these, proline accumulated in all organs during drought while accumulation of the other metabolites varied between organs. This may suggest that each organ in the same plant uses a different set of osmolytes for drought resistance. Our results suggest that photosynthetic organs of the barley spike maintain higher water content, greater osmotic adjustment, and higher rates of gas exchange than the leaf during drought.

  16. Effects of tied ridges and mulch on barley (Hordeum vulgare) rainwater use efficiency and production in Northern Ethiopia

    NARCIS (Netherlands)

    Araya, A.; Stroosnijder, L.

    2010-01-01

    Two alternative in situ area rainwater conservation practices (tied ridging and mulching) were evaluated for four seasons (2004, 2007, 2008 and 2009) at an experimental station in Mekelle, Ethiopia. The objectives were to evaluate the performance of barley as influenced by mulch and tied ridge and

  17. Antioxidant activity of 100% and 80% methanol extracts from barley seeds (Hordeum vulgare L.: stabilization of sunflower oil

    Directory of Open Access Journals (Sweden)

    Iqbal, Shahid

    2010-09-01

    Full Text Available The antioxidant potential of 100% and 80% methanol extracts from the seeds of three barley varieties (Jou 83, Jou 87 and Haider 93 was assessed. The extract yields from barley seeds ranged from 3.23% (Haider 93,100% methanol to 5.31% (Jou 83, 80% methanol. The total phenolic contents, DPPH radical scavenging activity (IC50 values and inhibition of linoleic acid oxidation of barley seed extracts (BSE were determined to be 88.1-145.7 mg/100g, 90.8-168.6 μg/mL and 62.6-74.6%, respectively. The antioxidant effectiveness of BSE was also assessed by stabilizing sunflower oil (SFO with BSE at a concentration of 600 ppm (oil weight basis. The stabilized (treated with extract and the control (without extract addition SFO samples were subjected to accelerated (oven heating at 60ºC for 30 days, 8 h heating cycle/day storage. These were analyzed at regular intervals for the extent of oxidative changes according to the measurements of their contents of peroxide value, para-anisidine value, conjugated dienes and conjugated trienes. Generally, the 80% methanol extract of barely seeds demonstrated better antioxidant action than the 100% methanol extract. The antioxidant activity of BSE was also found to be considerably varied among the varieties tested. The present results suggest that antioxidant extracts from barely seeds might be used to protect vegetable oils from oxidation.El potencial antioxidante de extractos de metanol al 100% y el 80% de semillas de tres variedades de cebada (Jou 83, Jou 87 y Haider 93 fue evaluada. El rendimiento de los extractos de las semillas de cebada vario desde un 3.23% (Haider, 100% methanol a un 5.31% (Jou 83, 80% metanol. El contenido total de fenoles, la actividad atrapadora del radical DPPH (valores IC50 y la inhibición de la oxidación del ácido linoleico de los extractos de semilla de cebada (BSE fueron 88.1-145.7 mg/100g, 90.8-168.6 μg/mL y 62.6- 74.6%, respectivamente. La efectividad antioxidante de BSE fue también evaluada mediante su capacidad para estabilizar aceite de girasol con concentraciones de BSE de 600 ppm (respecto al peso del aceite. La muestras estabilizadas (tratadas con extractos y el control (sin adición de extractos SFO fueron tratadas bajo condiciones de almacenamiento acelerado (calentamiento en un horno a 60ºC durante 30 días y ciclos de calentamiento de 8 h/día. Estas fueron analizadas a intervalos regulares para evaluar la extensión de los cambios oxidativos mediante la medida del valor de peróxidos, valor de para-anisidina y los contenidos de dienos conjugados y trienos congujados. Generalmente, los extractos de semilla de cebada al 80% demostraron una mejor acción antioxidante que los extracto al 100% de metanol. La actividad antioxidante de BSE varió también considerablemente entre las distintas variedades ensayadas. Los presentes resultados sugieren que los extractos antioxidantes de semillas de cebada podrían ser usadas para proteger aceites vegetales de la oxidación.

  18. Evaluation of Chitosan Nanoparticles Effects on Yield and Yield Components of Barley (Hordeum vulgare L. under Late Season Drought Stress

    Directory of Open Access Journals (Sweden)

    Faride Behboudi

    2018-01-01

    Full Text Available As a step towards the profitable employment of nanoparticles (NPs in agriculture, effects of chitosan NPs was probed on barley plants under late season drought stress. A factorial experiment was performed based on a randomized complete block design with three replications. The experimental factors included the chitosan NPs concentrations (0 (control, 30, 60 and 90 ppm, application methods (foliar and soil application and irrigation regimes (well-watered and withholding of irrigation for 15 days after pollination. The barley seeds were separately planted in pots. Then, the NPs were added to them through the soil and foliar application at three stages. The results indicated that using the chitosan NPs, especially 60 and 90 ppm, significantly increased the leaf area (LA, the leaf color (SPAD, the number of grain per spike, the grain yield and the harvest index compared to the control. Also, drought stress significantly decreased the yield and yield components compared to the well-watered plants. In contrast, using the chitosan NPs in plants under drought stress significantly increased the relative water content (RWC, the 1000-grain weight, the grain protein, the proline content, the catalase (CAT and the superoxide dismutase (SOD compared to the control. There was no a significant difference between two methods of using NPs in most studied traits. The results highlighted that using the chitosan NPs, especially 60 and 90 ppm, in both irrigation regimes can significantly improve the majority of the studied traits compared to the control and mitigate the harmful effects of drought stress.

  19. Environmental influence on the effect of gamma irradiation on proximate chemical composition of barley (Hordeum vulgare L.)

    International Nuclear Information System (INIS)

    Hassan, S.; Farhatullah; Khan, S.; Iqbal, M.

    1989-01-01

    Effects of 10, 20 and 30 krad gamma rays on Ash, Moisture, Crude protein, Crude fat, Crude fibre and Nitrogen free extract contents of barely variety, C-63 sown on 5th and 20th November and 5th December were observed. Sowing dates had significant effects for all characters except moisture percentage and carbohydrates. Ash, moisture and carbohydrates percentages had increased due to early sowing, while crude protein, fat and fibre percentages had decreased due to late sowing. Radiation effects were highly significant for all characters except moisture percentage. The severity of stimulatory or inhibitory effect, in general, was dependent upon the intensity of radiation doses and time of sowing for all characters studied. Maximum stimulatory effects were due to 30 krad which were 6.23, 32.78, 4.92 and 29.07% for Ash, Protein, fat and fibre, respectively than their respective controls. The retarding effects of 14.57 and 8.20% for moisture and carbohydrate were also found due to 30 krad, as compared with their respective controls

  20. A study on zinc distribution in calcareous soils for cowpea (Vigna Unguiculata L.) and barely ( Hordeum Vulgare L.)

    Science.gov (United States)

    Boroomand, Naser; Maleki, Mohammad Reza

    2010-05-01

    Compared to other cereals, such as wheat and barley cultivars which have low sensitivity to Zn deficiency, cowpea is sensitive to zinc (Zn) deficiency, however it extensively grows even in soils with deficient in Zn. A 8-week greenhouse experiment was conducted to study the response of cowpea and barely to Zn in calcareous soils with different DTPA- Zn. The soil samples were taken from soil surface up to 0.3 m in which their DTPA- Zn ranged from 0.5 to 3.5 mg kg-1. Shoot dry matter, concentration and uptake of Zn were found to be significantly correlated with soil DTPA- Zn in cowpea and barely. Critical deficiency level of Zn in cowpea was 1.3 mg kg-1 in soil and 28.5 mg kg-1 in shoot dry matter, however, to barely symptoms of Zn deficiency was not observed and concentration of Zn was higher than the critical level reported in literatures. Organic carbon (OC), calcium carbonate equivalent (CCE), pH and field capacity soil moisture content(FC) were significantly correlated with plant responses to Zn which were the most influenced characteristics to Zn uptake by plants.

  1. Creation of the first ultra-low gluten barley (Hordeum vulgare L.) for coeliac and gluten-intolerant populations.

    Science.gov (United States)

    Tanner, Gregory J; Blundell, Malcolm J; Colgrave, Michelle L; Howitt, Crispin A

    2016-04-01

    Coeliac disease is a well-defined condition that is estimated to affect approximately 1% of the population worldwide. Noncoeliac gluten sensitivity is a condition that is less well defined, but is estimated to affect up to 10% of the population, and is often self-diagnosed. At present, the only remedy for both conditions is a lifelong gluten-free diet. A gluten-free diet is often expensive, high in fat and low in fibre, which in themselves can lead to adverse health outcomes. Thus, there is an opportunity to use novel plant breeding strategies to develop alternative gluten-free grains. In this work, we describe the breeding and characterization of a novel ultra-low gluten (ULG) barley variety in which the hordein (gluten) content was reduced to below 5 ppm. This was achieved using traditional breeding strategies to combine three recessive alleles, which act independently of each other to lower the hordein content in the parental varieties. The grain of the initial variety was shrunken compared to wild-type barleys. We implemented a breeding strategy to improve the grain size to near wild-type levels and demonstrated that the grains can be malted and brewed successfully. The ULG barley has the potential to provide novel healthy foods and beverages for those who require a gluten-free diet. © 2015 The Authors. Plant Biotechnology Journal published by Society for Experimental Biology and The Association of Applied Biologists and John Wiley & Sons Ltd.

  2. The 'Green Revolution' dwarfing genes play a role in disease resistance in Triticum aestivum and Hordeum vulgare.

    Science.gov (United States)

    Saville, R J; Gosman, N; Burt, C J; Makepeace, J; Steed, A; Corbitt, M; Chandler, E; Brown, J K M; Boulton, M I; Nicholson, P

    2012-02-01

    The Green Revolution dwarfing genes, Rht-B1b and Rht-D1b, encode mutant forms of DELLA proteins and are present in most modern wheat varieties. DELLA proteins have been implicated in the response to biotic stress in the model plant, Arabidopsis thaliana. Using defined wheat Rht near-isogenic lines and barley Sln1 gain of function (GoF) and loss of function (LoF) lines, the role of DELLA in response to biotic stress was investigated in pathosystems representing contrasting trophic styles (biotrophic, hemibiotrophic, and necrotrophic). GoF mutant alleles in wheat and barley confer a resistance trade-off with increased susceptibility to biotrophic pathogens and increased resistance to necrotrophic pathogens whilst the converse was conferred by a LoF mutant allele. The polyploid nature of the wheat genome buffered the effect of single Rht GoF mutations relative to barley (diploid), particularly in respect of increased susceptibility to biotrophic pathogens. A role for DELLA in controlling cell death responses is proposed. Similar to Arabidopsis, a resistance trade-off to pathogens with contrasting pathogenic lifestyles has been identified in monocotyledonous cereal species. Appreciation of the pleiotropic role of DELLA in biotic stress responses in cereals has implications for plant breeding.

  3. Nematode assemblages in the rhizosphere of spring barley (Hordeum vulgare L.) depended on fertilisation and plant growth phase

    DEFF Research Database (Denmark)

    Madsen, Mette Vestergård

    2004-01-01

    rhizosphere; nitrogen and phosphorus fertilisation; nematode assemblages; plant parasites; barley......rhizosphere; nitrogen and phosphorus fertilisation; nematode assemblages; plant parasites; barley...

  4. Luteibacter rhizovicinus gen. nov., sp nov., a yellow-pigmented gammaproteobacterium isolated from the rhizosphere of barley (Hordeum vulgare L.)

    DEFF Research Database (Denmark)

    Johansen, Jens E.; Binnerup, Svend J.; Kroer, Niels

    2005-01-01

    at 4-30 degrees C, pH 6-9 and 0-3% (w/v) NaCl. The strains had identical 16S rRNA gene sequences and ERIC (enterobacterial repetitive intergenic consensus sequence) fingerprint profiles, but could be differentiated by their RAPID (random amplified polymorphic DNA) fingerprint patterns. Strain U96(T...... % to Frateuria aurantia DSM 6220(T) and 96 % to Fulvimonas soli LMG 19981(T). Using LJ96(T) DNA as probe, DNA-DNA hybridizations documented the relationship of the three strains to a single species (87.4-98.7% relatedness) and showed less than 30% relatedness to Frateuria aurantia DSM 62207 and Fulvimonas soli...... DSM 14263(T). Rhodanobacter lindaniclasticus LMG 183857 is not extant and the strain not available from any public strain collections, thus DNA-DNA hybridization could not include this strain. On the basis of genotypic and phenotypic characteristics, the three yellow-pigmented strains could also...

  5. Effect of caffeine on peroxidase activity and gamma-ray-induced oxic and anoxic damage in Hordeum vulgare

    International Nuclear Information System (INIS)

    Balachandran, R.; Kesavan, P.C.

    1978-01-01

    The influence of caffeine during and after gamma radiation of barley seeds was studied using seedling injury and peroxidase activity as parameters. The radiation-induced stimulation of peroxidase activity is evident in eight-day only seedlings but not in embryos (i.e. immediately after irradiation). Caffeine present during irradiation of seeds soaked in oxygenated water diminishes seedling injury and also reduces the peroxidase activity to the level observed in eight-day old seedlings of unirradiated seeds. Caffeine, however, produces just the opposite effect (i.e. enhances the seedling injury and peroxidase activity of eight-day old seedlings) when applied during irradiation of seeds soaked in oxygen-free water. There is no evidence that caffeine effects enzyme activity under in vitro conditions. (author)

  6. Antidepressant-like effects of young green barley leaf (Hordeum vulgare L.) in the mouse forced swimming test.

    Science.gov (United States)

    Yamaura, Katsunori; Nakayama, Noriyuki; Shimada, Maki; Bi, Yuanyuan; Fukata, Hideki; Ueno, Koichi

    2012-01-01

    Young green barley leaf is one of the richest sources of antioxidants and has been widely consumed for health management in Japan. In this study, we examined whether oral administration of young green barley leaf has an antidepressant effect on the forced swimming test in mice. Mice were individually forced to swim in an open cylindrical container, one hour after oral administration of young green barley leaf (400 or 1000 mg / kg) or imipramine (100 mg / kg). Expression of mRNA for nerve growth factor (NGF), brain-derived neurotrophic factor, and glucocorticoid receptor in the brain was analyzed using real-time quantitative polymerase chain reaction (PCR). There was a significant antidepressant-like effect in the forced swimming test; both 400 and 1000 mg / kg young green barley leaves, as well as the positive control imipramine (100 mg / kg), reduced the immobility duration compared to the vehicle group. The expression of mRNA for NGF detected in the hippocampus immediately after the last swimming test was higher than that in the non-swimming group (Nil). Oral administration of imipramine suppressed this increase to the level of the Nil group. Young green barley leaf (400 and 1000 mg / kg) also showed a moderate decrease in the expression of mRNA for NGF, in a dose-dependent manner. Oral administration of young green barley leaf is able to produce an antidepressant-like effect in the forced swimming test. Consequently it is possible that the antidepressant-like effects of the young green barley leaf are, at least in part, mediated by an inhibition of the increase in the hippocampus levels of NGF.

  7. Physiological, Biochemical and Molecular Characterization of Barley (Hordeum vulgare L.) and Maize (Zea mays L.) for Improving Manganese Efficiency

    DEFF Research Database (Denmark)

    Long, Lizhi

    Manganese (Mn) deficiency is a nutritional problem, causing significant reductions in crop yields and in severe cases resulting in complete loss of crops during winter time. Different plant species and genotypes within the same species vary in their tolerance with respect to growth in soils with ...

  8. Interactive effects of soil acidity and fluoride on soil solution aluminium chemistry and barley (Hordeum vulgare L.) root growth

    International Nuclear Information System (INIS)

    Manoharan, V.; Loganathan, P.; Tillman, R.W.; Parfitt, R.L.

    2007-01-01

    A greenhouse study was conducted to determine if concentrations of fluoride (F), which would be added to acid soils via P fertilisers, were detrimental to barley root growth. Increasing rates of F additions to soil significantly increased the soil solution concentrations of aluminium (Al) and F irrespective of the initial adjusted soil pH, which ranged from 4.25 to 5.48. High rates of F addition severely restricted root growth; the effect was more pronounced in the strongly acidic soil. Speciation calculations demonstrated that increasing rates of F additions substantially increased the concentrations of Al-F complexes in the soil. Stepwise regression analysis showed that it was the combination of the activities of AlF 2 1+ and AlF 2+ complexes that primarily controlled barley root growth. The results suggested that continuous input of F to soils, and increased soil acidification, may become an F risk issue in the future. - Addition of high rates of fluoride to strongly acidic soils can reduce barley root growth due to the toxicity of aluminium-fluoride complexes formed in soil solution

  9. Interactive effects of soil acidity and fluoride on soil solution aluminium chemistry and barley (Hordeum vulgare L.) root growth.

    Science.gov (United States)

    Manoharan, V; Loganathan, P; Tillman, R W; Parfitt, R L

    2007-02-01

    A greenhouse study was conducted to determine if concentrations of fluoride (F), which would be added to acid soils via P fertilisers, were detrimental to barley root growth. Increasing rates of F additions to soil significantly increased the soil solution concentrations of aluminium (Al) and F irrespective of the initial adjusted soil pH, which ranged from 4.25 to 5.48. High rates of F addition severely restricted root growth; the effect was more pronounced in the strongly acidic soil. Speciation calculations demonstrated that increasing rates of F additions substantially increased the concentrations of Al-F complexes in the soil. Stepwise regression analysis showed that it was the combination of the activities of AlF2(1+) and AlF(2+) complexes that primarily controlled barley root growth. The results suggested that continuous input of F to soils, and increased soil acidification, may become an F risk issue in the future.

  10. Antioxidant activity of 100% and 80% methanol extracts from barley seeds (Hordeum vulgare L.): stabilization of sunflower oil

    Energy Technology Data Exchange (ETDEWEB)

    Anwar, F.; Abdul Qayyum, H. M.; Hussein, A. I.; Iqbal, S.

    2010-07-01

    The antioxidant potential of 100% and 80% methanol extracts from the seeds of three barley varieties (Jou 83, Jou 87 and Haider 93) was assessed. The extract yields from barley seeds ranged from 3.23% (Haider 93,100% methanol) to 5.31% (Jou 83, 80% methanol). The total phenolic contents, DPPH radical scavenging activity (IC50 values) and inhibition of linoleic acid oxidation of barley seed extracts (BSE) were determined to be 88.1-145.7 mg/100g, 90.8-168.6 {mu}g/mL and 62.6-74.6%, respectively. The antioxidant effectiveness of BSE was also assessed by stabilizing sunflower oil (SFO) with BSE at a concentration of 600 ppm (oil weight basis). The stabilized (treated with extract) and the control (without extract addition) SFO samples were subjected to accelerated (oven heating at 60 degree centigrade for 30 days, 8 h heating cycle/day) storage. These were analyzed at regular intervals for the extent of oxidative changes according to the measurements of their contents of peroxide value, para-anisidine value, conjugated dienes and conjugated trienes. Generally, the 80% methanol extract of barely seeds demonstrated better antioxidant action than the 100% methanol extract. The antioxidant activity of BSE was also found to be considerably varied among the varieties tested. The present results suggest that antioxidant extracts from barely seeds might be used to protect vegetable oils from oxidation. (Author) 32 refs.

  11. HvZIP7 mediates zinc accumulation in barley (Hordeum vulgare) at moderately high zinc supply

    DEFF Research Database (Denmark)

    Tiong, Jingwen; Mcdonald, Glenn K.; Genc, Yusuf

    2014-01-01

    Summary: High expression of zinc (Zn)-regulated, iron-regulated transporter-like protein (ZIP) genes increases root Zn uptake in dicots, leading to high accumulation of Zn in shoots. However, none of the ZIP genes tested previously in monocots could enhance shoot Zn accumulation. In this report...... were also generated to further understand the functions of HvZIP7 in metal transport. HvZIP7 is strongly induced by Zn deficiency, primarily in vascular tissues of roots and leaves, and its protein was localized in the plasma membrane. These properties are similar to its closely related homologs...... in dicots. Overexpression of HvZIP7 in barley plants increased Zn uptake when moderately high concentrations of Zn were supplied. Significantly, there was a specific enhancement of shoot Zn accumulation, with no measurable increase in iron (Fe), manganese (Mn), copper (Cu) or cadmium (Cd). HvZIP7 displays...

  12. Analysis of early events in the interaction between Fusarium graminearum and the susceptible barley (Hordeum vulgare) cultivar Scarlett

    DEFF Research Database (Denmark)

    Yang, Fen; Jensen, J.D.; Svensson, Birte

    2010-01-01

    A proteomic analysis was conducted to map the events during the initial stages of the interaction between the fungal pathogen Fusarium graminearum and the susceptible barley cultivar Scarlett. Quantification of fungal DNA demonstrated a sharp increase in fungal biomass in barley spikelets at 3 da...

  13. Carbon nanofibers suppress fungal inhibition of seed germination of maize (Zea mays) and barley (Hordeum vulgare L.) crop

    Energy Technology Data Exchange (ETDEWEB)

    Joshi, Anjali, E-mail: joshianjali1982@gmail.com; Sharma, Arti [Centre For Nanoscience and Nanotechnology, Panjab University, Chandigarh (India); Nayyar, Harsh [Department of Botany, Panjab University, Chandigarh (India); Verma, Gaurav [Dr. SS Bhatnagar University Institute of Chemical Engineering and Technology, Panjab University, Chandigarh (India); Dharamvir, Keya [Department of Physics, Panjab University, Chandigarh (India)

    2015-08-28

    Carbon nanofibers (CNFs) are one of allotropes of carbon, consists of graphene layers arrangement in the form of stacked cones or like a cup diameter in nanometer and several millimeters in length. Their extraordinary mechanical, chemical and electronic properties are due to their small size. CNFs have been successfully applied in field of medicine in variety of diagnostic methods. They proven to be an excellent system for drug delivery, tissue regeneration, biosensor etc. This research focuses the applications of CNFs in all fields of Agriculture. In the we treated some fungal disease seed of maize and barley using functionalised CNFs. We find that the tested seeds grow just as well as the healthy seeds whereas the untreated fungal disease seeds, by themselves show very poor germination and seedling growth. This simple experiment shows the extraordinary ability of Carbon nanofibers in carrying effectively inside the germinated seeds.

  14. Cultivate In Vitro Of Anthers Of Barley (Hordeum Vulgare L.) Vars. UNAGRO V-PM6 And DISSA

    International Nuclear Information System (INIS)

    Marquinez Casas, Xavier

    1994-01-01

    The barley is a autonomous cereal originated of the wild subspecies H. vulgare L. Only at the end of last century it acquired commercial importance with the establishment of the industry brewer (Chaparro and Moreno 1894); at the moment its national production is far from supplying the demand of the market. The Andean area is the most appropriate region for its cultivation in Colombia, mainly between 1800 and 3200 meters on the level of the sea, in the Boyaca, Cundinamarca and Narino departments. Their production is dedicated in a 80 at 85 for the industry brewer and malt industry and of the 15 at 20 for seeds, human food and animal

  15. Prioritization of Candidate Genes in QTL Regions for Physiological and Biochemical Traits Underlying Drought Response in Barley (Hordeum vulgare L.

    Directory of Open Access Journals (Sweden)

    Kornelia Gudys

    2018-06-01

    Full Text Available Drought is one of the most adverse abiotic factors limiting growth and productivity of crops. Among them is barley, ranked fourth cereal worldwide in terms of harvested acreage and production. Plants have evolved various mechanisms to cope with water deficit at different biological levels, but there is an enormous challenge to decipher genes responsible for particular complex phenotypic traits, in order to develop drought tolerant crops. This work presents a comprehensive approach for elucidation of molecular mechanisms of drought tolerance in barley at the seedling stage of development. The study includes mapping of QTLs for physiological and biochemical traits associated with drought tolerance on a high-density function map, projection of QTL confidence intervals on barley physical map, and the retrievement of positional candidate genes (CGs, followed by their prioritization based on Gene Ontology (GO enrichment analysis. A total of 64 QTLs for 25 physiological and biochemical traits that describe plant water status, photosynthetic efficiency, osmoprotectant and hormone content, as well as antioxidant activity, were positioned on a consensus map, constructed using RIL populations developed from the crosses between European and Syrian genotypes. The map contained a total of 875 SNP, SSR and CGs, spanning 941.86 cM with resolution of 1.1 cM. For the first time, QTLs for ethylene, glucose, sucrose, maltose, raffinose, α-tocopherol, γ-tocotrienol content, and catalase activity, have been mapped in barley. Based on overlapping confidence intervals of QTLs, 11 hotspots were identified that enclosed more than 60% of mapped QTLs. Genetic and physical map integration allowed the identification of 1,101 positional CGs within the confidence intervals of drought response-specific QTLs. Prioritization resulted in the designation of 143 CGs, among them were genes encoding antioxidants, carboxylic acid biosynthesis enzymes, heat shock proteins, small auxin up-regulated RNAs, nitric oxide synthase, ATP sulfurylases, and proteins involved in regulation of flowering time. This global approach may be proposed for identification of new CGs that underlies QTLs responsible for complex traits.

  16. Weed infestation of spring barley (Hordeum vulgare L. depending on the cover crop and weed control method

    Directory of Open Access Journals (Sweden)

    Dorota Gawęda

    2014-04-01

    Full Text Available The aim of this 3-year field study was to evaluate the effect of some stubble crops and weed control methods on the species composition, number and air-dry weight of weeds in a spring barley crop grown in short-term monoculture. The study was conducted in the period 2009–2011 at the Uhrusk Experimental Farm, on mixed rendzina soil classified as very good rye soil complex. It included stubble crops which were ploughed under in each year (control treatment without cover crop, white mustard, lacy phacelia, a mixture of legumes – narrow-leaf lupin + field pea and 3 weed control methods used in spring barley crops (mechanical, mechanical and chemical, chemical weed control. Veronica persica was the weed species that occurred in greatest numbers in the spring barley crop sown after stubble crops. All cover crops reduced the numbers of Avena fatua which was the dominant species in the control treatment. Chemical as well as chemical and mechanical weed control significantly reduced the numbers of Avena fatua compared to the treatment where only double harrowing was used for weed control. The stubble crops did not reduce weed infestation of spring barley. Compared to the control treatment, the ploughing-in of white mustard and the mixture of legumes reduced the dry weight of weeds by 49.1 and 22.7%, respectively. Mechanical weed management proved to be less effective in reducing the number and dry weight of weeds compared to the other weed control methods. A significant negative correlation was found between the dry weight of weeds in the spring barley crop and the dry weight of the ploughed-in white mustard cover crop under the conditions of chemical weed control as well as in the case of the mixture of legumes when complete mechanical and chemical weed control was used.

  17. Can barley (Hordeum vulgare L. s.l.) adapt to fast climate changes? A controlled selection experiment

    DEFF Research Database (Denmark)

    Alemayehu, Fikadu Reta; Frenck, Georg; van der Linden, Leon

    2013-01-01

    to environmental stress, we conducted a selection experiment over five plant generations (G0–G4) in three scenarios, where atmospheric [CO2] and temperature were increased as single factors and in combination. The treatments represented the expected environmental characteristics in Northern Europe around year 2075...... to environmental change needs to be explored in order to select the most productive genotypes. Presently, it is unknown whether cereal crops like spring barley can adapt to climate stressors over relatively few generations. To evaluate if strong selection pressures could change the performance of barley......, the G4-generation of selected plants did not improve its reproductive output compared to the G0-generation, as G4 produced less seeds and had a lower yield than unselected plants. These results indicate that barley might not respond positively to rapid and strong selection by elevated [CO2...

  18. Localising QTLs for leaf rust resistance and agronomic traits in barley (¤Hordeum vulgare¤ L.)

    DEFF Research Database (Denmark)

    Kicherer, S.; Backes, G.; Walther, U.

    2000-01-01

    to leaf rust by means of artificial infection, heading date, plant height and Kernel weight were assessed. For leaf rust resistance, 4 QTLs were localised, that explained 96.1% of the genetic variation. One QTL on chromosome 4H confirmed a position found in another genetic background and one mapped...

  19. Inheritance analysis and mapping of quantitative trait loci (QTL controlling individual anthocyanin compounds in purple barley (Hordeum vulgare L. grains.

    Directory of Open Access Journals (Sweden)

    Xiao-Wei Zhang

    Full Text Available Anthocyanin-rich barley can have great potential in promoting human health and in developing nutraceuticals and functional foods. As different anthocyanin compounds have different antioxidant activities, breeding cultivars with pre-designed anthocyanin compositions could be highly desirable. Working toward this possibility, we assessed and reported for the first time the genetic control of individual anthocyanin compounds in barley. Of the ten anthocyanins assessed, two, peonidin-3-glucoside (P3G and cyanidin-3-glucoside (C3G, were major components in the purple pericarp barley genotype RUSSIA68. Quantitative trait locus (QTL mapping showed that both anthocyanin compounds were the interactive products of two loci, one located on chromosome arm 2HL and the other on 7HS. However, the two different anthocyanin components seem to be controlled by different interactions between the two loci. The effects of the 7HS locus on P3G and C3G were difficult to detect without removing the effect of the 2HL locus. At least one copy of the 2HL alleles from the purple pericarp parent was required for the synthesis of P3G. This does not seem to be the case for the production of C3G which was produced in each of all the different allele combinations between the two loci. Typical maternal effect was also observed in the inheritance of purple pericarp grains in barley. The varied values of different compounds, coupled with their different genetic controls, highlight the need for targeting individual anthocyanins in crop breeding and food processing.

  20. HorTILLUS—A Rich and Renewable Source of Induced Mutations for Forward/Reverse Genetics and Pre-breeding Programs in Barley (Hordeum vulgare L.

    Directory of Open Access Journals (Sweden)

    Miriam E. Szurman-Zubrzycka

    2018-02-01

    Full Text Available TILLING (Targeting Induced Local Lesions IN Genomes is a strategy used for functional analysis of genes that combines the classical mutagenesis and a rapid, high-throughput identification of mutations within a gene of interest. TILLING has been initially developed as a discovery platform for functional genomics, but soon it has become a valuable tool in development of desired alleles for crop breeding, alternative to transgenic approach. Here we present the HorTILLUS (Hordeum—TILLING—University of Silesia population created for spring barley cultivar “Sebastian” after double-treatment of seeds with two chemical mutagens: sodium azide (NaN3 and N-methyl-N-nitrosourea (MNU. The population comprises more than 9,600 M2 plants from which DNA was isolated, seeds harvested, vacuum-packed, and deposited in seed bank. M3 progeny of 3,481 M2 individuals was grown in the field and phenotyped. The screening for mutations was performed for 32 genes related to different aspects of plant growth and development. For each gene fragment, 3,072–6,912 M2 plants were used for mutation identification using LI-COR sequencer. In total, 382 mutations were found in 182.2 Mb screened. The average mutation density in the HorTILLUS, estimated as 1 mutation per 477 kb, is among the highest mutation densities reported for barley. The majority of mutations were G/C to A/T transitions, however about 8% transversions were also detected. Sixty-one percent of mutations found in coding regions were missense, 37.5% silent and 1.1% nonsense. In each gene, the missense mutations with a potential effect on protein function were identified. The HorTILLUS platform is the largest of the TILLING populations reported for barley and best characterized. The population proved to be a useful tool, both in functional genomic studies and in forward selection of barley mutants with required phenotypic changes. We are constantly renewing the HorTILLUS population, which makes it a permanent source of new mutations. We offer the usage of this valuable resource to the interested barley researchers on cooperative basis.

  1. Quantitative trait loci for yield and grain plumpness relative to maturity in three populations of barley (Hordeum vulgare L. grown in a low rain-fall environment.

    Directory of Open Access Journals (Sweden)

    Bulti Tesso Obsa

    Full Text Available Identifying yield and grain plumpness QTL that are independent of developmental variation or phenology is of paramount importance for developing widely adapted and stable varieties through the application of marker assisted selection. The current study was designed to dissect the genetic basis of yield performance and grain plumpness in southern Australia using three doubled haploid (DH populations developed from crosses between adapted parents that are similar in maturity and overall plant development. Three interconnected genetic populations, Commander x Fleet (CF, Commander x WI4304 (CW, and Fleet x WI4304 (FW developed from crossing of Australian elite barley genotypes, were used to map QTL controlling yield and grain plumpness. QTL for grain plumpness and yield were analysed using genetic linkage maps made of genotyping-by-sequencing markers and major phenology genes, and field trials at three drought prone environments for two growing seasons. Seventeen QTL were detected for grain plumpness. Eighteen yield QTL explaining from 1.2% to 25.0% of the phenotypic variation were found across populations and environments. Significant QTL x environment interaction was observed for all grain plumpness and yield QTL, except QPlum.FW-4H.1 and QYld.FW-2H.1. Unlike previous yield QTL studies in barley, none of the major developmental genes, including Ppd-H1, Vrn-H1, Vrn-H2 and Vrn-H3, that drive barley adaption significantly affected grain plumpness and yield here. Twenty-two QTL controlled yield or grain plumpness independently of known maturity QTL or genes. Adjustment for maturity effects through co-variance analysis had no major effect on these yield QTL indicating that they control yield per se.

  2. Immobilization of Lead Migrating from Contaminated Soil in Rhizosphere Soil of Barley (Hordeum vulgare L.) and Hairy Vetch (Vicia villosa) Using Hydroxyapatite.

    Science.gov (United States)

    Katoh, Masahiko; Risky, Elsya; Sato, Takeshi

    2017-10-23

    This study conducted plant growth tests using a rhizobox system to quantitatively determine the distance of immobilization lead migrating from contaminated soil into uncontaminated rhizosphere soil, and to assess the lead phases accumulated in rhizosphere soil by sequential extraction. Without the hydroxyapatite, exchangeable lead fractions increased as the rhizosphere soil got closer to the contaminated soil. Exchangeable lead fractions were higher even in the rhizosphere soil that shares a boundary with the root surface than in the soil before being planted. Thus, plant growth of hairy vetch was lower in the soil without the hydroxyapatite than in the soil with the hydroxyapatite. The presence of hydroxyapatite may immobilize the majority of lead migrating from contaminated soil into the rhizosphere soil within 1 mm from the contaminated soil. The dominant lead fraction in the rhizosphere soil with the hydroxyapatite was residual. Thus, plant growth was not suppressed and the lead concentration of the plant shoot remained at the background level. These results indicate that the presence of hydroxyapatite in the rhizosphere soil at 5% wt may immobilize most of the lead migrating into the rhizosphere soil within 1 mm from the contaminated soil, resulting in the prevention of lead migration toward the root surface.

  3. The Effects of Climate Change on Invasion Potential of Wild Barley (Hordeum spontaneum K.Koch in Iran and the World

    Directory of Open Access Journals (Sweden)

    Seyed Karim Mousavi

    2017-09-01

    Full Text Available Introduction Invasive species present a major threat to biodiversity, which may be boosted due to the climate change effects, particularly if desired weather conditions allow weed to spread to new areas. Identification of areas climatically suitable to weed establishment can offer great opportunities for stopping or decelerating invasion process. Bioclimatic and species distribution models that relate geographic data of a species to environmental variables have become an important modeling tool in invasion ecology. Although the predicted area by climex as suitable environmental for a species does not mean that, it can necessarily establish there, it does suggest a beneficial knowledge about detecting areas with invasion potential. Taking advantage of climate match index to predict the potential invasion of wild barley grass weed in Iran and other world regions under current climate and different climate change scenarios are the objectives of current research .Identifying suitable environmental areas for invasive species provides an opportunity to prevent or slow down the invasion process Materials and methods Based on the presence intensity index of weeds, the climate of infestation hotspots in the Lorestan province, including Khorramabad (Aymanabad and Rimmelleh region, Dorud, Kuhdasht and Aleshtar, were defined as the favorable climate for wild barley. Wild barley-infected foci climate in Lorestan province was considered as a desirable climate for this weed. Climatic similarity of different regions of the world with the intended zone was evaluated as a criterion of invasion susceptibility of those regions in the current conditions and under climate change scenarios by using Climex model. Results and Discussion Results showed that Kermanshah, Tehran, Hamedan, Kurdistan, Markazi, Qazvin and Chaharmahal and Bakhtiari with composite match Index greater than 0.81 in compare to infected area in Lorestan, were the most prone province of Iran for wild barley weed establishment. under climate change scenarios, Zanjan, Hamedan, Ardebil, West Azarbaijan, East Azarbaijan, Kurdistan, Chharmhal and bakhtyary, and Markazi climate conditions will be more favorable in comparison with the current situation for establishment of wild barley weed, and the climate conditions in other provinces will be less favorable. Under climate change scenarios condition, the climate conditions of Lorestan will be 8.5% unfavorable to establish wild barley. Islamabad gharb, Borujerd, Ivan, Tuyserkan, Kangavar, peers, Kermanshah, Kamyaran, Ardal, Silakhor, Sararood, Sanandaj, Shamiran Tehran, Rawansar, Rvmshkan, Skinheads, Ilam, Farsan, Tazehabad, Nourabad Delfan, Mahabad, Azna, Songhor, Harsin, Sisakht, Khorramabad, Sepidan, Zarghan, Moalem Kalayeh, Sarableh, Bukan, Qazvin, Shahin Dez, Bane, Bilasuvar, Shazand, Takhte jamshid, Arak, Khomeini, Hashtgerd, Saghez, Oshnavieh, Saman, Khondab, Shiraz, Shahr kord, and Malayer with a composite match index of greater than 0.9 were considered the most vulnerable regions against the wild barley invasion. In the current climate situation, Spain, United States of America, Algeria, Greece, Syria, Turkey, Italy, Australia, Uzbekistan, Tunisia, Pakistan, Iraq, Morocco, Chile, Afghanistan, Bulgaria, Macedonia, Portugal, Argentina, Turkmenistan, Libya, Romania, Jordan, South Africa, France, Armenia, Ukraine, Palestine and China have at least one region with composite match index greater than 0.8 for wild barley weed infested region in Lorestan province. Climate conditions of North Korea, Switzerland, South Korea, Hungary, Austria, Bosnia and Herzegovina, Mongolia, Luxembourg, Czech Republic, Germany, Canada, Poland, Romania, Yugoslavia, South Georgia, Belgium, Russia, Bulgaria, Netherlands, Ukraine, Sweden, Kazakhstan, Finland, Belarus, England, Norway, France, Denmark and Ireland become 10-30% more vulnerable to wild barley invasion, according to the UK scenario for the year 2080, climate change in compared with current weather condition. Conclusions Europe was the most talented continent for invasion of wild barley, and South America and the Africa continents in the current and future climates respectively had the minimum risk for establishment of wild barley.

  4. Barley (Hordeum vulgare) in the Okhotsk culture (5th-10th century AD) of northern Japan and the role of cultivated plants in hunter-gatherer economies.

    Science.gov (United States)

    Leipe, Christian; Sergusheva, Elena A; Müller, Stefanie; Spengler, Robert N; Goslar, Tomasz; Kato, Hirofumi; Wagner, Mayke; Weber, Andrzej W; Tarasov, Pavel E

    2017-01-01

    This paper discusses archaeobotanical remains of naked barley recovered from the Okhotsk cultural layers of the Hamanaka 2 archaeological site on Rebun Island, northern Japan. Calibrated ages (68% confidence interval) of the directly dated barley remains suggest that the crop was used at the site ca. 440-890 cal yr AD. Together with the finds from the Oumu site (north-eastern Hokkaido Island), the recovered seed assemblage marks the oldest well-documented evidence for the use of barley in the Hokkaido Region. The archaeobotanical data together with the results of a detailed pollen analysis of contemporaneous sediment layers from the bottom of nearby Lake Kushu point to low-level food production, including cultivation of barley and possible management of wild plants that complemented a wide range of foods derived from hunting, fishing, and gathering. This qualifies the people of the Okhotsk culture as one element of the long-term and spatially broader Holocene hunter-gatherer cultural complex (including also Jomon, Epi-Jomon, Satsumon, and Ainu cultures) of the Japanese archipelago, which may be placed somewhere between the traditionally accepted boundaries between foraging and agriculture. To our knowledge, the archaeobotanical assemblages from the Hokkaido Okhotsk culture sites highlight the north-eastern limit of prehistoric barley dispersal. Seed morphological characteristics identify two different barley phenotypes in the Hokkaido Region. One compact type (naked barley) associated with the Okhotsk culture and a less compact type (hulled barley) associated with Early-Middle Satsumon culture sites. This supports earlier suggestions that the "Satsumon type" barley was likely propagated by the expansion of the Yayoi culture via south-western Japan, while the "Okhotsk type" spread from the continental Russian Far East region, across the Sea of Japan. After the two phenotypes were independently introduced to Hokkaido, the boundary between both barley domains possibly existed ca. 600-1000 cal yr AD across the island region. Despite a large body of studies and numerous theoretical and conceptual debates, the question of how to differentiate between hunter-gatherer and farming economies persists reflecting the wide range of dynamic subsistence strategies used by humans through the Holocene. Our current study contributes to the ongoing discussion of this important issue.

  5. Barley (Hordeum vulgare) in the Okhotsk culture (5th–10th century AD) of northern Japan and the role of cultivated plants in hunter–gatherer economies

    Science.gov (United States)

    Sergusheva, Elena A.; Müller, Stefanie; Spengler, Robert N.; Goslar, Tomasz; Kato, Hirofumi; Wagner, Mayke; Weber, Andrzej W.; Tarasov, Pavel E.

    2017-01-01

    This paper discusses archaeobotanical remains of naked barley recovered from the Okhotsk cultural layers of the Hamanaka 2 archaeological site on Rebun Island, northern Japan. Calibrated ages (68% confidence interval) of the directly dated barley remains suggest that the crop was used at the site ca. 440–890 cal yr AD. Together with the finds from the Oumu site (north-eastern Hokkaido Island), the recovered seed assemblage marks the oldest well-documented evidence for the use of barley in the Hokkaido Region. The archaeobotanical data together with the results of a detailed pollen analysis of contemporaneous sediment layers from the bottom of nearby Lake Kushu point to low-level food production, including cultivation of barley and possible management of wild plants that complemented a wide range of foods derived from hunting, fishing, and gathering. This qualifies the people of the Okhotsk culture as one element of the long-term and spatially broader Holocene hunter–gatherer cultural complex (including also Jomon, Epi-Jomon, Satsumon, and Ainu cultures) of the Japanese archipelago, which may be placed somewhere between the traditionally accepted boundaries between foraging and agriculture. To our knowledge, the archaeobotanical assemblages from the Hokkaido Okhotsk culture sites highlight the north-eastern limit of prehistoric barley dispersal. Seed morphological characteristics identify two different barley phenotypes in the Hokkaido Region. One compact type (naked barley) associated with the Okhotsk culture and a less compact type (hulled barley) associated with Early–Middle Satsumon culture sites. This supports earlier suggestions that the “Satsumon type” barley was likely propagated by the expansion of the Yayoi culture via south-western Japan, while the “Okhotsk type” spread from the continental Russian Far East region, across the Sea of Japan. After the two phenotypes were independently introduced to Hokkaido, the boundary between both barley domains possibly existed ca. 600–1000 cal yr AD across the island region. Despite a large body of studies and numerous theoretical and conceptual debates, the question of how to differentiate between hunter–gatherer and farming economies persists reflecting the wide range of dynamic subsistence strategies used by humans through the Holocene. Our current study contributes to the ongoing discussion of this important issue. PMID:28355249

  6. Evaluation of the Effect of Agroforestry and Conventional System on Yield and Yield Components of Barley Hordeum vulgare L. (and Wheat Triticum

    Directory of Open Access Journals (Sweden)

    monir nazari

    2017-09-01

    Full Text Available Introduction: Low sustainability, soil erosion and loss of soil fertility in conventional systems are the major threats to the agricultural production systems. These threats leads researchers towards more attention to different agroforestry systems including alley cropping as a solution in different regions of the world. Agroforestry has attracted considerable attentions because of its potential to maintain or increase productivity in areas with high energy input in which large scale agricultural systems are impractical. It is often assumed that appropriate agroforestry systems can provide the essential ecological functions needed to ensure sustainability and maintain microclimatic and other favorable influences, and that such benefits may outweigh their enhanced use of water in areas of limited water availability. Evidences suggest that diversity in agroecosystems, in particular the integration of different perennial crops or trees (agroforestry, augments nutrient capture and cycling processes; processes that in turn lead to reduced reliance on nutrient or water inputs, abatement of air and water pollution, and enhancement of other ecosystem services across multiple spatial and temporal scales. Agroforestry is viewed as providing ecosystem services, has many environmental benefits and economic advantages as part of a multifunctional agroecosystem. Conventional cultivation of barley and wheat systems in Saman Region has many problems about sustainability of production, erosion of soil, yield stability and soil nutrient properties. On the other hand, planting of Almond is a good option for farmers to make orchards, in compare to Nut. Although some farmers do Agroforestry as an innovative practice, but studying the advantages of these systems and finding their rewards, because of its unique benefits in dry, poor and endangered areas, could help farmers to increase their cultivation area as they wish, particularly in Saman region. Materials and Methods: In order to evaluate the benefits of a tree-based intercropping system, a study was conducted in an almond-based agroforestry plantation located in Saman region of Shahrekord, Iran (32˚43ꞌ N latitude and 50˚49ꞌ E longitude, with an altitude of 2085 m based on a completely randomized design with four replications in 2014-2015.,The region is a semi-arid area receives 346 mm precipitation annually distributed only in 5-6 months.. Treatments include different types of cultivation systems: almond - wheat, almond - barley, and sole cropping of Wheat and Barley. Measured traits were leaf area index, plant height, spike length, dry matter, number of grains per spike, number of spikes per m², 1000 grain weight and grain yield (per unit area and actual yield, biological yield and harvest index of wheat and barley. Results and Discussion: Results showed that the highest yield (456 g.m-2 was acquired from almond-barley agroforestry system and the lowest from almond-wheat (233 g.m-2. Cultivation of barley in almond-barley system increased dry matter (14% and grain yield (28%. Intercropping with almond tree increased leaf area Index, plant height, number of tillers, spike length and dry weight, especially for barley. So Agroforestry may increase morphological characteristics rather than the others. But number of spike, seed number and 1000 seed weight increased just for barley and decreased in wheat, However agroforestry increased biological yield in both barley and wheat, but the trend for grain yield was only in barley and some decrement were seen for wheat. It could be due to difference in filling period length and commence, and accordance with crucial developmental stage in almond. Conclusion: Results of this study showed that the highest biological and grain yields were obtained from barley at agroforestry system with almond tree, indicating that barley is a more suitable option for multiple cropping compared to wheat. It may be due to higher dry matter accumulation of barley before bud developing and shading of almonds lead to higher dry matter accumulation, the situation that will occur for wheat latter. so barley- almond agroforestry system could be an effective technique to increase productivity and satisfying economical purposes in Saman region, Iran.

  7. [The influence of root excretions of germinating barley seed (Hordeum vulgare L.) on qualitative and quantitative composition of soil organic components].

    Science.gov (United States)

    Volkov, O I

    2010-01-01

    The data from scientific publications on excretory activity of herbs root endings were analyzed, along with the data on the role of polyvalent metals cations in stabilization of humus substances (HS) of soil organic mineral complex. On the base of the analysis a working hypothesis was proposed considering root endings influence on fractional composition of soil organic components. To detect the changes taking place in soil HS, the chromatographic fractionation method was chosen. The soil aggregates stuck to root endings of germinating barley seed were washed off, and the washouts were used as the samples for the analysis. The soil from the weighed portion was dissolved directly with extenuating concentrations of LiCl and Li2SO4 alkaline solution. The fractionation was carried out in a chromatographic column. Some changes were detected in optical density of chernozem and dark-grey forest soil leached out after 1-2 days of barley seeds germination. Besides, the experiment showed that the content of organic carbon in HS changes as well.

  8. Winter forage quality of oats (avena sativa), barley (hordeum vulgare) and vetch (vicia sativa) in pure stand and cereal legume mixture

    International Nuclear Information System (INIS)

    Ullah, Z.

    2015-01-01

    A field study was carried out for two consecutive years in subtropical rainfed conditions of Rawalpindi, Pakistan to evaluate the forage quality of oats, barley and vetch grown in pure stands and cereal-legume mixtures. Treatments comprised oats pure stand, oats in oats-vetch mixture, barley pure stand, barley in barley-vetch mixture, vetch pure stand, vetch in oats-vetch mixture and vetch in barley-vetch mixture. Forage yield and quality of oats and barley were improved in oats-vetch and barley-vetch mixtures than their respective pure stands. The higher values of crude protein (CP) and lower values of neutral detergent fiber (NDF) and acid detergent fiber (ADF) reflected quality forage. CP for oats in oats-vetch -1 -1 mixture and barley in barley-vetch mixture was 175 g kg and 170 g kg, -1 respectively. NDF and ADF for oats in oats-vetch mixture were 494 g kg /sup -1/ and 341 g kg, respectively; while these values for barley in barley-vetch -1 -1 mixture were 340 g kg and 176 g kg, respectively. (author)

  9. The effect of adjuvants and reduced rates of crop protection agents on weed infestation, health and lodging of spring barley (Hordeum sativum L.

    Directory of Open Access Journals (Sweden)

    Cezary A. Kwiatkowski

    2012-12-01

    Full Text Available A field experiment in the cultivation of spring barley was carried out in the period 2007-2009 at the Experimental Farm in Czesławice (central Lublin region on grey-brown podzolic soil derived from loess (soil quality class II. The study involved 3 rates of herbicides, growth retardant and fungicides (100%, 75%, 50% as well as different adjuvant types (oil, surface- active, mineral adjuvant. Plots without any adjuvant were the control treatment. Conventional tillage was used, while mineral fertilization was adjusted to high initial soil nutrient availability. A hypothesis was made that the reduction of pesticide rates by 25-50%, with the simultaneous addition of adjuvants, would allow health, weed infestation and lodging of spring barley to be maintained at a level similar to that obtained under the conditions when maximum rates are applied without any adjuvant. It was also assumed that particular adjuvants could show different interactions with the tested groups of crop protection agents. It was proved that the application of full recommended rates of pesticides gave the best values of the indicators relating to weed infestation, health and lodging of spring barley. However, thanks to the addition of adjuvants to the spray solution, the application of pesticide doses reduced by 25% produced similar results. A higher reduction of pesticide rates (by 50% had an adverse effect on the traits in question. In such case, there was noted higher weed infestation of the spring barley crop, compensation of some weed species, and increased stem-base infection by the fungal disease complex. On the other hand, less radical changes were observed in the case of spring barley lodging. The above-mentioned situation occurred in spite of the fact that the action of pesticides was aided by adjuvants. From the group of adjuvants under comparison, the oil adjuvant Atpolan 80 EC showed the best interaction with the crop protection agents under consideration.

  10. Uptake, degradation and chiral discrimination of N-acyl-D/L-homoserine lactones by barley (Hordeum vulgare) and yam bean (Pachyrhizus erosus) plants

    Czech Academy of Sciences Publication Activity Database

    Götz, C.; Fekete, A.; Gebefuegi, I.; Forczek, Sándor; Fuksová, Květoslava; Li, X.; Englmann, M.; Gryndler, Milan; Hartmann, A.; Matucha, Miroslav; Schmitt-Kopplin, P.

    2007-01-01

    Roč. 389, č. 5 (2007), s. 1447-1457 ISSN 1618-2642 Institutional research plan: CEZ:AV0Z50380511; CEZ:AV0Z50200510 Keywords : UPLC * FTICR-MS * tritium autoradiography Subject RIV: EF - Botanics Impact factor: 2.867, year: 2007

  11. Genotype-Dependent Effect of Exogenous Nitric Oxide on Cd-induced Changes in Antioxidative Metabolism, Ultrastructure, and Photosynthetic Performance in Barley Seedlings (Hordeum vulgare)

    DEFF Research Database (Denmark)

    Chen, Fei; Wang, Fang; Sun, Hongyan

    2010-01-01

    M Cd increased the accumulation of O2•-, H2O2, and malondialdehyde (MDA) but reduced plant height, chlorophyll content, net photosynthetic rate (P n), and biomass, with a much more severe response in the Cd-sensitive genotype. Antioxidant enzyme activities increased significantly under Cd stress......A greenhouse hydroponic experiment was performed using Cd-sensitive (cv. Dong 17) and Cd-tolerant (Weisuobuzhi) barley seedlings to evaluate how different genotypes responded to cadmium (Cd) toxicity in the presence of sodium nitroprusside (SNP), a nitric oxide (NO) donor. Results showed that 5 μ...... in the roots of the tolerant genotype, whereas in leaves of the sensitive genotype, superoxide dismutase (SOD) and ascorbate peroxide (APX), especially cytosol ascorbate peroxidase (cAPX), decreased after 5-15 days Cd exposure. Moreover, Cd induces NO synthesis by stimulating nitrate reductase and nitric oxide...

  12. Cell-type-specific H+-ATPase activity in root tissues enables K+ retention and mediates acclimation of barley (Hordeum vulgare) to salinity stress

    DEFF Research Database (Denmark)

    Shabala, Lana; Zhang, Jingyi; Pottosin, Igor

    2016-01-01

    While the importance of cell type specificity in plant adaptive responses is widely accepted, only a limited number of studies have addressed this issue at the functional level. We have combined electrophysiological, imaging, and biochemical techniques to reveal the physiological mechanisms confe...

  13. The fungi communities of the soil environment of Triticum aestivum and its forecrops: Hordeum vulgare, Vicia faba ssp. minor and Trifolium pratense

    OpenAIRE

    Elżbieta Pląskowska

    2014-01-01

    The species spectrum and abundance of the fungi communities were affected by the soil environment developed by wheat and its forecrops, and by atmospheric conditions. The fungi of the genus Fusarium were the greatest threat to winter wheat regardless of the forecrop. The field bean was the best forecrop to the wheat whereas spring barley was the worst.

  14. Genetic variations of HvP5CS1 and their association with drought tolerance related traits in barley (Hordeum vulgare L.)

    Science.gov (United States)

    Delta-1-pyrroline-5-carboxylate synthase gene1 (P5CS1) is the key gene involved in the biosynthesis of proline and is significantly induced by drought stress. The exploration of genetic variation in HvP5CS1 may facilitate a better understanding of the mechanism of drought adaptation in barley. In th...

  15. Comparing the effect of visceral fat and barley seed ash (hordeum vulgare L) with silversulfadiazine on burn wound healing in rats.

    Science.gov (United States)

    Azadi, Mohammad; Foruozandeh, Hossein; Karami, Leila; Khodayar, Mohammad Javad; Rashidi Nooshabadi, Mohamadreza; Kalantar, Mojtaba; Gudarzi, Mehdi; Pirouzi, Aliyar

    2015-02-01

    Skin burn is one of the most common complications and remains a major public health issue worldwide. This experiment was conducted to study the effects of traditional medicine (Visceral Fat and Barely Seed Ash) compared with silversulfadiazine (SSD) cream on healing burn wounds in rats. Sixty adult male Wistar rats were randomly divided into four groups of equal numbers; each group consisted of 15 animals. After sedation, type II of skin burn with 1.5 cm diameter circle was created on the back of rats with a heated metal in boiling water. Group one was not treated and considered as control. The burned areas in the second, third and fourth groups were applied twice a day with normal saline, SSD cream and traditional preparation, respectively. Percentage of the burn wound concentration and histopathological examinations were used as parameters of our study on days 4, 9and 14. Obtained data were compared between the groups and days. SSD cream and traditional preparation had better effects on burnt wound healing compared with control group. Furthermore, on the final day of study, the average percentage of wound concentration in traditional medicine group was significantly greater than other groups (P < 0.05). This finding was supported and confirmed by histological examination as well. Traditional preparation significantly decreased inflammation and accelerated wound healing in treated rats. Furthermore, the findings of this study can be applied clinically in the future.

  16. Effect of pH and Recombinant Barley (Hordeum vulgare L.) Endoprotease B2 on Degradation of Proteins in Soaked Barley

    DEFF Research Database (Denmark)

    Christensen, Jesper Bjerg; Dionisio, Giuseppe; Poulsen, Hanne Damgaard

    2014-01-01

    .3. Solubilized and degraded proteins evaluated by biuret, SDS-PAGE, and differential proteomics revealed that pH 4.3 had the greatest impact on both solubilization and degradation. In order to boost proteolysis, the recombinant barley endoprotease B2 (rec-HvEP-B2) was included after 8 h using the pH 4.3 regime......Nonfermented soaking of barley feedstuff has been established as an in vitro procedure prior to the feeding of pigs as it can increase protein digestibility. In the current study, two feed cultivars of barley (Finlissa and Zephyr) were soaked in vitro either nonbuffered or buffered at pH 3.6 and 4....... Proteolysis evaluated by SDS-PAGE and differential proteomics confirmed a powerful effect of adding rec-HvEP-B2 to the soaked barley, regardless of the genotype. Our study addresses the use of rec-HvEP-B2 as an effective feed enzyme protease. HvEP-B2 has the potential to increase the digestibility of protein...

  17. Detection of duplicates among repatriated Nordic spring barley (Hordeum vulgare L. s.l.) accessions using agronomic and morphological descriptors and microsatellite markers

    DEFF Research Database (Denmark)

    Lund, Birgitte; Ortiz, Rodomiro; von Bothmer, Roland

    2013-01-01

    on agronomic and morphological discriminators to detect genetic heterogeneity, although with reduced sensitivity compared with microsatellite markers. These results also suggest that grouping ensuing from either approach could reflect distinct patterns of diversity (due to different mutation rates...... their use with results from previous research with microsatellite markers. These accessions were initially grouped into 36 potential duplicates according to passport data but further analysis with microsatellites reduce them to 22 genetically homogeneous groups. The analysis with 26 agronomic...... and morphological descriptors of putative Nordic spring barley accessions from nine gene banks was compared with a previous study with microsatellites. Each agronomic and morphological descriptor was weighed relative to its genetic determination with the aim of reducing the effect of environmental errors on genetic...

  18. Development of mutants of local barley bakur (T. Hordeum vulgare. c v Bakkur L.) with good quantitative and qualitative traits under rainfed condition

    International Nuclear Information System (INIS)

    Saif, A. A.; Al-Shamiri, A. A.

    2012-12-01

    Seeds of local barley bakur were exposed to 150 Gy of gamma rays from cobalt 60 source irradiated seeds were planted in rows as M1.From M1 magnetized population plants , the main spike of each plants were collected, threshed and planted head to row method in 2008 winter season as M2. Evaluation of mutants was done for the increase in long spike and level of resistance to loading in compare with mother variety (untreated) resulted in selecting fifty mutated plants. These plants were planted as plant/ row method along with the mother variety and evaluated for grain yield and level of resistance for lodging which consequent y resulted in selecting of twenty four mutant lines which were varied in plant height long spike and yield. These lines were planted in the research farm during 2009 and the research farm during 2009 and 2011 winter season as M4 and M5 for two consecutive season resulted in selecting eight mutant lines which were distinguished of others in respect of level of resistance and increase of yield. These mutant lines were planted in plots in Kawkban and Bani-Mater locations during 2010 and 2011 seasons along with mother variety and improved variety Kawkban-1 which dominated in the region. Data were collected from the trail analyzed them separate y over each location. Results showed that the mutant line Al-e rra-B-008-15 was the best in grain yield and early maturity followed by Al-erra-B-008-20 and Al-erra-B-008-20. In the meantime these mutant line showed resistance to loading compare with other including the mother variety. There fore it can be recommended to register these mutants as a new varieties for Kawkaban Bain-Mater regions as well as for similar areas in the central and northern regions. This research summarizing results obtained from the trail conducted in both research farm and in farmer fields at Kawkaban and Bani-Mater locations. (Author)

  19. Phytotoxicity of Chitosan and SiO2 Nanoparticles to Seed Germination of Wheat (Triticum aestivum L. and Barley (Hordeum vulgare L. Plants

    Directory of Open Access Journals (Sweden)

    Faride BEHBOUDI

    2017-06-01

    Full Text Available Plants such as wheat and barley that are strategically important crops need to be considered to develop a comprehensive toxicity profile for nanoparticles (NPs. The present study was aimed to investigate the effects of chitosan and SiO2 NPs on wheat and barley plants. Two factorial experiments (seeds priming and direct exposure were performed based on a completely randomized design in four replications. Results showed that the seeds priming with the NPs had not significant effect on germination parameters such as Germination Percentage (GP, Germination Rate (GR, Germination Value (GV, Mean Germination Time (MGT, Pick Value (PV and Mean Daily Germination (MDG. In contrast, exposure of the seeds to the NPs had significant effects on these parameters. In both experiments, treatments had significant effects on shoot, seedling, root length, fresh and dry weight, as well as vigor indexes as compared to the control. In most traits, the best concentration of NPs was 30 ppm, whereas applications of the NPs with 90 ppm displayed adverse effects on majority of the studied traits. According to these results, selectivity in applications of NPs with suitable concentration and method is essential for different plant species.

  20. The bioaccumulation of heavy metals in barley (Hordeum vulgare L cultivated on fly ash dump mixed with compost and natural zeolite materials

    Directory of Open Access Journals (Sweden)

    Smaranda Mâșu

    2012-10-01

    Full Text Available The physic-chemical characteristics of the upper layers of fly ash dumps are very important when phytostabilizationplant selection is carried out. Plants with topsoil well developed roots, like cereals are used to stabilize fly ash dumpsin order to eliminate the deflation, erosion, etc. These plant species could be used in thephytostabilization/phytoextraction variant taking into account their metal hyper accumulation capacity, and also inphytostabilization variant by adequate topsoil treatments when a decrease mobility of metals from soil to plants isachieved and thus a less toxic crop is obtained. This study presents a comparative analysis of the metalbioaccumulation degree in plant tissues (grain and straw of barley cultivated on fly ash variants treated withdifferent quantities of compost in the absence/presence of natural zeolite materials, indigenous volcanic tuff. Theaddition of plant debris and sewage sludge compost mixed with natural zeolite materials has lowered thebioaccumulation of Cr with 49%, of Cu with 29%, Fe with more than 77.5%, in grains and straw when compared tountreated fly ash. Barley plants does not allow for Pb and Ni transfer from the fly ash in the aerial part of tissue.

  1. QTLs for straw quality characteristics identified in recombinant inbred lines of a Hordeum vulgare x H spontaneum cross in a Mediterranean environment

    DEFF Research Database (Denmark)

    Grando, S.; Baum, M.; Ceccarelli, S.

    2005-01-01

    Barley straw is commonly used as animal feed in many developing countries. Even a small increase in its nutritive value can have a large impact on animal production, and hence, on rural livelihood and human nutrition. Straw quality is strongly affected by environmental factors and is, therefore...... neutral detergent fiber, acid detergent fiber, lignin, digestible organic matter in dry matter, voluntary intake, crude protein, and straw morphology (the percentage of blades, sheaths, and stems). Localization of QTLs was performed using Windows QTL Cartographer, version 2.0. Seventy-three QTLs were...... identified, the majority of which (17) in the driest of the four environments. Only six QTLs were identified. ed in two environments; in five cases, one of the two was the wettest environment. This is discussed in relation to the possibility of improving straw quality in favorable environments where yields...

  2. Chromosome landing at the ¤Mla¤ locus in barley (¤Hordeum vulgare¤ L.) by means of high-resolution mapping with AFLP markers

    DEFF Research Database (Denmark)

    Schwarz, G.; Michalek, W.; Mohler, V.

    1999-01-01

    The complex Mla locus of barley determines resistance to the powdery mildew pathogen Erysiphe graminis f. sp. hol dei. With a view towards gene isolation, a population consisting of 950 F-2 individuals derived from a cross between the near-isogenic lines 'P01' (Mla1) and 'P10' (Mla12) was used to...

  3. Barley (Hordeum vulgare in the Okhotsk culture (5th-10th century AD of northern Japan and the role of cultivated plants in hunter-gatherer economies.

    Directory of Open Access Journals (Sweden)

    Christian Leipe

    Full Text Available This paper discusses archaeobotanical remains of naked barley recovered from the Okhotsk cultural layers of the Hamanaka 2 archaeological site on Rebun Island, northern Japan. Calibrated ages (68% confidence interval of the directly dated barley remains suggest that the crop was used at the site ca. 440-890 cal yr AD. Together with the finds from the Oumu site (north-eastern Hokkaido Island, the recovered seed assemblage marks the oldest well-documented evidence for the use of barley in the Hokkaido Region. The archaeobotanical data together with the results of a detailed pollen analysis of contemporaneous sediment layers from the bottom of nearby Lake Kushu point to low-level food production, including cultivation of barley and possible management of wild plants that complemented a wide range of foods derived from hunting, fishing, and gathering. This qualifies the people of the Okhotsk culture as one element of the long-term and spatially broader Holocene hunter-gatherer cultural complex (including also Jomon, Epi-Jomon, Satsumon, and Ainu cultures of the Japanese archipelago, which may be placed somewhere between the traditionally accepted boundaries between foraging and agriculture. To our knowledge, the archaeobotanical assemblages from the Hokkaido Okhotsk culture sites highlight the north-eastern limit of prehistoric barley dispersal. Seed morphological characteristics identify two different barley phenotypes in the Hokkaido Region. One compact type (naked barley associated with the Okhotsk culture and a less compact type (hulled barley associated with Early-Middle Satsumon culture sites. This supports earlier suggestions that the "Satsumon type" barley was likely propagated by the expansion of the Yayoi culture via south-western Japan, while the "Okhotsk type" spread from the continental Russian Far East region, across the Sea of Japan. After the two phenotypes were independently introduced to Hokkaido, the boundary between both barley domains possibly existed ca. 600-1000 cal yr AD across the island region. Despite a large body of studies and numerous theoretical and conceptual debates, the question of how to differentiate between hunter-gatherer and farming economies persists reflecting the wide range of dynamic subsistence strategies used by humans through the Holocene. Our current study contributes to the ongoing discussion of this important issue.

  4. Assessment of CH4 and N2O fluxes in a Danish Beech (Fagus sylvatica) forest and an adjacent N-fertilised barley (Hordeum vulgare)

    DEFF Research Database (Denmark)

    Ambus, P.; Jensen, J.M.; Prieme, A.

    2001-01-01

    Fluxes of CH4 and N2O were measured regularly in an agricultural field treated with 280 g m(-2) of sewage sludge. In a nearby beech forest N2O and CH4 fluxes were measured in a well-drained (dry) area and in a wet area adjacent to a drainage canal. We observed brief increases of both CH4 and N2O...... and independent of drainage status. Methane oxidation was observed all-year round in the forest cumulating to -225 mg C m(-2) and -84 mg C m(-2) in dry and wet areas. In a model experiment with incubated soil cores, nitrogen amendment (NH4Cl) and perturbation significantly reduced CH4 oxidation in the forest soil...... sludge, respectively. Four months after the sludge applications a significant effect on CO2 and NO emissions was still obvious in the field, the latter perhaps due to elevated nitrification. Nitrous oxide emission in the beech forest was about six times smaller (45 mg N m(-2)) than in the field...

  5. Engineering of the aspartate family biosynthetic pathway in barley (Hordeum vulgare L.) by transformation with heterologous genes encoding feed-back-insensitive aspartate kinase and dihydrodipicolinate synthase

    DEFF Research Database (Denmark)

    Brinch-Pedersen, H.; Galili, G.; Sørensen, K.

    1996-01-01

    In prokaryotes and plants the synthesis of the essential amino acids lysine and threonine is predominantly regulated by feed-back inhibition of aspartate kinase (AK) and dihydrodipicolinate synthase (DHPS). In order to modify the flux through the aspartate family pathway in barley and enhance...... the accumulation of the corresponding amino acids, we have generated transgenic barley plants that constitutively express mutant Escherichia coli genes encoding lysine feed-back insensitive forms of AK and DHPS. As a result, leaves of primary transformants (T0) exhibited a 14-fold increase of free lysine and an 8......, no differences were observed in the composition of total amino acids. The introduced genes were inherited in the T1 generation where enzymic activities revealed a 2.3-fold increase of AK activity and a 4.0-9.5-fold increase for DHPS. T1 seeds of DHPS transformants showed the same changes in free amino acids...

  6. DNA binding sites recognised in vitro by a knotted class 1 homeodomain protein encoded by the hooded gene, k, in barley (Hordeum vulgare)

    DEFF Research Database (Denmark)

    Krusell, L; Rasmussen, I; Gausing, K

    1997-01-01

    of knotted1 from maize was isolated from barley seedlings and expressed as a maltose binding protein fusion in E. coli. The purified HvH21-fusion protein selected DNA fragments with 1-3 copies of the sequence TGAC. Gel shift experiments showed that the TGAC element was required for binding and the results...

  7. Effects of microwaves on the reduction of Aspergillus flavus and Aspergillus parasiticus on brown rice (Oryza sativa L.) and barley (Hordeum vulgare L.).

    Science.gov (United States)

    Lee, Seung-Hun; Park, Shin Young; Byun, Kye-Hwan; Chun, Hyang Sook; Ha, Sang-Do

    2017-07-01

    Aspergillus flavus and Aspergillus parasiticus are primary pathogen moulds on brown rice and barley. This study investigated the effects of microwave irradiation (MWI) (2450 MHz, 700 W, 10-50 s) on inactivation of A. flavus and A. parasiticus on brown rice and barley and the quality of these samples. The counts of both strains were significantly (p  90% reduction of mould without causing deleterious changes to the colour, moisture content and sensory qualities of these cereals.

  8. Weed Control Efficiency of wild Safflower (Carthamus oxyacanthus M. Bieb in Replacement Series Technique of Barley (Hordeum vulgare L. and Common Vetch (Vicia sativa L.

    Directory of Open Access Journals (Sweden)

    abdolreza ahmadi

    2017-08-01

    Full Text Available Introduction In agronomy, natural outlook has been expressed in different forms which stable agriculture is an example. Stable agriculture is ascribed to the authentic management of agricultural resources, which in addition to fulfilling the ever-changing needs of humans, maintains the health of environment and capacity of water and soil resources. Application of herbicides, besides being costly, resulted in the selection of herbicide resistant weed species and has become an environmental contamination factor. However, reduction of herbicide consumption is one of the goals of modern agriculture, with several methods being suggested, including intercropping. In natural conditions of production, environment conservation of weed existence requires cost. One of the important preparations in weed control from the perspective of sustainable agriculture, is using intercropping system. The aim of this study was to determine the role of crop diversity on weed and crop production based on the beneficial effects of intercropping system than pure. Materials and methods In order to study effects of mixed and sole cropping of barley with common vetch on their biologic yield and utilization indices, an experiment was conducted in Agricultural college of the University of Lorestan, during the growing season of 2013-2014 with 24 treatments using the method of rows replacement series technique by the randomized complete block design in a factorial arrangement with three replications. First factor included 6 levels of intercropping: sole cropping of common vetch (100%, 55-45 (Common vetch-barley, 35-65, 45-55, 65-35 and sole cropping of barley and second factor included 4 levels of weed wild safflower, control, 10, 15 and 20 plants per m2. In this experiment WCE, LER and CR were measured. The data were subjected to analysis of variance (ANOVA using Mstat-C computer software. Mean comparisons were performed using Duncan’s multiple range test at two levels of significant 1% and 5%. Results and discussion There was significant difference between minimum and maximum dry weight of weeds, the results showed that barley have important role in weed control wild safflower. Therefore, weed control efficiency in 15 plant in m2 was higher than two 10 and 20 plant in m2. The lowest WCE (161.27% was found at 15-35-65 treatment, but, the highest WCE (51.99 was obtained from 15-65-35 (Wild safflower-common vetch-barley treatment. Computes showed that WCE, in 15 plants of wild safflower/m2, was more than 10 and 20 p/m2. The reduction in weed population and biomass in intercropping systems with barley may be attributed to shading effect and competition stress created by the canopy. Thus, result showed that reduction rate of common vetch in intercropping, with bearing compatibility power to weeds reduced LER. CR for common vetch intercropping component in comparison with barley in total treatments was>1. The highest CR, for vetch obtained from treatment 45-55-control (2.64 and for barley from seed ratio 65-35-control (1.83. Conclusion The results in this study showed various seed rate had noticeable effect on forage yield, LER and weed control. In this experiment changing seed rate in two tested plants (barly- commen vetch changed the number and weed species, as a result noticeable changing was created in their competitive power. Result showed that seed rate (35% barley-65% common vetch was better than other treatment, not only in use efficiency of environment, but also it had more dry forage yield. Also, former seed rate had effective role in decreasing the weed biomass. This important result was related to reduced light penetrate at the bottom of cover crop and probably lack of competition in access to environmental resources was also affected. So using this seed density for mentioned area is recommended for reducing weed competition and improving the quality and quantity of dry forage. Acknowledgments The authors gratefully acknowledge the teachers of College of Agriculture of Lorestan University, for their critical review of the manuscript.

  9. DETERMINACIÓN DEL POTENCIAL NUTRITIVO Y FUNCIONAL DE GALLETAS Y COMPOTAS PREPARADOS A BASE DE CHOCHO (Lupinus bogotensis, CEBADA (Hordeum vulgare Y ZANAHORIA (Daucus carota

    Directory of Open Access Journals (Sweden)

    Herminia Sanaguano

    2013-12-01

    Full Text Available El propósito de este trabajo fue estudiar el efecto nutricional de las combinaciones  de chocho, cebada y zanahoria a través de análisis de minerales como: potasio calcio, fósforo y hierro; así como  el  análisis de proteína, cenizas,  sólidos totales y  vitamina A. Considerando de esta manera, la interacción de los componentes del alimento para cada uno de los tratamientos. Se aprovechó estos productos  agrícolas debido a que son muy cultivados en la provincia de Bolívar, la experimentación se la realizó en los laboratorios de Biología Molecular ubicados en el campus Agropecuario Laguacoto II, mediante análisis de minerales, bromatológicos, vitamina A. Se determinó que la combinación del tratamiento 7 (T7 es el mejor debido a que cumple con las especificaciones de comparación  nutrición infantil de la Organización Mundial de la Salud. Como es el caso del potasio, proteína y vitamina A. Sensorialmente este tratamiento es el más aceptado por niños, recalcando que los resultados fueron tabulados  y su comparación de significancia fue de (p>0.05

  10. Giemsa C-banding in two polyploid, South American Hordeum species, H. tetraploidum and H. lechleri, and their aneuploid hybrids with H. vulgare

    DEFF Research Database (Denmark)

    Linde-Laursen, Ib; Bothmer, R. von

    1986-01-01

    . The hybrids were stably aneuploid. Both had lost and acquired H. vulgare chromosomes. Thus, somatic elimination of chromosomes was combined with multiplication of chromosomes. The observations of stably aneuploid hybrids have implications for the exploitation of alien germplasm. The activity of non-H. vulgare...

  11. Genetic Study of the Manganese Use Efficiency Trait in Winter Barley (Hordeum vulgare L.) by Genome- Wide Association and Genomic Selection

    DEFF Research Database (Denmark)

    Leplat, Florian Jean Victor

    Manganese (Mn) deficiency remains an unsolved nutritional problem affecting crop production worldwide. The tolerance to Mn limiting conditions, known as Mn efficiency, is a quantitative abiotic stress trait, generally controlled by several genes. However the underlying genetic background of Mn...... functionality in Mn dependent pathways and processes. In a the second step, a genuine statistical method to assist breeding programs in selecting new varieties, named Genomic Selection (GS), was applied. It was demonstrated that GS is an effective tool to be used in breeding programs for selecting more...

  12. Evaluation of the mature grain phytase candidate HvPAPhy_a gene in barley (Hordeum vulgare L.) using CRISPR/Cas9 and TALENs.

    Science.gov (United States)

    Holme, Inger B; Wendt, Toni; Gil-Humanes, Javier; Deleuran, Lise C; Starker, Colby G; Voytas, Daniel F; Brinch-Pedersen, Henrik

    2017-09-01

    In the present study, we utilized TALEN- and CRISPR/Cas9-induced mutations to analyze the promoter of the barley phytase gene HvPAPhy_a. The purpose of the study was dual, validation of the PAPhy_a enzyme as the main contributor of the mature grain phytase activity (MGPA), as well as validating the importance of a specific promoter region of the PAPhy_a gene which contains three overlapping cis-acting regulatory elements (GCN4, Skn1 and the RY-element) known to be involved in gene expression during grain filling. The results confirm that the barley PAPhy_a enzyme is the main contributor to the MGPA as grains of knock-out lines show very low MGPA. Additionally, the analysis of the HvPAPhy_a promoter region containing the GCN4/Skn1/RY motif highlights its importance for HvPAPhy_a expression as the MGPA in grains of plant lines with mutations within this motif is significantly reduced. Interestingly, lines with deletions located downstream of the motif show even lower MGPA levels, indicating that the GCN4/SKn1/RY motif is not the only element responsible for the level of PAPhy_a expression during grain maturation. Mutant grains with very low MPGA showed delayed germination as compared to grains of wild type barley. As grains with high levels of preformed phytases would provide more readily available phosphorous needed for a fast germination, this indicates that faster germination may be implicated in the positive selection of the ancient PAPhy gene duplication that lead to the creation of the PAPhy_a gene.

  13. Evaluation of recurrent radiation with Cobalt 60 gamma rays on agronomic traits of barley (Hordeum Vulgare L.) in the R2M1 generation

    International Nuclear Information System (INIS)

    Vega G, M.G.

    1994-01-01

    The objective of this work was to evaluate the effect of recurrent radiation on agronomic traits in two barley varieties. The research was carried out at experimental fields pertaining to the Instituto de Investigacion Agropecuaria, Acuicola y Forestal of the Estado de Mexico (ICAMEX). The biological material was irradiated in the Gamma Cell 220 at the Instituto Nacional de Investigaciones Nucleares (ININ). The experimental design was divided plots in the randomized blocks, with four replications. The factor varieties (Cerro Prieto and Puebla) was assigned to the big plots mean while in the factor doses was assignated to the small plots (0, 10, 20, 30, 40 and 50 krad of gamma rays). The variables under study were: germination, number of shoots, plant height, incidence of Puccinia striiformis, days to flowering, days to physiological maturity, spike length and yield. The analysis of variance exhibited no significant differences between varieties for all the studied variables. Regarding to dose, most of the studied variables exhibited significant differences, except for incidence of Puccinia striiformis and days to flowering. The interaction variety x doses showed significance only for the variable days to flowering and days to physiological maturity. The mean separation by Tukey test at 0.05 and the regression analysis showed that the variables: germination, number of shoots, plant height, spike length and yield decreased as the dose increased. On the other hand in the variables incidence of Puccinia striiformis, days to flowering and days to physiological maturity exhibited a direct relationship with the dose. (Author)

  14. under water stress conditio

    African Journals Online (AJOL)

    A. Thameur

    2012-05-17

    adjustment trait variation in barley (Hordeum vulgare L.). Theor. Appl. Genet., 96: 688-698. Thameur A, Ferchichi A, López-Carbonell M (2011). Quantification of free and conjugated abscisic acid in five genotypes of barley. (Hordeum ...

  15. The effect of fast neutrons, as compared with X-rays upon mutation spectrum and mutation frequency in Arabidopsis thaliana (L.) Heynh. and Hordeum vulgare L. in relation to evaluation of the BARN-reactor

    International Nuclear Information System (INIS)

    Dellaert, L.M.W.

    1980-01-01

    Explanations were sought for the 'saturation' in mutant frequency, observed after relatively high irradiation doses (fast neutrons and X-rays) in Arabidopsis thaliana (L.) Heynh, when scoring for mutants is done in the siliques (Mueller's embryotest) of the 'main' inflorescence of M 1 -plants. Studies have been carried out on the effect of the presence of dithiothreitol (DTT) during irradiation, on fast neutron and X-ray induced M 1 -ovule sterility, M 2 -embryonic lethals, M 2 -chlorophyll mutants and M 2 -viable mutants in Arabidopsis thaliana. It was found that DTT provides considerable protection against both fast neutron and X-ray induced genetic damage. (Auth.)

  16. Predicting Changes of Rainfed Barley (Hordeum vulgare L. Farming Calendar using Downscaling LARS-WG and HadCM3 Models in Lorestan Province in 2011-2030 period

    Directory of Open Access Journals (Sweden)

    Mahmoud Ahmadi

    2017-10-01

    Full Text Available Introduction The results of climate change studies in recent years confirm this phenomenon occurrence in Iran. The climatic characteristics (potential and limitations of climate are considered in the long run, to determine the pattern of cultivation and distribution of different plant species. Unfortunately, the agricultural sector due to the low speed and power compliance, will suffer the greatest impact of climate change. General circulation models provide accurate tools to predict future climatic conditions, and the necessary data for the implementation of simulation models and the development of crops under climate change conditions. The study of the effects of climate change on the agricultural sector seems to be necessary due to increase the demand for agricultural production. The aim of this study was to investigate the effects of climate change on the rainfed barley farming calendar in Lorestan province as an effective pole in cereal cultivation in Iran. Materials and methods In order to study the effects of climate change on the rainfed barley farming calendar, outputs from the HadCM3 model simulations were used. After evaluating the LARS-WG stochastic weather generator model using performance indicators and ensure the suitability of the model, this model was applied to downscale HadCM3 model outputs. A2 scenario was chosen to evaluate climate impacts for the period 2011–2030. In this study, due to the suitable temperature for germination in the region, has been emphasized only on the precipitation to find the most suitable time for barley cultivation. Planting date was calculated by Weibull probability with 50 and 75% confidence intervals. Growing degree days (GDD were used to calculate the phenological stages. For the forecast period, the same method was used to determine the farming calendar. Results Discussion The results showed that in the observation period, the earliest planting date was observed in northern province in Borujerd and Aleshtar cities, and as we go south, the planting date postponed. The beginning of the cultivation is a function of temperature, so that the latest planting date was observed in Poldokhtar city as the warmest region of the province. In the observation period, the latest harvesting date was observed in Aligoodarz and Aleshtar cities and the earliest harvesting date was observed in Poldokhtar city. In the forecast period, the beginning of crop cultivation did not change much and remained constant for less than 10 days compared to the observation period. However, many changes occurred in the harvesting date. So that the most changes with 60 days earlier occurred at the Poldokhtar city. The duration of the growth period reduced at all the stations. The greatest reduction in the duration of the growth period was observed at the Aligudarz city with 62 days. The decreasing duration of the growth period was due to changes in temperature and precipitation. This shows that the fall precipitation, which is related to the cold season, does not change much, but the precipitation of the warm season decreases. One of the limitations of rainfed barley cultivation in Lorestan province is temperature in the tillering stage. This restriction will continue in future. In the observation period, temperature of flowering and grain filling period was in optimal conditions, but in the forecast period, with increasing temperature, we will encounter high temperature stress in these two stages. The adaptation strategies are different depending on the type of farming and the climate change scenario. Among these strategies we can mention changes in planting date and crop rotation, use of resistant varieties to the warm conditions and irrigation management. Conclusion The results showed that at all stations, the planting date will be earlier and the duration of the growth period will decrease in the period 2011–2030.

  17. VOLÁTILES DE MAÍZ (lea mays, CEBADA (Hordeum vulgare Y CAFE (Coffea arábica TOSTADOS. INFLUENCIA DE LA ADICIÓN DE ESTOS CEREALES EN EL AROMA DEL CAFÉ

    Directory of Open Access Journals (Sweden)

    Alvaro Duarte Ruiz

    2010-09-01

    Full Text Available Los volátiles de café a dos grados de torrefacción, como también los del maíz y los de cebada tostados, fueron extraídos por "Headspace" dinámico. La composición de los volátiles fue determinada por Cromatografía de Gases de Alta Resolución acoplada a Espectrometría de Masas (CGAREM. Los constituyentes mayoritarios del café torrefactado a 230 "C durante 8 minutos fueron el furfural 2-metil-3 dihidrofuranona y 2,3- pentadiona mientras que a230"Cy 10 minutos fueron el 2-furanmetanol, 3 metilpirazina, la 1,6-dimetilpirazina y acetato de 2-furanmetanol. Los constituyentes de mayor concentración en el maíz fueron el furfural y el 5-metilfurfuraI y en la cebada el 2-metilbutanal, el 3 metilbutanal y el furano. El análisis sensorial del café y mezclas de café con maiz y cebada permitió detectar adulteración a partir de 20% de cereal en un café torrefactado durante 8 min., pero cuando la torrefacción se realizó por 10 min. fue muy difícil percibir el aroma a cereal, principalmente cuando éste es cebada. Los resultados fueron utilizados como indicadores de la adulteración del café con cereales y como un criterio de evaluación para garantizar la pureza del café Colombiano.

  18. Estudio reológico de las mezclas de harinas: trigo (Triticum vulgare, cebada (Hordeum vulgare y papas (Solanum tuberosum para la utilización en la elaboración de pan

    Directory of Open Access Journals (Sweden)

    Galo Sandoval

    2012-01-01

    Full Text Available Con las harinas de trigo importado, el trigo nacional y los cereales que se producen en el país, y el tubérculo papa, se realizó un estudio reológico para determinar las proporciones más convenientes de sustitución de harina de trigo importado con éstas últimas y su factibilidad para la elaboración de pan. Se trabajó en mezclas de harinas, de trigo CWRS#1 (trigo rojo de primavera del oeste de Canadá, de cebada Cañicapa, trigo Cojitambo y papa Gabriela, provenientes de cultivos ecuatorianos, en proporciones de 10, 20 y 30% (p/p. Las masas provenientes de las mezclas de harinas fueron analizadas en un Farinógrafo Brabender, con la finalidad de determinar la absorción de agua, el tiempo de desarrollo, la estabilidad e índice de tolerancia, con el objeto de seleccionar las mezclas de harinas que tuvieran un comportamiento similar a la harina de trigo CWRS#1. Las mejores mezclas encontradas fueron: harina de trigo CWRS#1 sustituida con el 10, 20 y 30% de harina de cebada Cañicapa; y la mezcla de harina de trigo CWRS#1 con harina de trigo Cojitambo en un 30%. Estas mezclas de harinas seleccionadas fueron también sometidas al análisis reológico de sus masas utilizando un equipo MIXOLAB. La utilización de las harinas seleccionadas en la elaboración de pan fue evaluado a través de un análisis sensorial. Los panes más aceptados por los consumidores fueron aquellos que contenían 20 y 30% de cebada; seguido del grupo de los elaborados con trigo importado con 30% de trigo Cojitambo, y los que contenían el 10% de harina de cebada.

  19. The barley (Hordeum vulgare) cellulose synthase-like D2 gene (HvCslD2) mediates penetration resistance to host-adapted and nonhost isolates of the powdery mildew fungus

    NARCIS (Netherlands)

    Douchkov, Dimitar; Lueck, Stefanie; Hensel, Goetz; Kumlehn, Jochen; Rajaraman, Jeyaraman; Johrde, Annika; Doblin, Monika S.; Beahan, Cherie T.; Kopischke, Michaela; Fuchs, René; Lipka, Volker; Niks, Rients E.; Bulone, Vincent; Chowdhury, Jamil; Little, Alan; Burton, Rachel A.; Bacic, Antony; Fincher, Geoffrey B.; Schweizer, Patrick

    2016-01-01

    Cell walls and cellular turgor pressure shape and suspend the bodies of all vascular plants. In response to attack by fungal and oomycete pathogens, which usually breach their host's cell walls by mechanical force or by secreting lytic enzymes, plants often form local cell wall appositions

  20. Development and Validation of a Reversed-Phase Liquid Chromatography Method for the Simultaneous Determination of Indole-3-Acetic Acid, Indole-3-Pyruvic Acid, and Abscisic Acid in Barley (Hordeum vulgare L.

    Directory of Open Access Journals (Sweden)

    Ilva Nakurte

    2012-01-01

     mm I.D with a mobile phase composed of methanol and 1% acetic acid (60 : 40 v/v in isocratic mode at a flow rate of 1 ml min-1. The detection was monitored at 270 nm (ABA and at 282 nm (Ex and 360 nm (Em (IAA, IPA. The developed method was validated in terms of accuracy, precision, linearity, limit of detection, limit of quantification, and robustness. The determined validation parameters are in the commonly acceptable ranges for that kind of analysis.

  1. Haplotype divergence and multiple candidate genes at Rphq2, a partial resistance QTL of barley to Puccinia hordei

    Czech Academy of Sciences Publication Activity Database

    Yeo, F. K. S.; Wang, Y.; Vozábová, Tereza; Huneau, C.; LeRoy, P.; Chalhoub, B.; Qi, X. Q.; Niks, R. E.; Marcel, T. C.

    2016-01-01

    Roč. 129, č. 2 (2016), s. 289-304 ISSN 0040-5752 Institutional support: RVO:67985939 Keywords : cartial resistance genes * cloning * Hordeum vulgare Subject RIV: EF - Botanics Impact factor: 4.132, year: 2016

  2. Journal of Genetics Online Resources

    Indian Academy of Sciences (India)

    pdf. Jaiswal S. K., Pandey S. P., Sharma S., Prasad R., Prasad L. C., Verma R. P. S. and Joshi A. K. 2010 Diversity in Indian barley (Hordeum vulgare) cultivars and identification of genotype-specific fingerprints using microsatellite markers.

  3. Effects of INH, DNP, 2,4-D and CMU on the photosynthetic activity of barley and maize plants; Efecto de cuatro inhibidores metabolicos (INH, DNP, 2, 4-D y CMU) sobre la actividad fotosintetica de plantular de cebada (Hordeum vulgare L.) y Maiz (Zea mais L.)

    Energy Technology Data Exchange (ETDEWEB)

    Fernandez, J; Prieto, M P

    1979-07-01

    Determinations of the rate of photosynthesis were made in barley and maize leaves treated with INH, DNP, 2,4-D or CMU. 1 ppm of the chemicals in nutritive solutions was absorbed by roots during 24 or 48 hours in both dark and light conditions. After this period, photosynthetic activity, compensation point and 14{sup C}O{sub 2} assimilation were determined. Results show that INH increases the rate of photosynthesis, DNP and 2,4-D do not alter it sensibly and CMU acts as a strong inhibitor of photosynthesis. Some possible applications for ths obtention of labelled compounds by biosynthesis are discussed. (Author) 87 refs.

  4. Volátiles De Maíz {lea mays, cebada (Hordeum vulgare y café (Coffea arábica tostados. influencia de la adición de estos cereales en el aroma del café

    Directory of Open Access Journals (Sweden)

    Margoth Suárez

    2010-07-01

    Full Text Available Los volátiles de café a dos grados de torrefacción, como también los del maíz y los de cebada tostados, fueron extraídos por "Headspace" dinámico. La composición de los volátiles fue determinada por Cromatografía de Gases de Alta Resolución acoplada a Espectrometría de Masas (CGAREM. Los constituyentes mayoritarios del café torrefactado a 230 "C durante 8 minutos fueron el furfural 2-metil-3-dihidrofuranona y 2,3- pentadiona mientras que a230"Cy 10 minutos fueron el 2-furanmetanol, 3-metilpirazina, la 1,6-dimetilpirazina y acetato de 2-furanmetanol. Los constituyentes de mayor concentración en el maíz fueron el furfural y el 5-metilfurfuraI y en la cebada el 2-metilbutanal, el 3-metilbutanal y el furano. El análisis sensorial del café y mezclas de café con maiz y cebada permitió detectar adulteración a partir de 20% de cereal en un café torrefactado durante 8 min., pero cuando la torrefacción se realizó por 10 min. fue muy difícil percibir el aroma a cereal, principalmente cuando éste es cebada. Los resultados fueron utilizados como indicadores de la adulteración del café con cereales y como un criterio de evaluación para garantizar la pureza del café Colombiano.

  5. Effects of INH, DNP, 2, 4-D and CMU on the sugar content of the barley and maize leaves; Efecto de cuatro inhibidores metabolicos (INH, DNP, 2, 3-D y CMU) sobre el contenido en azucares de hohas de cebada (Hordeum vulgare L.) y Maiz (Zea mais L.)

    Energy Technology Data Exchange (ETDEWEB)

    Fernandez, J; Sancho, P

    1979-07-01

    1 ppm of the chemicals in nutritive solution was absorbed by barley and maize roots during 24 and 48 hours in dark or light conditioners in order to determine the best conditions. for the obtention of labelled sugars with high specific activity. Results show that the highest specific activity was obtained In maize plants treated with DNP for 24 hours in dark conditions. (Author) 51 refs.

  6. Comparative study of the inhibition produced by CMU (3-p-chlorophenyl-1. 1-dimethyl-urea) in barley leaves, on the photophosphorilation, photocarboxilation and hill reaction; Estudio comparativo de la inhibicion que produce el CMU sobre la fotogosforilacion, totocarboxilacion y reaccion de hill en cebada. (Hordeum vulgare L.)

    Energy Technology Data Exchange (ETDEWEB)

    Fernandez, J; Sancho, C

    1977-07-01

    The effect of different concentrations of CMU (from 10 {sup -}8 M to 10{sup -}3 H) on the photophosphorilation, photocarboxilation and Hill reaction was studied. CMU (Carbon-H labelled) was utilized to determine the concentration of CMU in leaf parenchyma. Photocarboxilation and photophosphorolation was sensible to concentrations less than 10{sup -}7 M. Hill reaction in isolated chloroplasts was sensible from concentrations of the order of 10{sup -}8 M. (Author) 50 refs.

  7. Direct selection of expressed sequences on a YAC clone revealed proline-rich-like genes and BARE-1 sequences physically linked to the complex ¤Mla¤ powdery mildew resistance locus of barley (¤Hordeum vulgare¤ L.)

    DEFF Research Database (Denmark)

    Schwarz, G.; Michalek, W.; Jahoor, A.

    2002-01-01

    homology to the copia-like retroelement BA REI of barley, putatively involved in evolution of disease resistance loci. The high degree of clones representing barley rRNA sequences or false positives is a major disadvantage of direct selection of cDNAs in barley. (C) 2002 Elsevier Science Ireland Ltd. All...... gene. Of 22 selected cDNA clones, six were re-located on the YAC by southern analysis. Two of these clones are predicted to encode members of the hydroxyproline-rich glycoprotein and proline-rich protein gene families which have been implicated in plant defense response. Four sequences showed high...

  8. Gene capture from across the grass family in the allohexaploid Elymus repens (L.) Gould (Poaceae, Triticeae) as evidenced by ITS, GBSSI, and molecular cytogenetics.

    Science.gov (United States)

    Mahelka, Václav; Kopecký, David

    2010-06-01

    Four accessions of hexaploid Elymus repens from its native Central European distribution area were analyzed using sequencing of multicopy (internal transcribed spacer, ITS) and single-copy (granule-bound starch synthase I, GBSSI) DNA in concert with genomic and fluorescent in situ hybridization (GISH and FISH) to disentangle its allopolyploid origin. Despite extensive ITS homogenization, nrDNA in E. repens allowed us to identify at least four distinct lineages. Apart from Pseudoroegneria and Hordeum, representing the major genome constituents, the presence of further unexpected alien genetic material, originating from species outside the Triticeae and close to Panicum (Paniceae) and Bromus (Bromeae), was revealed. GBSSI sequences provided information complementary to the ITS. Apart from Pseudoroegneria and Hordeum, two additional gene variants from within the Triticeae were discovered: One was Taeniatherum-like, but the other did not have a close relationship with any of the diploids sampled. GISH results were largely congruent with the sequence-based markers. GISH clearly confirmed Pseudoroegneria and Hordeum as major genome constituents and further showed the presence of a small chromosome segment corresponding to Panicum. It resided in the Hordeum subgenome and probably represents an old acquisition of a Hordeum progenitor. Spotty hybridization signals across all chromosomes after GISH with Taeniatherum and Bromus probes suggested that gene acquisition from these species is more likely due to common ancestry of the grasses or early introgression than to recent hybridization or allopolyploid origin of E. repens. Physical mapping of rDNA loci using FISH revealed that all rDNA loci except one minor were located on Pseudoroegneria-derived chromosomes, which suggests the loss of all Hordeum-derived loci but one. Because homogenization mechanisms seem to operate effectively among Pseudoroegneria-like copies in this species, incomplete ITS homogenization in our samples

  9. Intergeneric hybridization and C-banding patterns in Hordelymus (Triticeae, Poaceae)

    DEFF Research Database (Denmark)

    Bothmer, R. von; Lu, B.-R.; Linde-Laursen, I.

    1994-01-01

    Crosses of Hordelymus europaeus (2n = 4x = 28) with four genera in the Triticeae were attempted. Adult hybrids were obtained in combinations with Hordeum bogdanii (2x), Hordeum depressum (4x), and Secale cereale (2x). The meiotic pairing was very low in the hybrids with H. bogdanii and Secale...... cereale (0.12 and 0.30 chiasmata/cell, respectively), whereas high pairing (9.90 chiasmata/cell) was found in hybrids with H. depressum due to autosyndetic pairing of H. depressum chromosomes. The chromosome complement of Hordelymus europaeus comprised 16 metacentrics, 8 submetacentrics, and 4 SAT...

  10. Inhibition of barley grain germination by light

    NARCIS (Netherlands)

    Roth-Bejerano, N.; Meulen, R.M. van der; Wang, M.

    1996-01-01

    Intact grains of barley (Hordeum distichum cv. Triumph) germinated rapidly in the dark or when exposed to brief daily light breaks in the temperature range 15-25°C, although germination proceeded less rapidly at low temperatures. Prolonged illumination (16 h/day) or continuous light inhibited

  11. Integrated transcriptomics and proteomics analysis of storage protein composition in developing barley grain to improve nutritional profile

    DEFF Research Database (Denmark)

    Kaczmarczyk, Agnieszka Ewa; Dionisio, Giuseppe; Renaut, Jenny

    2012-01-01

    The aim of the study was to understand the molecular and biochemical mechanisms underpinning the effect of nitrogen (N) on barley (Hordeum vulgare) storage protein production (hordeins) during grain filling. Using a combination of advanced biochemistry methods, we could comprehensively describe c...

  12. Induced Variations in Brassinosteroid Genes Define Barley Height and Sturdiness, and Expand the Green Revolution Genetic Toolkit

    Czech Academy of Sciences Publication Activity Database

    Dockter, C.; Gruszka, D.; Braumann, I.; Druka, A.; Franckowiak, J.; Muller, A.H.; Oklešťková, Jana; Schulz, B.; Zakhrabekova, S.; Hansson, M.

    2014-01-01

    Roč. 166, č. 4 (2014), s. 1912-1927 ISSN 0032-0889 R&D Projects: GA MŠk LK21306 Institutional support: RVO:61389030 Keywords : HORDEUM-VULGARE L. * GIBBERELLIN-SYNTHESIS * SIGNAL-TRANSDUCTION Subject RIV: EF - Botanics Impact factor: 6.841, year: 2014

  13. total contents of phenolics, flavonoids, tannins and antioxidant

    African Journals Online (AJOL)

    and korefe (a malt beverage like beer) are made from a mixture of enkuro (a dark ... Phenolic compounds are important components of beverages, to which they .... pH 3.20–5.17. Unmalted roasted barley. (Hordeum vuldare), sugar and yeast.

  14. Main: 1BE2 [RPSD[Archive

    Lifescience Database Archive (English)

    Full Text Available me=Ltp1; Synonyms=Papi; Hordeum Vulgare Molecule: Lipid Transfer Protein; Chain: Null; Synonym: Ltp Lipid Tr...ansport M.H.Lerche, F.M.Poulsen M.H.Lerche, F.M.Poulsen Two Different Binding Modes Of Palmitate In The Homologous Mai

  15. Sequencing of 15622 gene-bearing BACs clarifies the gene-dense regions of the barley genome

    Czech Academy of Sciences Publication Activity Database

    Munoz-Amatriain, M.; Lonardi, S.; Luo, M.C.; Madishetty, K.; Svensson, J.T.; Moscou, M. J.; Wanamaker, S.; Kudrna, D.; Zheng, J.; Šimková, Hana; Doležel, Jaroslav; Grimwood, J.; Mammadov, J.; Close, T.J.

    2015-01-01

    Roč. 84, č. 1 (2015), s. 216-227 ISSN 0960-7412 R&D Projects: GA MŠk(CZ) LO1204 Institutional support: RVO:61389030 Keywords : Barley * Hordeum vulgare L * BAC sequencing Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 5.468, year: 2015

  16. Genetic transformation of barley: limiting factors

    Czech Academy of Sciences Publication Activity Database

    Vyroubalová, Š.; Šmehilová, M.; Galuszka, P.; Ohnoutková, Ludmila

    2011-01-01

    Roč. 55, č. 2 (2011), s. 213-224 ISSN 0006-3134 R&D Projects: GA ČR GD522/08/H003; GA MŠk 1M06030 Institutional research plan: CEZ:AV0Z50380511 Keywords : Agrobacterium * albinism * Hordeum Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 1.974, year: 2011

  17. Mapping genes in barley for resistance to Puccinia coronata from couch grass and to P. striiformis from brome, wheat and barley

    NARCIS (Netherlands)

    Niks, R.E.; Alemu, Sisay K.; Marcel, T.C.; Heyzen, van Skye

    2015-01-01

    Barley (Hordeum vulgare L.) mapping populations have been developed that are useful to study the inheritance of quantitative resistance to adapted and unadapted rust fungi. In a recent host range study, we found that the parents of those mapping populations also differed in their resistance to

  18. Significance and value of non.traded ecosystem services on farmland

    DEFF Research Database (Denmark)

    Sandhu, Harpinder; Wratten, Steve; Costanza, Robert

    2015-01-01

    peas (Pisum sativum), beans (Phaseolus vulgaris), barley (Hordeum vulgare), and wheat (Triticum aestivum). Organic systems were chosen as comparators not because they are the only forms of sustainable agriculture, but because they are subject to easily understood standards. Results. We found...

  19. Changes in vertical distribution of spectral reflectance within Spring barley canopy as an indicator of nitrogen nutrition, canopy structure and yield parametrs

    Czech Academy of Sciences Publication Activity Database

    Klem, Karel; Rajsnerová, Petra; Novotná, Kateřina; Míša, P.; Křen, J.

    2014-01-01

    Roč. 60, č. 2 (2014), s. 50-59 ISSN 0551-3677 R&D Projects: GA MZe QI111A133; GA TA ČR TA02010780 Institutional support: RVO:67179843 Keywords : Hordeum vulgare * spectral reflectance * vertical gradient * vegetation indices * nitrogen * grain yield * protein content Subject RIV: GC - Agronomy

  20. Phenotypic selection and regulation of reproduction in different environments in wild barley

    NARCIS (Netherlands)

    Volis, S.; Verhoeven, K.J.F.; Mendlinger, S.; Ward, D.

    2004-01-01

    Plasticity of the phenotypic architecture of wild barley, Hordeum spontaneum, was studied in response to water and nutrient stress. Direct and indirect selection on several vegetative and reproductive traits was estimated and path analysis used to reveal how regulating pathways via maternal

  1. PLANT REMAINS FROM ASIKLI-HOYUK, A PRE-POTTERY NEOLITHIC SITE IN CENTRAL ANATOLIA

    NARCIS (Netherlands)

    VANZEIST, W; DEROLLER, GJ

    Cereal crop plants at Asikli Hayuk included einkorn wheat (Triticum monococcum), emmer wheat (T. dicoccum), free-threshing wheat (T. cf. durum), hulled two-rowed barley (Hordeum distichum) and naked barley (H. vulgare var. nudum). As for pulses, bitter vetch (Vicia ervilia), lentil (Lens culinaris)

  2. Chernobyl Doses. Volume 3. Habitat and Vegetation Near the Chernobyl Nuclear Reactor Station

    Science.gov (United States)

    1993-01-01

    Hordeum vulgare, Avena sativa, Fagopyrum esculentum, Beta vulgaris, Solanum tuberosum, Linum usitatissimum , Cannabis satii, Humulus lupulus, Daucus carota... USITATISSIMUM flax It is grown for fiber. Fine-quality fiber can be obtained from plants grown on podzolic and gley soils with considerable fertilizing. In the

  3. QTLs for agronomic traits in the Mediterranean environment identified in recombinant inbred lines of the cross 'Arta' × ¤H. spontaneum¤ 41-1

    DEFF Research Database (Denmark)

    Baum, M.; Grando, S.; Backes, G.

    2003-01-01

    A genetic linkage map has been developed for recombinant inbred lines (RILs) of the cross 'Arta' x Hordeum spontaneum 41-1. One hundred and ninety four RILs, randomly chosen from a population of 494 RILs, were mapped with 189 markers including one morphological trait (btr = brittle rachis locus...

  4. Journal of Genetics | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Microsatellite development and characterization for Saurogobio dabryi Bleeker, 1871 in a Yangtze river-connected lake, China · HONG GAO LIU ... Online Resource. Genomic restructuring in F1 Hordeum chilense × durum wheat hybrids and corresponding hexaploid tritordeum lines revealed by DNA fingerprinting analyses.

  5. COMPARISON OF THE FROST RESISTANCE OF BARLEY ...

    African Journals Online (AJOL)

    Preferred Customer

    immediate recovery of the photosynthetic quantum yield after freezing. Landraces which showed the highest cold tolerance were found to acclimatize best. Key words/phrases: Barley, chlorophyll fluorescence, cold acclimation, Ethiopia, frost tolerance. INTRODUCTION. Barley (Hordeum vulgare L.) is a traditional crop.

  6. Wheat and barley exposure to nanoceria: Implications for agricultural productivity

    Science.gov (United States)

    The impacts of man-made nanomaterials on agricultural productivity are not yet well understood. A soil microcosm study was performed to assess the physiological, phenological, and yield responses of wheat (Triticum aestivum) and barley (Hordeum vulgare L.) exposed to nanoceria (n...

  7. Assessment of the nutritive value of cereal and legume straws based on chemical composition and in vitro digestibility

    NARCIS (Netherlands)

    Lopez, S.; Davies, D.; Dhanoa, M.S.; Dijkstra, J.; France, J.

    2005-01-01

    The nutritive value of 17 straws was determined on the basis of their chemical composition, in vitro dry matter (DM) digestibility and rumen fermentation kinetics (from gas production curves measured in vitro). Five roughages were from the cereal species Avena sativa (oat), Hordeum vulgare (barley),

  8. Environmental impact from mountainous olive orchards under different soil-management systems (SE Spain)

    NARCIS (Netherlands)

    Francia-Martinez, J.R.; Duran Zuazo, V.H.; Martinez-Raya, A.

    2006-01-01

    Soil erosion, runoff and nutrient-loss patterns over a two-year period (1999¿2000) were monitored in erosion plots on a mountainside with olive (Olea europaea cv. Picual) trees under three different types of soil management: (1) non-tillage with barley (Hordeum vulgare) strips of 4 m width (BS); (2)

  9. Wheat and barley seed systems in Ethiopia and Syria

    NARCIS (Netherlands)

    Bishaw, Z.

    2004-01-01

    Keywords: Wheat,Triticumspp., Barley,Hordeumvulgare L., Seed Systems, Formal Seed Sector, Informal Seed Sector, National Seed Program, Seed Source, Seed Selection, Seed Management, Seed Quality,

  10. Effects of slurry pre-treatment and application technique on short-term N2O emmissions as determind by a new non-linear approach

    DEFF Research Database (Denmark)

    Thomsen, Ingrid K; Pedersen, Asger R; Nyord, Tavs

    2010-01-01

    , and losses via N2O. Two field experiments were carried out on a loamy sand. Pig slurry was applied to established crops, i.e., to spring barley (Hordeum vulgare L.) in May 2007, and to winter wheat (Triticum aestivum L.) in April 2008. In 2007 the slurry was applied by direct injection using either winged...

  11. The Role of alpha-Glucosidase in Germinating Barley Grains

    DEFF Research Database (Denmark)

    Stanley, Duncan; Rejzek, Martin; Næsted, Henrik

    2011-01-01

    The importance of alpha-glucosidase in the endosperm starch metabolism of barley (Hordeum vulgare) seedlings is poorly understood. The enzyme converts maltose to glucose (Glc), but in vitro studies indicate that it can also attack starch granules. To discover its role in vivo, we took complementa...

  12. Journal of Genetics | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    MAO-A promoter polymorphism and idiopathic pulmonary arterial hypertension · Shivani Vadapalli Sujana Katta B. K. S. Sastry Pratibha Nallari · More Details Fulltext PDF. pp e46-e54. Diversity in Indian barley (Hordeum vulgare) cultivars and identification of genotype-specific fingerprints using microsatellite markers.

  13. Responses of growth and primary metabolism of water-stressed barley roots to rehydration

    Science.gov (United States)

    Barley seedlings [Hordeum vulgare L. Brant] were grown in pots in controlled environment chambers and drought treatments were imposed 11 days after sowing. Soil water content decreased from 92% to 10% after an additional 14 days of water stress. Shoot and root growth ceased after 4 and 9 days of wat...

  14. cultivars and identification of genotype-specific fingerprints using ...

    Indian Academy of Sciences (India)

    Home; Journals; Journal of Genetics; Volume 89; Online resources. Diversity in Indian barley (Hordeum vulgare) cultivars and identification of genotype-specific fingerprints using microsatellite markers. S. K. Jaiswal Shree P. Pandey S. Sharma R. Prasad L. C. Prasad R. P. S. Verma Arun K. Joshi. Volume 89 Online ...

  15. Abnormal germling development by brown rust and powdery mildew on cer barley mutants

    NARCIS (Netherlands)

    Rubiales, D.; Ramirez, M.C.; Carver, T.L.W.; Niks, R.E.

    2001-01-01

    The barley leaf rust fungus forms appressoria over host leaf stomata and penetrates via the stomatal pore. High levels of avoidance to leaf rust fungi have been described in some wild accessions of Hordeum species where a prominent wax layer on the stomata inhibits triggering of fungal appressorium

  16. A new agro-climatic classification for crop suitability zoning in northern semi-arid Ethiopia

    NARCIS (Netherlands)

    Araya, A.; Keesstra, S.D.; Stroosnijder, L.

    2010-01-01

    The agro-climatic resources of Giba catchment in northern Ethiopia were assessed and characterized. The objectives were (i) to ascertain the suitability of the climate for growing teff (Eragrostis tef) and barley (Hordeum vulgare); (ii) to determine the onset and length of the growing period (LGP),

  17. Farmer’s seed sources and seed quality: 2. seed health

    NARCIS (Netherlands)

    Bishaw, Z.; Struik, P.C.; Gastel, van A.J.G.

    2013-01-01

    The study assessed the health quality of wheat (Triticum aestivum L.) and barley (Hordeum vulgare L.) seed samples collected from formal and informal sector in Ethiopia and Syria. In Ethiopia, several seed-borne fungi were found on wheat samples: Cochliobolus sativum, Fusarium avenaceum, F.

  18. The use of microsatellite markers for genetic diversity assessment of ...

    African Journals Online (AJOL)

    In this study, gene diversity and genetic relationships among 30 genotypes of genus Hordeum from Kerman province (Iran) were assessed using 10 simple sequence repeat (SSR) primers. Seven of these markers were highly polymorphic. A total of 96 alleles were detected. The number of alleles per microsatellite marker ...

  19. A redox-dependent dimerization switch regulates activity and tolerance for reactive oxygen species of barley seed glutathione peroxidase

    DEFF Research Database (Denmark)

    Navrot, Nicolas; Skjoldager, Nicklas; Bunkenborg, Jakob

    2015-01-01

    Monomeric and dimeric forms of recombinant barley (Hordeum vulgare subsp. vulgare) glutathione peroxidase 2 (HvGpx2) are demonstrated to display distinctly different functional properties in vitro. Monomeric HvGpx2 thus has five fold higher catalytic efficiency than the dimer towards tert-butyl h...

  20. Quantification of peptides causing celiac disease in historical and modern hard red spring wheat cultivars

    Science.gov (United States)

    Celiac disease (CD) is prevalent in 0.5 to 1.26% of adolescents and adults. The disease develops in genetically susceptible individuals as a result of ingestion of gluten forming proteins found in cereals such as, wheat (Triticum aestivum L.), rye (Secale cereale L.) and barley (Hordeum sativum L.)...

  1. Nitrogen accumulation and residual effects of nitrogen catch crops

    DEFF Research Database (Denmark)

    Jensen, E.S.

    1991-01-01

    The nitrogen accumulation in Italian ryegrass (Lolium multiflorum Lam.), perennial ryegrass (Lolium perenne L.), white mustard (Sinapis alba L.) and tansy phacelia (Phacelia tanacetifolia L.), under- or aftersown as nitrogen catch crops to spring barley (Hordeum vulgare L.) and field pea (Pisum s...

  2. Real-time weed detection, decision making and patch spraying in maize, sugarbeet, winter wheat and winter barley

    DEFF Research Database (Denmark)

    Gerhards, R; Christensen, Svend

    2003-01-01

    with weed infestation levels higher than the economic weed threshold; a review of such work is provided. This paper presents a system for site-specific weed control in sugarbeet (Beta vulgaris L.), maize (Zea mays L.), winter wheat (Triticum aestivum L.) and winter barley (Hordeum vulgare L.), including...

  3. Simulation of spring barley yield variability in different climatic zones of Northern and Central Europe

    DEFF Research Database (Denmark)

    Rötter, R P; Palosuo, T; Kersebaum, K C

    2012-01-01

    In this study, the performance of nine widely used and accessible crop growth simulation models (APES-ACE, CROPSYST, DAISY, DSSAT-CERES, FASSET, HERMES, MONICA, STICS and WOFOST) was compared during 44 growing seasons of spring barley (Hordeum vulgare L.) at seven sites in Northern and Central...

  4. Grain Yield Variation in Malting Barley Cultivars in Uruguay and Its Consequences for the Design of a Trials Network

    NARCIS (Netherlands)

    Ceretta, S.S.E.; Eeuwijk, van F.A.

    2008-01-01

    The efficiency of cultivar trial networks is an important subject in official cultivar testing. We investigated this efficiency for malting barley (Hordeum vulgare L.) in Uruguay, using data on 213 cultivars tested across an eight-year period at six locations. The variance-components approach was

  5. Zinc biofortification of cereals: rice differs from wheat and barley

    NARCIS (Netherlands)

    Stomph, T.J.; Jiang, W.; Struik, P.C.

    2009-01-01

    In their review, mainly focused on bread wheat (Triticum aestivum), durum wheat (Triticum durum) and barley (Hordeum vulgare), Palmgren et al. 1 M.G. Palmgren et al., Zinc biofortification of cereals: problems and solutions, Trends Plant Sci. 13 (2008), pp. 464–473. Article | PDF (905 K) | View

  6. Synthesis of the major storage protein, hordein, in barley

    DEFF Research Database (Denmark)

    Giese, Nanna Henriette; Andersen, B.; Doll, Hans

    1983-01-01

    A liquid culture system for culturing detached spikes of barley (Hordeum vulgare L.) at different nutritional levels was established. The synthesis of hordein polypeptides was studied by pulse-labeling with [14C]sucrose at different stages of development and nitrogen (N) nutrition. All polypeptides...

  7. Ridging in autumn as an alternative to mouldboard ploughing in a humid-temperate region

    DEFF Research Database (Denmark)

    Henriksen, Jens Christian Martin Bugge; Rasmussen, Jesper; Søgaard, Carsten

    2006-01-01

    and ploughing. Residue treatments were stubble, stubble + straw and stubble + liquid manure in order to create a gradient of C/N ratios. From the time of harvest until planting of a subsequent barley crop (Hordeum vulgare L.), inorganic N was determined 11 times in 1998–1999 and 10 times in 1999–2000 in the 0...

  8. Multi-method research strategy for understanding changes in storage protein composition in developing barley grain to improve nutritional profile

    DEFF Research Database (Denmark)

    Kaczmarczyk, Agnieszka Ewa

    Barley (Hordeum vulgare L.) is cultivated in a range of diverse environments and is widely utilised as feed for animal and as malt in brewing. Nitrogen (N) is a key macronutrient whch directly increases plant growth and is used as a fertiliser to meet the demands for higher yield. However...

  9. Biochemistry, Structure and Function of Non-Wheat Proteins: Case Study of Barley ß-Amylase

    Science.gov (United States)

    The importance of a protein is not always evident and may be due to its multifunctional nature. ß-Amylase in seeds of barley (Hordeum vulgare L.) constitutes approximately 2% of the total protein in mature seeds and is assumed to be important when storage proteins are mobilized to support protein s...

  10. Effects of free and chelated iron on in vitro androgenesis in barley and wheat

    Czech Academy of Sciences Publication Activity Database

    Novotný, J.; Vagera, Jiří; Ohnoutková, Ludmila

    2000-01-01

    Roč. 63, - (2000), s. 35-40 ISSN 0167-6857 R&D Projects: GA ČR GV521/96/K117 Institutional research plan: CEZ:AV0Z5038910 Keywords : ferrous ions * Hordeum vulgare * Triticum aestivum Subject RIV: EF - Botanics Impact factor: 0.444, year: 2000

  11. N-acyl-homoserine lactone uptake and systemic transport in barley rest upon active parts of the plant

    Czech Academy of Sciences Publication Activity Database

    Sieper, T.; Forczek, Sándor; Matucha, Miroslav; Kraemer, P.; Hartmann, A.; Schroeder, P.

    2014-01-01

    Roč. 201, č. 2 (2014), s. 545-555 ISSN 1469-8137 Institutional support: RVO:61389030 Keywords : barley (Hordeum vulgare) * monoclonal antibodies * N-acyl-homoserine lactones (HSLs) Subject RIV: EF - Botanics Impact factor: 6.545, year: 2013

  12. Registration of ‘Kardia’, a Two-Rowed Spring Food Barley

    Science.gov (United States)

    ‘Kardia’ (Reg. No. XXXX, XXXX), a two-rowed spring food barley (Hordeum vulgare L.) developed by the USDA-ARS, Aberdeen, ID, in cooperation with the University of Idaho Agricultural Experiment Station, was released in 2015. Kardia is derived from the cross of ‘03AH3054 / 98Ab12019’ and was advanced...

  13. Investigation of GMO and ancient Grains for Bioplastic and Food Applications

    DEFF Research Database (Denmark)

    Sagnelli, Domenico

    I dette projekt er der udviklet nye koncepter for helt naturlige bioplast systemer og sunde diætfibre. Termoplastisk stivelse (TPS) fremstilles ved anvendelse af traditionelle processer, såsom ekstrudering. I dette projekt anvendes transgen byg (Hordeum vulgare, Hv) med en stivelse der indeholder...

  14. Comparing Evapotranspiration Rates Estimated from Atmospheric Flux and TDR Soil Moisture Measurements

    DEFF Research Database (Denmark)

    Schelde, Kirsten; Ringgaard, Rasmus; Herbst, Mathias

    2011-01-01

    limit estimate (disregarding dew evaporation) of evapotranspiration on dry days. During a period of 7 wk, the two independent measuring techniques were applied in a barley (Hordeum vulgare L.) field, and six dry periods were identified. Measurements of daily root zone soil moisture depletion were...

  15. Starch and Free Sugars during Kernel Development of Bomi Barley and its High-Lysine Mutant 1508

    DEFF Research Database (Denmark)

    Kreis, Michael

    1978-01-01

    At maturity the high-lysine barley (Hordeum vulgare L.) Ris0 mutants 1508, 527 and 29 kernels contained about 20% less starch and twice as much free sugars as the parent varieties Bomi and Carlsberg II. An enhanched effect on starch reduction and free sugar accumulation was observed during kernel...

  16. Fungal Endophytes of Wild Barley and their Effects on Diuraphis noxia Population Development

    Science.gov (United States)

    S.L. Clement; A. Dan Wilson; D.G. Lester; C.M. Davitt

    1997-01-01

    Laboratory experiments were conducted to compare the expression of Diuraphis noxia (Mordvilko) (Homoptera: Aphididae) resistance in four plant introduction (PI) lines of wild barley (Hordeum) infected with different species or strains of endophytic fungi (tribe Balansieae, family Clavicipitaceae, Neotyphodium gen. nov. [formerly...

  17. Agricultural drought and spring barley yields in the Czech Republic

    Czech Academy of Sciences Publication Activity Database

    Trnka, M.; Hlavinka, P.; Semerádová, Daniela; Dubrovský, Martin; Žalud, Z.; Možný, M.

    2007-01-01

    Roč. 53, č. 7 (2007), s. 306-316 ISSN 1214-1178 Institutional research plan: CEZ:AV0Z30420517 Keywords : Hordeum vulgare L * Palmer Z-index * climatic conditions * yield * drought Subject RIV: DG - Athmosphere Sciences, Meteorology http://journals.uzpi.cz:8050/web/_generovani_8050/pse_2007.htm

  18. Comparison of fast neutrons and X-rays in respect to genetic effects accompanying induced chromosome aberrations, in relation to the evaluation of the BARN-reactor

    International Nuclear Information System (INIS)

    Ramulu, K.S.

    1980-01-01

    The M 2 and M 3 plants derived from both fast neutron and X-ray treatments have been studied to detect and analyse reciprocal translocations in Arabidopsis thaliana (L.) Heynh. cv. Landsberg erecta (2n=10), Hordeum vulgare L. cv. Aramir (2n=14) and Secale cereale L., summer inbred line ZF9 (2n=14). (Auth.)

  19. Biomass production, symbiotic nitrogen fixation and inorganic N use in dual tri-component annual intercrops

    DEFF Research Database (Denmark)

    Andersen, M.K.; Hauggaard-Nielsen, H.; Ambus, P.

    2005-01-01

    The interspecific complementary and competitive interactions between pea (Pisum sativum L.), barley (Hordeum vulgare L.) and oilseed rape (Brassica napus L.), grown as dual and tri-component intercrops were assessed in a field study in Denmark. Total biomass production and N use at two levels of ...

  20. Unraveling possible association between quantitative trait loci (QTL ...

    African Journals Online (AJOL)

    Unraveling possible association between quantitative trait loci (QTL) for partial resistance and nonhost resistance in food barley ( Hordeum vulgaris L.) ... Abstract. Many quantitative trait loci (QTLs) in different barley populations were discovered for resistance to Puccinia hordei and heterologous rust species. Partial ...

  1. Can a genetic correlation with seed mass constrain adaptive evolution of seedling desiccation tolerance in wild barley?

    NARCIS (Netherlands)

    Verhoeven, K.J.F.; Biere, A.; Nevo, E.; Van Damme, J.M.M.

    2004-01-01

    Very young seedlings of wild barley Hordeum spontaneum have the ability to survive extended periods of severe drought. This desiccation tolerance is considered an adaptation to the rain-limited and unpredictable habitats that the species occupies. Genetic variation has been observed for this trait,

  2. Yield and grain quality of spring barley as affected by biomass formation at early growth stages

    Czech Academy of Sciences Publication Activity Database

    Křen, J.; Klem, Karel; Svobodová, I.; Míša, P.; Neudert, L.

    2014-01-01

    Roč. 60, č. 5 (2014), s. 221-227 ISSN 1214-1178 R&D Projects: GA MZe QI111A133 Keywords : Hordeum vulgare L * above-ground biomass * tillering * grain yield formation * grain protein content Subject RIV: EH - Ecology, Behaviour Impact factor: 1.226, year: 2014

  3. Nitrate Leaching, Yields and Carbon Sequestration after Noninversion Tillage, Catch Crops, and Straw Retention

    DEFF Research Database (Denmark)

    Hansen, Elly Møller; Munkholm, Lars Juhl; Olesen, Jørgen E

    2015-01-01

    retention did not significantly increase yields, nor did it reduce leaching, while fodder radish (Raphanus sativus L.) as a catch crop was capable of reducing nitrate leaching to a low level. Thus, YSL of winter wheat (Triticum aestivum L.) was higher than for spring barley (Hordeum vulgare L.) grown after...

  4. Journal of Genetics | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Journal of Genetics; Volume 96; Online resources. Genomic restructuring in F1 Hordeum chilense × durum wheat hybrids and corresponding hexaploid tritordeum lines revealed by DNA fingerprinting analyses. ANDREIA DELGADO ANA CARVALHO AZAHARA CARMEN MARTÍN ANTONIO MARTÍN JOSÉ ...

  5. Effects of Net Blotch ( Pyrenophora teres ) on Malt Barley Yield and ...

    African Journals Online (AJOL)

    Barley (Hordeum vulgare L.) production is constrained by diseases such as net blotch caused by Pyrenophora teres Drechsl. The objectives of this study were to assess the effects of net blotch disease on malt barley yield and grain quality under natural infection. Four malt barley varieties (Beka, HB 120, HB 52 and Holker), ...

  6. Classification and salt tolerance analysis of barley varieties

    NARCIS (Netherlands)

    Katerji, N.; Hoorn, van J.W.; Hamdy, A.; Mastrorilli, M.; Fares, C.; Ceccarelli, S.; Grando, S.; Oweis, T.

    2006-01-01

    Six varieties of barley (Hordeum vulgare), five of which were provided by ICARDA, were tested in a green house experiment for their salt tolerance. Afterwards the ICARDA variety Melusine, selected from this experiment for its combination of high yield and salt tolerance, was compared in a lysimeter

  7. Studies on the histology of partial resistance in barley to leafrust, Puccinia hordei

    NARCIS (Netherlands)

    Niks, R.E.

    1983-01-01

    In de gerst (Hordeum vulgare) - dwergroest (Puccinia hordei) relatie zijn twee typen van resistentie te onderscheiden, namelijk overgevoeligheidsresistentie en partiële resistentie. Deze typen kunnen beschouwd worden als voorbeelden van Van der Plank's verticale en horizontale

  8. Population structure revealed by different marker types (SSR or DArT) has an impact on the results of genome-wide association mapping in European barley cultivars

    NARCIS (Netherlands)

    Matthies, I.E.; Hintum, van T.J.L.; Weise, S.; Röder, M.S.

    2012-01-01

    Diversity arrays technology (DArT) and simple sequence repeat (SSR) markers were applied to investigate population structure, extent of linkage disequilibrium and genetic diversity (kinship) on a genome-wide level in European barley (Hordeum vulgare L.) cultivars. A set of 183 varieties could be

  9. Dicty_cDB: Contig-U03338-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ) 486099E06.x1 486 - leaf primordia cDNA library fr... 155 1e-33 1 ( FL885969 ) CCGN6504.b1 CCGN Panicum virgatum eti...( CF272843 ) EST3049 Zea mays sperm cell cDNA library Zea mays... 105 1e-18 1 ( FE623651 ) CBYY4925.g1 CBYY Panicum virgatu...22B2F04.f1 BG01 - normalized library Leymus ... 266 1e-90 2 ( EX580446 ) HDP26H23w HDP Hordeum vulgare subsp. vulgare... 2 ( EX571824 ) HDP35N10T HDP Hordeum vulgare subsp. vulgare cDNA... 287 5e-90 2 ( CV056143 ) BNEL14D8 Barley EST endosperm library... rachis EST library... 161 2e-35 1 ( AU173547 ) Oryza sativa Japonica Group cDNA, parti

  10. Exploration of beer proteome using OFFGEL prefractionation in combination with two-dimensional gel electrophoresis with narrow pH range gradients.

    Science.gov (United States)

    Konečná, Hana; Müller, Lukáš; Dosoudilová, Hana; Potěšil, David; Buršíková, Jana; Sedo, Ondrej; Márová, Ivana; Zdráhal, Zbyněk

    2012-03-14

    Two-dimensional gel electrophoresis in combination with mass spectrometry has already been applied successfully to study beer proteome. Due to the abundance of protein Z in beer samples, prefractionation techniques might help to improve beer proteome coverage. Proteins from four lager beers of different origins were separated by two-dimensional electrophoresis (2-DE) followed by tandem mass spectrometric analysis. Initially 52 proteins mostly from Hordeum vulgare (22 proteins) and Saccharomyces species (25 proteins) were identified. Preparative isoelectric focusing by OFFGEL Fractionator was applied prior to 2-DE to improve its resolution power. As a result of this combined approach, a total of 70 beer proteins from Hordeum vulgare (30 proteins), from Saccharomyces species (31 proteins), and from other sources (9 proteins) were identified. Of these, 37 proteins have not been previously reported in beer samples.

  11. Foderstater för ökad konsumtion av vallfoder

    DEFF Research Database (Denmark)

    Hetta, M.; Lund, Peter; Tahir, M.N.

    2011-01-01

    nedbrytningen från våmmen till tunntarmen. Nedbrytning av stärkelse i tunntarmen leder till högre energieffektivitet i ämnesomsättningen. Stärkelse hos korn (Hordeum Vulgare, L) anses i litteraturen ha en snabb omsättning i våmmen och stärkelse hos majs (Zea Mays, L) anses ha en långsam nedbrytning (Mills et al...

  12. Comparing the performance of 11 crop simulation models in predicting yield response to nitrogen fertilization

    OpenAIRE

    Salo , Tapio J.; Palosuo , Taru; Kersebaum , Kurt Christian; Nendel , Claas; Angulo , Carlos; Ewert , Frank; Bindi , Marco; Calanca , Pierluigi; Klein , Tommy; Moriondo , Marco; Ferrise , Roberto; Olesen , Jørgen Eivind; Patil , Rasmi H.; Ruget , Francoise; Takac , Jozef

    2016-01-01

    Eleven widely used crop simulation models (APSIM, CERES, CROPSYST, COUP, DAISY, EPIC, FASSET, HERMES, MONICA, STICS and WOFOST) were tested using spring barley (Hordeum vulgare L.) data set under varying nitrogen (N) fertilizer rates from three experimental years in the boreal climate of Jokioinen, Finland. This is the largest standardized crop model inter-comparison under different levels of N supply to date. The models were calibrated using data from 2002 and 2008, of which 2008 included si...

  13. Physiological effects and transport of 24-epibrassinolide in heat-stressed barley

    Czech Academy of Sciences Publication Activity Database

    Janeczko, A.; Oklešťková, Jana; Pociecha, E.; Koscielniak, J.; Mirek, M.

    2011-01-01

    Roč. 33, č. 4 (2011), s. 1249-1259 ISSN 0137-5881 R&D Projects: GA AV ČR IAA400550801; GA ČR GA301/08/1649 Institutional research plan: CEZ:AV0Z50380511 Keywords : Brassinosteroid transport * Dark respiration * Hordeum vulgare L * PSII efficiency * Metabolic activity Subject RIV: EF - Botanics Impact factor: 1.639, year: 2011

  14. INFLUENCE OF SPATIAL AND TEMPORAL VARIATIONS IN THE HYPERSENSITIVE RESPONSE ON THE ACCUMULATION OF DEFENSE-RELATED TRANSCRIPTS IN POWDERY MILDEW-INFECTED BARLEY

    Czech Academy of Sciences Publication Activity Database

    Rayapuram, C.; Hemzalová, Vendula; Lyngkjaer, M. E.

    2011-01-01

    Roč. 93, č. 3 (2011), s. 613-625 ISSN 1125-4653 R&D Projects: GA MZe QH72117 Institutional research plan: CEZ:AV0Z50380511 Keywords : Blumeria graminis f. sp hordei * Hordeum vulgare * hypersensitive response Subject RIV: GF - Plant Pathology, Vermin, Weed, Plant Protection Impact factor: 0.912, year: 2011 http://sipav.org/main/jpp/index.php/jpp/article/view/1229

  15. Toxicities of TNT and RDX to Terrestrial Plants in Five Soils with Contrasting Characteristics

    Science.gov (United States)

    2013-07-01

    lettuce ( Lactuca sativa (L.)) and barley (Hordeum vulgare (L.)), respectively, at analytically determined soil concentrations up to and including 3320... sativa L.), Japanese millet (J. millet; Echinochloa crus-galli L. [Beauv.]), and perennial ryegrass (Lolium perenne L.) in five natural soils that...of the test. The test species in these studies were Medicago sativa (L.) var. Canada no. 1 (alfalfa), Echinochloa crus-galli (L.) P. Beauv. var

  16. Lead action on activity of some enzymes of plants

    International Nuclear Information System (INIS)

    Korolyov, A.N.; Koshkaryova, A.I.

    2008-01-01

    Lead action on activity of some enzymes of young plants of barley double-row (Hordeum distichon L.) families of cereals (Grominea). It is established that activity urease, catalase, ascorbatoxidase is in dependence as from a lead dose in a nutritious solution, and term ontogenesis. At later stages ontogenesis the increase in concentration of lead in an inhabitancy leads to sharp decrease in activity ascorbatoxidase. In the same conditions activity urease and catalase raises.

  17. Phytoremediation of Pharmaceuticals - Preliminary Study

    OpenAIRE

    Kotyza, J. (Jan); Soudek, P. (Petr); Kafka, Z.; Vaněk, T. (Tomáš)

    2010-01-01

    Phytoremediation of selected pharmaceuticals (diclofenac, ibuprofen, and acetaminophen) using Armoracia rusticana and Linum usitatissimum cell cultures and by hydroponically cultivated Lupinus albus, Hordeum vulgaris, and Phragmites australis plants in laboratory conditions is described. During in vitro experiments, the best results for acetaminophen were achieved using Armoracia rusticana hairy root cultures, where 100% of the starting amount was removed from the media during eight days. To...

  18. Strip Tillage and Early-Season Broadleaf Weed Control in Seeded Onion (Allium cepa)

    OpenAIRE

    Sarah Gegner-Kazmierczak; Harlene Hatterman-Valenti

    2016-01-01

    Field experiments were conducted in 2007 and 2008 near Oakes, North Dakota (ND), USA, to evaluate if strip tillage could be incorporated into a production system of seeded onion (Allium cepa) to eliminate the standard use of a barley (Hordeum vulgare) companion crop with conventional, full width tillage, yet support common early-season weed control programs. A split-factor design was used with tillage (conventional and strip tillage) as the main plot and herbicide treatments (bromoxynil, DCPA...

  19. Isozyme differences in barley mutants

    Energy Technology Data Exchange (ETDEWEB)

    AI-Jibouri, A A.M.; Dham, K M [Department of Botany, Nuclear Research Centre, Baghdad (Iraq)

    1990-01-01

    Full text: Thirty mutants (M{sub 11}) of barley (Hordeum vulgare L.) induced by physical and chemical mutagens were analysed for isozyme composition using polyacrylamide gel electrophoresis. Results show that these mutants were different in the isozymes leucine aminopeptidase, esterase and peroxidase. The differences included the number of forms of each enzyme, relative mobility value and their intensity on the gel. Glutamate oxaloacetate transaminase isozyme was found in six molecular forms and these forms were similar in all mutants. (author)

  20. Assessing Installation Ethnobotanical Resources Using Land Condition Trend Analysis (LCTA) Data: A Fort Riley, Kansas, Case Study

    Science.gov (United States)

    1998-07-01

    incarnata S F Carya illinoensis G L Asclepias stenophylla S B Ceanothus herbaceus S B Asclepias syriaca S B Ceanothus oliganthus S L Asclepias tuberosa S...cannabinum S B Carex retroflexa G F Argemone polyanthemos S F Carex vulpinoidea S F Artemisia ludoviciana S B Carya cordiformis S B Asclepias...longipilum G B Descurainia pinnata S F Hordeum pusillum G F Descurainia sophia S F Hymenopappus scabiosaeus G B Desmanthus illinoensis S B Hypericum

  1. Coupling amplified DNA from flow-sorted chromosomes to high-density SNP mapping in barley

    Czech Academy of Sciences Publication Activity Database

    Šimková, Hana; Svensson, J.T.; Condamine, P.; Hřibová, Eva; Suchánková, Pavla; Bhat, P.R.; Bartoš, Jan; Šafář, Jan; Close, T.J.; Doležel, Jaroslav

    2008-01-01

    Roč. 9, č. 294 (2008), s. 1-9 ISSN 1471-2164 R&D Projects: GA ČR GD521/05/H013; GA MŠk ME 884; GA MŠk(CZ) LC06004 Institutional research plan: CEZ:AV0Z50380511 Keywords : Flow cytometry * DNA amplification * Hordeum vulgare L. Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 3.926, year: 2008

  2. Radiation induced early maturing mutants in barley

    International Nuclear Information System (INIS)

    Kumar, R.; Chauhan, S.V.S.; Sharma, R.P.

    1978-01-01

    In M 2 generation, two early maturing plants were screened from a single spike progeny of a plant obtained from 20 kR of gamma-ray irradiation of a six-rowed barley (Hordeum vulgare L. var. Jyoti). Their true breeding nature was confirmed in M 3 generation. These mutants flower and mature 38 and 22 days earlier than those of control. (auth.)

  3. Isozyme differences in barley mutants

    International Nuclear Information System (INIS)

    AI-Jibouri, A.A.M.; Dham, K.M.

    1990-01-01

    Full text: Thirty mutants (M 11 ) of barley (Hordeum vulgare L.) induced by physical and chemical mutagens were analysed for isozyme composition using polyacrylamide gel electrophoresis. Results show that these mutants were different in the isozymes leucine aminopeptidase, esterase and peroxidase. The differences included the number of forms of each enzyme, relative mobility value and their intensity on the gel. Glutamate oxaloacetate transaminase isozyme was found in six molecular forms and these forms were similar in all mutants. (author)

  4. Protective effect of UV-A radiation during acclimation of the photosynthetic apparatus to UV-B treatment

    Czech Academy of Sciences Publication Activity Database

    Štroch, Michal; Materová, Z.; Vrábl, D.; Karlický, Václav; Šigut, Ladislav; Nezval, J.; Špunda, Vladimír

    2015-01-01

    Roč. 96, nov (2015), s. 90-96 ISSN 0981-9428 R&D Projects: GA MŠk(CZ) LO1415; GA MŠk(CZ) LM2010007 Grant - others:EHP(CZ) EHP-CZ02-OV-1-014-2014 Program:CZ02 Institutional support: RVO:67179843 Keywords : barley (Hordeum vulgare L.) * chlorophyll fluorescence * photosynthesis * photosynthetic pigments * UV-A radiation * UV-B radiation Subject RIV: BO - Biophysics Impact factor: 2.928, year: 2015

  5. Synthesis of Salt Soluble Proteins in Barley. Pulse-Labeling Study of Grain Filling in Liquid-Cultured Detached Spikes

    DEFF Research Database (Denmark)

    Giese, Nanna Henriette; Hejgaard, Jørn

    1984-01-01

    The accumulation of salt-soluble proteins in the endosperm of developing barley (Hordeum vulgare L.) grains was examined. Detached spikes of barley were cultured at different levels of nitrogen nutrition and pulse-labeled with [14C] sucrose at specific times after anthesis. Proteins were extracted...... to increased nitrogen nutrition. Two major components, β-amylase and protein Z in particular, had a synthesis profile almost identical to that of the endosperm storage protein, hordein....

  6. Effects of 24-epibrassinolide and green light on plastid gene transcription and cytokinin content of barley leaves

    Czech Academy of Sciences Publication Activity Database

    Efimova, N.V.; Vaňková, Radomíra; Kusnetsov, V.; Litvinovskaya, R. P.; Zlobin, Y.L.; Dobrev, Petre; Vedenicheva, N.P.; Savchuk, A. L.; Karnachuk, R. A.; Kudryakova, N.V.; Kuznetsov, V. D.

    2017-01-01

    Roč. 120, APR (2017), s. 32-40 ISSN 0039-128X Institutional support: RVO:61389030 Keywords : lupinus-luteus cotyledons * arabidopsis-thaliana * de-etiolation * abscisic-acid * brassinosteroid biosynthesis * plant development * hormonal balance * mutant * expression * growth * Brassinosteroids * Cytokinin * Gene expression * Green light * Hordeum vulgare * Transcription Subject RIV: EF - Botanics OBOR OECD: Plant sciences, botany Impact factor: 2.282, year: 2016

  7. The Effects of Designated Pollutants on Plants

    Science.gov (United States)

    1978-11-01

    Persea americana Mill. Haas and Bacon Barley Hordeum vulgare L. CM 67 Bean Phaseolus vulgaris L. Pinto, U.I. III Briza Briza maxima L. Ornamental...Tagetes patula L. French dwarf double goldie Marigold Tagetes erecta L. American ,Senator Dirksen Petunia Petunia hybrida Vilm. White cascade Radish...Probit analysis of five plant species: citrus seedlings, lemon, orange,, grape, French marigold, American marigold. Probit scale is the probability that a

  8. Variability of barley aleurone layer induced by X-rays

    Directory of Open Access Journals (Sweden)

    Romuald Kosina

    2015-05-01

    Full Text Available A series of Hordeum vulgare cultivars was irradiated by X-rays to induce mutations in endosperm. Many structural defects of endosperm were revealed in plants irradiated 8 DAF. Change of a cell cycle was especially frequent and this was visible in the form of clones of small or large cells in the aleurone layer. X-irradiation appeared as a successful tool in the study of development.

  9. Green Fodder Production and Water Use Efficiency of Some Forage Crops under Hydroponic Conditions

    OpenAIRE

    Ghazi N. Al-Karaki; M. Al-Hashimi

    2012-01-01

    The objectives of this study were to evaluate five forage crops (alfalfa (Medicago sativa), barley (Hordeum vulgare), cowpea (Vigna unguiculata), sorghum (Sorghum bicolor), and wheat (Triticum aestivum)) for green fodder production and water use efficiency under hydroponic conditions. The experiment has been conducted under temperature-controlled conditions (24 ± 1°C) and natural window illumination at growth room of Soilless Culture Laboratory, Arabian Gulf University, Manama, Bahrain. The r...

  10. Interspecific competition changes photosynthetic and oxidative stress response of barley and barnyard grass to elevated CO2 and temperature

    OpenAIRE

    Irena Januskaitiene; Jūratė Žaltauskaitė; Austra Dikšaitytė; Gintarė Sujetovienė; Diana Miškelytė; Giedrė Kacienė; Sandra Sakalauskienė; Jurga Miliauskienė; Romualdas Juknys

    2018-01-01

    This work focuses on the investigation of competition interaction between C3 crop barley (Hordeum vulgare L.) and C4 weed barnyard grass (Echinochloa crus-galli L.) at 2 times higher than ambient [CO2] and +4 0C higher ambient temperature climate conditions. It was hypothesized that interspecific competition will change the response of the investigated plants to increased [CO2] and temperature. The obtained results showed that in the current climate conditions, a higher biomass and photosynth...

  11. The Phytotoxicity of Designated Pollutants on Plant Species

    Science.gov (United States)

    1984-03-01

    Only seeds collected from those flowers exposed during pollin 20. DISTRIBUTION/AVAILABILITY OF ABSTRACT 21. ABSTRACT SECURITY CLASSIFICATION...acid exposure during pollination lowered the germination rate of mature seeds. Plant injury was chiefly a function of acid concentration, but amount...TESTS Species Name Variety Barley Hordeum vulgare L. CM67 Bean Phaseolus vulgaris L. Pinto Citrus Citrus limon (L.) Lupe Lemon Lettuce Lactuca sativa

  12. Development of K-bioassay for the efficient potassium fertilization of citrus tree

    Energy Technology Data Exchange (ETDEWEB)

    U, Jang Kual [Cheju National University, Cheju (Korea, Republic of); Han, Hae Ryong [Cheju National University, Cheju (Korea, Republic of); Moon, Duk Young; Kim, Chang Myung; Lim, Han Cheol; Moon, Do Kyung [Cheju Citrus Research Institute, Cheju (Korea, Republic of); Song, Sung Jun [Cheju National Univerisity, Cheju (Korea, Republic of)

    1994-12-31

    a Similar to the {sup 42} K uptake, {sup 86} Rb uptake by the roots of Hordeum distichum grown in the hydroponic culture was negatively correlated with the concentration of K supplied previously, showing that {sup 86} Rb can be used for the K-bioassay. {sup 86} Rb having longer half life(18.86 day) than {sup 42} K(12.36 hr) allowed the use of larger number of root samples. {sup 86} Rb uptake of 3 years old Citrus unshiu Marc. grown in water culture decreased drastically with the increase of K concentration of the culture solution, thus demonstrating that the nutrition status of K for citrus trees can be diagnosed by K-bioassay using {sup 86} Rb tracer. {sup 86} Rb uptake by the excised roots of Hordeum distichum correlated with the exchangeable K in soil. The amount of exchangeable K in soil for the optimal plant growth can be determined by its relationship. {sup 42} K- and {sup 86} Rb-uptake by the Hordeum distichum roots were markedly inhibited by 5 x 10{sup -3} M KCN in the bioassay solution, indicating that uptake is metabolically controlled. There was no significant relationship between K content in citrus leaves and K concentration in the water-culture medium. It is concluded that K-bioassay is a potentially useful tool for determining of K requirement in citrus trees. (author)

  13. Leaf rust of cultivated barley: pathology and control.

    Science.gov (United States)

    Park, Robert F; Golegaonkar, Prashant G; Derevnina, Lida; Sandhu, Karanjeet S; Karaoglu, Haydar; Elmansour, Huda M; Dracatos, Peter M; Singh, Davinder

    2015-01-01

    Leaf rust of barley is caused by the macrocyclic, heteroecious rust pathogen Puccinia hordei, with aecia reported from selected species of the genera Ornithogalum, Leopoldia, and Dipcadi, and uredinia and telia occurring on Hordeum vulgare, H. vulgare ssp. spontaneum, Hordeum bulbosum, and Hordeum murinum, on which distinct parasitic specialization occurs. Although Puccinia hordei is sporadic in its occurrence, it is probably the most common and widely distributed rust disease of barley. Leaf rust has increased in importance in recent decades in temperate barley-growing regions, presumably because of more intensive agricultural practices. Although total crop loss does not occur, under epidemic conditions yield reductions of up to 62% have been reported in susceptible varieties. Leaf rust is primarily controlled by the use of resistant cultivars, and, to date, 21 seedling resistance genes and two adult plant resistance (APR) genes have been identified. Virulence has been detected for most seedling resistance genes but is unknown for the APR genes Rph20 and Rph23. Other potentially new sources of APR have been reported, and additivity has been described for some of these resistances. Approaches to achieving durable resistance to leaf rust in barley are discussed.

  14. DOES JASMONIC ACID PREVENT THE GERMINATION

    OpenAIRE

    ÇAVUŞOĞLU, Kürşat

    2009-01-01

    Abstract: Effect of jasmonic acid on seed germination and seedling growth of barley (Hordeum vulgare L. cv. Bülbül 89) was investigated in the present study. Jasmonic acid concentrations less than 1500 µM have not inhibited the seed germination, while 1500 and 2000 µM jasmonic acid levels caused atypical germination. The germination was completely inhibited at 3000 µM level of jasmonic acid. However, the seedling growth clearly slowed down with increasing concentrations of jasmonic acid. Furt...

  15. UCE: A uracil excision (USERTM)-based toolbox for transformation of cereals

    DEFF Research Database (Denmark)

    Hebelstrup, Kim H; Christiansen, Michael W; Carciofi, Massimiliano

    2010-01-01

    Background Cloning of gene casettes and other DNA sequences into the conventional vectors for biolistic or Agrobacterium-mediated transformation is hampered by a limited amount of unique restriction sites and by the difficulties often encountered when ligating small single strand DNA overhangs...... (USER cereal), ready for use in cloning of complex constructs into the T-DNA. A series of the vectors were tested and shown to perform successfully in Agrobacterium-mediated transformation of barley (Hordeum vulgare L.) as well as in biolistic transformation of endosperm cells conferring transient...

  16. Assessment of a relaxed eddy accumulation for measurements of fluxes of biogenic volatile organic compounds: Study over arable crops and a mature beech forest

    DEFF Research Database (Denmark)

    Gallagher, M.W.; Clayborough, R.; Beswick, K.M.

    2000-01-01

    A relaxed eddy accumulation (REA) system, based on the design by Beverland et al. (Journal of Geophysics Research 101 (D17) 22, 807-22, 815), for the measurement of biogenic VOC species was evaluated by intercomparison with an eddy correlation CO2 flux system over a mature deciduous beech canopy...... (Fagus Sylvatica) during the FOREXNOX program. Measurements from a site where winter wheat and barley (Hordeum Vulgare ann Triticum Aestivum) were being harvested are also presented. The system was inter-compared with two different eddy correlation systems for measuring CO2 fluxes. Good results were...

  17. Candidate Herbaceous Plants for Phytoremediation of Energetics on Ranges. Strategic Environmental Research and Development Program

    Science.gov (United States)

    2007-09-01

    fescue P medium medium N-W NE, NH G.c. CCREL 10 Hordeum sativum Barley TNT A medium medium N&S AK, HW 4 Lolium multiflorum Ryegrass TNT AP... Allium schoenopra- sum Wild chives TNT P small small N AK 4 Brassica rapa Canola RDX,HMX AB medium medium N&S AK, HW, IL, PR, VI 4, 20 Bupleurum...TNT, HMX A medium medium N&S IL, PR, VI JAAP 4, 12.,13 Pisum sativum Pea TNT A small large N&S 4 Raphanus sativus Radish RDX A tap small N

  18. Roles of Hydroxynitrile Glucosides in Barley

    DEFF Research Database (Denmark)

    Roelsgaard, Pernille Sølvhøj

    on barley (Hordeum vulgare). Barley accumulates five hydroxynitrile glucosides, including one cyanogenic glucoside, in the epidermal cell layer. Cyanogenic glucosides are classically known as hydrogen cyanide-releasing defense compounds which act against generalist insects and herbivores. However...... is proposed. The results obtained in this Ph.D. study provide a unique insight demonstrating that hydroxynitrile glucosides play a far more complex role in barley defense against and susceptibility to Bgh than previously described. Future studies can build on the platforms established in this study to provide...

  19. Studies on /sup 32/P transport and yellow rust resistance in barley

    Energy Technology Data Exchange (ETDEWEB)

    Schubert, J. (Akademie der Landwirtschaftswissenschaften der DDR, Aschersleben. Inst. fuer Phytopathologie)

    1982-01-01

    Several cultivars of barley (Hordeum vulgare L.) differing in their resistance to yellow rust were used to study the influence of the infection with Puccinia striiformis West. (strain 24) on /sup 32/P transport in intact plants and isolated leaves. Close correlations exist between transport processes and resistance. For example, resistant plants seem to have a more intensive matter transport than susceptible ones. The importance of the rate of transport to the effectiveness of hypothetic inducers of resistance reactions and defence substances is discussed.

  20. Influence of yellow rust infection on /sup 32/P transport in detached barley leaves

    Energy Technology Data Exchange (ETDEWEB)

    Schubert, J. (Akademie der Landwirtschaftswissenschaften der DDR, Aschersleben. Inst. fuer Phytopathologie)

    1982-01-01

    Several barley cultivars (Hordeum vulgare L.) differing in their resistance to yellow rust (Puccinia striiformis West.) were tested for relationships between changes of /sup 32/P transport in detached leaves and resistance to yellow rust disease. Investigation carried out with detached second leaves from plants infected at their first leaf revealed a matter transport in these leaves changed by the infection. Transport was also influenced by inoculation with yellow rust uredospores. In that case rust infection influenced the basipetal transport less strongly in resistent plants than in susceptible ones. Connected with the findings the influence of fungal substances on transport processes is discussed in general.

  1. Does heavy traffic have long term implications for crop yields?

    DEFF Research Database (Denmark)

    Nielsen, J. Aa.; Munkholm, Lars Juhl; Schjønning, Per

    Danish soils are subject to increasingly heavier traffic. Today, wheel loads of 6-12 tons are common on e.g. slurry tankers, combines and sugar beet harvesters. Field trials were started in Denmark in spring 2010 to answer the question: "does heavy traffic have long term implications for crop...... by the contractors delivering the machinery for the experimentation. Each year, spring barley (Hordeum vulgare L.) was established after the compaction treatments. s.ince 2013, investigations on biological tillage (root growth by pioneering crops) have been added to the trials. Significant yield losses up to 12.5 dt...

  2. STUDY ON THE ENERGY NUTRITION VALUES OF HULL-LESS BARLEY IN EXPERIMENTS WITH MUSCOVY DUCKS

    Directory of Open Access Journals (Sweden)

    Dimo PENKOV

    2004-10-01

    Full Text Available Using adapted methods for balanced experiments with waterfowl, the apparent (AMEn-0 and the true (TMEn-0 metabolizable energy of hull-less barley have been established. Despite the lower content of crude fi ber, the energy values were similar to the common barley (Hordeum sativa L.. The AMEn-0 and the TMEn-0 of the forage for Muscovy ducks were 12.29 MJ/kg DM and 13.28 MJ/kg DM, and the coeffi cients of the gross energy transformation - 68.97 and 74.52, respectively.

  3. Effect of sterilization on mineralization of straw and black carbon

    OpenAIRE

    Bobul'ská, Lenka; Bruun, Sander; Fazekašová, Danica

    2013-01-01

    The study was aimed at investigating the role of microorganisms in the degradation of BC (black carbon). CO evolution was measured under sterilized and non-sterilized soil using BC and straw amendments. Black carbon and straw were produced from homogenously C labelled roots of barley (Hordeum vulgare) with a specific activity 2.9 MBq g C. Production of BC was implemented at 300 °C for 24 h in a muffle oven, incubated in soil and C in the evolved CO was measured after 0.5, 1, 2, 4, 8, 16, 26 a...

  4. Integrated transcriptomics and proteomics analysis of storage protein composition in developing barley grain to improve nutritional profile

    DEFF Research Database (Denmark)

    Kaczmarczyk, Agnieszka Ewa; Dionisio, Giuseppe; Renaut, Jenny

    2012-01-01

    The aim of the study was to understand the molecular and biochemical mechanisms underpinning the effect of nitrogen (N) on barley (Hordeum vulgare) storage protein production (hordeins) during grain filling. Using a combination of advanced biochemistry methods, we could comprehensively describe......-regimes caused significant differences in both quantity and quality of the storage proteins transcripts. Principal Component Analysis of the amino acid (AA) profiles also indicated dissimilarity in individual AA percentages, correlated to hordein content. The abundance values of proteins of interest confirmed...

  5. Identification of barley and rye varieties using matrix- assisted laser desorption/ionisation time-of-flight mass spectrometry with neural networks

    DEFF Research Database (Denmark)

    Bloch, H.A.; Petersen, Marianne Kjerstine; Sperotto, Maria Maddalena

    2001-01-01

    developed, which combines analysis of alcohol-soluble wheat proteins (gliadins) using matrix-assisted laser desorption/ionisation time-of-flight mass spectrometry with neural networks. Here we have applied the same method for the identification of both barley (Hordeum vulgare L.) and rye (Secale cereale L.......) varieties. For barley, 95% of the mass spectra were correctly classified. This is an encouraging result, since in earlier experiments only a grouping into subsets of varieties was possible. However, the method was not useful in the classification of rye, due to the strong similarity between mass spectra...

  6. Host genotype is an important determinant of the cereal phyllosphere mycobiome

    DEFF Research Database (Denmark)

    Sapkota, Rumakanta; Knorr, Kamilla; Jørgensen, Lise Nistrup

    2015-01-01

    The phyllosphere mycobiome in cereals is an important determinant of crop health. However, an understanding of the factors shaping this community is lacking. Fungal diversity in leaves from a range of cultivars of winter wheat (Triticum aestivum), winter and spring barley (Hordeum vulgare...... and location have minor effects. We found many host-specific fungal pathogens, but also a large diversity of fungi that were relatively insensitive to host genetic background, indicating that host-specific pathogens live in a 'sea' of nonspecific fungi....

  7. GeneCAT--novel webtools that combine BLAST and co-expression analyses

    DEFF Research Database (Denmark)

    Mutwil, Marek; Obro, Jens; Willats, William G T

    2008-01-01

    The gene co-expression analysis toolbox (GeneCAT) introduces several novel microarray data analyzing tools. First, the multigene co-expression analysis, combined with co-expressed gene networks, provides a more powerful data mining technique than standard, single-gene co-expression analysis. Second...... orthologs in the plant model organisms Arabidopsis thaliana and Hordeum vulgare (Barley). GeneCAT is equipped with expression data for the model plant A. thaliana, and first to introduce co-expression mining tools for the monocot Barley. GeneCAT is available at http://genecat.mpg.de....

  8. High-level expression of the native barley alpha-amylase/subtilisin inhibitor in Pichia pastoris

    DEFF Research Database (Denmark)

    Micheelsen, Pernille Ollendorff; Ostergaard, Peter Rahbek; Lange, Lene

    2008-01-01

    An expression system for high-level expression of the native Hordeum vulgare alpha-amylase/subtilisin inhibitor (BASI) has been developed in Pichia pastoris, using the methanol inducible alcohol oxidase 1 (AOX1) promoter. To optimize expression, two codon-optimized coding regions have been designed...... and expressed alongside the wild-type coding region. To ensure secretion of the native mature protein, a truncated version of the alpha mating factor secretion signal from Saccharomyces cerevisiae was used. In order to be able to compare expression levels from different clones, single insertion transformants...

  9. Mercury in mercury(II)-spiked soils is highly susceptible to plant bioaccumulation.

    Science.gov (United States)

    Hlodák, Michal; Urík, Martin; Matúš, Peter; Kořenková, Lucia

    2016-01-01

    Heavy metal phytotoxicity assessments usually use soluble metal compounds in spiked soils to evaluate metal bioaccumulation, growth inhibition and adverse effects on physiological parameters. However, exampling mercury phytotoxicity for barley (Hordeum vulgare) this paper highlights unsuitability of this experimental approach. Mercury(II) in spiked soils is extremely bioavailable, and there experimentally determined bioaccumulation is significantly higher compared to reported mercury bioaccumulation efficiency from soils collected from mercury-polluted areas. Our results indicate this is not affected by soil sorption capacity, thus soil ageing and formation of more stable mercuric complexes with soil fractions is necessary for reasonable metal phytotoxicity assessments.

  10. Rapid gene isolation in barley and wheat by mutant chromosome sequencing

    Czech Academy of Sciences Publication Activity Database

    Sanchez-Martin, J.; Steuernagel, B.; Ghosh, S.; Herren, G.; Hurni, S.; Adamski, N.; Vrána, Jan; Kubaláková, Marie; Krattinger, S.G.; Wicker, T.; Doležel, Jaroslav; Keller, B.; Wulff, B. B. H.

    2016-01-01

    Roč. 17, OCT 31 (2016), č. článku 221. ISSN 1465-6906 R&D Projects: GA ČR GBP501/12/G090; GA MŠk(CZ) LO1204 Institutional support: RVO:61389030 Keywords : induced mutations * mitotic chromosomes * confers resistance * exome capture * genome * identification * evolution * pathogens * hordeum * MutChromSeq * Gene cloning * Mutational genomics * Chromosome flow sorting * Triticeae * Wheat * Barley Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 11.313, year: 2015

  11. Inter-simple sequence repeat (ISSR) loci mapping in the genome of perennial ryegrass

    DEFF Research Database (Denmark)

    Pivorienė, O; Pašakinskienė, I; Brazauskas, G

    2008-01-01

    The aim of this study was to identify and characterize new ISSR markers and their loci in the genome of perennial ryegrass. A subsample of the VrnA F2 mapping family of perennial ryegrass comprising 92 individuals was used to develop a linkage map including inter-simple sequence repeat markers...... demonstrated a 70% similarity to the Hordeum vulgare germin gene GerA. Inter-SSR mapping will provide useful information for gene targeting, quantitative trait loci mapping and marker-assisted selection in perennial ryegrass....

  12. Aplicación de modelos en los sistemas agrícolas de secano de la meseta central : Simulación de rotaciones y modelado de la arquitectura de la planta en leguminosas

    OpenAIRE

    Hernández Díaz-Ambrona, Carlos Gregorio

    1999-01-01

    Este trabajo profundiza en el estudio de los sistemas agrícolas de secano de la Meseta Central. Sobre la base de la alternativa tradicional ce^eal^arbecho, se han estudiado durante tres años de cultivo 1995/96, 1996/97 y 1997/98 seis rotaciones diferentes: monocultivo de cebada (Hordeum vulgare L.), cebada/barbecho, cebada/habas (Viciafaba L.), cebada/guisantes {Pisum sativum L.), cebada/habas/barbecho y cebada/guisantes/barbecho. Entre las rotaciones, se ha comparado la biomasa, el rendimien...

  13. Starch bioengineering in Brachypodium distachyon

    DEFF Research Database (Denmark)

    Tanackovic, Vanja; Svensson, Jan Tommy; Buleon, A

    2011-01-01

    Brachypodium distachyon was recently introduced as a model plant for temperate cereals (Opanowicz et al., 2008). We aim to establish Brachypodium as a model for cereal starch metabolism. Grain starch from two lines: Bd21 and Bd21-3 are being characterized. Microscopic, chemical and structural data...... including amylopectin chain length distribution, phosphate content and amylose content provided further evidence for the close relationship to temperate cereals even though starch content and starch granule size were considerably lower than that for barley (Hordeum vulgare). Bioinformatics analyses...... in temperate cereals....

  14. Identification and characterization of barley RNA-directed RNA polymerases

    DEFF Research Database (Denmark)

    Madsen, Christian Toft; Stephens, Jennifer; Hornyik, Csaba

    2009-01-01

    in dicot species. In this report, we identi!ed and characterized HvRDR1, HvRDR2 and HvRDR6 genes in the monocot plant barley (Hordeum vulgare). We analysed their expression under various biotic and abiotic stresses including fungal and viral infections, salicylic acid treatment as well as during plant...... development. The different classes and subclasses of barley RDRs displayed contrasting expression patterns during pathogen challenge and development suggesting their involvement in speci!c regulatory pathways. Their response to heat and salicylic acid treatment suggests a conserved pattern of expression...

  15. Estimating legume N-2 fixation in grass-clover mixtures of a grazed organic cropping system using two N-15 methods

    DEFF Research Database (Denmark)

    Vinther, F.P.; Jensen, E.S.

    2000-01-01

    The input of Nitrogen (N) through symbiotic N-2 fixation (SNF) in grass-clover mixtures was determined in an organic cropping. system for grazing during 3 years. The mixture of perennial ryegrass (Lolium perenne L.) and white clover (Trifolium repens L.) was established by undersowing in spring...... barley (Hordeum vulgare L.) and maintained subsequently for two production years. Dinitrogen fixation was determined using the N-15 isotope dilution techniques and two labelling procedures. Using either pre-labelling of the soil with immobilisation of the N-15 by addition of a carbon source before...

  16. Influence of yellow rust infextion on 32P transport in detached barley leaves

    International Nuclear Information System (INIS)

    Schubert, J.

    1982-01-01

    Several barley cultivars (Hordeum vulgare L.) differing in their resistance to yellow rust (Puccinia striiformis West.) were tested for relationships between changes of 32 P transport in detached leaves and resistance to yellow rust disease. Investigation carried out with detached second leaves from plants infected at their first leaf revealed a matter transport in these leaves changed by the infection. Transport was also influenced by inoculation with yellow rust uredospores. In that case rust infection influenced the basipetal transport less strongly in resistent plants than in susceptible ones. Connected with the findings the influence of fungal substances on transport processes is discussed in general. (author)

  17. Nitrogen acquisition by pea and barley and the effect of their crop residues on available nitrogen for subsequent crops

    DEFF Research Database (Denmark)

    Jensen, E.S.

    1996-01-01

    Nitrogen acquisition by field pea (Pisum sativum L.) and spring barley (Hordeum vulgare L.) grown on a sandy loam soil and availability of N in three subsequent sequences of a cropping system were studied in an outdoor pot experiment. The effect of crop residues on the N availability was evaluated....... The dry matter production and total N uptake of a spring barley crop following pea or barley, with a period of unplanted soil in the autumn/winter, were significantly higher after pea than after barley. The barley crop following pea and barley recovered 11% of the pea and 8% of the barley residue N...

  18. Resistance to Barley Leaf Stripe

    DEFF Research Database (Denmark)

    Nørgaard Knudsen, J. C.

    1986-01-01

    in well adapted Northwest European spring cultivars. Virulence matching two hitherto not overcome resistances was demonstrated. Differences in apparent race nonspecific or partial resistance were also present, changing the percentage of infected plants of susceptible genotypes from about 20 to 44 per cent.......Ten barley [Hordeum vulgare] genotypes were inoculated with twelve isolates of Pyrenophora graminea of diverse European and North African origin. Race specific resistance occurred. Four, possibly five, genetically different sources of race-specific resistance were found, three of them occurring...

  19. Carbon source-sink limitations differ between two species with contrasting growth strategies.

    Science.gov (United States)

    Burnett, Angela C; Rogers, Alistair; Rees, Mark; Osborne, Colin P

    2016-11-01

    Understanding how carbon source and sink strengths limit plant growth is a critical knowledge gap that hinders efforts to maximize crop yield. We investigated how differences in growth rate arise from source-sink limitations, using a model system comparing a fast-growing domesticated annual barley (Hordeum vulgare cv. NFC Tipple) with a slow-growing wild perennial relative (Hordeum bulbosum). Source strength was manipulated by growing plants at sub-ambient and elevated CO 2 concentrations ([CO 2 ]). Limitations on vegetative growth imposed by source and sink were diagnosed by measuring relative growth rate, developmental plasticity, photosynthesis and major carbon and nitrogen metabolite pools. Growth was sink limited in the annual but source limited in the perennial. RGR and carbon acquisition were higher in the annual, but photosynthesis responded weakly to elevated [CO 2 ] indicating that source strength was near maximal at current [CO 2 ]. In contrast, photosynthetic rate and sink development responded strongly to elevated [CO 2 ] in the perennial, indicating significant source limitation. Sink limitation was avoided in the perennial by high sink plasticity: a marked increase in tillering and root:shoot ratio at elevated [CO 2 ], and lower non-structural carbohydrate accumulation. Alleviating sink limitation during vegetative development could be important for maximizing growth of elite cereals under future elevated [CO 2 ]. © 2016 John Wiley & Sons Ltd.

  20. Phytoremediation of pharmaceuticals--preliminary study.

    Science.gov (United States)

    Kotyza, Jan; Soudek, Petr; Kafka, Zdenĕk; Vanĕk, Toás

    2010-03-01

    Phytoremediation of selected pharmaceuticals (diclofenac, ibuprofen, and acetaminophen) using Armoracia rusticana and Linum usitatissimum cell cultures and by hydroponically cultivated Lupinus albus, Hordeum vulgaris, and Phragmites australis plants in laboratory conditions is described. During in vitro experiments, the best results for acetaminophen were achieved using Armoracia rusticana hairy root cultures, where 100% of the starting amount was removed from the media during eight days. Total removal of ibuprofen and diclofenac was achieved using a Linum usitatissimum suspension culture after one and six days, respectively. In the hydroponic arrangement, the best results were achieved for Lupinus, where acetaminophen was totally removed from media during two or four days in concentrations of 0.1 or 0.2 mM, respectively. The best effectiveness of ibuprofen removal (50% of starting amount) was found in case of Phragmites. Effectiveness of all tested plants for diclofenac removal was low. The best removal was achieved using Phragmites in the case of 0.2 mM concentration-67% of the starting amount and Hordeum for 0.1 mM starting concentration, 56%.

  1. Primer registro de Conidiobolus coronatus (Zygomycetes: Entomophthorales en crías experimentales de dos especies plaga del maíz: Delphacodes kuscheli y D. haywardi (Hemiptera: Delphacidae en la Argentina First record of Conidiobolus coronatus (Zygomycetes: Entomophthorales in experimental breeding of two pest species of corn: Delphacodes kuscheli and D. haywardi Muir (Hemiptera: Delphacidae in Argentine

    Directory of Open Access Journals (Sweden)

    A. V. Toledo

    Full Text Available Se investigó la ocurrencia natural del hongo entomopatógeno Conidiobolus coronatus (Costantin Batko (Zygomycetes: Entomophthorales en adultos de Delphacodes kuscheli Fennah y D. haywardi Muir (Hemiptera: Delphacidae, criados sobre Hordeum vulgare L. bajo condiciones de invernadero. Los insectos muertos, por una sospechada infección fúngica, fueron recolectados, esterilizados superficialmente, y examinados en el laboratorio. Conidiobolus coronatus fue aislado en cultivos puros, descrito morfológicamente y depositado en colecciones micológicas. Este trabajo presenta el primer registro de C. coronatus contra insectos perjudiciales en la Argentina.The natural occurrence of the entomopathogenic fungus Conidiobolus coronatus (Costantin Batko (Zygomycetes: Entomophthorales in adults of Delphacodes kuscheli Fennah and D. haywardi Muir (Hemiptera: Delphacidae, reared on Hordeum vulgare L. under greenhouse conditions, was investigated. Dead insects, suspected of fungal infection, were collected, surface sterilized, and examined in the laboratory. Conidiobolus coronatus was isolated in pure cultures, described morphologically, and deposited in mycological collections. This paper presents the first record of C. coronatus against harmful insects in Argentina.

  2. Detection of alien genetic introgressions in bread wheat using dot-blot genomic hybridisation.

    Science.gov (United States)

    Rey, María-Dolores; Prieto, Pilar

    2017-01-01

    Simple, reliable methods for the identification of alien genetic introgressions are required in plant breeding programmes. The use of genomic dot-blot hybridisation allows the detection of small Hordeum chilense genomic introgressions in the descendants of genetic crosses between wheat and H. chilense addition or substitution lines in wheat when molecular markers are difficult to use. Based on genomic in situ hybridisation, DNA samples from wheat lines carrying putatively H. chilense introgressions were immobilised on a membrane, blocked with wheat genomic DNA and hybridised with biotin-labelled H. chilense genomic DNA as a probe. This dot-blot screening reduced the number of plants necessary to be analysed by molecular markers or in situ hybridisation, saving time and money. The technique was sensitive enough to detect a minimum of 5 ng of total genomic DNA immobilised on the membrane or about 1/420 dilution of H. chilense genomic DNA in the wheat background. The robustness of the technique was verified by in situ hybridisation. In addition, the detection of other wheat relative species such as Hordeum vulgare , Secale cereale and Agropyron cristatum in the wheat background was also reported .

  3. Increases in both acute and chronic temperature potentiate tocotrienol concentrations in wild barley at 'Evolution Canyon'.

    Science.gov (United States)

    Shen, Yu; Lansky, Ephraim; Traber, Maret; Nevo, Eviatar

    2013-09-01

    Biosynthesis of tocols (vitamin E isoforms) is linked to response to temperature in plants. 'Evolution Canyon', an ecogeographical microcosm extending over an average of 200 meters (range 100-400) wide area in the Carmel Mountains of northern Israel, has been suggested as a model for studying global warming. Both domestic (Hordeum vulgare) and wild (Hordeum spontaneum) barley compared with wheat, oat, corn, rice, and rye show high tocotrienol/tocopherol ratios. Therefore, we hypothesized that tocol distribution might change in response to global warming. α-, β-, γ-, and δ-tocopherol, and α-, β-, γ-, and δ-tocotrienol concentrations were measured in wild barley (H. spontaneum) seeds harvested from the xeric (African) and mesic (European) slopes of Evolution Canyon over a six-year period from 2005-2011. Additionally, we examined seeds from areas contiguous to and distant from the part of the Canyon severely burned during the Carmel Fire of December 2010. Increased α-tocotrienol (pslope in contrast to the cooler 'European' slope, and 3) to propinquity to the fire. The study illustrates the role of α-tocotrienol in both chronic and acute temperature adaptation in wild barley and suggests future research into thermoregulatory mechanisms in plants. Copyright © 2013 Verlag Helvetica Chimica Acta AG, Zürich.

  4. Variation in shoot tolerance mechanisms not related to ion toxicity in barley

    KAUST Repository

    Tilbrook, Joanne

    2017-09-27

    Soil salinity can severely reduce crop growth and yield. Many studies have investigated salinity tolerance mechanisms in cereals using phenotypes that are relatively easy to measure. The majority of these studies measured the accumulation of shoot Na+ and the effect this has on plant growth. However, plant growth is reduced immediately after exposure to NaCl before Na+ accumulates to toxic concentrations in the shoot. In this study, nondestructive and destructive measurements are used to evaluate the responses of 24 predominately Australian barley (Hordeum vulgare L.) lines at 0, 150 and 250mMNaCl. Considerable variation for shoot tolerance mechanisms not related to ion toxicity (shoot ion-independent tolerance) was found, withsome lines being able to maintain substantial growth rates under salt stress, whereas others stopped growing. Hordeum vulgare spp. spontaneum accessions and barley landraces predominantly had the best shoot ion independent tolerance, although two commercial cultivars, Fathom and Skiff, also had high tolerance. The tolerance of cv. Fathom may be caused by a recent introgression from H. vulgare L. spp. spontaneum. This study shows that the most salt-tolerant barley lines are those that contain both shoot ion-independent tolerance and the ability to exclude Na+ from the shoot (and thus maintain high K+: Na+ ratios).

  5. Recovery of nitrogen by spring barley following incorporation of 15N-labelled straw and catch crop material

    DEFF Research Database (Denmark)

    Thomsen, I.K.; Jensen, E.S.

    1994-01-01

    The recovery by spring barley (Hordeum vulgare L.) of nitrogen mineralized from N-15-labelled straw and ryegrass material was followed for 3 years in the field. The effects of separate and combined applications of straw and ryegrass were studied using cross-labelling with N-15. Reference plots re...... mineral fertilizer was in the second and third barley crop similar to the recovery of N from incorporated plant residues.......The recovery by spring barley (Hordeum vulgare L.) of nitrogen mineralized from N-15-labelled straw and ryegrass material was followed for 3 years in the field. The effects of separate and combined applications of straw and ryegrass were studied using cross-labelling with N-15. Reference plots...... receiving (NH4NO3)-N-15-N-15 were included. Plant samples were taken every second week until maturity during the first growing season and at maturity in the two following years. Incorporation of plant material had no significant influence on the above-ground dry matter yield of the barley. The barley...

  6. Variation in shoot tolerance mechanisms not related to ion toxicity in barley

    KAUST Repository

    Tilbrook, Joanne; Schilling, Rhiannon K.; Berger, Bettina; Garcia, Alexandre F.; Trittermann, Christine; Coventry, Stewart; Rabie, Huwaida; Brien, Chris; Nguyen, Martin; Tester, Mark A.; Roy, Stuart J.

    2017-01-01

    Soil salinity can severely reduce crop growth and yield. Many studies have investigated salinity tolerance mechanisms in cereals using phenotypes that are relatively easy to measure. The majority of these studies measured the accumulation of shoot Na+ and the effect this has on plant growth. However, plant growth is reduced immediately after exposure to NaCl before Na+ accumulates to toxic concentrations in the shoot. In this study, nondestructive and destructive measurements are used to evaluate the responses of 24 predominately Australian barley (Hordeum vulgare L.) lines at 0, 150 and 250mMNaCl. Considerable variation for shoot tolerance mechanisms not related to ion toxicity (shoot ion-independent tolerance) was found, withsome lines being able to maintain substantial growth rates under salt stress, whereas others stopped growing. Hordeum vulgare spp. spontaneum accessions and barley landraces predominantly had the best shoot ion independent tolerance, although two commercial cultivars, Fathom and Skiff, also had high tolerance. The tolerance of cv. Fathom may be caused by a recent introgression from H. vulgare L. spp. spontaneum. This study shows that the most salt-tolerant barley lines are those that contain both shoot ion-independent tolerance and the ability to exclude Na+ from the shoot (and thus maintain high K+: Na+ ratios).

  7. Implementation of biochemical screening to improve baking quality of barley

    DEFF Research Database (Denmark)

    Vincze, Éva; Dionisio, Giuseppe; Aaslo, Per

    2011-01-01

    Barley (Hordeum vulgare) has the potential to offer considerable human nutritional benefits, especially as supplement to wheat-based breads. Under current commercial baking conditions it is not possible to introduce more that 20% barley flour to the wheat bread without negative impact on the phys......Barley (Hordeum vulgare) has the potential to offer considerable human nutritional benefits, especially as supplement to wheat-based breads. Under current commercial baking conditions it is not possible to introduce more that 20% barley flour to the wheat bread without negative impact...... on the physical chemical properties of the bread products due to the poor baking properties of barley flour. As a consequence, the nutritional advantages of barley are not fully exploited. The inferior leavening and baking properties of barley can, in part, be attributed to the physical properties of the storage...... proteins. Changing the storage protein composition can lessen this problem. Our working hypothesis was that exploiting the substantial genetic variation within the gene pool for storage proteins could enable improving the baking qualities of barley flour. We characterised forty-nine barley cultivars...

  8. Understanding rhizosphere processes to enhance phytoextraction of germanium and rare earth elements

    Science.gov (United States)

    Wiche, Oliver

    2017-04-01

    Germanium (Ge) and rare earth elements (REEs) are economically valuable raw materials that are not actually rare in terms of concentrations in soils but they are hardly available for plant uptake due to interactions with organic matter (SOM), secondary soil constituents such as Fe/Mn oxides and P bearing soil fractions. Processes in the rhizosphere might influence availability of Ge and REEs in the soil-plant system, since lowering of the pH and presence of carboxylates and siderophores (small molecules that strongly chelate Fe and other elements) strongly influences the chemical speciation of Ge and REEs in soil and consequently this comprehensive knowledge helps us to improve phytomining. In a series of field and greenhouse experiments 16 plant species from the functional groups of grasses, herbs and legumes were tested with regard to their accumulation efficiency of Ge and REEs in shoots. Subsequently, we conducted mixed culture experiments in which inefficient species (e.g. cereals like Avena sativa, Hordeum vulgare, Panicum miliaceum) were cultivated in mixed cultures with efficient species (Lupinus albus, Lupinus angustifolius). Based on the plant concentrations a principal component analysis (PCA) was performed to identify significant factors that explain the accumulation behavior of different plant species with regard to Ge, REEs, Si, Fe and Mn. In this analysis Mn was used to identify plant species with efficient mechanisms to access sparingly available P-resources in soils. Particularly in nonmycorrhizal species concentrations of Mn in leaves often indicate a carboxylate based P-mobilising strategy. Herbaceous plant species accumulated significantly higher amounts of REEs while grasses accumulated significantly higher amounts of Ge. Concentrations of Ge in shoots of grasses correlated significantly positive with Si, but negatively with concentrations of Mn. Indeed, the results of the PCA clearly show that plants with high Mn concentrations tend to have

  9. Reliability of different methods used for forming of working samples in the laboratory for seed testing

    Directory of Open Access Journals (Sweden)

    Opra Branislava

    2000-01-01

    Full Text Available The testing of seed quality starts from the moment a sample is formed in a warehouse during processing or packaging of the seed. The seed sampling as the process of obtaining the working sample also assumes each step undertaken during its testing in the laboratory. With the aim of appropriate forming of a seed sample in the laboratory, the usage of seed divider is prescribed for large seeded species (such as seed the size of wheat or larger (ISTA Rules, 1999. The aim of this paper was the comparison of different methods used for obtaining the working samples of maize and wheat seeds using conical, soil and centrifugal dividers. The number of seed of added admixtures confirmed the reliability of working samples formation. To each maize sample (1000 g 10 seeds of the following admixtures were added: Zea mays L. (red pericarp, Hordeum vulgäre L., Triticum aestivum L., and Glycine max (L. Merr. Two methods were used for formation of maze seed working sample. To wheat samples (1000 g 10 seeds of each of the following species were added: Avena saliva (hulled seeds, Hordeum vulgäre L., Galium tricorne Stokes, and Polygonum lapatifolmm L. For formation of wheat seed working samples four methods were used. Optimum of 9, but not less than 7 seeds of admixture were due to be determined in the maize seed working sample, while for wheat, at least one seed of admixture was expected to be found in the working sample. The obtained results confirmed that the formation of the maize seed working samples was the most reliable when centrifugal divider, the first method was used (average of admixture - 9.37. From the observed admixtures the seed of Triticum aestivum L. was the most uniformly distributed, the first method also being used (6.93. The second method gains high average values satisfying the given criterion, but it should be used with previous homogenization of the sample being tested. The forming of wheat seed working samples is the most reliable if the

  10. The effect of abandoned mining ponds on trace elements dynamics in the soil-plant system

    Science.gov (United States)

    Gabarrón, María; Faz, Ángel; Zornoza, Raúl; Acosta, Jose A.

    2017-04-01

    In semiarid climate regions lack of vegetation and dryer climate contribute to erosion of abandoned mining surface areas making them up important potential sources of metal pollution into the environment. The objectives of this study were to determine the influence of mine ponds in agriculture and forest soils, and identify the dynamic of metals in the soil-plant system for native plant species (Ballota hirsuta) and crop species (Hordeum vulgare) in two ancient mining districts: La Unión and Mazarrón. To achieve these objectives, wastes samples from mine ponds and soil samples (rhizosphere and non-rhizosphere soils) from natural and agricultural lands were collected. In addition, six plants (Ballota hirsuta) from natural area and 3 plants (Hordeum vulgare) from crops were collected. Physicochemical properties and total, water soluble and bioavailable metals (Cd, Co, Cr, Cu, Fe, Mn, Ni, Pb, and Zn) and arsenic were measured in waste/soil samples. The chemical speciation of metals in soil was estimated by a sequential extraction procedure. For plants analyses, each plant were divided in roots, stem and leaves and metal content measured by ICP-MS. Results indicated that mine, natural and agricultural soils were contaminated by As, Cd, Cu, Pb, and Zn. Chemical partitioning revealed higher mobility of metals in mine ponds than natural and agriculture soils while only Fe and As are completely bound to the soil matrix due to the mineralogical compositions of soils. The accumulation of metals in Ballota hirsuta in La Union decrease as Fe>As>Cr>Ni>Cu>Zn>Cd>Mn>Co>Pb while in Mazarrón did as As>Fe>Cr>Pb>Cu>Ni>Co>Mn>Zn>Cd. Ballota hirsuta showed high ability to bio-accumulate Cu, Cr, Fe, Ni, and As, transferring a large amount to edible parts without exceeding the toxicity limits for animals. Results for barley plants (Hordeum vulgare) showed the ability to absorb and accumulate As, Fe, Mn, Pb and Zn, although the transfer ability of As, Cd and Pb was lower. Although the

  11. Long-term rotation and tillage effects on soil structure and crop yield

    DEFF Research Database (Denmark)

    Munkholm, Lars Juhl; Heck, R; Deen, B

    2013-01-01

    long-term rotation and tillage treatment experiment on a Canadian silt loam soil. Topsoil measurements were carried out for three different rotations: R1, (C–C–C–C) continuous corn (Zea mays L.), R6, (C–C–O(RC), B(RC)) corn, corn, oats (Avena fatua L.) and spring barley (Hordeum vulgare L.) and R8, (C......–C–S–S) corn, corn, soybean (Glycine max L.), soybean. A red clover (Trifolium pretense L.) cover crop was under seeded in oats and spring barley in R6. In 2010, first year corn was grown in R6 and R8. The tillage treatments included no tillage, NT and mouldboard ploughing, MP. Topsoil structural quality...

  12. Long-Term Effects of Rotational Tillage On Visual Evaluation of Soil Structure, Soil Quality and Crop Yield

    DEFF Research Database (Denmark)

    Munkholm, Lars Juhl; Heck, Richard; Deen, Bill

    year old long-term rotation and tillage treatment experiment on a Canadian silt loam soil. Measurements were carried out in the topsoil for three different rotations: R1 (C-C-C-C) continuous corn (Zea mays L.), R6. (C-C-O(RC), B(RC)) corn, corn, oats (Avena fatua L.) and spring barley (Hordeum vulgare...... L.) and R8, (C-C-S-S) corn, corn, soybean (Glycine max L.), soybean. A red clover (Trifolium pretense L.) cover crop was under seeded in oats and spring barley in R6. In 2010, first year corn was grown in R6 and R8. The tillage treatments included no tillage, NT and mouldboard plowing, MP. Topsoil...

  13. Concerted suppression of all starch branching enzyme genes in barley produces amylose-only starch granules

    DEFF Research Database (Denmark)

    Carciofi, Massimiliano; Blennow, Per Gunnar Andreas; Jensen, Susanne Langgård

    2012-01-01

    is preferentially derived from amylose, which can be increased by suppressing amylopectin synthesis by silencing of starch branching enzymes (SBEs). However all the previous works attempting the production of high RS crops resulted in only partly increased amylose-content and/or significant yield loss. Results...... In this study we invented a new method for silencing of multiple genes. Using a chimeric RNAi hairpin we simultaneously suppressed all genes coding for starch branching enzymes (SBE I, SBE IIa, SBE IIb) in barley (Hordeum vulgare L.), resulting in production of amylose-only starch granules in the endosperm...... yield in a living organism. This was achieved by a new method of simultaneous suppression of the entire complement of genes encoding starch branching enzymes. We demonstrate that amylopectin is not essential for starch granule crystallinity and integrity. However the slower initial growth of shoots from...

  14. Archaeobotanical study of ancient food and cereal remains at the Astana Cemeteries, Xinjiang, China.

    Science.gov (United States)

    Chen, Tao; Wu, Yan; Zhang, Yongbing; Wang, Bo; Hu, Yaowu; Wang, Changsui; Jiang, Hongen

    2012-01-01

    Starch grain, phytolith and cereal bran fragments were analyzed in order to identify the food remains including cakes, dumplings, as well as porridge unearthed at the Astana Cemeteries in Turpan of Xinjiang, China. The results suggest that the cakes were made from Triticum aestivum while the dumplings were made from Triticum aestivum, along with Setaria italica. The ingredients of the porridge remains emanated from Panicum miliaceum. Moreover, direct macrobotantical evidence of the utilization of six cereal crops, such as Triticum aestivum, Hordeum vulgare var. coeleste, Panicum miliaceum, Setaria italica, Cannabis sativa, and Oryza sativa in the Turpan region during the Jin and Tang dynasties (about 3(rd) to 9(th) centuries) is also presented. All of these cereal crops not only provided food for the survival of the indigenous people, but also spiced up their daily life.

  15. Possible role for abscisic acid in regulation of photosynthetic and photorespiratory carbon metabolism in barley leaves

    International Nuclear Information System (INIS)

    Popova, L.P.; Tsonev, T.D.; Vaklinova, S.G.

    1987-01-01

    The influence of abscisic acid (ABA) on carbon metabolism, rate of photorespiration, and the activity of the photorespiratory enzymes ribulose bisphosphate oxygenase and glycolate oxidase in 7-day-old barley seedlings (Hordeum vulgare L. var. Alfa) was investigated. Plants treated with ABA had enhanced incorporation of labeled carbon from 14 CO 2 into glycolic acid, glycine, and serine, while 14 C incorporation into 3-phosphoglyceric acid and sugarphosphate esters was depressed. Parallel with this effect, treated plants showed a rise in activity of RuBP oxygenase and glycolic acid oxidase. The rate of photorespiration was increased twofold by ABA treatment at IO -6 molar while the CO 2 -compensation point increased 46% and stomatal resistance increased more than twofold over control plants

  16. The Barley Magnesium Chelatase 150-kD Subunit Is Not an Abscisic Acid Receptor1[OA

    Science.gov (United States)

    Müller, André H.; Hansson, Mats

    2009-01-01

    Magnesium chelatase is the first unique enzyme of the chlorophyll biosynthetic pathway. It is composed of three gene products of which the largest is 150 kD. This protein was recently identified as an abscisic acid receptor in Arabidopsis (Arabidopsis thaliana). We have evaluated whether the barley (Hordeum vulgare) magnesium chelatase large subunit, XanF, could be a receptor for the phytohormone. The study involved analysis of recombinant magnesium chelatase protein as well as several induced chlorophyll-deficient magnesium chelatase mutants with defects identified at the gene and protein levels. Abscisic acid had no effect on magnesium chelatase activity and binding to the barley 150-kD protein could not be shown. Magnesium chelatase mutants showed a wild-type response in respect to postgermination growth and stomatal aperture. Our results question the function of the large magnesium chelatase subunit as an abscisic acid receptor. PMID:19176716

  17. Effects of potentially acidic air pollutants on the intracellular distribution and transport of plant growth regulators in mesophyll cells of leaves. Consequences on stress- and developmental physiology

    Energy Technology Data Exchange (ETDEWEB)

    Kremer, H.; Pfanz, H.; Hartung, W.

    1987-07-11

    The influence of SO/sub 2/ on the intracellular distribution of abscisic acid (ABA) and indole-acetic acid (IAA) in mesophyll cells of Picea abies, Tsuga americana and Hordeum vulgare was investigated. The compartmentation of ABA and IAA depends on intracellular pH-gradients. The hydrophilic anions ABA and IAA are accumulated in the alkaline cell compartments cytosol and chloroplasts, which act as anion traps for weak acids. Uptake of sulfur dioxide into leaves leads to an acidification of alkaline cell compartments, thus decreasing intracellular pH-gradients. Consequently this results in an increased release of plant growth regulators from the cell interior into the apoplast. Therefore the target cells of plant hormones i.e. meristems and stomates are exposed to altered hormone concentrations. Obviously this influences the regulation of cellular metabolism plant development and growth.

  18. The genetics of indirect ecological effects - plant parasites and aphid herbivores

    Directory of Open Access Journals (Sweden)

    Jennifer K Rowntree

    2014-04-01

    Full Text Available When parasitic plants and aphid herbivores share a host, both direct and indirect ecological effects (IEEs can influence evolutionary processes. We used a hemiparasitic plant (Rhinanthus minor, a grass host (Hordeum vulgare and a cereal aphid (Sitobion avenae to investigate the genetics of IEEs between the aphid and the parasitic plant, and looked to see how these might affect or be influenced by the genetic diversity of the host plants. Survival of R. minor depended on the parasite’s population of origin, the genotypes of the aphids sharing the host and the genetic diversity in the host plant community. Hence the indirect effects of the aphids on the parasitic plants depended on the genetic environment of the system. Here, we show that genetic variation can be important in determining the outcome of IEEs. Therefore, IEEs have the potential to influence evolutionary processes and the continuity of species interactions over time.

  19. Low Resolution Structure of RAR1-GST-Tag Fusion Protein in Solution

    International Nuclear Information System (INIS)

    Taube, M.; Kozak, M.; Jarmolowski, A.

    2010-01-01

    RAR1 is a protein required for resistance mediated by many R genes and function upstream of signaling pathways leading to H 2 O 2 accumulation. The structure and conformation of RAR1-GST-Tag fusion protein from barley (Hordeum vulgare) in solution was studied by the small angle scattering of synchrotron radiation. It was found that the dimer of RAR1-GST-Tag protein is characterized in solution by radius of gyration R G = 6.19 nm and maximal intramolecular vector D max = 23 nm. On the basis of the small angle scattering of synchrotron radiation SAXS data two bead models obtained by ab initio modeling are proposed. Both models show elongated conformations. We also concluded that molecules of fusion protein form: dimers in solution via interaction of GST domains. (authors)

  20. Incorporation of tritiated thymidine and uridine in normal and endopolyploid nuclei of differentiated tissue

    International Nuclear Information System (INIS)

    Bansal, Y.K.; Sen, Sumitra

    1987-01-01

    Rate of replication and transcription between normal and giant endopolyploid nuclei of differentiated tissue of Hordeum vulgare L. (2n=14) roots and Phlox drummondii Hook. (2n=14) and Zea mays L. (2n=20) endosperms were studied by labelling experiments with tritiated thymidine and uridine. The incorporation of thymidine and uridine was identical in both diploid and giant endopolyploid nuclei of the roots of H. vulgare. The endosperm cells of P. drummondii and Z. mays, however, exhibit markedly different labelling pattern in normal (i.e. triploid) and endopolyploid nuclei where both replication and transcription were rather high. The nutritive function of the endosperm is probably responsible for this high degree of activity. (author). 14 refs., 10 figs., 3 tables

  1. The 'Big bang' in the Early Iron Age

    Directory of Open Access Journals (Sweden)

    Medović Aleksandar

    2010-01-01

    Full Text Available The Early Iron Age granaries of Tell Gradina upon Bosut exploded in a fire inferno in the 8th century B.C. The result of this catastrophe is 2-5 cm thick layer with mixed carbonized seeds and fruits. Recently, eight samples were taken from Gradina's profile for archaeobotanical analysis. The goal was to obtain basic information on land use and on major crops and weeds of that period. The most abundant were cereals, followed by millets, pulses and oil/fibre plants. The dominant cereals were einkorn (Triticum monococcum and hulled barley (Hordeum vulgare vulgare. Broomcorn millet (Panicum miliaceum was also very important. Pulses were represented with six and oil/fibre plants with three species. Among weeds and ruderals, most common are rye brome (Bromus secalinus, fat hen (Chenopodium album, darnel ryegrass (Lolium temulentum, hairy crabgrass (Digitaria sanguinalis and corncockle (Agrostemma githago.

  2. Archaeobotanical study of ancient food and cereal remains at the Astana Cemeteries, Xinjiang, China.

    Directory of Open Access Journals (Sweden)

    Tao Chen

    Full Text Available Starch grain, phytolith and cereal bran fragments were analyzed in order to identify the food remains including cakes, dumplings, as well as porridge unearthed at the Astana Cemeteries in Turpan of Xinjiang, China. The results suggest that the cakes were made from Triticum aestivum while the dumplings were made from Triticum aestivum, along with Setaria italica. The ingredients of the porridge remains emanated from Panicum miliaceum. Moreover, direct macrobotantical evidence of the utilization of six cereal crops, such as Triticum aestivum, Hordeum vulgare var. coeleste, Panicum miliaceum, Setaria italica, Cannabis sativa, and Oryza sativa in the Turpan region during the Jin and Tang dynasties (about 3(rd to 9(th centuries is also presented. All of these cereal crops not only provided food for the survival of the indigenous people, but also spiced up their daily life.

  3. Influence of forage inclusion in the diet on ileal and total tract digestibility

    DEFF Research Database (Denmark)

    Jørgensen, Henry; Carlson, Dorthe; Lærke, Helle Nygaard

    2012-01-01

    The present investigation aimed to study the ileal and total tract digestibility of 3 forages (clover–grass, clover–grass silage, and fi eld pea (Pisum sativum)–barley (Hordeum vulgare) silage) supplemented to a basal diet. A total of 24 pigs, adapted to eating forages by supplementing a basal feed...... throughout the whole experiment. The intake of forages was low and quite variable and on average accounted for only 10 to 12% of the DMI. Ileal digestibility of protein estimated by collection from the T-cannula was higher (P = 0.031) than the digestibility estimated by the slaughter technique indicating...... in the diet as forage reduced (P pea– barley silage. In organic slaughter pig production, the overall energy supply from these forages is limited, but they may play an important role in satiety...

  4. Progress in the evaluation, use in breeding, and genetic analysis of semi-dwarf mutants of barley

    International Nuclear Information System (INIS)

    Ullrich, S.E.; Muir, C.E.; Washington State Univ., Pullman

    1984-01-01

    Breeding for reduced height in barley (Hordeum vulgare L.) to primarily reduce lodging susceptibility is ongoing in the Washington State University barley breeding program. Two semi-dwarf winter and spring cultivars have been released and a number of advanced lines are being considered for release. Several semi-dwarf sources are utilized, including those from induced mutants in 'Jotun', 'Piroline' and 'Valticky'. In addition, over 200 putative mutants have been selected in the past four years from M 2 sodium azide-treated populations of local cultivars and advanced lines. These are evaluated in the pedigree breeding program and some have been incorporated into male sterile facilitated recurrent selection populations developed for reduced height. The inheritance of dwarfism in one mutant in the cultivar 'Advance' was determined to be controlled by a single recessive gene. (author)

  5. Effects of Single and Multifactor Treatments with Elevated Temperature, CO2 and Ozone on Oilseed Rape and Barley

    DEFF Research Database (Denmark)

    Clausen, Sabine Karin; Frenck, Georg; van der Linden, Leon Gareth

    2011-01-01

    We investigated the effect of elevated [CO2], [O3] and temperature on plant productivity and if these climate factors interacted with each other in multifactor treatments. The climate effects were studied in 14 different cultivars/lines of European spring oilseed rape (Brassica napus L.) and spring...... barley (Hordeum vulgare L.). Seven genotypes of each species were cultivated in six single- and multifactor treatments with ambient or elevated CO2 (385 ppm and 700 ppm), O3 (20 ppb and 60 ppb) and temperature (12/19 °C and 17/24 °C). Growth and production parameters were measured. Elevated CO2 increased....... A significantly decreased yield and thousand grain weight was also seen in barley due to elevated O3. The multifactor combination of elevated CO2, O3 and temperature showed a decrease in growth and production in the two species, though not statistically significant for all parameters. This trend suggests...

  6. Complex interplay of future climate levels of CO2, ozone and temperature on susceptibility to fungal diseases in barley

    DEFF Research Database (Denmark)

    Mikkelsen, Bolette Lind; Bagger Jørgensen, Rikke; Lyngkjær, Michael Foged

    2015-01-01

    efficiency of PSII, both at ambient and elevated [CO2], suggesting that photosynthesis was not limited by [CO2] at ambient temperature. When growing under elevated temperature or [O3], infection by the biotrophic powdery mildew fungus decreased, whereas disease symptoms and growth of the toxin......Barley (Hordeum vulgare) was grown in different climatic environments with elevated [CO2] (700 vs 385 ppm), [O3] (60/90 vs 20 ppb) and temperature (24/19 vs 19/12°C day/night) as single factors and in combinations, to evaluate the impact of these climatic factors on photosynthesis...... and susceptibility to powdery mildew and spot blotch disease. No significant increase in net CO2 assimilation rate was observed in barley grown under elevated [CO2] at ambient temperature. However, this rate was positively stimulated under elevated temperature together with a slightly higher potential quantum...

  7. Brachypodium distachyon

    DEFF Research Database (Denmark)

    Tanackovic, Vanja

    Starch is one of the most abundant polysaccharides on the Earth, the principal energy storage of most plant species and of crucial significance for humans as a major nutrient in human diet. The majority of produced starch comes from cereals, domesticated grasses, characterized by specific en......­hanced traits known as the domestication syndrome. Wild grasses, on the other side, still have traits lost during the process. Brachypodium distachyon (Brachypodium) is one of the wild grass recently introduced as a model plant for temperate cereals, closely related to pre-domesticated cereals such as barley...... (Hordeum vulgare). This thesis focuses on domestication of grasses – the cereal ancestors, starch in the grass Brachypodium distachyon, and its comparison to domesticated cereal. Grasses can potentially be used for the reintroduction of the lost grass traits, like health-promoting carbohydrates. Therefore...

  8. Root plasma membrane transporters controlling K+/Na+ homeostasis in salt-stressed bBarley1[C][W

    DEFF Research Database (Denmark)

    Chen, Zhonghua; Pottosin, Igor I.; Cuin, Tracey A.

    2007-01-01

    are well combined to withstand saline conditions. These mechanisms include: (1) better control of membrane voltage so retaining a more negative membrane potential; (2) intrinsically higher H1 pump activity; (3) better ability of root cells to pump Na1 from the cytosol to the external medium; and (4) higher......Plant salinity tolerance is a polygenic trait with contributions from genetic, developmental, and physiological interactions, in addition to interactions between the plant and its environment. In this study, we show that in salt-tolerant genotypes of barley (Hordeum vulgare), multiple mechanisms...... of the cytosolic K1-to-Na1 ratio being a key determinant of plant salinity tolerance, and suggest multiple pathways of controlling that important feature in salt-tolerant plants....

  9. In vivo monitoring of seeds and plant-tissue water absorption using optical coherence tomography and optical coherence microscopy

    Science.gov (United States)

    Sapozhnikova, Veronika V.; Kutis, Irina S.; Kutis, Sergey D.; Kuranov, Roman V.; Gelikonov, Grigory V.; Shabanov, Dmitry V.; Kamensky, Vladislav A.

    2004-07-01

    First experimental results on OCT imaging of internal structure of plant tissues and in situ OCT monitoring of plant tissue regeneration at different water supply are reported. Experiments for evaluating OCT capabilities were performed on Tradescantia. The investigation of seeds swelling was performed on wheat seeds (Triticum L.), barley seeds (Hordeum L.), long-fibred flax seeds (Linum usitatissimum L.) and cucumber seeds (Cucumis sativus L.). These OCT images correlate with standard microscopy data from the same tissue regions. Seeds were exposed to a low-intensity physical factor-the pulsed gradient magnetic field (GMF) with pulse duration 0.1 s and maximum amplitude 5 mT (4 successive pulses during 0.4 s). OCT and OCM enable effective monitoring of fast reactions in plants and seeds at different water supply.

  10. Effects of combined action of γ-irradiation and sulfur dioxide or N-methyl-N'-nitro-N-nitrosoguanidin on bacteria and higher plants

    International Nuclear Information System (INIS)

    Kal'chenko, V.A.; Lotareva, O.V.; Spirin, D.A.; Karaban', R.T.; Mal'tseva, L.N.; Ignat'ev, A.A.

    1988-01-01

    Effect of combined action of of gamma-irradiation and sulfur dioxide or N-methyl-N-nitro-N-nitrosoguanidin on baceria (Bacillus subtilis) and higher plants (Hordeum vulgare L., Pinus sylvestris L.) have been studied. The number of barley germ root cells with chromosomal aberrations depends on the order of treatment with the studied agents. The coefficients of SO 2 and gamma-irradiation correlation fluctuate from 1,3 to 2,6 in the above experiments. In experiments with pine seedlings, these correlation coefficients were similar to additive ones. The data obtained suggest that the pattern of action of the agents is determined by the radiation sensitivity of objects and the order of action of the agents

  11. Open gas exchange system for simultaneous determination of the apparent CO2 assimilation by means of URAS technique and incorporation of 14C into plants

    International Nuclear Information System (INIS)

    Schumann, F.; Merbach, W.; Freye, E.; Schilling, G.

    1988-01-01

    Apparent CO 2 assimilation and 14 C incorporation into intact plants (Hordeum distichon L., Beta vulgaris L., and Vicia faba L.) were simultaneously measured on the same leaf, using a simple combination of the URAS technique (infrared absorption recorder) and 14 CO 2 fumigation in an open system. As a result of 14 C discrimination during the CO 2 incorporation and respiration losses during harvest and post-harvest treatment, the 14 C method gave always lower CO 2 assimilation values (by 17 to 25%) than the URAS technique. Nevertheless, the results obtained by both methods were closely correlated. Therefore, for quantifying the assimilated CO 2 properly and simultaneously tracing the assimilates synthesized from CO 2 , it is not sufficient to measure solely 14 C incorporation, but to combine both techniques. The system presented is qualified to meet these requirements. (author)

  12. Comparing the performance of 11 crop simulation models in predicting yield response to nitrogen fertilization

    DEFF Research Database (Denmark)

    Salo, T J; Palosuo, T; Kersebaum, K C

    2016-01-01

    Eleven widely used crop simulation models (APSIM, CERES, CROPSYST, COUP, DAISY, EPIC, FASSET, HERMES, MONICA, STICS and WOFOST) were tested using spring barley (Hordeum vulgare L.) data set under varying nitrogen (N) fertilizer rates from three experimental years in the boreal climate of Jokioinen......, Finland. This is the largest standardized crop model inter-comparison under different levels of N supply to date. The models were calibrated using data from 2002 and 2008, of which 2008 included six N rates ranging from 0 to 150 kg N/ha. Calibration data consisted of weather, soil, phenology, leaf area...... ranged from 170 to 870 kg/ha. During the test year 2009, most models failed to accurately reproduce the observed low yield without N fertilizer as well as the steep yield response to N applications. The multi-model predictions were closer to observations than most single-model predictions, but multi...

  13. An assessment of the biotechnological use of hemoglobin modulation in cereals

    DEFF Research Database (Denmark)

    Hebelstrup, Kim; Shah, Jay K; Simpson, Catherine

    2014-01-01

    Non-symbiotic hemoglobin (nsHb) genes are ubiquitous in plants, but their biological functions have mostly been studied in model plant species rather than in crops. nsHb influences cell signaling and metabolism by modulating the levels of nitric oxide (NO). Class 1 nsHb is upregulated under hypoxia...... and is involved in various biotic and abiotic stress responses. Ectopic overexpression of nsHb in Arabidopsis thaliana accelerates development, whilst targeted overexpression in seeds can increase seed yield. Such observations suggest that manipulating nsHb could be a valid biotechnological target. We studied...... the effects of overexpression of class 1 nsHb in the monocotyledonous crop plant barley (Hordeum vulgare cv. Golden Promise). nsHb was shown to be involved in NO metabolism in barley, as ectopic overexpression reduced the amount of NO released during hypoxia. Further, as in Arabidopsis, nsHb overexpression...

  14. Induced mutations for disease resistance in wheat and barley

    International Nuclear Information System (INIS)

    Hanis, M.; Hanisova, A.; Knytl, V.; Cerny, J.; Benc, S.

    1977-01-01

    The induction of mutations in cultivars of wheat (Triticum aestivum), barley (Hordeum vulgare), and field beans (Phaseolus vulgaris) has been part of the breeding programme at the Plant Breeding Station at Stupice since 1960. A total of 26 cultivars or selections of winter wheat, 4 cultivars or selections of spring wheat, 2 cultivars of field beans, and 43 selections of spring barley have been treated since 1960. A total of 140 mutant lines of wheat and 37 mutant lines of barley with improved disease resistance of a race-specific type have been obtained. Several mutation programme derived cultivars have been registered in Czechoslovakia (''Diamant'', ''Ametyst'', ''Favorit'', ''Hana'', ''Rapid'', and ''Atlas'' in barley, and ''Alfa'' in field beans), but none of them is a mutation for disease resistance. A series of mutants have been used in crossing programmes. Approaches to improve the efficiency of mutation breeding for disease resistance are suggested. (author)

  15. Maize, Sunflower and Barley Sensitivity to the Residual Activity of Clomazone in Soil

    Directory of Open Access Journals (Sweden)

    Jelena Gajić Umiljendić

    2012-01-01

    Full Text Available Sensitivity of maize, sunflower and barley to clomazone residues in loamy soil wasassessed in the study using bioassay. Clomazone was applied at a series of concentrationsfrom 0.12 to 12 mg a.i./kg of soil. After 14 days, morphological (shoot height, fresh and dryweight and physiological (content of carotenoids, chlorophyll a and chlorophyll b parameterswere measured. The results showed that morphological parameters are not valid indicatorsof clomazone sensitivity. Based on the results showing inhibition of the physiologicalparameters, I50 values were calculated and used to estimate the difference in sensitivitybetween the species tested. Sunflower was the most sensitive species, while the differencein sensitivity between maize and barley was not significant.Nomenclature: clomazone (2-(2-chlorbenzyl-4,4-dimethyl-1,2-oxazolidin-3-one, maize(Zea mays L., sunflower (Helianthus annuus L., barley (Hordeum vulgare L.

  16. Barley Seed Germination/Root Elongation Toxicity Test For Evaluation Of Sludge Pre-Treatment

    DEFF Research Database (Denmark)

    Eriksson, Eva; Kusk, Kresten Ole; Barrett Sørensen, Mie

    Application of sludge from wastewater treatment plants (WWTPs) on agricultural land is an approach for nutrient recycling that rise challenges due to recalcitrant and harmful pollutants. In this study we assessed the feasibility of a seed germination test to evaluate sludge ecotoxicity and compared...... germination responses from two test parameters, root elongation and seed germination (sprouts elongation) of the barley (Hordeum vulgare). 2nd objective was to evaluate sewage sludge pre-treatments at batch-scale of sludge samples from two WWTPs using anaerobic digestion, and thermal and ozonation pre......-treatments. Glyphosate and eco-labelled soil were used as references. Inhibition of germination of seeds exposed to the glyphosate and sludge was registered and thus germination was successfully applied for sludge ecotoxicity assessment, and using the root elongation as the end-point was both faster and more precise...

  17. Water mobility in the endosperm of high beta-glucan barley mutants as studied by nuclear magnetic resonance imaging

    DEFF Research Database (Denmark)

    Seefeldt, Helene Fast; van den Berg, Frans W.J.; Köckenberger, Walter

    2007-01-01

    1H NMR imaging (MRI) was used as a noninvasive technique to study water distribution and mobility in hydrated barley (Hordeum vulgare L.) seeds of accessions with varying content of beta glucan (BG), a highly hygroscopic cell wall component. High contents of BG in barley are unfavorable in malting...... where it leads to clotting of filters and hazing of beer as well as in animal feed where it hinders the rapid uptake of energy. However, a high content of BG has a positive nutritional effect, as it lowers the cholesterol and the glycaemic index. It was studied whether water distribution and mobility...... were related to content and location of BG. Water mobility was investigated by following the rate and mode of desiccation in hydrated single seeds. In order to determine the different water components, a multispin echo experiment was set up to reveal the T2 transverse relaxation rates of water within...

  18. Action de I'AlA sur la teneur en azote total et protéinique des graines de céréales cultivées à different niveau de la capacité capillaire en eau

    Directory of Open Access Journals (Sweden)

    Wiesław Nowakowski

    2015-06-01

    Full Text Available L'action de I'AIA sur la teneur en azote total et en azote protéinique des graines du Triticum vulgare, d'Hordeum vulgare et d'Avena sativa cultivés a 30%, 60% et 90% de la capacité capillaire en eau du sable a tété étudiée au cours de trois ans (1969, 1970, 1971. La teneur en g-protéines totales liée au rendement des graines de céréales examinees a été plus élevée dans les conditions de sécheresse (30% de la capacite capillaire en eau à la suite d'un traitement auxinique. La teneur (% en azote total et proteinique ne semble pas etre tellement modifiee dans les graines de cereales à la suite d'un traitement auxinique.

  19. Enhanced quantitative resistance against fungal disease by combinatorial expression of different barley antifungal proteins in transgenic tobacco

    DEFF Research Database (Denmark)

    Jach, G; Görnhardt, B; Mundy, J

    1995-01-01

    cDNAs encoding three proteins from barley (Hordeum vulgare), a class-II chitinase (CHI), a class-II beta-1,3-glucanase (GLU) and a Type-I ribosome-inactivating protein (RIP) were expressed in tobacco plants under the control of the CaMV 35S-promoter. High-level expression of the transferred genes...... was detected in the transgenic plants by Northern and Western blot analysis. The leader peptides in CHI and GLU led to accumulation of these proteins in the intercellular space of tobacco leaves. RIP, which is naturally deposited in the cytosol of barley endosperm cells, was expressed either in its original...... cytosolic form or fused to a plant secretion peptide (spRIP). Fungal infection assays revealed that expression of the individual genes in each case resulted in an increased protection against the soilborne fungal pathogen Rhizoctonia solani, which infects a range of plant species including tobacco...

  20. The Perennial Ryegrass GenomeZipper – Targeted Use of Genome Resources for Comparative Grass Genomics

    DEFF Research Database (Denmark)

    Pfeiffer, Matthias; Martis, Mihaela; Asp, Torben

    2013-01-01

    (Lolium perenne) genome on the basis of conserved synteny to barley (Hordeum vulgare) and the model grass genome Brachypodium (Brachypodium distachyon) as well as rice (Oryza sativa) and sorghum (Sorghum bicolor). A transcriptome-based genetic linkage map of perennial ryegrass served as a scaffold......Whole-genome sequences established for model and major crop species constitute a key resource for advanced genomic research. For outbreeding forage and turf grass species like ryegrasses (Lolium spp.), such resources have yet to be developed. Here, we present a model of the perennial ryegrass...... to establish the chromosomal arrangement of syntenic genes from model grass species. This scaffold revealed a high degree of synteny and macrocollinearity and was then utilized to anchor a collection of perennial ryegrass genes in silico to their predicted genome positions. This resulted in the unambiguous...

  1. Density and relative frequency effects on competitive interactions and resource use in pea–barley intercrops

    DEFF Research Database (Denmark)

    Hauggaard-Nielsen, H.; Andersen, H.K.; Jørnsgaard, B.

    2006-01-01

    or specific grain yield composition are wanted. Keywords: Competition dynamics; Grain quality; Hordeum vulgare; Intercropping; Nitrogen use; Organic farming; Pisum sativum; Weeds; Yield Abbreviations: IC, mixed intercropping; LER, land equivalent ratio; N, nitrogen; REIc, relative efficiency index; SC, sole...... not increase its reliance on atmospheric nitrogen fixation compared to the pea sole crop. With respect to soil nitrogen uptake there were no effect of plant density but a strong effect of the relative frequency of pea in the intercrop, the greater the proportion the lower the uptake. Changes in the competitive...... and tillering ability of barley are seen as likely explanations of lower weed load in the barley dominated crop treatments. This study points at the potential of employing density and relative crop frequency as "regulators" when specific intercrop objectives such as increased competitiveness towards weeds...

  2. The Localization of Eceriferum Loci in Barley

    DEFF Research Database (Denmark)

    Søgaard, Bodil

    1974-01-01

    Three different 3-point tests have been made for gene distances on chromosome 1 in barley (Hordeum vulgare L.). In all cases eceriferum, cer-f9, and albina, ac2, were examined with erectoides as the third gene. The erectoides, ert, genes are ert-a23, ert-d33 and ert-m40, respectively. The analyses...... have been carried through to F3. The experiments demonstrated the following sequence of the five genes: cer-f9 — ac2 — ert-d33 — ert-a23 — ert-m40 and the following distances: cer-f9 — ac2 = 2.3 %, ac2 — ert-a23 = 8.5 %, ac2 — ert-d33 = 2.5 % and ac2 — ert-m40 = 12.8 %. The cer-f9 — ac2 distance, which...

  3. In silico characterization of boron transporter (BOR1 protein sequences in Poaceae species

    Directory of Open Access Journals (Sweden)

    Ertuğrul Filiz

    2013-01-01

    Full Text Available Boron (B is essential for the plant growth and development, and its primary function is connected with formation of the cell wall. Moreover, boron toxicity is a shared problem in semiarid and arid regions. In this study, boron transporter protein (BOR1 sequences from some Poaceae species (Hordeum vulgare subsp. vulgare, Zea mays, Brachypodium distachyon, Oryza sativa subsp. japonica, Oryza sativa subsp. indica, Sorghum bicolor, Triticum aestivum were evaluated by bioinformatics tools. Physicochemical analyses revealed that most of BOR1 proteins were basic character and had generally aliphatic amino acids. Analysis of the domains showed that transmembrane domains were identified constantly and three motifs were detected with 50 amino acids length. Also, the motif SPNPWEPGSYDHWTVAKDMFNVPPAYIFGAFIPATMVAGLYYFDHSVASQ was found most frequently with 25 repeats. The phylogenetic tree showed divergence into two main clusters. B. distachyon species were clustered separately. Finally, this study contributes to the new BOR1 protein characterization in grasses and create scientific base for in silico analysis in future.

  4. Purification, enzymatic characterization, and nucleotide sequence of a high-isoelectric-point alpha-glucosidase from barley malt

    DEFF Research Database (Denmark)

    Frandsen, T P; Lok, F; Mirgorodskaya, E

    2000-01-01

    in the transition state complex. Mass spectrometry of tryptic fragments assigned the 92-kD protein to a barley cDNA (GenBank accession no. U22450) that appears to encode an alpha-glucosidase. A corresponding sequence (HvAgl97; GenBank accession no. AF118226) was isolated from a genomic phage library using a c......High-isoelectric-point (pI) alpha-glucosidase was purified 7, 300-fold from an extract of barley (Hordeum vulgare) malt by ammonium sulfate fractionation, ion-exchange, and butyl-Sepharose chromatography. The enzyme had high activity toward maltose (k(cat) = 25 s(-1)), with an optimum at pH 4...

  5. MILDEW LOCUS O Mutation Does Not Affect Resistance to Grain Infections with Fusarium spp. and Ramularia collo-cygni.

    Science.gov (United States)

    Hofer, Katharina; Linkmeyer, Andrea; Textor, Katharina; Hückelhoven, Ralph; Hess, Michael

    2015-09-01

    MILDEW LOCUS O defines a major susceptibility gene for powdery mildew, and recessive mlo resistance alleles are widely used in breeding for powdery mildew resistance in spring barley. Barley powdery mildew resistance, which is conferred by mlo genes, is considered to be costly in terms of spontaneous defense reactions and enhanced susceptibility to cell-death-inducing pathogens. We assessed fungal infestation of barley (Hordeum vulgare) grain by measuring fungal DNA after natural infection with Fusarium spp. and Ramularia collo-cygni or after inoculation with Fusarium spp. in the field. Powdery-mildew-resistant mlo5 genotypes did not show enhanced Fusarium spp. or R. collo-cygni DNA content of grain over four consecutive years. Data add to our understanding of pleiotropic effects of mlo-mediated powdery mildew resistance and contributes to the discussion of whether or not application of barley mlo mutations may support pathogenesis of cell-death-inducing fungal pathogens under field conditions.

  6. Tracer study on sulphur use efficiency in potato-barley sequence on acid soil of Shimla

    International Nuclear Information System (INIS)

    Sud, K.C.; Sharma, R.C.; Sharma, N.K.

    1999-01-01

    Controlled studies were conducted on acidic soil of Fagu (Shimla) to study the efficiency of labelled ammonium sulphate as effected by farmyard manure (FYM) on potato (Solanum tuberosum L.) and its residual effect on succeeding barley (Hordeum vulgare L.). The direct and residual effects of FYM and sulphur on dry matter yield and S concentration in potato and barley plants were significant. Applied FYM had a positive effect on radioassay values i.e. % Sdff and % S utilization by potato from labelled S carrier, whereas, the residual effect of applied S on barley was more than its direct effect on potato. Results indicate that combined application of S and FYM resulted in 3.4 per cent more S contribution to barley crop and was reflected in % S utilization values. (author)

  7. Characterization of N-type glycosylation sites and glycan structures of Purple Acid Phosphatase Phytases from Wheat (Triticum aestivum L.)

    DEFF Research Database (Denmark)

    Dionisio, Giuseppe; Brinch-Pedersen, Henrik; Welinder, Karen Gjesing

    2011-01-01

    Wheat (Triticum aestivum L.) possesses preformed phytase activity in the grain that is essential to make phosphate available to cell metabolism and in food and feed (Brejnholt S. et al., 2011). Cereals contain the purple acid phosphatase type of phytases, PAPhy (Dionisio G. et al., 2011a). Mature......., Skov L. Brinch-Pedersen H. (2011). The degradation of phytate by microbial and wheat phytases is dependent on the phytate matrix and the phytase origin. J. Sci. Food Agri. (in press). Dionisio G., Madsen C.K., Holm P.B., Welinder K.G., Jørgensen M., Stoger E., Arcalis E., Brinch-Pedersen H. (2011a......) Cloning and Characterization of Purple Acid Phosphatase Phytases from Wheat (Triticum aestivum L.), Barley (Hordeum vulgare L.), Maize (Zea maize L.) and Rice (Oryza sativa L.). Plant Physiol. [in press, Jan 10, Epub ahead of print] Dionisio G., Brinch-Pedersen H., Welinder K.G., Jørgensen M. (2011b...

  8. Cloning and Characterization of Purple Acid Phosphatase Phytases from Wheat, Barley, Maize and Rice

    DEFF Research Database (Denmark)

    Dionisio, Giuseppe; Madsen, Claus Krogh; Holm, Preben Bach

    2011-01-01

    development and germination. In wheat, it was demonstrated that a and b isogene expression is driven by different promoters (approximately 31% identity). TaPAPhy_a/b promoter reporter gene expression in transgenic grains and peptide mapping of TaPAPhy purified from wheat bran and germinating grains confirmed......Barley (Hordeum vulgare) and wheat (Triticum aestivum) possess significant phytase activity in the mature grains. Maize (Zea mays) and rice (Oryza sativa) possess little or virtually no preformed phytase activity in the mature grain and depend fully on de novo synthesis during germination. Here......, it is demonstrated that wheat, barley, maize, and rice all possess purple acid phosphatase (PAP) genes that, expressed in Pichia pastoris, give fully functional phytases (PAPhys) with very similar enzyme kinetics. Preformed wheat PAPhy was localized to the protein crystalloid of the aleurone vacuole. Phylogenetic...

  9. Population Growth of Rhopalosiphum padi L. (Homoptera: Aphididae on Different Cereal Crops from the Semiarid Pampas of Argentina under Laboratory Conditions Crecimiento Poblacional de Rhopalosiphum padi L. (Homoptera: Aphididae sobre Diferentes Cereales de la Pampas Semiárida de Argentina en Condiciones de Laboratorio

    Directory of Open Access Journals (Sweden)

    Lilian R Descamps

    2011-09-01

    Full Text Available The bird cherry-oat aphid Rhopalosiphum padi L. (Homoptera: Aphididae is one of the main pests in a number of crops in the semiarid Pampas of Argentina. In the present study, the effect of different host plants, including Triticum aestivum L., ×Triticosecale Wittm., Hordeum vulgare L., Hordeum distichum L., Avena sativa L., and Secale cereale L. on biological parameters of R. padi L. was studied in the laboratory at 24 ± 1 °C, 65 ± 10% RH and a 14:10 photoperiod. Longevity, intrinsic rate of natural increase (r m, net reproductive rate (R0, mean generation time (T, doubling time (DT, and finite rate of increase (λ of the bird cherry-oat aphid on the different cereal crops were estimated. Differences in fertility life table parameters of R. padi among host plants were analyzed using pseudo-values, which were produced by Jackknife re-sampling. Results indicated that beer barley might be the most suitable food for R. padi due to greater adult longevity (20.88 d, higher fecundity (41 nymphs female-1, higher intrinsic rate of natural increase (0.309 females female-1 d-1, lower doubling time (2.24, and lower nymphal mortality (22.2%. Therefore, it can be concluded from the present study that R. padi prefers beer barley for fast and healthy development over other cereal crops.El áfido Rhopalosiphum padi L. (Homoptera: Aphididae es una de las principales plagas de numerosos cultivos de la región semiárida pampeana de Argentina. En el presente trabajo se estudió el efecto de diferentes cereales incluidos Triticum aestivum L., ×Triticosecale Wittm., Hordeum vulgare L., Hordeum distichum L., Avena sativa L. and Secale cereale L. sobre los parámetros biológicos de R. padi en laboratorio. Se estimaron longevidad, tasa intrínseca de crecimiento natural (r m, tasa neta de reproducción (R0, tiempo generacional medio (T, tiempo de duplicación (TD, y tasa finita de incremento (λ del pulgón de la avena en diferentes cereales. Las diferencias de

  10. Biochemical and Molecular Characterization of a Barley Seed ß-Glucosidase

    DEFF Research Database (Denmark)

    Leah, R.; Kigel, J.; Svendsen, I.

    1995-01-01

    blot analysis with the cDNA as probe indicated that BGQ60 is encoded by a single gene, and that BGQ60 mRNA only accumulates in the starchy endosperm tissue of late developing seeds. The bgq60 structural gene of approximately 5 kilobases contains an open reading frame encoding 485 amino acids...... during barley seed development and germination are discussed.......A 60-kDa ß-glucosidase (BGQ60) was purified and characterized from seeds of barley (Hordeum vulgare L.). BGQ60 catalytic activity was restricted to the cleavage of short-chain oligosaccharides composed of(1, 2) -,(1, 2, 3) -, and/or(1, 2, 3, 4) -ß-linked glucose or mannose units...

  11. Differences in the diurnal pattern of soil respiration under adjacent Miscanthus x giganteus and barley crops reveal potential flaws in accepted sampling strategies

    Science.gov (United States)

    Keane, James; Ineson, Phil

    2017-04-01

    Soil respiration (Rs) plays an important role in the global carbon cycle and contributes ca. 30% of global ecosystem respiration.However, for convenience, measurements used to compare Rs from different land uses, crops or management practices are often made between 09:00 and 16:00, with an implicit assumption that Rs is largely controlled by temperature. Three months' continuous data presented here show distinctly different diurnal patterns of Rs between barley (Hordeum vulgare) and Miscanthus x giganteus (Miscanthus) grown on adjacent fields. Maximum Rs in barley occurred during the afternoon and correlated with soil temperature, whereas Rs peaked in Miscanthus during the night and was significantly correlated with earlier levels of solar radiation, probably due to delays in translocation of recent photosynthate. Since daily mean Rs in Miscanthus coincided with levels 40% greater than the mean in barley, it is vital to select appropriate times to measure Rs if only single daily measurements are to be made.

  12. Micro-PIXE evaluation of Fe distribution in barley roots

    International Nuclear Information System (INIS)

    Schneider, T.; Povh, B.; Strasser, O.; Gierth, M.; Przybylowicz, W.; Mesjasz-Przybylowicz, J.; Churms, C.; Schuessler, A.

    1999-01-01

    High Fe concentrations were reported from roots of plants grown in soil. This has been discussed as a possible Fe source for plants, since the concentrations shown in the roots were much higher than in the shoots. There are, however, also some indications that soil contamination at the root surface of soil grown plants could have led to an overestimation of the Fe concentration in roots. Fe distribution in root cross sections of barley (Hordeum vulgare L. cv. Alexis) has been studied to investigate this hypothesis. Micro-PIXE analyses in point and mapping mode were complemented by the STIM technique. Based on the correlation between Fe and soil-related elements (Ti, Al and Si), most of Fe located at the root surface could be attributed to soil contamination. It could also be shown that this soil contamination leads to an overestimation of Fe concentration in roots. (author)

  13. Intercropping effect on root growth and nitrogen uptake at different nitrogen levels

    DEFF Research Database (Denmark)

    Ramirez-Garcia, Javier; Martens, Helle Juel; Quemada, Miguel

    2015-01-01

    of root growth and N foraging for barley (Hordeum vulgare L.) and vetch (Vicia sativa L.), frequently grown in mixtures as cover crops. N was added at 0 (N0), 50 (N1) and 150 (N2) kg N ha−1. The roots discrimination relying on the anatomical and morphological differences observed between dicots......Aims Intercropping legumes and non-legumes may affect the root growth of both components in the mixture, and the non-legume is known to be strongly favored by increasing nitrogen (N) supply. The knowledge of how root systems affect the growth of the individual species is useful for understanding...... the interactions in intercrops as well as for planning cover cropping strategies. The aim of this work was (i) to determine if different levels of N in the topsoil influence root depth (RD) and intensity of barley and vetch as sole crops or as an intercropped mixture and (ii) to test if the choice of a mixture...

  14. Characteristics of injury and recovery of net NO3- transport of barley seedlings from treatments of NaCl

    Science.gov (United States)

    Klobus, G.; Ward, M. R.; Huffaker, R. C.

    1988-01-01

    The nature of the injury and recovery of nitrate uptake (net uptake) from NaCl stress in young barley (Hordeum vulgare L, var CM 72) seedlings was investigated. Nitrate uptake was inhibited rapidly by NaCl, within 1 minute after exposure to 200 millimolar NaCl. The duration of exposure to saline conditions determined the time of recovery of NO3- uptake from NaCl stress. Recovery was dependent on the presence of NO3- and was inhibited by cycloheximide, 6-methylpurine, and cerulenin, respective inhibitors of protein, RNA, and sterol/fatty acid synthesis. These inhibitors also prevented the induction of the NO3- uptake system in uninduced seedlings. Uninduced seedlings exhibited endogenous NO3- transport activity that appeared to be constitutive. This constitutive activity was also inhibited by NaCl. Recovery of constitutive NO3- uptake did not require the presence of NO3-.

  15. Rhizodeposition of N by pea and barley and its effect on soil N dynamics

    DEFF Research Database (Denmark)

    Jensen, E.S.

    1996-01-01

    Rhizodeposition of N during plant growth influences the microbial activity in the rhizosphere and constitutes a source of labile organic N, but has not been quantified to the same degree as the rhizodeposition of C. The rhizodeposition of N, defined as root-derived N present in the soil after...... removal of visible roots and root fragments, was determined during field pea (Pisum sativum L.) and spring barley (Hordeum vulgare L.) growth in a sandy soil at a low concentration of mineral N using a continuous split-root N-15-labelling technique. The N rhizodeposition constituted 15 and 48......% of the below-ground N in pea when determined 7 and 14 (maturity) wk after planting (WAP), respectively. In barley 32 and 71% of the below-ground N were present in rhizodeposits at the two samplings. At maturity the rhizodeposition of N amounted to 19 mg N plant(-1) (7% of total plant N) for pea and 17 mg N...

  16. Comparison of metal toxic impacts between aquatic and terrestrial organisms: is the free ion concentration a sufficient descriptor?

    DEFF Research Database (Denmark)

    Owsianiak, Mikolaj; Rosenbaum, Ralph K.; Larsen, Henrik Fred

    2011-01-01

    Characterization of metal toxic impacts in comparative risk assessment and life cycle impact assessment (LCIA) should take into account metal speciation and interactions with soil/water organic constituents, because these mechanisms control metal bioavailability and may influence their toxic...... that the free metal ion is an appropriate “general”descriptor of metal toxicity. Results for 128 laboratory tests on Daphnia magna exposed to copper ions (Cu2+) in water show that variation of several orders of magnitude are observed between the toxicity tests. These variations may be a result of the inability...... of magnitude difference occur for the extreme case of barley (Hordeum vulgare). Given the scarcity of terrestrial effect data compared to aquatic data, reliable and transparent, mechanistic-based predictions of terrestrial toxic impacts from aquatic effect data would be an important step ahead in the context...

  17. Study of the biochemical effects of ionizing and nonionizing radiation on plant metabolism during development. Progress report, September 1, 1976--November 30, 1977

    International Nuclear Information System (INIS)

    Klein, W.H.

    1977-01-01

    Studies on spectral distribution and its control of plant growth and development included spectral quality measurements and biological responses. Spectral quality measurements consisted of spectral monitoring, the erythmal band, and testing of solar collectors. A physiological system for determining biological response was the photoperiodic response to the induction of flowering by long days in Hordeum vulgare; the design of the system was intended to test whether or not changes in the spectral distribution of natural daylight are capable of controlling photoperiodism. Biological responses were also determined by phytochrome measurements. Photostationary states of phytochrome were determined from white light grown tissue and the effect of changes in the red to far-red ratio on phytochrome was assessed. Experimental results are reported for studies on effects of pulsed light on plant productivity

  18. Are plant endogenous factors like ethylene modulators of the early oxidative stress induced by mercury?

    Directory of Open Access Journals (Sweden)

    M Belén eMontero-Palmero

    2014-08-01

    Full Text Available The induction of oxidative stress is one of the quickest symptoms appearing in plants subjected to metal stress. A transcriptional analysis of the early responses of alfalfa (Medicago sativa seedlings to mercury (Hg; 3 µM for 3, 6 and 24 h showed that up-regulation of genes responding to ethylene were up-regulated, a phytohormone known to mediate in the cellular redox homeostasis. In this mini-review we have compared these quick responses with two other concurrent transcriptomic analysis in Barrel medic (Medicago truncatula and barley (Hordeum vulgare under Hg stress. Besides ethylene, ABA and jasmonate related genes were up-regulated, all of them are endogenous factors known to intervene in oxidative stress responses. The information obtained may target future work to understand the cellular mechanisms triggered by Hg, enabling biotechnological approaches to diminish Hg-induced phytotoxicity.

  19. Occurrence of barley leaf disease and control strategies in Denmark

    DEFF Research Database (Denmark)

    Jørgensen, Lise Nistrup; Ørum, Jens Erik; Heick, Thies Marten

    Barley (Hordeum vulgare) is one of the major crops in Denmark and of special importance for malting and for pig feed. In 2016, the crop was grown covering a total area of 700,000 ha; approximately 25% of arable area in Denmark. To ensure high yield of around 60 dt ha-1, disease-tolerant cultivars...... have proven to be quite effective against all leaf diseases, aside from brown rust and mildew. Denmark has a national record system for pesticide usages. All farmers upload their fungicide use by crop, creating a good basis for assessing the differences in use pattern across different regions...... and fungicide treatments are required. Each year, barley cultivars are assessed for susceptibility towards leaf diseases in national observation plots. The most predominant fungal leaf diseases in Denmark are barley scald (Rhynchosporium secalis), net blotch (Pyrenophora teres), brown rust (Puccinia hordei...

  20. Genetic diversity among wild and cultivated barley as revealed by RFLP

    DEFF Research Database (Denmark)

    Petersen, L.; Østergård, H.; Giese, H.

    1994-01-01

    Genetic variability of cultivated and wild barley, Hordeum vulgare ssp. vulgare and spontaneum, respectively, was assessed by RFLP analysis. The material consisted of 13 European varietes, single-plant offspring lines of eight land races from Ethiopia and Nepal, and five accessions of ssp. sponta...... an intermediate level. The proportion of gene diversity residing among,geographical groups (F-ST) varied from 0.19 to 0.94 (average 0.54) per RFLP pattern, indicating large diversification between geographical groups....... was estimated and the barley lines clustered into five groups reflecting geographical origin. The geographical groups of land-race lines showed less intragroup variation than the geographical groups of spontaneum lines. The group of European varieties, representing large variation in agronomic traits, showed...

  1. Nitrogen immobilization and mineralization during initial decomposition of 15N-labelled pea and barley residues

    DEFF Research Database (Denmark)

    Jensen, E.S.

    1997-01-01

    The immobilization and mineralization of N following plant residue incorporation were studied in a sandy loam soil using N-15-labelled field pea (Pisum sativum L.) and spring barley (Hordeum vulgare L.) straw. Both crop residues caused a net immobilization of soil-derived inorganic N during...... the complete incubation period of 84 days. The maximum rate of N immobilization was found to 12 and 18 mg soil-derived N g(-1) added C after incorporation of pea and barley residues, respectively. After 7 days of incubation, 21% of the pea and 17% of the barley residue N were assimilated by the soil microbial...... the decomposition of the barley residue. The net mineralization of residue-derived N was 2% in the barley and 22% in the pea residue treatment after 84 days of incubation. The results demonstrated that even if crop residues have a relative low C/N ratio (15), transient immobilization of soil N in the microbial...

  2. The comparison of nitrogen use and leaching in sole cropped versus intercropped pea and barley

    DEFF Research Database (Denmark)

    Hauggaard-Nielsen, H.; Ambus, P.; Jensen, E.S.

    2003-01-01

    The effect of sole and intercropping of field pea (Pisum sativum L.) and spring barley (Hordeum vulgare L.) and of crop residue management on crop yield, NO3- leaching and N balance in the cropping system was tested in a 2-year lysimeter experiment on a temperate sandy loam soil. The crop rotation...... cropping. Crops received no fertilizer in the experimental period. Natural N-15 abundance techniques were used to determine pea N-2 fixation. The pea-barley intercrop yielded 4.0 Mg grain ha(-1), which was about 0.5 Mg lower than the yields of sole cropped pea but about 1.5 Mg greater than harvested...... was pea and barley sole and intercrops followed by winter-rye and a fallow period. The Land Equivalent Ratio (LER), which is defined as the relative land area under sole crops that is required to produce the yields achieved in intercropping, was used to compare intercropping performance relative to sole...

  3. Nitrogen mineralization and denitrification as influenced by crop residue particle size

    DEFF Research Database (Denmark)

    Ambus, P.; Jensen, E.S.

    1997-01-01

    1: N-15-labelled ground (less than or equal to 3 mm) and cut (25 mm) barley residue, and microcrystalline cellulose+glucose were mixed into a sandy loam soil with additional inorganic N. Experiment 2: inorganic N-15 and C2H2 were added to soils with barley and pea material after 3, 26, and 109 days......Managing the crop residue particle size has the potential to affect N conservation in agricultural systems. We investigated the influence of barley (Hordeum vulgare) and pea (Pisum sativum) crop residue particle size on N mineralization and denitrification in two laboratory experiments. Experiment...... for measuring gross N mineralization and denitrification. Net N immobilization over 60 days in Experiment 1 cumulated to 63 mg N kg(-1) soil (ground barley), 42 (cut barley), and 122 (cellulose+glucose). More N was seemingly net mineralized from ground barley (3.3 mg N kg(-1) soil) than from cut barley (2.7 mg...

  4. 210Pb and 210Po in Finnish cereals

    International Nuclear Information System (INIS)

    Turtiainen, Tuukka; Kostiainen, Eila; Hallikainen, Anja

    2011-01-01

    A survey was carried out on the activity concentrations of 210 Pb and 210 Po in cereal grains produced in Finland. The cereal species were wheat (Triticum aestivum), rye (Secale cereale), oats (Avena sativa) and barley (Hordeum vulgare), which account for 90% of the Finnish consumption of cereal products. The survey consisted of 18 flour and 13 unprocessed cereal samples and one hulled grain sample from 22 flour mills. According to the results, the mean 210 Pb/ 210 Po concentrations in wheat grains, wheat flour, rye flour, oat grains and barley grains were 0.29, 0.12, 0.29, 0.36 and 0.36 Bq kg -1 , respectively. Combined with the consumption rates of the products, we assess that the mean effective doses from 210 Pb and 210 Po in cereal products for the adult male and female population are 22 and 17 μSv per year, respectively.

  5. Establishment techniques in under-sown perennial ryegrass for seed production

    DEFF Research Database (Denmark)

    Deleuran, Lise C; Boelt, Birte

    2009-01-01

    Establishment methods have proven to be of major importance for grass-seed production. The objective of this research was to test the effect of different sowing techniques on plant establishment and the subsequent seed yield. Perennial ryegrass (Lolium perenne L.) is used as the model grass due...... to its large importance in Danish agriculture. In a three-year trial six different methods of under-sowing of perennial ryegrass in a spring barley cover crop were employed. Perennial ryegrass was either sown directly at different depths within the spring barley (Hordeum vulgare L.) rows or placed 2, 6......, or 12 cm from the spring barley rows. Results of dry-matter yield indicate that the best establishment of the grass occurred when placing the grass 6 or 12 cm from the cover-crop row, and this is of importance in less vigorous grasses. Overall, no seed-yield difference has been observed for perennial...

  6. Barley uptake of N deposited in the rhizosphere of associated field pea

    DEFF Research Database (Denmark)

    Jensen, E.S.

    1996-01-01

    N deposited in the rhizosphere of a legume may contribute to the N-nutrition of an intercropped non-legume. The process of deposition and subsequent uptake by a neighbouring plant is often termed N-transfer. The N-transfer from field pea (Pisum sativum L.) to associated spring barley (Hordeum...... debris. Separating the root systems reduced the barley recovery of pea-derived N to about half the amount recovered in the association where root systems grew in the same compartment. The death of pea, caused by spraying with a herbicide, increased the amount of N recovered in barley, whereas shading...... the pea plant had no effect on the amount of pea-derived N taken up in barley. The N deposited up to 45 days of growth contributed

  7. Functional proteomics of barley and barley chloroplasts – strategies, methods and perspectives

    DEFF Research Database (Denmark)

    Petersen, Jørgen; Rogowska-Wrzesinska, Adelina; Jensen, Ole Nørregaard

    2013-01-01

    Barley (Hordeum vulgare) is an important cereal grain that is used in a range of products for animal and human consumption. Crop yield and seed quality has been optimized during decades by plant breeding programs supported by biotechnology and molecular biology techniques. The recently completed...... whole-genome sequencing of barley revealed approximately 26,100 open reading frames, which provides a foundation for detailed molecular studies of barley by functional genomics and proteomics approaches. Such studies will provide further insights into the mechanisms of, for example, drought and stress...... tolerance, micronutrient utilization, and photosynthesis in barley. In the present review we present the current state of proteomics research for investigations of barley chloroplasts, i.e., the organelle that contain the photosynthetic apparatus in the plant. We describe several different proteomics...

  8. A laser ablation ICP-MS based method for multiplexed immunoblot analysis

    DEFF Research Database (Denmark)

    de Bang, Thomas Christian; Petersen, Jørgen; Pedas, Pai Rosager

    2015-01-01

    developed a multiplexed antibody-based assay and analysed selected PSII subunits in barley (Hordeum vulgare L.). A selection of antibodies were labelled with specific lanthanides and immunoreacted with thylakoids exposed to Mn deficiency after western blotting. Subsequently, western blot membranes were...... analysed by laser ablation inductively coupled plasma mass spectrometry (LA-ICP-MS), which allowed selective and relative quantitative analysis via the different lanthanides. The method was evaluated against established liquid chromatography electrospray ionization tandem mass spectrometry (LC...... by more than one technique. The developed method enables a higher number of proteins to be multiplexed in comparison to existing immunoassays. Furthermore, multiplexed protein analysis by LA-ICP-MS provides an analytical platform with high throughput appropriate for screening large collections of plants....

  9. Labeled Azospirillum brasilense wild type and excretion-ammonium strains in association with barley roots.

    Science.gov (United States)

    Santos, Adrian Richard Schenberger; Etto, Rafael Mazer; Furmam, Rafaela Wiegand; Freitas, Denis Leandro de; Santos, Karina Freire d'Eça Nogueira; Souza, Emanuel Maltempi de; Pedrosa, Fábio de Oliveira; Ayub, Ricardo Antônio; Steffens, Maria Berenice Reynaud; Galvão, Carolina Weigert

    2017-09-01

    Soil bacteria colonization in plants is a complex process, which involves interaction between many bacterial characters and plant responses. In this work, we labeled Azospirillum brasilense FP2 (wild type) and HM053 (excretion-ammonium) strains by insertion of the reporter gene gusA-kanamycin into the dinitrogenase reductase coding gene, nifH, and evaluated bacteria colonization in barley (Hordeum vulgare). In addition, we determined inoculation effect based on growth promotion parameters. We report an uncommon endophytic behavior of A. brasilense Sp7 derivative inside the root hair cells of barley and highlight the promising use of A. brasilense HM053 as plant growth-promoting bacterium. Copyright © 2017 Elsevier Masson SAS. All rights reserved.

  10. Allelopathic relations of selected cereal and vegetable species during seed germination and seedling growth

    Directory of Open Access Journals (Sweden)

    Bojović Biljana M.

    2015-01-01

    Full Text Available Allelopathy is the direct or indirect harmful effect which one plant produces on another through the production of chemical compounds that escape into the environment. In the presence paper allelopathic relationships were determined in three cereals - wheat (Triticum aestivum L., barley (Hordeum vulgare L., oat (Avena sativa L. and vegetable crops - spinach (Spinacia oleracea L., radish (Raphanus sativus L., pepper (Capsicum annum L.. In addition to the percentage of germination, allelopathic potential was tested measuring root and stem length of tested plant species germinated either alone or in combination with others. The obtained results showed that seed germination and plant growth of cereals and vegetables are depended on the presence of other plants in all tested combinations. In this study has proven largely inhibitory allelopathic effect on germination and plant growth.

  11. 210Pb and 210Po in Finnish cereals.

    Science.gov (United States)

    Turtiainen, Tuukka; Kostiainen, Eila; Hallikainen, Anja

    2011-05-01

    A survey was carried out on the activity concentrations of (210)Pb and (210)Po in cereal grains produced in Finland. The cereal species were wheat (Triticum aestivum), rye (Secale cereale), oats (Avena sativa) and barley (Hordeum vulgare), which account for 90% of the Finnish consumption of cereal products. The survey consisted of 18 flour and 13 unprocessed cereal samples and one hulled grain sample from 22 flour mills. According to the results, the mean (210)Pb/(210)Po concentrations in wheat grains, wheat flour, rye flour, oat grains and barley grains were 0.29, 0.12, 0.29, 0.36 and 0.36 Bq kg(-1), respectively. Combined with the consumption rates of the products, we assess that the mean effective doses from (210)Pb and (210)Po in cereal products for the adult male and female population are 22 and 17 μSv per year, respectively. Copyright © 2010 Elsevier Ltd. All rights reserved.

  12. Evidence for adaptive evolution of low-temperature stress response genes in a Pooideae grass ancestor

    DEFF Research Database (Denmark)

    Vigeland, Magnus D; Spannagl, Manuel; Asp, Torben

    2013-01-01

    Adaptation to temperate environments is common in the grass subfamily Pooideae, suggesting an ancestral origin of cold climate adaptation. Here, we investigated substitution rates of genes involved in low-temperature-induced (LTI) stress responses to test the hypothesis that adaptive molecular...... evolution of LTI pathway genes was important for Pooideae evolution. Substitution rates and signatures of positive selection were analyzed using 4330 gene trees including three warm climate-adapted species (maize (Zea mays), sorghum (Sorghum bicolor), and rice (Oryza sativa)) and five temperate Pooideae...... species (Brachypodium distachyon, wheat (Triticum aestivum), barley (Hordeum vulgare), Lolium perenne and Festuca pratensis). Nonsynonymous substitution rate differences between Pooideae and warm habitat-adapted species were elevated in LTI trees compared with all trees. Furthermore, signatures...

  13. MICROBIOLIZATION WITH TRICHODERMA SPP., COMBINED OR NOT WITH POLYMER, ON THE HEALTH, GERMINATION AND VIGOR OF BLACK OATS AND BARLEY SEEDS

    Directory of Open Access Journals (Sweden)

    E. R. Baseggio

    2017-12-01

    Full Text Available The use of bioprotectors in the coating of seeds is increasing, and these become an alternative for the use of chemical fungicides. The aim of this work was to evaluate the use of Trichoderma spp., with or without polymerization, in the control of pathogens associated with black oats (Avena strigosa and barley (Hordeum vulgare seeds of the cultivars 'Comum' (black oats and BRS Cauê (barley, 2014 crop. After asepsis and dried of the seeds, the treatments were applied, using a dose of 5 mL of Trichoderma spp. kg-1 and 10 mL of seed polymer kg-1 of seeds. Sanity tests; germination; germination and emergency rate index; length of seedling (shoot and root; and fresh and dry weight were performed. The coating of oat and barley seeds with Trichoderma spp. was efficient in the control of pathogens, as well as increased the germination and development of the seedlings for both cultures evaluated.

  14. An unusual case of grass inflorescence aspiration presenting as a chest wall tumour

    Energy Technology Data Exchange (ETDEWEB)

    Karagoez, Beguel; Koeksal, Yavuz; Varan, Ali; Bueyuekpamukcu, Muenevver [Hacettepe University, Department of Paediatric Oncology, Institute of Oncology, Ankara (Turkey); Haliloglu, Mithat [Hacettepe University, Department of Radiology, Faculty of Medicine, Ankara (Turkey); Ekinci, Saniye [Hacettepe University, Department of Paediatric Surgery, Faculty of Medicine, Ankara (Turkey)

    2006-05-15

    A 9-year-old boy was referred to the Oncology Department because of a thoracic soft-tissue mass thought to be a chest wall tumour. He had a history of grass inflorescence (Hordeum murinum) aspiration 2 weeks prior to this admission. On physical examination a tender soft-tissue mass under the right scapula and diminished breath sounds from the right lower lobe were detected. Thoracic CT confirmed soft-tissue swelling of the right posterior chest wall. There was a hypodense area within the soft-tissue mass suggesting a foreign body and also focal consolidation of the right lower lobe adjacent to the soft-tissue swelling. We report here unique CT findings of grass inflorescence aspiration before and after its migration through the airways. (orig.)

  15. An unusual case of grass inflorescence aspiration presenting as a chest wall tumour

    International Nuclear Information System (INIS)

    Karagoez, Beguel; Koeksal, Yavuz; Varan, Ali; Bueyuekpamukcu, Muenevver; Haliloglu, Mithat; Ekinci, Saniye

    2006-01-01

    A 9-year-old boy was referred to the Oncology Department because of a thoracic soft-tissue mass thought to be a chest wall tumour. He had a history of grass inflorescence (Hordeum murinum) aspiration 2 weeks prior to this admission. On physical examination a tender soft-tissue mass under the right scapula and diminished breath sounds from the right lower lobe were detected. Thoracic CT confirmed soft-tissue swelling of the right posterior chest wall. There was a hypodense area within the soft-tissue mass suggesting a foreign body and also focal consolidation of the right lower lobe adjacent to the soft-tissue swelling. We report here unique CT findings of grass inflorescence aspiration before and after its migration through the airways. (orig.)

  16. Variability in mesophyll conductance between barley genotypes, and effects on transpiration efficiency and carbon isotope discrimination.

    Science.gov (United States)

    Barbour, Margaret M; Warren, Charles R; Farquhar, Graham D; Forrester, Guy; Brown, Hamish

    2010-07-01

    Leaf internal, or mesophyll, conductance to CO(2) (g(m)) is a significant and variable limitation of photosynthesis that also affects leaf transpiration efficiency (TE). Genotypic variation in g(m) and the effect of g(m) on TE were assessed in six barley genotypes (four Hordeum vulgare and two H. bulbosum). Significant variation in g(m) was found between genotypes, and was correlated with photosynthetic rate. The genotype with the highest g(m) also had the highest TE and the lowest carbon isotope discrimination as recorded in leaf tissue (Delta(p)). These results suggest g(m) has unexplored potential to provide TE improvement within crop breeding programmes.

  17. Quantitative Trait Loci and Inter-Organ Partitioning for Essential Metal and Toxic Analogue Accumulation in Barley.

    Directory of Open Access Journals (Sweden)

    Stefan Reuscher

    Full Text Available The concentrations of both essential nutrients and chemically similar toxic analogues accumulated in cereal grains have a major impact on the nutritional quality and safety of crops. Naturally occurring genetic diversity can be exploited for the breeding of improved varieties through introgression lines (ILs. In this study, multi-element analysis was conducted on vegetative leaves, senesced flag leaves and mature grains of a set of 54 ILs of the wild ancestral Hordeum vulgare ssp. spontaneum in the cultivated variety Hordeum vulgare ssp. vulgare cv. Scarlett. Plants were cultivated on an anthropogenically heavy metal-contaminated soil collected in an agricultural field, thus allowing simultaneous localization of quantitative trait loci (QTL for the accumulation of both essential nutrients and toxic trace elements in barley as a model cereal crop. For accumulation of the micronutrients Fe and Zn and the interfering toxin Cd, we identified 25, 16 and 5 QTL, respectively. By examining the gene content of the introgressions, we associated QTL with candidate genes based on homology to known metal homeostasis genes of Arabidopsis and rice. Global comparative analyses suggested the preferential remobilization of Cu and Fe, over Cd, from the flag leaf to developing grains. Our data identifies grain micronutrient filling as a regulated and nutrient-specific process, which operates differently from vegetative micronutrient homoeostasis. In summary, this study provides novel QTL for micronutrient accumulation in the presence of toxic analogues and supports a higher degree of metal specificity of trace element partitioning during grain filling in barley than previously reported for other cereals.

  18. Free proline accumulation in leaves of cultivated plant species under water deficit conditions

    Directory of Open Access Journals (Sweden)

    Hanna Bandurska

    2013-12-01

    Full Text Available The effect of water deficit caused by soil drought on the content of free proline as well as the degree of cell membrane damages in the leaves of three cultivated plant species having different farm usefulness and water requirements have been studied. The used pIants were: poinsettia (Euphorbia pulcherrima Willd., 'Regina' and 'Cortez' grown for decorative purposes, a green vegetable of broccoli (Brassica oleracea var. botrytis, subvar. cymosa, 'Colonel' and 'Marathon' and a cereal plant of barley (the wild form Hordeum spontaneumm and Hordeum vulgaree 'Maresi'. The examined species differed in the size of the experienced stress. the Iargest RWC reduction was found iii broccoli leaves, while somewhat smaller - in barley. In poinsettia leaves, the reduction of RWC level was not large or did not occur at all. The accumulation of free proline in the species under study was also variable. The largest amount of this amino acid tended to accumulate in broccoli leaves, whereas the increase of its level took place only at a strong dehydration of tissues. The increase of proline level was smaller in barley leaves than in broccoli, but that was found already at a smalI dehydration of tissues. In poinsettia leaves, a several f`old increase of proline level was found at the early stage of the stress. The level of that amino acid gradually increased at consecutive times and did not depend on tissue dehydration. Damage of cell membranes amounted to 8.5-9.5% in barley leaves, about 3% in brocolli and to 0-2.6% in poinsettia. The role of proline in prevention of leaf dehydration and in alleviation of dehydration effects in the studied species has been discussed.

  19. The role of plants in the economy of Tell Arbid, north-east Syria, in the Post-Akkadian Period and Middle Bronze Age

    Directory of Open Access Journals (Sweden)

    Wasylikowa Krystyna

    2013-12-01

    Full Text Available Archaeological fieldwork carried out at the Tell Arbid site in north-eastern Syria exposed settlement remains dating from the early 3rd millennium BC to the mid 2nd millennium BC. Recent excavations in Sector P, on the eastern slope of the site, revealed the existence of a significant occupation of the Post-Akkadian/ Early Jazirah V period and of levels dated to the Early and Classic Khabur Ware/Old Jazirah/Middle Bronze Age I-II periods. Cereal remains were dominated by grains and ear fragments of hulled two-rowed barley Hordeum distichon. Less numerous were wheats represented by emmer Triticum dicoccon, einkorn T. monococcum, and macaroni wheat T. durum. The presence of bread wheat T. aestivum and six-rowed barley Hordeum vulgare could not be excluded. The two periods contained similar sets of cereals, but in the Post-Akkadian Period the percentage of hulled wheat remains was higher, while in the Middle Bronze Age (particularly in its younger phase naked wheat slightly exceeded hulled wheats. Legumes were represented by only very few seeds of lentil Lens culinaris and bitter vetch Vicia ervilia. Diaspores of wild plants were very abundant, particularly those from the families of grasses and legumes. The considerable number of ear and culm fragments probably belonging to cereals as well as numerous seeds/fruits of wild plants suggests that the plant remains originated from fodder or animal dung or belonged to threshing waste. The presence of grass stems with nodes indicated that cereals were reaped low on the straw; occasional use of uprooting was suggested by the occurrence of basal culm fragments with traces of rootlets.

  20. The family of DOF transcription factors in Brachypodium distachyon: phylogenetic comparison with rice and barley DOFs and expression profiling

    Directory of Open Access Journals (Sweden)

    Hernando-Amado Sara

    2012-11-01

    Full Text Available Abstract Background Transcription factors (TFs are proteins that have played a central role both in evolution and in domestication, and are major regulators of development in living organisms. Plant genome sequences reveal that approximately 7% of all genes encode putative TFs. The DOF (DNA binding with One Finger TF family has been associated with vital processes exclusive to higher plants and to their close ancestors (algae, mosses and ferns. These are seed maturation and germination, light-mediated regulation, phytohormone and plant responses to biotic and abiotic stresses, etc. In Hordeum vulgare and Oryza sativa, 26 and 30 different Dof genes, respectively, have been annotated. Brachypodium distachyon has been the first Pooideae grass to be sequenced and, due to its genomic, morphological and physiological characteristics, has emerged as the model system for temperate cereals, such as wheat and barley. Results Through searches in the B. distachyon genome, 27 Dof genes have been identified and a phylogenetic comparison with the Oryza sativa and the Hordeum vulgare DOFs has been performed. To explore the evolutionary relationship among these DOF proteins, a combined phylogenetic tree has been constructed with the Brachypodium DOFs and those from rice and barley. This phylogenetic analysis has classified the DOF proteins into four Major Cluster of Orthologous Groups (MCOGs. Using RT-qPCR analysis the expression profiles of the annotated BdDof genes across four organs (leaves, roots, spikes and seeds has been investigated. These results have led to a classification of the BdDof genes into two groups, according to their expression levels. The genes highly or preferentially expressed in seeds have been subjected to a more detailed expression analysis (maturation, dry stage and germination. Conclusions Comparison of the expression profiles of the Brachypodium Dof genes with the published functions of closely related DOF sequences from the cereal

  1. Single and combined toxicity of copper and cadmium to H. vulgare growth and heavy metal bioaccumulation

    Directory of Open Access Journals (Sweden)

    Žaltauskaitė J.

    2013-04-01

    Full Text Available The single and combined effects of copper (Cu and cadmium (Cd (0.1-10 mg L−1 in spring barley (Hordeum vulgare L. plants grown in hydroponics are investigated. The aim of the study was to investigate the interactive effect of the binary mixture of Cu and Cd to the growth of H. vulgare and accumulation of these metals by the plants. Single and combined metal treatment led to major effects in the growth of roots and shoots and dry weight of barley. Exposure to metals altered the content of photosynthetic pigments and caused lipid peroxidation. It was observed that combined effects of heavy metals to plants are endpoint and concentration depending. The binary mixture Cu+Cd exhibited additive or less than additive interaction for dry weight, root length and shoot height. Analysis of tissue metal concentrations showed that Cu and Cd were mainly accumulated in the roots and the combination of Cu+Cd had less than additive response of metal bioaccumulation in the leaves and roots.

  2. Integrating Biological Perspectives:. a Quantum Leap for Microarray Expression Analysis

    Science.gov (United States)

    Wanke, Dierk; Kilian, Joachim; Bloss, Ulrich; Mangelsen, Elke; Supper, Jochen; Harter, Klaus; Berendzen, Kenneth W.

    2009-02-01

    Biologists and bioinformatic scientists cope with the analysis of transcript abundance and the extraction of meaningful information from microarray expression data. By exploiting biological information accessible in public databases, we try to extend our current knowledge over the plant model organism Arabidopsis thaliana. Here, we give two examples of increasing the quality of information gained from large scale expression experiments by the integration of microarray-unrelated biological information: First, we utilize Arabidopsis microarray data to demonstrate that expression profiles are usually conserved between orthologous genes of different organisms. In an initial step of the analysis, orthology has to be inferred unambiguously, which then allows comparison of expression profiles between orthologs. We make use of the publicly available microarray expression data of Arabidopsis and barley, Hordeum vulgare. We found a generally positive correlation in expression trajectories between true orthologs although both organisms are only distantly related in evolutionary time scale. Second, extracting clusters of co-regulated genes implies similarities in transcriptional regulation via similar cis-regulatory elements (CREs). Vice versa approaches, where co-regulated gene clusters are found by investigating on CREs were not successful in general. Nonetheless, in some cases the presence of CREs in a defined position, orientation or CRE-combinations is positively correlated with co-regulated gene clusters. Here, we make use of genes involved in the phenylpropanoid biosynthetic pathway, to give one positive example for this approach.

  3. Green manuring effect of pure and mixed barley - hairy vetch winter cover crops on maize and processing tomato N nutrition

    DEFF Research Database (Denmark)

    Tosti, Giacomo; Benincasa, Paolo; Farneselli, Michela

    2012-01-01

    this can influence the N uptake and N status of different subsequent summer cash crops. In this study the N effect of barley (Hordeum vulgare L.) and hairy vetch (Vicia villosa Roth.) grown in pure stands or in mixtures with different sowing proportion was tested on maize (Zea Mays L.) and processing......Adopting mixtures between legumes and non legumes can be an efficient tool to merge the advantages of the single species in the fall-sown cover crop practice. Nevertheless there is a lack of information on how the species proportion may affect N accumulation and C/N of the cover crops and how...... of the relationship between cover crop C/N and Neff was confirmed, so mixtures can be used to adjust the extent and timing of mineralisation of the incorporated biomass to the subsequent cash crop requirements. Prediction of the cash crops N status on the cover crop C/N appears to be a useful approach, but, it may...

  4. Molecular identification based on coat protein sequences of the Barley yellow dwarf virus from Brazil

    Directory of Open Access Journals (Sweden)

    Talita Bernardon Mar

    2013-12-01

    Full Text Available Yellow dwarf disease, one of the most important diseases of cereal crops worldwide, is caused by virus species belonging to the Luteoviridae family. Forty-two virus isolates obtained from oat (Avena sativa L., wheat (Triticum aestivum L., barley (Hordeum vulgare L., corn (Zea mays L., and ryegrass (Lolium multiflorum Lam. collected between 2007 and 2008 from winter cereal crop regions in southern Brazil were screened by polymerase chain reaction (PCR with primers designed on ORF 3 (coat protein - CP for the presence of Barley yellow dwarf virus and Cereal yellow dwarf virus (B/CYDV. PCR products of expected size (~357 bp for subgroup II and (~831 bp for subgroup I were obtained for three and 39 samples, respectively. These products were cloned and sequenced. The subgroup II 3' partial CP amino acid deduced sequences were identified as BYDV-RMV (92 - 93 % of identity with "Illinois" Z14123 isolate. The complete CP amino acid deduced sequences of subgroup I isolates were confirmed as BYDV-PAV (94 - 99 % of identity and established a very homogeneous group (identity higher than 99 %. These results support the prevalence of BYDV-PAV in southern Brazil as previously diagnosed by Enzyme-Linked Immunosorbent Assay (ELISA and suggest that this population is very homogeneous. To our knowledge, this is the first report of BYDV-RMV in Brazil and the first genetic diversity study on B/CYDV in South America.

  5. Ruminal pH and temperature, papilla characteristics, and animal performance of fattening calves fed concentrate or maize silage-based diets

    Directory of Open Access Journals (Sweden)

    Raúl Bodas

    2014-09-01

    Full Text Available Feeding systems can play an important role, not only in beef farm profitability but also in animal health and performance. Fourteen Avilena-Negra Iberica bulls, with an initial weight of 270 kg (SE 22.6 kg and aged 223 d (SE 16.2 were used to study the effect of two feeding systems on ruminal pH and temperature and animal performance when calves were kept in loose housing conditions. Feeding systems were barley (Hordeum vulgare L. grain-based concentrate plus barley straw (CONC and maize (Zea mays L. silage-based total mixed ration (TMR. Internal wireless boluses were used to collect pH and temperature values every 10 min throughout the measurement period (15 d. Diet did not modify (P > 0.10 average daily gain, carcass weight, dressing percentage, ruminal mucosa color, or papilla counts. Papilla width and papilla width/lamina propria thickness were significantly lower (P 0.10. Although animal performance is not affected, feeding fattening calves on a concentrate plus barley straw diet can result in better rumen conditions than using maize silage-based TMR.

  6. Anti-methicillin-resistant Staphylococcus aureus (MRSA) activity of Rubiaceae, Fabaceae and Poaceae plants: A search for new sources of useful alternative antibacterials against MRSA infections.

    Science.gov (United States)

    Sharifi-Rad, M; Iriti, M; Sharifi-Rad, M; Gibbons, S; Sharifi-Rad, J

    2016-08-29

    In this study, we evaluated the effects of the extracts of the leaves of species from the Rubiaceae (Galium aparine L. and Asperula arvensis L.), Fabaceae (Lathyrus aphaca L. and Vicia narbonensis L.) and Poaceae (Digitaria sanguinalis (L.) Scop. and Hordeum murinum L.) plant families on a wide and extensive panel of isolated methicillin-resistant Staphylococcus aureus strains (MRSA). The effects of the methanolic leaf extracts of Rubiaceae, Fabaceae and Poaceae plants on MRSA were evaluated by the disc diffusion assay and the broth dilution method. Among a total of 177 S. aureus isolates, 92 (51.97%) were found to be methicillin-resistant in an antibiogram and this was confirmed by the presence of the mecA gene in polymerase chain reaction method. All MRSA isolates were sensitive to all extracts. There were dose-dependent inhibitions on tested microorganisms for all plant extracts which showed maximum inhibition zones at a concentration of 300 mg/L. L. aphaca, G. aparine and H. murinum exhibited the highest antibacterial activity on the MRSA strains compared to the positive control (P Fabaceae), G. aparine (Rubiaceae), and H. murinum (Poaceae) proved to have high antibacterial activity on MRSA isolates, thus representing promising antimicrobial agents in clinical settings.

  7. Possible evidence for transport of an iron cyanide complex by plants

    International Nuclear Information System (INIS)

    Samiotakis, M.; Ebbs, S.D.

    2004-01-01

    Barley (Hordeum vulgare L.), oat (Avena sativa L.), and wild cane (Sorghum bicolor L.), were exposed to 15 N-labeled ferrocyanide to determine whether these plant species can transport this iron cyanide complex. Plants were treated with ferrocyanide in a nutrient solution that simulated iron cyanide contaminated groundwater and soil solutions. This nutrient solution has been shown to maintain ferrocyanide speciation with minimal dissociation to free cyanide. Following treatment, all three plants showed dramatic enrichments in roots (δ 15 N%o=1000-1500) and shoots (δ 15 N%o=500). Barley and oat showed enrichment primarily in roots while wild cane showed a near equal enrichment in root and shoot tissues. Nitrogen-deficient barley plants treated with ferrocyanide showed a significantly greater 15 N enrichment as compared to nitrogen-sufficient plants. While the results are suggestive of ferrocyanide transport by these plant species, additional study will be required to verify these results. - Results suggest ferrocyanide transport by barley, oat and wild cane

  8. Prediction of malting quality traits in barley based on genome-wide marker data to assess the potential of genomic selection.

    Science.gov (United States)

    Schmidt, Malthe; Kollers, Sonja; Maasberg-Prelle, Anja; Großer, Jörg; Schinkel, Burkhard; Tomerius, Alexandra; Graner, Andreas; Korzun, Viktor

    2016-02-01

    Genomic prediction of malting quality traits in barley shows the potential of applying genomic selection to improve selection for malting quality and speed up the breeding process. Genomic selection has been applied to various plant species, mostly for yield or yield-related traits such as grain dry matter yield or thousand kernel weight, and improvement of resistances against diseases. Quality traits have not been the main scope of analysis for genomic selection, but have rather been addressed by marker-assisted selection. In this study, the potential to apply genomic selection to twelve malting quality traits in two commercial breeding programs of spring and winter barley (Hordeum vulgare L.) was assessed. Phenotypic means were calculated combining multilocational field trial data from 3 or 4 years, depending on the trait investigated. Three to five locations were available in each of these years. Heritabilities for malting traits ranged between 0.50 and 0.98. Predictive abilities (PA), as derived from cross validation, ranged between 0.14 to 0.58 for spring barley and 0.40-0.80 for winter barley. Small training sets were shown to be sufficient to obtain useful PAs, possibly due to the narrow genetic base in this breeding material. Deployment of genomic selection in malting barley breeding clearly has the potential to reduce cost intensive phenotyping for quality traits, increase selection intensity and to shorten breeding cycles.

  9. Photoperiod-H1 (Ppd-H1) Controls Leaf Size1[OPEN

    Science.gov (United States)

    Digel, Benedikt; Tavakol, Elahe; Verderio, Gabriele; Xu, Xin

    2016-01-01

    Leaf size is a major determinant of plant photosynthetic activity and biomass; however, it is poorly understood how leaf size is genetically controlled in cereal crop plants like barley (Hordeum vulgare). We conducted a genome-wide association scan for flowering time, leaf width, and leaf length in a diverse panel of European winter cultivars grown in the field and genotyped with a single-nucleotide polymorphism array. The genome-wide association scan identified PHOTOPERIOD-H1 (Ppd-H1) as a candidate gene underlying the major quantitative trait loci for flowering time and leaf size in the barley population. Microscopic phenotyping of three independent introgression lines confirmed the effect of Ppd-H1 on leaf size. Differences in the duration of leaf growth and consequent variation in leaf cell number were responsible for the leaf size differences between the Ppd-H1 variants. The Ppd-H1-dependent induction of the BARLEY MADS BOX genes BM3 and BM8 in the leaf correlated with reductions in leaf size and leaf number. Our results indicate that leaf size is controlled by the Ppd-H1- and photoperiod-dependent progression of plant development. The coordination of leaf growth with flowering may be part of a reproductive strategy to optimize resource allocation to the developing inflorescences and seeds. PMID:27457126

  10. Photoperiod-H1 (Ppd-H1) Controls Leaf Size.

    Science.gov (United States)

    Digel, Benedikt; Tavakol, Elahe; Verderio, Gabriele; Tondelli, Alessandro; Xu, Xin; Cattivelli, Luigi; Rossini, Laura; von Korff, Maria

    2016-09-01

    Leaf size is a major determinant of plant photosynthetic activity and biomass; however, it is poorly understood how leaf size is genetically controlled in cereal crop plants like barley (Hordeum vulgare). We conducted a genome-wide association scan for flowering time, leaf width, and leaf length in a diverse panel of European winter cultivars grown in the field and genotyped with a single-nucleotide polymorphism array. The genome-wide association scan identified PHOTOPERIOD-H1 (Ppd-H1) as a candidate gene underlying the major quantitative trait loci for flowering time and leaf size in the barley population. Microscopic phenotyping of three independent introgression lines confirmed the effect of Ppd-H1 on leaf size. Differences in the duration of leaf growth and consequent variation in leaf cell number were responsible for the leaf size differences between the Ppd-H1 variants. The Ppd-H1-dependent induction of the BARLEY MADS BOX genes BM3 and BM8 in the leaf correlated with reductions in leaf size and leaf number. Our results indicate that leaf size is controlled by the Ppd-H1- and photoperiod-dependent progression of plant development. The coordination of leaf growth with flowering may be part of a reproductive strategy to optimize resource allocation to the developing inflorescences and seeds. © 2016 American Society of Plant Biologists. All rights reserved.

  11. Vacuolar Localization of Endoproteinases EP(1) and EP(2) in Barley Mesophyll Cells.

    Science.gov (United States)

    Thayer, S S; Huffaker, R C

    1984-05-01

    The localization of two previously characterized endoproteinases (EP(1) and EP(2)) that comprise more than 95% of the protease activity in primary Hordeum vulgare L. var Numar leaves was determined. Intact vacuoles released from washed mesophyll protoplasts by gentle osmotic shock and increase in pH, were purified by flotation through a four-step Ficoll gradient. These vacuoles contained endoproteinases that rapidly degraded purified barley ribulose-1,5-bisphosphate carboxylase (RuBPCase) substrate. Breakdown products and extent of digestion of RuBPCase were determined using 12% polyacrylamide-sodium dodecyl sulfate gels. Coomassie brilliant blue- or silver-stained gels were scanned, and the peaks were integrated to provide quantitative information. The characteristics of the vacuolar endoproteinases (e.g. sensitivity to various inhibitors and activators, and the molecular weights of the breakdown products, i.e. peptide maps) closely resembled those of purified EP(1) and partially purified EP(2). It is therefore concluded that EP(1) and EP(2) are localized in the vacuoles of mesophyll cells.

  12. In vitro and in vivo phosphorylation of polypeptides in plasma membrane and tonoplast-enriched fractions from barley roots

    International Nuclear Information System (INIS)

    Garbarino, J.E.; Hurkman, W.J.; Tanaka, C.K.; DuPont, F.M.

    1991-01-01

    Phosphorylation of polypeptides in membrane fractions from barley (Hordeum vulgare L. cv CM 72) roots was compared in in vitro and in vivo assays to assess the potential role of protein kinases in modification of membrane transport. Membrane fractions enriched in endoplasmic reticulum, tonoplast, and plasma membrane were isolated using sucrose gradients and the membrane polypeptides separated using sodium dodecyl sulfate polyacrylamide gel electrophoresis. When the membrane fractions were incubated with γ[p 32 P]ATP, phosphorylation occurred almost exclusively in the plasma membrane fraction. Phosphorylation of a band at 38 kilodaltons increased as the concentration of Mg 2+ was decreased from millimolar to micromolar levels. Phosphorylation of bands at 125, 86, 58, 46 and 28 kilodaltons required millimolar Mg 2+ concentrations and was greatly enhanced by Ca 2+ . When roots of intact plants were labeled with [ 32 P]orthophosphate, polypeptides at approximately 135, 166, 90, 46 to 53, 32, 28, and 19 kilodaltons were labeled in the plasma membrane fraction and polypeptides at approximately 73, 66, and 48 kilodaltons were labeled in the tonoplast fraction. Treatment of the roots of intact plants with 150 millimolar NaCl resulted in increased phosphorylation of some polypeptides while treatment with 100 mM NaCl had no effect

  13. Utilizing virus-induced gene silencing for the functional characterization of maize genes during infection with the fungal pathogen Ustilago maydis.

    Science.gov (United States)

    van der Linde, Karina; Doehlemann, Gunther

    2013-01-01

    While in dicotyledonous plants virus-induced gene silencing (VIGS) is well established to study plant-pathogen interaction, in monocots only few examples of efficient VIGS have been reported so far. One of the available systems is based on the brome mosaic virus (BMV) which allows gene silencing in different cereals including barley (Hordeum vulgare), wheat (Triticum aestivum), and maize (Zea mays).Infection of maize plants by the corn smut fungus Ustilago maydis leads to the formation of large tumors on stem, leaves, and inflorescences. During this biotrophic interaction, plant defense responses are actively suppressed by the pathogen, and previous transcriptome analyses of infected maize plants showed comprehensive and stage-specific changes in host gene expression during disease progression.To identify maize genes that are functionally involved in the interaction with U. maydis, we adapted a VIGS system based on the Brome mosaic virus (BMV) to maize at conditions that allow successful U. maydis infection of BMV pre-infected maize plants. This setup enables quantification of VIGS and its impact on U. maydis infection using a quantitative real-time PCR (q(RT)-PCR)-based readout.

  14. Heat-stable proteins and abscisic acid action in barley aleurone cells

    International Nuclear Information System (INIS)

    Jacobsen, J.V.; Shaw, D.C.

    1989-01-01

    [ 35 S]Methionine labeling experiments showed that abscisic acid (ABA) induced the synthesis of at least 25 polypeptides in mature barley (Hordeum vulgare) aleurone cells. The polypeptides were not secreted. Whereas most of the proteins extracted from aleurone cells were coagulated by heating to 100 degree C for 10 minutes, most of the ABA-induced polypeptides remained in solution (heat-stable). ABA had little effect on the spectrum of polypeptides that were synthesized and secreted by aleurone cells, and most of these secreted polypeptides were also heat-stable. Coomassie blue staining of sodium dodecyl sulfate polyacrylamide gels indicated that ABA-induced polypeptides already occurred in high amounts in mature aleurone layers having accumulated during grain development. About 60% of the total protein extracted from mature aleurone was heat stable. Amino acid analyses of total preparations of heat-stable and heat-labile proteins showed that, compared to heat-labile proteins, heat-stable intracellular proteins were characterized by higher glutamic acid/glutamine (Glx) and glycine levels and lower levels of neutral amino acids. Secreted heat-stable proteins were rich in Glx and proline. The possibilities that the accumulation of the heat-stable polypeptides during grain development is controlled by ABA and that the function of these polypeptides is related to their abundance and extraordinary heat stability are considered

  15. Twenty years research of chronic gamma-ray irradiation on seed crops

    International Nuclear Information System (INIS)

    Yamashita, Atsushi

    1983-01-01

    Twenty years of the works on the chronic gamma-ray irradiation of seed crops are summarized. Radiosensitivity and the mutation rate per unit exposure varies not only with the genetic factor but also depend on whether treatment is given to seeds or growing plants. The relation between the radiosensitivity of seeds and growing plants also varies with plant species. In Hordeum, Avena and Nicotiana, the highest mutation rate obtained by the chronic irradiation of growing plants is similar to that in seed irradiation, but in Oryza and Setalia, chronic irradiation was two to three times more effective for attaining a higher mutation rate. The mutation spectrum also varies with the mutagen, the factors modifying the effects of mutagen, and the dose of mutagen. The suitability of a particular mutagenic treatment to a species should be taken into consideration in the evaluation of mutagenic treatment. For instance, NaN 3 is highly mutagenic to barley, but less mutagenic to rice. The gene ea7 controlling the maturing earliness of barley seems to be mutable in chronic irradiation, and the mutants obtained by chronic irradiation are healthy. The author emphasized that the chronic irradiation at the gamma-field is a useful mutagenic treatment, even though some negative results have been reported in European countries. (Kaihara, S.)

  16. The miR9863 family regulates distinct Mla alleles in barley to attenuate NLR receptor-triggered disease resistance and cell-death signaling.

    Directory of Open Access Journals (Sweden)

    Jie Liu

    2014-12-01

    Full Text Available Barley (Hordeum vulgare L. Mla alleles encode coiled-coil (CC, nucleotide binding, leucine-rich repeat (NB-LRR receptors that trigger isolate-specific immune responses against the powdery mildew fungus, Blumeria graminis f. sp. hordei (Bgh. How Mla or NB-LRR genes in grass species are regulated at post-transcriptional level is not clear. The microRNA family, miR9863, comprises four members that differentially regulate distinct Mla alleles in barley. We show that miR9863 members guide the cleavage of Mla1 transcripts in barley, and block or reduce the accumulation of MLA1 protein in the heterologous Nicotiana benthamiana expression system. Regulation specificity is determined by variation in a unique single-nucleotide-polymorphism (SNP in mature miR9863 family members and two SNPs in the Mla miR9863-binding site that separates these alleles into three groups. Further, we demonstrate that 22-nt miR9863s trigger the biogenesis of 21-nt phased siRNAs (phasiRNAs and together these sRNAs form a feed-forward regulation network for repressing the expression of group I Mla alleles. Overexpression of miR9863 members specifically attenuates MLA1, but not MLA10-triggered disease resistance and cell-death signaling. We propose a key role of the miR9863 family in dampening immune response signaling triggered by a group of MLA immune receptors in barley.

  17. Dental calculus reveals Mesolithic foragers in the Balkans consumed domesticated plant foods.

    Science.gov (United States)

    Cristiani, Emanuela; Radini, Anita; Edinborough, Marija; Borić, Dušan

    2016-09-13

    Researchers agree that domesticated plants were introduced into southeast Europe from southwest Asia as a part of a Neolithic "package," which included domesticated animals and artifacts typical of farming communities. It is commonly believed that this package reached inland areas of the Balkans by ∼6200 calibrated (cal.) BC or later. Our analysis of the starch record entrapped in dental calculus of Mesolithic human teeth at the site of Vlasac in the Danube Gorges of the central Balkans provides direct evidence that already by ∼6600 cal. BC, if not earlier, Late Mesolithic foragers of this region consumed domestic cereals, such as Triticum monococcum, Triticum dicoccum, and Hordeum distichon, which were also the main crops found among Early Neolithic communities of southeast Europe. We infer that "exotic" Neolithic domesticated plants were introduced to southern Europe independently almost half a millennium earlier than previously thought, through networks that enabled exchanges between inland Mesolithic foragers and early farming groups found along the Aegean coast of Turkey.

  18. Effects of Lime and Concrete Waste on Vadose Zone Carbon Cycling

    DEFF Research Database (Denmark)

    Thaysen, Eike Marie; Jessen, Søren; Postma, D.

    2014-01-01

    In this work we investigate how lime and crushed concrete waste (CCW) affect carbon cycling in the vadose zone and explore whether these amendments could be employed to mitigate climate change by increasing the transport of CO2 from the atmosphere to the groundwater. We use a combination of exper......In this work we investigate how lime and crushed concrete waste (CCW) affect carbon cycling in the vadose zone and explore whether these amendments could be employed to mitigate climate change by increasing the transport of CO2 from the atmosphere to the groundwater. We use a combination...... of experimental and modeling tools to determine ongoing biogeochemical processes. Our results demonstrate that lime and CCW amendments to acid soil contribute to the climate forcing by largely increasing the soil CO2 efflux to the atmosphere. In a series of mesocosm experiments, with barley (Hordeum vulgare L.......) grown on podzolic soil material, we have investigated inorganic carbon cycling through the gaseous and liquid phases and how it is affected by different soil amendments. The mesocosm amendments comprised the addition of 0, 9.6, or 21.2 kg m−2 of crushed concrete waste (CCW) or 1 kg lime m−2. The CCW...

  19. Contribution of Chromosomes 1HchS and 6HchS to Fertility Restoration in the Wheat msH1 CMS System under Different Environmental Conditions.

    Science.gov (United States)

    Castillo, Almudena; Rodríguez-Suárez, Cristina; Martín, Azahara C; Pistón, Fernando

    2015-01-01

    Exploiting hybrid wheat heterosis has been long pursued to increase crop yield, stability and uniformity. Cytoplasmic male sterility (CMS) systems based in the nuclear-cytoplasmic incompatible interactions are a classic way for hybrid seed production, but to date, no definitive system is available in wheat. The msH1 CMS system results from the incompatibility between the nuclear genome of wheat and the cytoplasmic genome of the wild barley Hordeum chilense. Fertility restoration of the CMS phenotype was first associated with the disomic addition of the short arm of chromosome 6H from H. chilense. In further studies it was observed that chromosome arm 1HchS was also implicated, and the combination of genes in both chromosome arms restored fertility more efficiently. In this work we aim to dissect the effect of each chromosome in fertility restoration when combined in different genomic backgrounds and under different environmental conditions. We propose a model to explain how restoration behaves in the msH1 system and generate valuable information necessary to develop an efficient system for hybrid wheat production.

  20. Amino acid transport across the tonoplast of vacuoles isolated from barley mesophyll protoplasts: Uptake of alanine, leucine, and glutamine

    International Nuclear Information System (INIS)

    Dietz, K.J.; Jaeger, R.; Kaiser, G.; Martinoia, E.

    1990-01-01

    Mesophyll protoplasts from leaves of well-fertilized barley (Hordeum vulgare L.) plants contained amino acids at concentrations as high as 120 millimoles per liter. With the exception of glutamic acid, which is predominantly localized in the cytoplasm, a major part of all other amino acids was contained inside the large central vacuole. Alanine, leucine, and glutamine are the dominant vacuolar amino acids in barley. Their transport into isolated vacuoles was studied using 14 C-labeled amino acids. Uptake was slow in the absence of ATP. A three- to sixfold stimulation of uptake was observed after addition of ATP or adenylyl imidodiphosphate an ATP analogue not being hydrolyzed by ATPases. Other nucleotides were ineffective in increasing the rate of uptake. ATP-Stimulated amino acid transport was not dependent on the transtonoplast pH or membrane potential. p-Chloromercuriphenylsulfonic acid and n-ethyl maleimide increased transport independently of ATP. Neutral amino acids such as valine or leucine effectively decreased the rate of alanine transport. Glutamine and glycine were less effective or not effective as competitive inhibitors of alanine transport. The results indicate the existence of a uniport translocator specific for neutral or basic amino acids that is under control of metabolic effectors

  1. Stomatal development in barley as a bioassay for cell differentation: its use with X-rays and gibberellic acid

    Energy Technology Data Exchange (ETDEWEB)

    Zeiger, E; Rafalowsky, J [Chile Univ., Santiago. Departamento de Biologia y Genetica

    1976-01-01

    A bioassay for cell differentiation during stomatal development in barley (Hordeum vulgare L.) has been defined. It uses cell kinetics analysis to follow the temporal course of cell divisions in the developmental sequence. The rate of displacement of the divisions along the stomatal rows provides a measure of differentiation. Physical factors affecting differentiation may be tested with intact seedlings. The bioassay showed that X-ray irradiation inhibited the divisions leading to stomatal formation. The inhibition kinetics was similar to the one observed in root meristems. Chemical substances are tested by culturing excised shoots in a synthetic medium. Detached leaves responded to sucrose and light with increasing rates of stomatal divisions. Gibberellic acid (GA/sub 3/) was assayed for its effects on the growth of the leaf and the differentiation of stomata. GA/sub 3/ increased the overall length of the leaves without affecting the rates of cell division. The treated cells responded with increased elongation rates and a precocious initiation and completion of cell enlargement. GA/sub 3/ had no specific effect on stomatal differentiation.

  2. ECOTOXICOLOGICAL EFFECTS OF BIODIESEL IN THE SOIL

    Directory of Open Access Journals (Sweden)

    Małgorzata Hawrot-Paw

    2015-11-01

    Full Text Available The paper analysed the toxic effect of the presence of biodiesel in the soil. The study involved tests with microorganisms that evaluated changes in their number and activity, and phytotoxicity tests with garden cress (Lepidium sativum and spring barley (Hordeum vulgare. Biodiesel produced in laboratory conditions and biofuel purchased at a petrol station were introduced to the soil. Two levels of contamination were used – 1% and 5% (per dry mass of the soil. Based on the results, it was discovered that biofuels both stimulated and reduced the number and activity of microorganisms. The changes observed depended on the type of biofuel and, most often, on its dose. Laboratory biodiesel exhibited more toxic effects, especially for actinobacteria and fungi. The tested plants showed diverse sensitivity to the presence of biodiesel. Given the determined value of the germination index, laboratory biodiesel was more toxic to spring barley and commercial biofuel to garden cress. In both cases, toxicity increased with an increase in the amount of biofuel.

  3. Do Tillage Methods Affect Germination and Species Similarity of Soil Weed Seeds Bank?

    Directory of Open Access Journals (Sweden)

    Shahgholi Hassan

    2015-12-01

    Full Text Available Cultural practices such as tillage used for crop production influence the composition of the weed seed bank in the soil. In order to investigate the effects of different tillage methods on seed bank properties, species diversity and similarity, two laboratory and greenhouse experiments were carried out as randomized complete block design with four replications in 2011. Treatments included: once tillage per year (T1, twice tillage per year (T2, more than twice tillage (T3 and no tillage (T4. Laboratory results showed that the T3 and T4 treatments had the highest and the lowest observed seeds numbers, respectively. Between the laboratory observed weed seeds, the maximum weed seed numbers were Echinochloa crus-galli and Amaranthus retroflexus in the T3 treatment, while Chenopodium album, Polygonum aviculare and Cuscuta campestris had the highest seed numbers in the T2 treatment. At the greenhouse study, Chenopodium album, Amaranthus retroflexus and Hordeum morinum in the T2 treatment were dominant species. The highest diversity was observed in the T2 treatment, and Chenopodium album and Echinochloa crus-galli were dominant species in the T2 and T3 treatments. Maximum species similarity index was achieved from the T1 and T3 treatments. Thereby this study concluded that increasing of tillage number could affect the similarity index of weed seeds and subsequently alters the weed community composition.

  4. Biological control of dodder (Cuscuta campestris L. by fungi pathogens

    Directory of Open Access Journals (Sweden)

    F. Fallahpour

    2016-04-01

    Full Text Available Parasite weeds are the most important yield reducing factors, and among them dodder (Cuscuta campestris L. is an obligate parasite of many plant families. In order to find a suitable biocontrol agent for dodder a study was conducted based on a randomized complete design with four replications at research greenhouse of Faculty of Agriculture, Ferdowsi University of Mashhad, Iran during 2007-2009. Diseased dodders sampled from sugarbeet farms of Chenaran, Iran. After culturing and isolating exiting fungi from infected tissues of dodder, Fusarium sp., Alternaria sp. and Colletotrichum sp. were recognized. Inoculation of isolates was carried out with concenteration of 1×108 spores per ml sterile water at different growth stages of dodder in labratoary and greenhouse. Among different fungi, isolate of 323 of F. oxysporum showed an effective control on germination of dodder seeds and the highest level of plant pathogencity was before the contact of dodder with host and infection in older plants decreased. Infection of this isolate with crops such as sugarbeet (Beta vulgaris L., alfalfa (Medigago sativa L., basil (Ocimum basilicum L., wheat (Triticum aestivum L. and barley (Hordeum vulgare L. showed no symptoms.

  5. Early H2O2 Accumulation in Mesophyll Cells Leads to Induction of Glutathione during the Hyper-Sensitive Response in the Barley-Powdery Mildew Interaction1

    Science.gov (United States)

    Vanacker, Helene; Carver, Tim L.W.; Foyer, Christine H.

    2000-01-01

    H2O2 production and changes in glutathione, catalase, and peroxidase were followed in whole-leaf extracts from the susceptible (AlgS [Algerian/4* (F14) Man.(S)]; ml-a1 allele) and resistant (AlgR [Algerian/4* (F14) Man.(R)]; Ml-a1 allele) barley (Hordeum vulgare) isolines between 12 and 24 h after inoculation with powdery mildew (Blumeria graminis [DC]. Speer [syn. Erysiphe graminis DC] f.sp hordei Marchal). Localized papilla responses and cell death hypersensitive responses were not observed within the same cell. In hypersensitive response sites, H2O2 accumulation first occurred in the mesophyll underlying the attacked epidermal cell. Subsequently, H2O2 disappeared from the mesophyll and accumulated around attacked epidermal cells. In AlgR, transient glutathione oxidation coincided with H2O2 accumulation in the mesophyll. Subsequently, total foliar glutathione and catalase activities transiently increased in AlgR. These changes, absent from AlgS, preceded inoculation-dependent increases in peroxidase activity that were observed in both AlgR and AlgS at 18 h. An early intercellular signal precedes H2O2, and this elicits anti-oxidant responses in leaves prior to events leading to death of attacked cells. PMID:10938348

  6. Pathogen-Induced Changes in the Antioxidant Status of the Apoplast in Barley Leaves

    Science.gov (United States)

    Vanacker, Hélène; Carver, Tim L.W.; Foyer, Christine H.

    1998-01-01

    Leaves of two barley (Hordeum vulgare L.) isolines, Alg-R, which has the dominant Mla1 allele conferring hypersensitive race-specific resistance to avirulent races of Blumeria graminis, and Alg-S, which has the recessive mla1 allele for susceptibility to attack, were inoculated with B. graminis f. sp. hordei. Total leaf and apoplastic antioxidants were measured 24 h after inoculation when maximum numbers of attacked cells showed hypersensitive death in Alg-R. Cytoplasmic contamination of the apoplastic extracts, judged by the marker enzyme glucose-6-phosphate dehydrogenase, was very low (less than 2%) even in inoculated plants. Dehydroascorbate, glutathione, superoxide dismutase, catalase, ascorbate peroxidase, glutathione reductase, monodehydroascorbate reductase, and dehydroascorbate reductase were present in the apoplast. Inoculation had no effect on the total foliar ascorbate pool size or the redox state. The glutathione content of Alg-S leaves and apoplast decreased, whereas that of Alg-R leaves and apoplast increased after pathogen attack, but the redox state was unchanged in both cases. Large increases in foliar catalase activity were observed in Alg-S but not in Alg-R leaves. Pathogen-induced increases in the apoplastic antioxidant enzyme activities were observed. We conclude that sustained oxidation does not occur and that differential strategies of antioxidant response in Alg-S and Alg-R may contribute to pathogen sensitivity. PMID:9662553

  7. Willet M. Hays, great benefactor to plant breeding and the founder of our association.

    Science.gov (United States)

    Troyer, A F; Stoehr, H

    2003-01-01

    Willet M. Hays was a great benefactor to plant breeding and the founder of the American Genetic Association (AGA). We commemorate the AGA's centennial. We mined university archives, U.S. Department of Agriculture (USDA) yearbooks, plant breeding textbooks, scientific periodicals, and descendants for information. Willet Hays first recognized the individual plant as the unit of selection and started systematic pure-line selection and progeny tests in 1888. He developed useful plant breeding methods. He selected superior flax (Linum usitatissimum L.), wheat (Triticum vulgare L.), corn (Zea mays L.), barley (Hordeum vulgare L.), and oat (Avena sativa L.) varieties, and discovered Grimm alfalfa (Medicago sativa L.); all became commercially important. He initiated branch stations for better performance testing. Willet Hays befriended colleagues in other universities, in federal stations, in a London conference, and in Europe. He gathered and spread the scientific plant breeding gospel. He also improved rural roads and initiated animal breeding records and agricultural economics records. He started the AGA in 1903, serving as secretary for 10 years. He became assistant secretary of agriculture in 1904. He introduced the project system for agricultural research. He authored or coauthored the Nelson Amendment, the Smith-Lever Act, the Smith-Hughes Act, and the protocol leading to the United Nations Food and Agriculture Organization-all involved teaching agricultural practices that improved the world.

  8. [14C]sucrose uptake and labeling of starch in developing grains of normal segl barley

    International Nuclear Information System (INIS)

    Felker, F.C.; Peterson, D.M.; Nelson, O.E.

    1984-01-01

    Previous work showed that the segl mutant of barley (Hordeum vulgare o Betzes) did not differ from normal Betzes in plant growth, photosynthesis, or fertility, but it produced only shrunken seeds regardless of pollen source. To determine whether defects in sucrose uptake or starch synthesis resulted in the shrunken condition, developing grains of Betzes and segl were cultured in [ 14 C]sucrose solutions after slicing transversely to expose the endosperm cavity and free space. In both young grains (before genotypes differed in dry weight) and older grains (17 days after anthesis, when segl grains were smaller than Betzes), sucrose uptake and starch synthesis were similar in both genotypes on a dry weight basis. To determine if sucrose was hydrolyzed during uptake, spikes of Betzes and segl were allowed to take up [fructose-U- 14 C]sucrose 14 days after anthesis and the radioactivity of endosperm sugars was examined during 3 hours of incubation. Whereas less total radioactivity entered the endosperm and the endosperm cavity (free space) of segl, in both genotypes over 96% of the label of endosperm sugars was in sucrose, and there was no apparent initial or progressive randomization of label among hexose moieties of sucrose as compared to the free space sampled after 1 hour of incubation. The authors conclude that segl endosperms are capable of normal sucrose uptake and starch synthesis and that hydrolysis of sucrose is not required for uptake in either genotype. Evidence suggests abnormal development of grain tissue of maternal origin during growth of segl grains

  9. Malt sprout, an underused beer by-product with promising potential for the growth and dehydration of lactobacilli strains.

    Science.gov (United States)

    Cejas, Luján; Romano, Nelson; Moretti, Ana; Mobili, Pablo; Golowczyc, Marina; Gómez-Zavaglia, Andrea

    2017-12-01

    Malt sprout (MS), a by-product of the malt industry obtained by removing rootlets and sprouts from the seed of germinated barley ( Hordeum vulgare L.), was used as culture, dehydration and storage medium of three strains of lactobacilli: Lactobacillus salivarius CM-CIDCA 1231B and CM-CIDCA 1232Y and Lactobacillus plantarum CIDCA 83114. The three strains were grown in MS and MS supplemented with 20% w/v fructo-oligosaccharides (MS FOS). Bacterial growth was determined by registering the decrease of pH and by plate counting. Comparable results with those of microorganisms grown in MRS (controls) were observed in terms of lag times, ΔpH and acidification rates. Furthermore, during fermentation, a significant increase of DP6 (FOS with degree of polymerization 6) was observed at expenses of inulin and DP7, probably indicating their hydrolysis. A concomitant decrease of DP3, sucrose and monosaccharides was also observed, as result of their bacterial consumption during growth. The presence of FOS in the fermented media protected microorganisms during freeze-drying and storage, as no decrease of culturability was observed after 60 days at 4 °C (> 10 8 CFU/mL). Using MS appears as an innovative strategy for the production of lactobacilli at large scale, supporting their use for the elaboration of functional foods containing prebiotics and probiotics.

  10. Uptake of cesium-137 by crops from contaminated soils

    Energy Technology Data Exchange (ETDEWEB)

    Demirel, H.; Oezer, I.; Celenk, I.; Halitligil, M.B.; Oezmen, A. [Ankara Nuclear Research and Training Center (Turkey)

    1994-11-01

    The Turkish tea crop was contaminated following the Chernobyl nuclear accident. Finding ways to dispose of the contaminated tea (Camellia sinensis L.) without damaging the environment was the goal of this research conducted at the Turkish Atomic Energy Authority (TAEA). In this study, an investigation was made of {sup 137}Cs activities of the plants and the ratios of transfer of {sup 137}Cs activity to plants when the contaminated tea was applied to the soil. Experiments were conducted in the field and in pots under greenhouse conditions. The activities of the tea applied in the field ranged from 12 500 to 72 800 Bq/m{sup 2}, whereas this activity was constant at 8000 Bq/pot in the greenhouse experiment. The transfer of {sup 137}Cs from soil to the plants was between 0.037 and 1.057% for wheat (Triticum aestivum L.), barley (Hordeum vulgare L.), corn (Zea mays indentata Sturt), bean (Phaseolus vulgaris L.), lettuce (Lactuca sativa L.), and grass (Lolium perenne L.). The ratio of the transfer of {sup 137}Cs activity to plants increased as the activity {sup 137}Cs in tea applied to soil was increased. The activity in the plants increased due to increased uptake of {sup 137}Cs by plants. 12 refs., 2 figs., 2 tabs.

  11. Effectiveness of urease inhibition on the abatement of ammonia, nitrous oxide and nitric oxide emissions in a non-irrigated Mediterranean barley field.

    Science.gov (United States)

    Abalos, Diego; Sanz-Cobena, Alberto; Misselbrook, Thomas; Vallejo, Antonio

    2012-09-01

    Urea is considered the cheapest and most commonly used form of inorganic N fertilizer worldwide. However, its use is associated with emissions of ammonia (NH(3)), nitrous oxide (N(2)O) and nitric oxide (NO), which have both economic and environmental impact. Urease activity inhibitors have been proposed as a means to reduce NH(3) emissions, although limited information exists about their effect on N(2)O and NO emissions. In this context, a field experiment was carried out with a barley crop (Hordeum vulgare L.) under Mediterranean conditions to test the effectiveness of the urease inhibitor N-(n-butyl) thiophosphoric triamide (NBPT) on reducing these gaseous N losses from surface applied urea. Crop yield, soil mineral N concentrations, dissolved organic carbon (DOC), denitrification potential, NH(3), N(2)O and NO fluxes were measured during the growing season. The inclusion of the inhibitor reduced NH(3) emissions in the 30 d following urea application by 58% and net N(2)O and NO emissions in the 95 d following urea application by 86% and 88%, respectively. NBPT addition also increased grain yield by 5% and N uptake by 6%, although neither increase was statistically significant. Under the experimental conditions presented here, these results demonstrate the potential of the urease inhibitor NBPT in abating NH(3), N(2)O and NO emissions from arable soils fertilized with urea, slowing urea hydrolysis and releasing lower concentrations of NH(4)(+) to the upper soil layer. Copyright © 2012 Elsevier Ltd. All rights reserved.

  12. Yield improvement in barley by using gamma-irradiation

    International Nuclear Information System (INIS)

    Benamer, Ibrahim Mohammed

    1990-01-01

    Breeding work for barley improvement in Libya is very rare. All varieties grown here are foreign varieties. Yield per hectare is low compared with other countries having similar climatic conditions. Productivity, lodging, disease resistance, drought and salt tolerance are the main characteristics that need to be improved. A mutation breeding programme for barley improvement was initiated at the Tajoura Nuclear Research Centre in 1983-1984. The objectives of this programme are the development of new lines that could be used directly or indirectly in the development of new varieties. The locally adapted barley (Hordeum vulgare L.) variety ''California Mariout'' was used as a parent material. Grains with 14% moisture were exposed to 200 Gy gamma-ray from 60 Co source at the Centre. Three experiments were conducted during 1986-1989. From the first experiment (1986-1987), 62 mutant lines were evaluated. From the second and third experiments (1987-1989), only seven mutant lines were evaluated. In the 1988-1989 experiment, the crop was irrigated and fertilised with 0, 100 and 200 kgN/ha. Lodging score was low in 0 kgN/ha and increased significantly by the increase in N level. None of the mutant lines more lodging resistant than the parent or the control. However, yield differences were significant and the application of 100 kgN/ha increased the grain yield

  13. Metabolism of diclofenac in plants--hydroxylation is followed by glucose conjugation.

    Science.gov (United States)

    Huber, Christian; Bartha, Bernadett; Schröder, Peter

    2012-12-01

    Pharmaceuticals from human or veterinary medication form a new class of micropollutants that poses a serious threat to our aquatic environment and its organisms. The intensively used nonsteroidal anti-inflammatory drug diclofenac is found in the environment worldwide due to its poor elimination during waste water treatment processes. In order to test phytoremediation as a tool for the removal of this drug from waste water, the uptake of the compound into plant tissues and its metabolic pathway was addressed using Hordeum vulgare (barley) and a hairy root cell culture of Armoracia rusticana (horse radish) as model species. Diclofenac is taken up by plants and undergoes rapid metabolization; already after 3h of exposure the drug and its metabolites could be detected in the plant tissues. Similar to its fate in mammalian cells the drug is activated in a phase I reaction resulting in the hydroxylated metabolite 4'OH-diclofenac which is conjugated subsequently in phase II to a glucopyranoside, a typical plant specific metabolite. After exposure to 10 and 100 μM diclofenac a concentration dependent formation of the hydroxylated metabolite was observed, while the formation of the phase II metabolite OH-diclofenac glucopyranoside was not positively affected by the higher concentration. To our knowledge this is the first time these two human painkiller metabolites are shown to occur in plant tissues. Copyright © 2012 Elsevier B.V. All rights reserved.

  14. Development of DArT-based PCR markers for selecting drought-tolerant spring barley.

    Science.gov (United States)

    Fiust, Anna; Rapacz, Marcin; Wójcik-Jagła, Magdalena; Tyrka, Mirosław

    2015-08-01

    The tolerance of spring barley (Hordeum vulgare L.) cultivars to spring drought is an important agronomic trait affecting crop yield and quality in Poland. Therefore, breeders require new molecular markers to select plants with lower spring drought susceptibility. With the advent of genomic selection technology, simple molecular tools may still be applicable to screen material for markers of the most important traits and in-depth genome scanning. In previous studies, diversity arrays technology (DArT)-based genetic maps were constructed for F2 populations of Polish fodder and malt barley elite breeding lines, and 15 and 18 quantitative trait loci (QTLs) related to spring drought tolerance were identified, respectively. In this paper, we show the results of a conversion of 30 DArT markers corresponding to 11 QTLs into simple sequence repeat (SSR) and sequence tagged site (STS) markers. Twenty-two polymorphic markers were obtained, including 13 DArT-based SSRs. Additionally, 31 SSR markers, located in close proximity to the DArT markers, were selected from the GrainGenes database and tested. Further analyses of 24 advanced breeding lines with different drought tolerances confirmed that five out of the 30 converted markers, as well as three out of the 31 additional SSR markers, were effective in marker-assisted selection for drought tolerance. The possible function of clones related to these markers in drought tolerance is discussed.

  15. Cell-Based Phenotyping Reveals QTL for Membrane Potential Maintenance Associated with Hypoxia and Salinity Stress Tolerance in Barley

    Directory of Open Access Journals (Sweden)

    Muhammad B. Gill

    2017-11-01

    Full Text Available Waterlogging and salinity are two major abiotic stresses that hamper crop production world-wide resulting in multibillion losses. Plant abiotic stress tolerance is conferred by many interrelated mechanisms. Amongst these, the cell’s ability to maintain membrane potential (MP is considered to be amongst the most crucial traits, a positive relationship between the ability of plants to maintain highly negative MP and its tolerance to both salinity and waterlogging stress. However, no attempts have been made to identify quantitative trait loci (QTL conferring this trait. In this study, the microelectrode MIFE technique was used to measure the plasma membrane potential of epidermal root cells of 150 double haploid (DH lines of barley (Hordeum vulgare L. from a cross between a Chinese landrace TX9425 and Japanese malting cultivar Naso Nijo under hypoxic conditions. A major QTL for the MP in the epidermal root cells in hypoxia-exposed plants was identified. This QTL was located on 2H, at a similar position to the QTL for waterlogging and salinity tolerance reported in previous studies. Further analysis confirmed that MP showed a significant contribution to both waterlogging and salinity tolerance. The fact that the QTL for MP was controlled by a single major QTL illustrates the power of the single-cell phenotyping approach and opens prospects for fine mapping this QTL and thus being more effective in marker assisted selection.

  16. Effect of inoculum density and soil tillage on the development and severity of rhizoctonia root rot.

    Science.gov (United States)

    Schroeder, K L; Paulitz, T C

    2008-03-01

    Rhizoctonia spp. cause substantial yield losses in direct-seeded cereal crops compared with conventional tillage. To investigate the mechanisms behind this increased disease, soils from tilled or direct-seeded fields were inoculated with Rhizoctonia spp. at population densities from 0.8 to 250 propagules per gram and planted with barley (Hordeum vulgare). The incidence and severity of disease did not differ between soils with different tillage histories. Both R. solani AG-8 and R. oryzae stunted plants at high inoculum densities, with the latter causing pre-emergence damping-off. High inoculum densities of both species stimulated early production of crown roots in barley seedlings. Intact soil cores from these same tilled and direct-seeded fields were used to evaluate the growth of Rhizoctonia spp. from colonized oat seeds. Growth of R. oryzae was not affected by previous tillage history. However, R. solani AG-8 grew more rapidly through soil from a long-term direct-seeded field compared to tilled soils. The differential response between these two experiments (mixed, homogenized soil versus intact soil) suggests that soil structure plays a major role in the proliferation of R. solani AG-8 through soils with different tillage histories.

  17. Effects of tillage on the activity density and biological diversity of carabid beetles in spring and winter crops.

    Science.gov (United States)

    Hatten, Timothy D; Bosque-Pérez, Nilsa A; Labonte, James R; Guy, Stephen O; Eigenbrode, Sanford D

    2007-04-01

    The effects of tillage regimen (conventional [CT] and no-tillage [NT]) on the activity density and diversity of carabid beetles (Coleoptera: Carabidae) was studied by pitfall trapping within a rain-fed cropping system in northwestern Idaho, 2000-2002. The cropping rotation consisted of a spring cereal (barley, Hordeum vulgare L., in 2000 and 2001; and wheat, Triticum aestivum L., in 2002), spring dry pea (Pisum sativum L.) 2000-2002, and wheat (T. aestivum), spring in 2000 and 2001, and winter in 2002. A total of 14,480 beetles comprised of 30 species was captured, with five numerically dominant species [Poecilus scitulus L., Poecilus lucublandus Say, Microlestes linearis L., Pterostichus melanarius Ill., and Calosoma cancellatum (Eschscholtz)], accounting for 98% of all captures. All species including the dominants responded idiosyncratically to tillage regimen. Adjusting for trapping biases did not significantly change seasonal activity density of Poecilus spp. or Pt. melanarius to tillage. More beetles were captured in CT than in NT crops because of the dominance of P. scitulus in CT, whereas species richness and biological diversity were generally higher in NT crops. Observed patterns suggest that direct effects of tillage affected some species, whereas indirect effects related to habitat characteristics affected others. CT may provide habitat preferable to xerophilic spring breeders. A relationship was found between beetle species size and tillage regimen in pea and to a lesser extent across all spring crops, with large species (>14 mm) conserved more commonly in NT, small species (tillage systems.

  18. Archaeogenetic evidence of ancient nubian barley evolution from six to two-row indicates local adaptation.

    Directory of Open Access Journals (Sweden)

    Sarah A Palmer

    Full Text Available BACKGROUND: Archaeobotanical samples of barley (Hordeum vulgare L. found at Qasr Ibrim display a two-row phenotype that is unique to the region of archaeological sites upriver of the first cataract of the Nile, characterised by the development of distinctive lateral bracts. The phenotype occurs throughout all strata at Qasr Ibrim, which range in age from 3000 to a few hundred years. METHODOLOGY AND FINDINGS: We extracted ancient DNA from barley samples from the entire range of occupancy of the site, and studied the Vrs1 gene responsible for row number in extant barley. Surprisingly, we found a discord between the genotype and phenotype in all samples; all the barley had a genotype consistent with the six-row condition. These results indicate a six-row ancestry for the Qasr Ibrim barley, followed by a reassertion of the two-row condition. Modelling demonstrates that this sequence of evolutionary events requires a strong selection pressure. CONCLUSIONS: The two-row phenotype at Qasr Ibrim is caused by a different mechanism to that in extant barley. The strength of selection required for this mechanism to prevail indicates that the barley became locally adapted in the region in response to a local selection pressure. The consistency of the genotype/phenotype discord over time supports a scenario of adoption of this barley type by successive cultures, rather than the importation of new barley varieties associated with individual cultures.

  19. Sulfur dioxide alleviates programmed cell death in barley aleurone by acting as an antioxidant.

    Directory of Open Access Journals (Sweden)

    Sha-Sha Wang

    Full Text Available Sulfur dioxide (SO2, a gaseous signaling molecule in animal cells, has recently been found to play a physiological role in plants. Here we studied the role of SO2 in gibberellic acid (GA3-induced programmed cell death (PCD in barley (Hordeum vulgare L. aleurone layers. The application of the SO2 donor (NaHSO3/Na2SO3, 1:3 M/M effectively alleviated PCD in barley aleurone layers in a dose-dependent manner with an optimal concentration of 50 μM. Further investigations showed that SO2 reduced the accumulation of hydrogen peroxide (H2O2, superoxide anion (⋅O2- and malondialdehyde (MDA in aleurone layers. Moreover, the activities of antioxidant enzymes such as superoxide dismutase (SOD, catalase (CAT, ascorbate peroxidase (APX, glutathione reductase (GR and guaiacol peroxidase (POD were enhanced by SO2 donor treatment. Meanwhile, lipoxygenase (LOX activity was attenuated by SO2 donor treatment. Furthermore, an induction of endogenous H2S and NO were also observed in SO2-treated aleurone layers, suggesting interactions of SO2 with other well-known signaling molecules. Taken together, we show that SO2 negatively regulated PCD by acting as an antioxidant to scavenge excessive reactive oxygen species (ROS generated during PCD.

  20. Archaeobotanical reconstructions of field habitats and crops: the grange in Pomorzany near Kutno, 18th/19th c.

    Directory of Open Access Journals (Sweden)

    Koszałka Joanna

    2015-03-01

    Full Text Available The paper presents the results of research of plant macrofossils from the grain deposit deriving from the 18th/19th centuries. The analysed material included 24760 diaspores representing 73 taxa. The majority were cultivated cereal crop species, and there was also abundance of accompanying segetal weed species. About 95% of the gathered crop material was Secale cereale. Another important crop was Hordeum vulgare and there were also some remains of Avena sativa, Triticum aestivum, Fagopyrum esculentum. Cannabis sativa and Linum usitatissimum were found as well. Weeds competing with these crops were, among others, the following species: Agrostemma githago, Raphanus raphanistrum, Apera spica-venti, Bromus secalinus, Centaurea cyanus, Spergula arvensis, Thlaspi arvense, Viola arvensis/tricolor, Fallopia convolvulus, Polygonum persicaria, Mentha arvensis, Anthemis arvensis, Papaver rhoeas, Rumex acetosella, Scleranthus annuus, Aphanes arvensis, Setaria pumila, Setaria viridis/verticilata. Extremely large presence of wild plant diaspores in the material allowed conducting economic and environmental interpretations. Reconstruction methods applied, used primarily in the case of macroremains from granaries, were fully applicable to the analysed plant residues. Weed species composition in the analysed material showed that they were mostly typical for the main winter crop. Some amount of species typical for other habitats were also found and they probably came from the near-by rye field. The presence of perennial diaspores indicated that the field was probably set aside