Complete chloroplast genome sequences of Hordeum vulgare, Sorghum bicolor and Agrostis stolonifera, and comparative analyses with other grass genomes

Science.gov (United States)

Saski, Christopher; Lee, Seung-Bum; Fjellheim, Siri; Guda, Chittibabu; Jansen, Robert K.; Luo, Hong; Tomkins, Jeffrey; Rognli, Odd Arne; Clarke, Jihong Liu

2009-01-01

Comparisons of complete chloroplast genome sequences of Hordeum vulgare, Sorghum bicolor and Agrostis stolonifera to six published grass chloroplast genomes reveal that gene content and order are similar but two microstructural changes have occurred. First, the expansion of the IR at the SSC/IRa boundary that duplicates a portion of the 5′ end of ndhH is restricted to the three genera of the subfamily Pooideae (Agrostis, Hordeum and Triticum). Second, a 6 bp deletion in ndhK is shared by Agrostis, Hordeum, Oryza and Triticum, and this event supports the sister relationship between the subfamilies Erhartoideae and Pooideae. Repeat analysis identified 19–37 direct and inverted repeats 30 bp or longer with a sequence identity of at least 90%. Seventeen of the 26 shared repeats are found in all the grass chloroplast genomes examined and are located in the same genes or intergenic spacer (IGS) regions. Examination of simple sequence repeats (SSRs) identified 16–21 potential polymorphic SSRs. Five IGS regions have 100% sequence identity among Zea mays, Saccharum officinarum and Sorghum bicolor, whereas no spacer regions were identical among Oryza sativa, Triticum aestivum, H. vulgare and A. stolonifera despite their close phylogenetic relationship. Alignment of EST sequences and DNA coding sequences identified six C–U conversions in both Sorghum bicolor and H. vulgare but only one in A. stolonifera. Phylogenetic trees based on DNA sequences of 61 protein-coding genes of 38 taxa using both maximum parsimony and likelihood methods provide moderate support for a sister relationship between the subfamilies Erhartoideae and Pooideae. PMID:17534593

Geography of Genetic Structure in Barley Wild Relative Hordeum vulgare subsp. spontaneum in Jordan.

Science.gov (United States)

Thormann, Imke; Reeves, Patrick; Reilley, Ann; Engels, Johannes M M; Lohwasser, Ulrike; Börner, Andreas; Pillen, Klaus; Richards, Christopher M

2016-01-01

Informed collecting, conservation, monitoring and utilization of genetic diversity requires knowledge of the distribution and structure of the variation occurring in a species. Hordeum vulgare subsp. spontaneum (K. Koch) Thell., a primary wild relative of barley, is an important source of genetic diversity for barley improvement and co-occurs with the domesticate within the center of origin. We studied the current distribution of genetic diversity and population structure in H. vulgare subsp. spontaneum in Jordan and investigated whether it is correlated with either spatial or climatic variation inferred from publically available climate layers commonly used in conservation and ecogeographical studies. The genetic structure of 32 populations collected in 2012 was analyzed with 37 SSRs. Three distinct genetic clusters were identified. Populations were characterized by admixture and high allelic richness, and genetic diversity was concentrated in the northern part of the study area. Genetic structure, spatial location and climate were not correlated. This may point out a limitation in using large scale climatic data layers to predict genetic diversity, especially as it is applied to regional genetic resources collections in H. vulgare subsp. spontaneum.

Lipid and sugar profiles of various barley cultivars (Hordeum vulgare

Directory of Open Access Journals (Sweden)

Pastor Kristian A.

2015-01-01

Full Text Available The lipid components and soluble sugars in flour samples of different cultivars of barley (Hordeum vulgare, involving winter malting barley, winter forage barley, spring barley, and hulless barley, were identified. Fatty acids were extracted from flour samples with n-hexane, and derivatized into volatile methyl esters, using TMSH (trimethylsulfonium hydroxide in methanol. Soluble sugars were extracted from defatted and dried samples of barley flour with 96% ethanol, and further derivatized into the corresponding trimethylsilyl (TMS oximes, using hydroxylamine hydrochloride solution and BSTFA (N,O-bis-(trimethylsilyl-trifluoroacetamide. The hexane and alcoholic extracts of barley cultivars were analyzed by GC-MS system. Lipid and sugar compositions were very similar in all barley cultivars. Therefore, multivariate analysis was applied to numerical values of automatically integrated areas of the identified fatty acid methyl esters and TMS oximes of soluble sugars. The application of hierarchical cluster analysis showed a great similarity between the investigated flour samples of barley cultivars, according to their fatty acid content (0.96. Also, significant, but somewhat less similarity was observed regarding the content of soluble sugars (0.70. These preliminary results indicate the possibility of distinguishing flour made of barley, regardless of the variety, from flours made of other cereal species, just by the analysis of the contents of fatty acids and soluble sugars.[Projekat Ministarstva nauke Republike Srbije, br. TR 31066

Effects of ultraviolet radiation on viability of isolated Beta vulgaris and Hordeum vulgare protoplasts

International Nuclear Information System (INIS)

Bornman, J.F.; Bjoern, L.O.; Bornman, C.H.

1982-01-01

Estimates of viability as measured by vital straining with fluorescein diacetate were carried out on freshly isolated and partially aged (16-hour-old) Beta vulgaris and Hordeum vulgare mesophyll protoplasts following irradiation with UV-B. Damage to the photosynthetic system by UV-B was determined by delayed light emission (DLE). In the case of freshly isolated Protoplasts Beta was approximately 30% more susceptible than Hordeum following 3h irradiation, with viability decreasing from 90% to 40%. After storage of protoplasts on ice for 16 h UV-B radiation markedly depressed viability in both species, but in the case of Hordeum there was a substantial initial loss of nearly 70% in viability over the first hour of irradiation. The first 10 min of UV-B radiation decreased the intensity of DLE by 40% without appreciably affecting the decay rate. Longer treatment times did not give a proportional effect so that even after 60 min of UV-B the inhibition did not exceed 60%. This suggested that although the enzyme system responsible for FDA hydrolysis may be partially inactivated (viability was 75-80% as compared with 90% in the control), the UV-B did not penetrate the innermost parts of the chloroplasts, but left some thylakoids undamaged. (orig.)

Regrowth in Barley (Hordeum vulgare L.) and Rye (Secale cereale L.)

DEFF Research Database (Denmark)

Christiansen, J L; Jørgensen, Johannes Ravn; Jørnsgård, B

1998-01-01

Regrowth after cutting at four development stages, from heading to grain maturity, was investigated in a pot experiment containing three rye and four barley varieties (including 2 Hordeum spontaneum lines). Regrowth in the barley varieties decreased strongly from heading to grain maturity. Rye ge...

Catabolism of (+/-)-abscisic acid by excised leaves of Hordeum vulgare L. cv Dyan and its modification by chemical and environmental factors

International Nuclear Information System (INIS)

Cowan, A.K.; Railton, I.D.

1987-01-01

Excised light-grown leaves and etiolated leaves of Hordeum vulgare L. cv Dyan catabolized applied (+/-)-[2- 14 C]abscisic acid ([+/-]-[2- 14 C]ABA) to phaseic acid (PA), dihydrophaseic acid (DPA), and 2'-hydroxymethyl ABA (2'-HMABA). Identification of these catabolites was made by microchemical methods and by combined capillary gas chromatography-mass spectrometry (GC-MS) following high dose feeds of nonlabeled substrate to leaves. Circular dichroism analysis revealed that 2'-HMABA was derived from the (-) enantiomer of ABA. Refeeding studies were used to confirm the catabolic route. The methyl ester of (+/-)-[2 14 C]-ABA was hydrolyzed efficiently by light-grown leaves of H. vulgare. Leaf age played a significant role in (+/-)-ABA catabolism, with younger leaves being less able than their older counterparts to catabolize this compound. The catabolism of (+/-)-ABA was inhibited markedly in water-stressed Hordeum leaves which was characterized by a decreased incorporation of label into 2'-HMABA, DPA, and conjugates. The specific, mixed function oxidase inhibitor, ancymidol, did not inhibit, dramatically (+/-)-ABA catabolism in light-grown leaves of Hordeum whereas the 80s ribosome, translational inhibitor, cycloheximide, inhibited this process markedly. The 70s ribosome translational inhibitors, lincomycin and chloramphenicol, were less effective than cycloheximide in inhibiting (+/-)-ABA catabolism, implying that cytoplasmic protein synthesis is necessary for the catabolism of (+/-)-ABA in Hordeum leaves whereas chloroplast protein synthesis plays only a minor role. This further suggests that the enzymes involved in (+/-)-ABA catabolism in this plant are cytoplasmically synthesized and are turned-over rapidly, although the enzyme responsible for glycosylating (+/-)-ABA itself appeared to be stable

Classification and salt tolerance analysis of barley varieties

NARCIS (Netherlands)

Katerji, N.; Hoorn, van J.W.; Hamdy, A.; Mastrorilli, M.; Fares, C.; Ceccarelli, S.; Grando, S.; Oweis, T.

2006-01-01

Six varieties of barley (Hordeum vulgare), five of which were provided by ICARDA, were tested in a green house experiment for their salt tolerance. Afterwards the ICARDA variety Melusine, selected from this experiment for its combination of high yield and salt tolerance, was compared in a lysimeter

Mapping and validation of major quantitative trait loci for kernel length in wild barley (Hordeum vulgare ssp. spontaneum).

Science.gov (United States)

Zhou, Hong; Liu, Shihang; Liu, Yujiao; Liu, Yaxi; You, Jing; Deng, Mei; Ma, Jian; Chen, Guangdeng; Wei, Yuming; Liu, Chunji; Zheng, Youliang

2016-09-13

Kernel length is an important target trait in barley (Hordeum vulgare L.) breeding programs. However, the number of known quantitative trait loci (QTLs) controlling kernel length is limited. In the present study, we aimed to identify major QTLs for kernel length, as well as putative candidate genes that might influence kernel length in wild barley. A recombinant inbred line (RIL) population derived from the barley cultivar Baudin (H. vulgare ssp. vulgare) and the long-kernel wild barley genotype Awcs276 (H.vulgare ssp. spontaneum) was evaluated at one location over three years. A high-density genetic linkage map was constructed using 1,832 genome-wide diversity array technology (DArT) markers, spanning a total of 927.07 cM with an average interval of approximately 0.49 cM. Two major QTLs for kernel length, LEN-3H and LEN-4H, were detected across environments and further validated in a second RIL population derived from Fleet (H. vulgare ssp. vulgare) and Awcs276. In addition, a systematic search of public databases identified four candidate genes and four categories of proteins related to LEN-3H and LEN-4H. This study establishes a fundamental research platform for genomic studies and marker-assisted selection, since LEN-3H and LEN-4H could be used for accelerating progress in barley breeding programs that aim to improve kernel length.

Interkingdom signaling: The role of homoserine lactones in early responses and resistance in barley (Hordeum vulgare L.)

OpenAIRE

Rankl, Simone

2017-01-01

N-Acyl-D/L-homoserine lactones (AHLs) are produced as microbial signaling compounds during bacterial intra- and inter-specific communication in the rhizosphere. Thus, plants are naturally exposed to these compounds and respond with tissue-specific reactions. In the present study the impact of AHLs on the monocot barley (Hordeum vulgare L.) was investigated. The treatment with C8- and C12- homoserine lactones (HSL) resulted in root and shoot biomass gain as well as in the formation of lat...

Localisation of genes for resistance against ¤Blumeria graminis¤ f.sp. ¤hordei¤ and ¤Puccinia graminis¤ in a cross between a barley cultivar and a wild barley (¤Hordeum vulgare¤ ssp. ¤spontaneum¤) line

DEFF Research Database (Denmark)

Backes, G.; Madsen, L.H.; Jaiser, H.

2003-01-01

The aims of this investigation have been to map new (quantitative) resistance genes against powdery mildew, caused by Blumeria graminis f.sp. hordei L., and leaf rust, caused by Puccinia hordei L., in a cross between the barley (Hordeum vulgare ssp. vulgare) cultivar "Vada" and the wild barley...... (Hordeum vulgare ssp. spontaneum) line "1B-87" originating from Israel. The population consisted of 121 recombinant inbred lines. Resistance against leaf rust and powdery mildew was tested on detached leaves. The leaf rust isolate "I-80" and the powdery mildew isolate "Va-4", respectively, were used...

The Influence of Processing by Impulse Pressure on the Productivity of the Don Barley (Hordeum vulgare L.

Directory of Open Access Journals (Sweden)

Pavlova Violetta Aleksandrovna

2014-04-01

Full Text Available Plant productivity is the important indicator, which determines the amount of yield. The productivity of plants depends on the number of bruchids per plant and on the weight of 1000 bruchids. The article studies the influence of impulse pressure of various magnitudes on plant productivity of Don barley (Hordeum vulgare L.. It was found that the pressure of 17 MPa was the most effective for increasing the productivity. Impulse pressure of other magnitudes also had influence on the productivity of Don barley.

Phylogenetic analysis of the genus Hordeum using repetitive DNA sequences

DEFF Research Database (Denmark)

Svitashev, S.; Bryngelsson, T.; Vershinin, A.

1994-01-01

A set of six cloned barley (Hordeum vulgare) repetitive DNA sequences was used for the analysis of phylogenetic relationships among 31 species (46 taxa) of the genus Hordeum, using molecular hybridization techniques. In situ hybridization experiments showed dispersed organization of the sequences...

Zinc blotting assay for detection of zinc binding prolamin in barley (Hordeum vulgare) grain

DEFF Research Database (Denmark)

Uddin, Mohammad Nasir; Nielsen, Ane Langkilde-Lauesen; Vincze, Eva

2014-01-01

In plants, zinc is commonly found bound to proteins. In barley (Hordeum vulgare), major storage proteins are alcohol-soluble prolamins known as hordeins, and some of them have the potential to bind or store zinc. 65Zn overlay and blotting techniques have been widely used for detecting zinc......-binding protein. However, to our knowledge so far this zinc blotting assay has never been applied to detect a prolamin fraction in barley grains. A radioactive zinc (65ZnCl2) blotting technique was optimized to detect zinc-binding prolamins, followed by development of an easy-to-follow nonradioactive colorimetric...... zinc blotting method with a zinc-sensing dye, dithizone. Hordeins were extracted from mature barley grain, separated by SDS-PAGE, blotted on a membrane, renatured, overlaid, and probed with zinc; subsequently, zinc-binding specificity of certain proteins was detected either by autoradiography or color...

Differential Antioxidative Responses to Water Deficit Among four Barley (Hordeum vulgare L. Genotypes

Directory of Open Access Journals (Sweden)

Z Amini

2013-08-01

Full Text Available Future climate changes are expected to increase risks of drought, which already represent the most common stress factor for stable barley (Hordeum vulgare L. production in Iran. Up to now, extensive research projects have been done to study effects of drought stress on the antioxidant enzyme activity. While there is a few works of such studies on the field condition. In order to study of water deficit effects on the antioxidant enzymes activities as a secondary stress, we evaluate the effects of mild and severe drought stress on activities of antioxidative enzymes including superoxide dismutases, ascorbate peroxidase, catalase and peroxidase, among four barley genotypes, differing in the capacity to maintain the grain yield under drought condition during beginning on anthesis, kernel watery ripe and late milk stages under field condition. Results showed that drought increased the activity of antioxidant enzymes in all genotypes. At beginning of anthesis, POX activity of Q22 was higher than it in other genotypes ( P

Powdery Mildew Resistance in 268 Entries of Hordeum vulgare

DEFF Research Database (Denmark)

Jiang, W.M.; Jørgensen, Jørgen Helms; Torp, J

1984-01-01

A collection of 24 'Spontaneum' barley [H. vulgare ssp. spontaneum] entries and one comprising 244 Ethiopian barleys [H. vulgare ssp. vulgare] were tested for resistance to 4 powdery mildew [used by Erysiphe graminis f. sp. hordei] cultures that carried genes for virulence corresponding to most...

A Novel QTL for Powdery Mildew Resistance in Nordic Spring Barley (Hordeum vulgare L. ssp. vulgare) Revealed by Genome-Wide Association Study.

Science.gov (United States)

Bengtsson, Therése; Åhman, Inger; Manninen, Outi; Reitan, Lars; Christerson, Therese; Due Jensen, Jens; Krusell, Lene; Jahoor, Ahmed; Orabi, Jihad

2017-01-01

The powdery mildew fungus, Blumeria graminis f. sp. hordei is a worldwide threat to barley ( Hordeum vulgare L. ssp. vulgare ) production. One way to control the disease is by the development and deployment of resistant cultivars. A genome-wide association study was performed in a Nordic spring barley panel consisting of 169 genotypes, to identify marker-trait associations significant for powdery mildew. Powdery mildew was scored during three years (2012-2014) in four different locations within the Nordic region. There were strong correlations between data from all locations and years. In total four QTLs were identified, one located on chromosome 4H in the same region as the previously identified mlo locus and three on chromosome 6H. Out of these three QTLs identified on chromosome 6H, two are in the same region as previously reported QTLs for powdery mildew resistance, whereas one QTL appears to be novel. The top NCBI BLASTn hit of the SNP markers within the novel QTL predicted the responsible gene to be the 26S proteasome regulatory subunit, RPN1, which is required for innate immunity and powdery mildew-induced cell death in Arabidopsis . The results from this study have revealed SNP marker candidates that can be exploited for use in marker-assisted selection and stacking of genes for powdery mildew resistance in barley.

Evaluation of the allelopathic potential of water-soluble compounds of barley (Hordeum vulgare L. subsp.vulgare and great brome (Bromus diandrus Roth. using a modified bioassay

Directory of Open Access Journals (Sweden)

Bouhaouel, I.

2016-01-01

Full Text Available Description of the subject. The present study focuses on the description of the allelopathic interactions between wild and crop species that may occur in a given ecosystem. Objectives. The objective is the evaluation of the allo- and autoinhibition activity of root exudates of barley (Hordeum vulgare L. subsp. vulgare and great brome (Bromus diandrus Roth. seedlings by water-soluble allelochemicals. Method. The allelopathic activities of five Tunisian barley genotypes (modern varieties and landraces, one Saudi Arabian barley landrace and great brome were assessed using a modified laboratory bioassay named "seedling-after-seedling agar method". Results. The barley or the great brome reduced, to a greater extent, the root growth compared to the shoot growth of receiver species. The response of the root system architecture of the great brome towards barley root exudates was studied in detail. All the measured root traits were highly sensitive to the presence of barley. In our conditions, the allelopathic activity of barley root exudates had no apparent relationship with the size of the root and a prominent action of genetic determinants in the allelopathic potential between genotypes is proposed. The alloinhibitory activity of barley or great brome root exudates deferred between the receiver species but was always higher than the autoinhibition potential. The autoinhibition in barley proved to depend on whether the genotypes used as donor and receiver are identical or different, suggesting a specific interaction of allelochemicals with the receiver plant. These molecules seem to be the main actors in the allelopathic barley potential as external factors such variations of pH have no evident relevance in the inhibition process. Conclusions. Barley and great brome exude molecules in their surroundings. This affects the growth of the receiver plants, suggesting that these compounds might contribute to the plant community dynamics.

The Effect of Trichoderma harzianum and Cadmium on Tolerance Index and Yield of Barley (Hordeum vulgare L.

Directory of Open Access Journals (Sweden)

F. Taghavi Ghasemkheyli

2015-01-01

Full Text Available To investigate the effect of Trichoderma harzianum, as a bioabsorbant to ameliorate the harmful effects of cadmium (Cd on growth and yield of barley (Hordeum vulgare L. variety ‘Sahra’, a factorial pot experiment based on completely randomized design with three replicates was conducted. Trichoderma harzianum withtwo levels (with and without inoculation and cadmium nitrate with four levels (0, 50, 100 and 150 mg.L-1 were the treatments. Results of ANOVA revealed that there was a significant interaction between Trichoderma and cadmium nitrate in terms of biological yield, straw yield, harvest index, spike number per plant and seed number per spike. Mean comparisons showed that Trichoderma inoculation at all Cd levels significantly improved both biological and straw yields. Trichoderma at 50 and 100 mg.L-1 of Cd also increased the spike number per plant (up to 120 and 66%, respectively significantly. Increasing Cd levels decreased seed yield (19%, 1000 seed weight (18%, partitioning coefficient (57% and tolerance index (23% significantly. Inoculation of Trichoderma into growth medium had a significant effect on seed yield and tolerance index (up to 17 and 22%, respectively. In conclusion, Trichoderma harzianum inoculation at lower concentrations of Cd (50 and 100 mg.L-1 could be effective to improve growth parameters of barley plant.

Resistance genes in barley (Hordeum vulgare L.) and their identification with molecular markers.

Science.gov (United States)

Chełkowski, Jerzy; Tyrka, Mirosław; Sobkiewicz, Andrzej

2003-01-01

Current information on barley resistance genes available from scientific papers and on-line databases is summarised. The recent literature contains information on 107 major resistance genes (R genes) against fungal pathogens (excluding powdery mildew), pathogenic viruses and aphids identified in Hordeum vulgare accessions. The highest number of resistance genes was identified against Puccinia hordei, Rhynchosporium secalis, and the viruses BaYMV and BaMMV, with 17, 14 and 13 genes respectively. There is still a lot of confusion regarding symbols for R genes against powdery mildew. Among the 23 loci described to date, two regions Mla and Mlo comprise approximately 31 and 25 alleles. Over 50 R genes have already been localised and over 30 mapped on 7 barley chromosomes. Four barley R genes have been cloned recently: Mlo, Rpg1, Mla1 and Mla6, and their structures (sequences) are available. The paper presents a catalogue of barley resistance gene symbols, their chromosomalocation and the list of available DNA markers useful in characterising cultivars and breeding accessions.

Fungos e micotoxinas em grãos de cevada (Hordeum vulgare L.) cervejeira, descontaminação pelo gás ozônio e segurança de cervejas artesanais

OpenAIRE

Piacentini, Karim Cristina

2015-01-01

Dissertação (mestrado) - Universidade Federal de Santa Catarina, Centro de Ciências Agrárias, Programa de Pós-Graduação em Ciência dos Alimentos, Florianópolis, 2015. A cevada (Hordeum vulgare L sp. vulgare) é considerada um dos cereais mais importantes no contexto mundial. Atualmente, uma preocupação latente da indústria cervejeira é o crescimento de fungos filamentosos nos grãos, que acorre devido ao manejo inadequado da matéria prima durante o armazenamento (excesso de umidade), a conde...

Cytogenetic effect of low dose gamma-radiation in Hordeum vulgare seedlings: non-linear dose-effect relationship.

Science.gov (United States)

Geras'kin, Stanislav A; Oudalova, Alla A; Kim, Jin Kyu; Dikarev, Vladimir G; Dikareva, Nina S

2007-03-01

The induction of chromosome aberrations in Hordeum vulgare germinated seeds was studied after ionizing irradiation with doses in the range of 10-1,000 mGy. The relationship between the frequency of aberrant cells and the absorbed dose was found to be nonlinear. A dose-independent plateau in the dose range from about 50 to 500 mGy was observed, where the level of cytogenetic damage was significantly different from the spontaneous level. The comparison of the goodness of the experimental data fitting with mathematical models of different complexity, using the most common quantitative criteria, demonstrated the advantage of a piecewise linear model over linear and polynomial models in approximating the frequency of cytogenetical disturbances. The results of the study support the hypothesis of indirect mechanisms of mutagenesis induced by low doses. Fundamental and applied implications of these findings are discussed.

Genetic Transformation of Hordeum vulgare ssp. spontaneum for the Development of a Transposon-Based Insertional Mutagenesis System.

Science.gov (United States)

Cardinal, Marie-Josée; Kaur, Rajvinder; Singh, Jaswinder

2016-10-01

Domestication and intensive selective breeding of plants has triggered erosion of genetic diversity of important stress-related alleles. Researchers highlight the potential of using wild accessions as a gene source for improvement of cereals such as barley, which has major economic and social importance worldwide. Previously, we have successfully introduced the maize Ac/Ds transposon system for gene identification in cultivated barley. The objective of current research was to investigate the response of Hordeum vulgare ssp. spontaneum wild barley accessions in tissue culture to standardize parameters for introduction of Ac/Ds transposons through genetic transformation. We investigated the response of ten wild barley genotypes for callus induction, regenerative green callus induction and regeneration of fertile plants. The activity of exogenous Ac/Ds elements was observed through a transient assay on immature wild barley embryos/callus whereby transformed embryos/calli were identified by the expression of GUS. Transient Ds expression bombardment experiments were performed on 352 pieces of callus (3-5 mm each) or immature embryos in 4 genotypes of wild barley. The transformation frequency of putative transgenic callus lines based on transient GUS expression ranged between 72 and100 % in wild barley genotypes. This is the first report of a transformation system in H. vulgare ssp. spontaneum.

A weed suppressive index for spring barley (Hordeum vulgare) varieties

DEFF Research Database (Denmark)

Hansen, P K; Kristensen, K; Willas, J

2008-01-01

A screening programme for crop variety competitiveness would ideally be based on only a few, non-destructive measurements of key growth traits. In this study we measured the weed suppressive ability of 79 varieties of spring barley in two ways: (i) directly, by weed coverage assessments under wee...

Farmers without borders-genetic structuring in century old barley (Hordeum vulgare).

Science.gov (United States)

Forsberg, N E G; Russell, J; Macaulay, M; Leino, M W; Hagenblad, J

2015-02-01

The geographic distribution of genetic diversity can reveal the evolutionary history of a species. For crop plants, phylogeographic patterns also indicate how seed has been exchanged and spread in agrarian communities. Such patterns are, however, easily blurred by the intense seed trade, plant improvement and even genebank conservation during the twentieth century, and discerning fine-scale phylogeographic patterns is thus particularly challenging. Using historical crop specimens, these problems are circumvented and we show here how high-throughput genotyping of historical nineteenth century crop specimens can reveal detailed geographic population structure. Thirty-one historical and nine extant accessions of North European landrace barley (Hordeum vulgare L.), in total 231 individuals, were genotyped on a 384 single nucleotide polymorphism assay. The historical material shows constant high levels of within-accession diversity, whereas the extant accessions show more varying levels of diversity and a higher degree of total genotype sharing. Structure, discriminant analysis of principal components and principal component analysis cluster the accessions in latitudinal groups across country borders in Finland, Norway and Sweden. FST statistics indicate strong differentiation between accessions from southern Fennoscandia and accessions from central or northern Fennoscandia, and less differentiation between central and northern accessions. These findings are discussed in the context of contrasting historical records on intense within-country south to north seed movement. Our results suggest that although seeds were traded long distances, long-term cultivation has instead been of locally available, possibly better adapted, genotypes.

Nitrogen uptake by Azospirillum brasilense inoculated barley (Hordeum vulgare L.) as influenced by N and P fertilization

International Nuclear Information System (INIS)

Negi, Mahima; Tilak, K.V.B.R.; Sachdev, M.S.

1991-01-01

Response of barley (Hordeum vulgare L.) in a sandy-loam soil under potted conditions revealed that application of nitrogen and phosphorus increased the population of Azospirillium in the barley rhizosphere. A two fold increase was observed in the Azospirillium population at 80 days compared to that at 40 days of plant growth. The unsterilized inoculated roots had more population than the surface sterilized inoculated roots. Increased drymatter production of barley was obtained in A. brasilense inoculated N 0 P 1 (0 kg N and 30 kg P 2 O 5 ha -1 ) treatment than uninoculated control. Also N and P uptake was higher in A. brasilense inoculated plants in the presence of both N and P fertilizers. The 15 N data revealed that at harvest nearly 36 per cent of the total N uptake was from the nitrogen fixed by A. brasilense irrespective of P treatment. (author). 16 refs., 4 tabs

Evaluation of barley (hordeum vulgare l.) germplasm for high forage production under salt stress

International Nuclear Information System (INIS)

Saleem, A.; Qurainy, F.A.; Akram, N.A.

2014-01-01

To explore high biomass producing salt tolerant cultivars of a potential forage crop barley (Hordeum vulgare L.), 30-day old plants of 105 different accessions from different origin were subjected to saline and non-saline (control) conditions for 45 days. Salinity stress (150 mM NaCl) markedly suppressed plant growth (shoot and/or root fresh and dry weights), chlorophyll pigments (a and b), internal CO/sub 2/ concentration, stomatal conductance, rate of transpiration and photosynthesis, while a considerable salt-induced increase was observed in all fluorescence related attributes including efficiency of photosystem-II (Fv/Fm), co-efficient of non-photochemical quenching (QN), photochemical quenching (QP), and non-photochemical quenching (NPQ) in all 105 accessions of barley. The response of all 105 barley accessions to salt stress varied significantly for all the morpho-physiological attributes determined in the present study. Overall, on the basis of shoot and root dry weights, accessions, 4050, 4053, 4056, 4163, 4228, 4229, 4244, 4245, 4290, 4414, 4415, 4427, 4452, Mahali, Jesto, 4165, 4229, 4249, 4405, 4409, 4426, 4456, and Giza 123 were found superior while accessions, 4245, 4158, 4166, 4246, 4406, 4423, 4441, 4442 4447, 4453 and 4458 inferior under saline conditions. (author)

Variation in the leaf sodium content of the Hordeum vulgare (barley) cultivar Maythorpe and its derived mutant cv. Golden Promise

International Nuclear Information System (INIS)

Forster, B.P.; Pakniyat, H.; Macaulay, M.; Matheson, W.; Phillips, M.S.; Thomas, W.T.B.; Powell, W.

1994-01-01

Tests for shoot and root sodium content were carried out on various barley cultivars (Hordeum vulgare) and experimental lines including wild barley (H. spontaneum) and derivatives. Lines were grown in hydroculture with and without the addition of salt (NaCl), and sodium concentrations in shoots and roots were determined. Variation in shoot sodium content was found between the various lines; in contrast, no significant differences were found between the lines tested for root sodium content. The most significant finding was the variation in shoot sodium content between the two cultivars Golden Promise and Maythorpe. Golden Promise is a direct gamma-ray induced mutant of the cultivar Maythorpe and the reduced shoot sodium content of Golden Promise can be attributed to radiation treatment. (author)

Malt quality of 4 barley (Hordeum vulgare L.) grain varieties grown ...

African Journals Online (AJOL)

user

2011-01-31

Jan 31, 2011 ... 76.6 to 79.7%). The varieties had a pasting- time and -temperature (Ti) of 4.7 to 5.0 min and 64.7 to .... 16°C) (Termaks chamber KBP 6395F, Bergen, Norway). Each .... varieties in the peak viscosity is in part attributed to the.

A flavonoid mutant of barley (Hordeum vulgare L.) exhibits increased sensitivity to UV-B radiation in the primary leaf

International Nuclear Information System (INIS)

Reuber, S.; Bornman, J.F.; Weissenböck, G.

1996-01-01

The aim of the present investigation was to define the role of soluble flavonoids as UV-B protectants in the primary leaf of barley (Hordeum vulgare L.). For this purpose we used a mutant line (Ant 287) from the Carlsberg collection of proanthocyanidin-free barley containing only 7% of total extractable flavonoids in the primary leaf as compared to the mother variety (Hiege 550/75). Seven-day-old leaves from plants grown under high visible light with or without supplementary UV-B radiation were used for the determination of UV-B sensitivity. UV-B-induced changes were assessed from parameters of chlorophyll fluorescence of photosystem II, including initial and maximum fluorescence, apparent quantum yield, and photochemical and non-photochemical quenching. A quartz fibre-optic microprobe was used to evaluate the amount of potentially harmful UV-B (310 nm radiation) penetrating into the leaf as a direct consequence of flavonoid deficiency. Our data indicate an essential role of flavonoids in UV-B protection of barley primary leaves. In leaves of the mutant line grown under supplementary UV-B, an increase in 310nm radiation in the mesophyll and a strong decrease in the quantum yield of photosynthesis were observed as compared to the corresponding mother variety. Primary leaves of liege responded to supplementary UV-B radiation with a 30% increase in the major flavonoid saponarin and a 500% increase in the minor compound lutonarin. This is assumed to be an efficient protective response since no changes in variable chlorophyll fluorescence were apparent. In addition, a further reduction in UV-B penetration into the mesophyll was recorded in these leaves

Genetic analysis on the competitive ability of barley ( Hordeum ...

African Journals Online (AJOL)

Genetic analysis on the competitive ability of barley ( Hordeum vulgare L.) recombinant inbred lines intercropped with oat ( Avena sativa L.) weeds. ... Furthermore, the commonly used herbicide price is soaring from time to time and out of the reach of the poor farmers in the developing countries. Therefore, this method is an ...

Enhanced Pb Absorption by Hordeum vulgare L. and Helianthus annuus L. Plants Inoculated with an Arbuscular Mycorrhizal Fungi Consortium.

Science.gov (United States)

Arias, Milton Senen Barcos; Peña-Cabriales, Juan José; Alarcón, Alejandro; Maldonado Vega, María

2015-01-01

The effect of an arbuscular mycorrhizal fungi (AMF) consortium conformed by (Glomus intraradices, Glomus albidum, Glomus diaphanum, and Glomus claroideum) on plant growth and absorption of Pb, Fe, Na, Ca, and (32)P in barley (Hordeum vulgare L.) and sunflower (Helianthus annuus L.) plants was evaluated. AMF-plants and controls were grown in a substrate amended with powdered Pb slag at proportions of 0, 10, 20, and 30% v/v equivalent to total Pb contents of 117; 5,337; 13,659, and 19,913 mg Pb kg(-1) substrate, respectively. Mycorrhizal root colonization values were 70, 94, 98, and 90%, for barley and 91, 97, 95, and 97%, for sunflower. AMF inoculum had positive repercussions on plant development of both crops. Mycorrhizal barley absorbed more Pb (40.4 mg Pb kg(-1)) shoot dry weight than non-colonized controls (26.5 mg Pb kg(-1)) when treated with a high Pb slag dosage. This increase was higher in roots than shoots (650.0 and 511.5 mg Pb kg(-1) root dry weight, respectively). A similar pattern was found in sunflower. Plants with AMF absorbed equal or lower amounts of Fe, Na and Ca than controls. H. vulgare absorbed more total P (1.0%) than H. annuus (0.9%). The arbuscular mycorrizal consortium enhanced Pb extraction by plants.

Molecular characterization of barley (Hordeum vulgare L. accessions of the Serbian GeneBank by SSR fingerprinting

Directory of Open Access Journals (Sweden)

Šurlan-Momirović Gordana

2013-01-01

Full Text Available Molecular diversity of 145 barley (Hordeum vulgare subsp. vulgare L. accessions from the Serbian GenBank was assessed by single sequence repeats (SSR markers. A set of 15 SSRs, covering all chromosomes of the diploid barley genome with 2-3 SSR markers per chromosome, with a range of 4-18 alleles per locus were used. In total, 15 loci and 119 alleles were detected, with an average of 7.93 alleles per locus. The Polymorphic information content value ranged from 0.220 to 0.782 with a mean value of 0.534. Regarding the growth habit and row type groups, gene diversity was comparatively higher for the spring (0.616 and six-rowed accessions (0.616 than for the winter and two- rowed accessions (0.322 and 0.478, respectively. Analysis of molecular variance showed that all sources of variation were significant (P < 0.01, but the between-group component was predominant (76.85% for growth habit and 89.45% for row type. Unweighted Pair Group Method with Arithmetic Mean (UPGMA cluster analysis based on the shared allele distance (DSA matrix estimated on the SSR data assigned the genotypes into two clusters - the first smaller consisting of the six 6-rowed spring cultivars and the second comprising six subclusters. Genotype MBR1012 was separated from all other genotypes that constitute UPGMA tree. The associations of genotypes belonging to different growth habit and row type groups were assessed using Principal Coordinate Analysis revealing separation of winter growth habit group from facultative one. The use of the STRUCTURE clustering algorithm allowed the identification of 2 subpopulations of genotypes. [Projekat Ministarstva nauke Republike Srbije, br. TR31092

Bioaccumulation of cadmium by spring barley (Hordeum vulgare L. and its effect on selected physiological and morphological parameters

Directory of Open Access Journals (Sweden)

Miriama Kopernická

2016-01-01

Full Text Available Heavy metals and other toxic elements in the environment, mainly located in soil and groundwater, have a significant effect on plant and its productivity that has a huge attention in recent years. Accumulation of heavy metals in soil cause toxicity to plants, and contaminate the food chain. The industrial areas, as well as developing countries have been contaminated with high concentration of heavy metals. Main sources of contamination are mining and other industrial processes, as well as military and or lanfills, sludge dumps or waste disposal sites. The heavy metals are very dangerous to environment and pose serious danger to public health by entering throught the food chain or into drinking water. Phytoextraction is one way how to remove the contaminants from soil by plants. Phytoextraction of heavy metals is a technology that has been studied for several years. It is more ecological and cheaper way how to clean our environment.Several plant species are known becauce they hyperaccumulate a high contents of metals from the soil. The accumulators are mainly herbaceous species, crops and nowadays angiosperm trees with a high growth such as poplars or willows. We have focused on the determination of some morphological (lenght and weight of roots and biomass and physiological (contents of dry mass and number of lief stomata characteristics and the determination of the bioaccumulation factor and the translocation factor of cadmium by spring barley (Hordeum vulgare L.. Imprints of leaves were evaluated using an optical microscope Axiostar Plus, Carl Zeiss, lens CP Achromat 40x/0.65, eyepiece PI 10x / 18, Canon Utilities Software Zoom Browser EX 4.6 and hardware Acer Travel Mate 4600, Canon Power Shot A95. The density of stomata was evaluated on an area of 1 mm2. Samples of the dried plants (leaves and roots were mineralized by acid digestion using microwave digestion device MARS X - press 5. The end of determination to obtain the cadmium content was

Malt quality of 4 barley (Hordeum vulgare L.) grain varieties grown ...

African Journals Online (AJOL)

user

2011-01-31

Jan 31, 2011 ... Grain flour starch pasting and malt qualities were analyzed. .... bags and stored in a cool place (ca. ... Pasting properties of four malting barely varieties grain flour starches and the effect of three fungicide (propiconazole) spray.

Characterization of Gene Candidates for Vacuolar Sodium Transport from Hordeum Vulgare

KAUST Repository

Scheu, Arne Hagen August

2017-05-01

Soil salinity is a major abiotic stress for land plants, and multiple mechanisms of salt tolerance have evolved. Tissue tolerance is one of these mechanisms, which involves the sequestration of sodium into the vacuole to retain low cytosolic sodium concentrations. This enables the plant to maintain cellular functions, and ultimately maintain growth and yield. However, the molecular components involved in tissue tolerance remain elusive. Several candidate genes for vacuolar sodium sequestration have recently been identified by proteome analysis of vacuolar membranes purified from the salt-tolerant cereal Hordeum vulgare (barley). In this study, I aimed to characterize these candidates in more detail. I successfully cloned coding sequences for the majority of candidate genes with primers designed based on the barley reference genome sequence. During the course of this study a newer genome sequence with improved annotations was published, to which I also compared my observations. To study the candidate genes, I used the heterologous expression system Saccharomyces cerevisiae (yeast). I used several salt sensitive yeast strains (deficient in intrinsic sodium transporters) to test whether the candidate genes would affect their salt tolerance by mediating the sequestration of sodium into the yeast vacuole. I observed a reduction in growth upon expression for several of the gene candidate under salt-stress conditions. However, confocal microscopy suggests that most gene products are subject to degradation, and did not localize to the vacuolar membrane (tonoplast). Therefore, growth effects cannot be linked to protein function without further evidence. Various potential causes are discussed, including inaccuracies in the genome resource used as reference for primer design and issues inherent to the model system. Finally, I make suggestions on how to proceed to further characterize the candidate genes and hopefully identify novel sodium transporters from barley.

Malt quality of 4 barley ( Hordeum vulgare L.) grain varieties grown ...

African Journals Online (AJOL)

propiconazole) spray intervals (7, 14, 21 day) and no spray control were arranged in a RCBD in 4 replications to assess net blotch (Pyrenophora teres) effect on malt quality. The varieties were grown at Holetta agricultural research center in 2005, ...

High-throughput transcriptome analysis of barley (Hordeum vulgare) exposed to excessive boron.

Science.gov (United States)

Tombuloglu, Guzin; Tombuloglu, Huseyin; Sakcali, M Serdal; Unver, Turgay

2015-02-15

Boron (B) is an essential micronutrient for optimum plant growth. However, above certain threshold B is toxic and causes yield loss in agricultural lands. While a number of studies were conducted to understand B tolerance mechanism, a transcriptome-wide approach for B tolerant barley is performed here for the first time. A high-throughput RNA-Seq (cDNA) sequencing technology (Illumina) was used with barley (Hordeum vulgare), yielding 208 million clean reads. In total, 256,874 unigenes were generated and assigned to known peptide databases: Gene Ontology (GO) (99,043), Swiss-Prot (38,266), Clusters of Orthologous Groups (COG) (26,250), and the Kyoto Encyclopedia of Genes and Genomes (KEGG) (36,860), as determined by BLASTx search. According to the digital gene expression (DGE) analyses, 16% and 17% of the transcripts were found to be differentially regulated in root and leaf tissues, respectively. Most of them were involved in cell wall, stress response, membrane, protein kinase and transporter mechanisms. Some of the genes detected as highly expressed in root tissue are phospholipases, predicted divalent heavy-metal cation transporters, formin-like proteins and calmodulin/Ca(2+)-binding proteins. In addition, chitin-binding lectin precursor, ubiquitin carboxyl-terminal hydrolase, and serine/threonine-protein kinase AFC2 genes were indicated to be highly regulated in leaf tissue upon excess B treatment. Some pathways, such as the Ca(2+)-calmodulin system, are activated in response to B toxicity. The differential regulation of 10 transcripts was confirmed by qRT-PCR, revealing the tissue-specific responses against B toxicity and their putative function in B-tolerance mechanisms. Copyright © 2014. Published by Elsevier B.V.

Efeitos de potenciais de água no solo, em diferentes estádios fenológicos da cultura da cevada (Hordeum vulgare L. Effects of soil water potentials at different phenological phases of barley crop (Hordeum vulgare L.

Directory of Open Access Journals (Sweden)

M.A. Urchei

1994-12-01

Full Text Available Objetivando avaliar os efeitos de défices hídricos, em três estádios fonológicos da cultura da cevada (Hordeum vulgare L., foi conduzido experimento em vasos, com delineamento em blocos ao acaso. Foram utilizados nove tratamentos decorrentes da combinação dos potenciais mínimos de água no solo de -0,05, -0,20 e -1,50 MPa, com os estádios fenológicos de máximo perfilhamento, florescimento e grão leitoso, permanecendo uniformizados durante o restante do ciclo, entre os potenciais de -0,01 a -0,05 MPa. Os resultados de produção, peso e teor de proteína dos grãos, tamanho de espigas, número total e número de espigas chochas, mostraram que os efeitos de défices hídricos variaram com a intensidade, duração e estádio fenológico da cultura, onde o estádio de florescimento mostrou-se mais sensível ao défice de água. A ocorrência de défice hídrico intenso, em cada um dos estádios, bem como ciclos repetidos de défices moderados ou intensos, levaram à diminuições significativas na produção de grãos, além de ocorrer tendência ao aumento do teor de protema dos grãos. O manejo da irrigação na cultura da cevada, quando se busca a máxima eficiência no uso da água, deve levar em conta os diferentes estádios fenológicos.The experiment was carried out under greenhouse conditions, with the objective of evaluating the effects of water deficits in three phenological phases of barley crop (Hordeum vulgare L.. Pots were arranged in a randomized block design with nine treatments. They originated from the combination of minimum soil water potentials of -0,05, -0,20 and -1,50 MPa, with the phenological phases of maximum tillering, flowering and milky grain, having been hold uniformly along the rest of the cycle, between -0,01 and -0,05 MPa potentials. Weight of grain, protein content, spike sizes, spike total number and number of hollow spikes, showed that water deficit effects varied with the intensity, duration and

Structure of Hordeum vulgare NADPH-dependent thioredoxin reductase 2. Unwinding the reaction mechanism

International Nuclear Information System (INIS)

Kirkensgaard, Kristine G.; Hägglund, Per; Finnie, Christine; Svensson, Birte; Henriksen, Anette

2009-01-01

The first crystal structure of a cereal NTR, a protein involved in seed development and germination, has been determined. The structure is in a conformation that excludes NADPH binding and indicates that a domain reorientation facilitated by Trx binding precedes NADPH binding in the reaction mechanism. Thioredoxins (Trxs) are protein disulfide reductases that regulate the intracellular redox environment and are important for seed germination in plants. Trxs are in turn regulated by NADPH-dependent thioredoxin reductases (NTRs), which provide reducing equivalents to Trx using NADPH to recycle Trxs to the active form. Here, the first crystal structure of a cereal NTR, HvNTR2 from Hordeum vulgare (barley), is presented, which is also the first structure of a monocot plant NTR. The structure was determined at 2.6 Å resolution and refined to an R cryst of 19.0% and an R free of 23.8%. The dimeric protein is structurally similar to the structures of AtNTR-B from Arabidopsis thaliana and other known low-molecular-weight NTRs. However, the relative position of the two NTR cofactor-binding domains, the FAD and the NADPH domains, is not the same. The NADPH domain is rotated by 25° and bent by a 38% closure relative to the FAD domain in comparison with AtNTR-B. The structure may represent an intermediate between the two conformations described previously: the flavin-oxidizing (FO) and the flavin-reducing (FR) conformations. Here, analysis of interdomain contacts as well as phylogenetic studies lead to the proposal of a new reaction scheme in which NTR–Trx interactions mediate the FO to FR transformation

Structure of Hordeum vulgare NADPH-dependent thioredoxin reductase 2. Unwinding the reaction mechanism

Energy Technology Data Exchange (ETDEWEB)

Kirkensgaard, Kristine G. [Carlsberg Laboratory (Denmark); Enzyme and Protein Chemistry, Department of Systems BioIogy, Technical University of Denmark (Denmark); Hägglund, Per; Finnie, Christine; Svensson, Birte [Enzyme and Protein Chemistry, Department of Systems BioIogy, Technical University of Denmark (Denmark); Henriksen, Anette, E-mail: anette@crc.dk [Carlsberg Laboratory (Denmark)

2009-09-01

The first crystal structure of a cereal NTR, a protein involved in seed development and germination, has been determined. The structure is in a conformation that excludes NADPH binding and indicates that a domain reorientation facilitated by Trx binding precedes NADPH binding in the reaction mechanism. Thioredoxins (Trxs) are protein disulfide reductases that regulate the intracellular redox environment and are important for seed germination in plants. Trxs are in turn regulated by NADPH-dependent thioredoxin reductases (NTRs), which provide reducing equivalents to Trx using NADPH to recycle Trxs to the active form. Here, the first crystal structure of a cereal NTR, HvNTR2 from Hordeum vulgare (barley), is presented, which is also the first structure of a monocot plant NTR. The structure was determined at 2.6 Å resolution and refined to an R{sub cryst} of 19.0% and an R{sub free} of 23.8%. The dimeric protein is structurally similar to the structures of AtNTR-B from Arabidopsis thaliana and other known low-molecular-weight NTRs. However, the relative position of the two NTR cofactor-binding domains, the FAD and the NADPH domains, is not the same. The NADPH domain is rotated by 25° and bent by a 38% closure relative to the FAD domain in comparison with AtNTR-B. The structure may represent an intermediate between the two conformations described previously: the flavin-oxidizing (FO) and the flavin-reducing (FR) conformations. Here, analysis of interdomain contacts as well as phylogenetic studies lead to the proposal of a new reaction scheme in which NTR–Trx interactions mediate the FO to FR transformation.

Hordein Variation in Wild (Hordeum Spontaneum) and Cultivated (H. Vulgare) Barley

DEFF Research Database (Denmark)

Doll, Hans; Brown, A. H. D.

1979-01-01

The storage protein hordein contains two major groups of polypeptides which are highly polymorphic in barley, and in its evolutionary progenitor Hordeum spontaneum Koch. Crosses between the two species showed that the complex electrophoretic phenotypes within the two groups of polypeptides are go...

Identification of barley and rye varieties using matrix- assisted laser desorption/ionisation time-of-flight mass spectrometry with neural networks

DEFF Research Database (Denmark)

Bloch, H.A.; Petersen, Marianne Kjerstine; Sperotto, Maria Maddalena

2001-01-01

developed, which combines analysis of alcohol-soluble wheat proteins (gliadins) using matrix-assisted laser desorption/ionisation time-of-flight mass spectrometry with neural networks. Here we have applied the same method for the identification of both barley (Hordeum vulgare L.) and rye (Secale cereale L.......) varieties. For barley, 95% of the mass spectra were correctly classified. This is an encouraging result, since in earlier experiments only a grouping into subsets of varieties was possible. However, the method was not useful in the classification of rye, due to the strong similarity between mass spectra...

Genome-Wide Association Mapping of Stem Rust Resistance in Hordeum vulgare subsp. spontaneum.

Science.gov (United States)

Sallam, Ahmad H; Tyagi, Priyanka; Brown-Guedira, Gina; Muehlbauer, Gary J; Hulse, Alex; Steffenson, Brian J

2017-10-05

Stem rust was one of the most devastating diseases of barley in North America. Through the deployment of cultivars with the resistance gene Rpg1 , losses to stem rust have been minimal over the past 70 yr. However, there exist both domestic (QCCJB) and foreign (TTKSK aka isolate Ug99) pathotypes with virulence for this important gene. To identify new sources of stem rust resistance for barley, we evaluated the Wild Barley Diversity Collection (WBDC) (314 ecogeographically diverse accessions of Hordeum vulgare subsp. spontaneum ) for seedling resistance to four pathotypes (TTKSK, QCCJB, MCCFC, and HKHJC) of the wheat stem rust pathogen ( Puccinia graminis f. sp. tritici , Pgt ) and one isolate (92-MN-90) of the rye stem rust pathogen ( P. graminis f. sp. secalis , Pgs ). Based on a coefficient of infection, the frequency of resistance in the WBDC was low ranging from 0.6% with HKHJC to 19.4% with 92-MN-90. None of the accessions was resistant to all five cultures of P. graminis A genome-wide association study (GWAS) was conducted to map stem rust resistance loci using 50,842 single-nucleotide polymorphic markers generated by genotype-by-sequencing and ordered using the new barley reference genome assembly. After proper accounting for genetic relatedness and structure among accessions, 45 quantitative trait loci were identified for resistance to P. graminis across all seven barley chromosomes. Three novel loci associated with resistance to TTKSK, QCCJB, MCCFC, and 92-MN-90 were identified on chromosomes 5H and 7H, and two novel loci associated with resistance to HKHJC were identified on chromosomes 1H and 3H. These novel alleles will enhance the diversity of resistance available for cultivated barley. Copyright © 2017 Sallam et al.

Barley (Hordeum vulgare) circadian clock genes can respond rapidly to temperature in an EARLY FLOWERING 3-dependent manner

Science.gov (United States)

Ford, Brett; Deng, Weiwei; Clausen, Jenni; Oliver, Sandra; Boden, Scott; Hemming, Megan; Trevaskis, Ben

2016-01-01

An increase in global temperatures will impact future crop yields. In the cereal crops wheat and barley, high temperatures accelerate reproductive development, reducing the number of grains per plant and final grain yield. Despite this relationship between temperature and cereal yield, it is not clear what genes and molecular pathways mediate the developmental response to increased temperatures. The plant circadian clock can respond to changes in temperature and is important for photoperiod-dependent flowering, and so is a potential mechanism controlling temperature responses in cereal crops. This study examines the relationship between temperature, the circadian clock, and the expression of flowering-time genes in barley (Hordeum vulgare), a crop model for temperate cereals. Transcript levels of barley core circadian clock genes were assayed over a range of temperatures. Transcript levels of core clock genes CCA1, GI, PRR59, PRR73, PRR95, and LUX are increased at higher temperatures. CCA1 and PRR73 respond rapidly to a decrease in temperature whereas GI and PRR59 respond rapidly to an increase in temperature. The response of GI and the PRR genes to changes in temperature is lost in the elf3 mutant indicating that their response to temperature may be dependent on a functional ELF3 gene. PMID:27580625

Development and validation of a terrestrial biotic ligand model predicting the effect of cobalt on root growth of barley (Hordeum vulgare)

International Nuclear Information System (INIS)

Lock, K.; De Schamphelaere, K.A.C.; Becaus, S.; Criel, P.; Van Eeckhout, H.; Janssen, C.R.

2007-01-01

A Biotic Ligand Model was developed predicting the effect of cobalt on root growth of barley (Hordeum vulgare) in nutrient solutions. The extent to which Ca 2+ , Mg 2+ , Na + , K + ions and pH independently affect cobalt toxicity to barley was studied. With increasing activities of Mg 2+ , and to a lesser extent also K + , the 4-d EC50 Co2+ increased linearly, while Ca 2+ , Na + and H + activities did not affect Co 2+ toxicity. Stability constants for the binding of Co 2+ , Mg 2+ and K + to the biotic ligand were obtained: log K CoBL = 5.14, log K MgBL = 3.86 and log K KBL = 2.50. Limited validation of the model with one standard artificial soil and one standard field soil showed that the 4-d EC50 Co2+ could only be predicted within a factor of four from the observed values, indicating further refinement of the BLM is needed. - Biotic Ligand Models are not only a useful tool to assess metal toxicity in aquatic systems but can also be used for terrestrial plants

Response of the rhizosphere prokaryotic community of barley (Hordeum vulgare L.) to elevated atmospheric CO2 concentration in open-top chambers.

Science.gov (United States)

Szoboszlay, Márton; Näther, Astrid; Mitterbauer, Esther; Bender, Jürgen; Weigel, Hans-Joachim; Tebbe, Christoph C

2017-08-01

The effect of elevated atmospheric CO 2 concentration [CO 2 ] on the diversity and composition of the prokaryotic community inhabiting the rhizosphere of winter barley (Hordeum vulgare L.) was investigated in a field experiment, using open-top chambers. Rhizosphere samples were collected at anthesis (flowering stage) from six chambers with ambient [CO 2 ] (approximately 400 ppm) and six chambers with elevated [CO 2 ] (700 ppm). The V4 region of the 16S rRNA gene was PCR-amplified from the extracted DNA and sequenced on an Illumina MiSeq instrument. Above-ground plant biomass was not affected by elevated [CO 2 ] at anthesis, but plants exposed to elevated [CO 2 ] had significantly higher grain yield. The composition of the rhizosphere prokaryotic communities was very similar under ambient and elevated [CO 2 ]. The dominant taxa were Bacteroidetes, Actinobacteria, Alpha-, Gamma-, and Betaproteobacteria. Elevated [CO 2 ] resulted in lower prokaryotic diversity in the rhizosphere, but did not cause a significant difference in community structure. © 2017 The Authors. MicrobiologyOpen published by John Wiley & Sons Ltd.

A Spectrophotometric Assay for Robust Viability Testing of Seed Batches Using 2,3,5-Triphenyl Tetrazolium Chloride: Using Hordeum vulgare L. as a Model

Directory of Open Access Journals (Sweden)

Laura Lopez Del Egido

2017-05-01

Full Text Available A comparative analysis was carried out of published methods to assess seed viability using 2,3,5-triphenyltetrazolium chloride (TTC based assays of seed batches. The tests were carried out on seeds of barley (Hordeum vulgare cv. Optic as a model. We established that 10% [w/v] trichloroacetic acid (TCA/methanol is superior to the acetone and methanol-only based methods: allowing the highest recovery of formazan and the lowest background optical density (OD readings, across seed lots comprising different ratios of viable and dead seeds. The method allowed a linear-model to accurately capture the statistically significant relationship between the quantity of formazan that could be extracted using the method we developed and the seed temperature-response, and seed viability as a function of artificially aged seed lots. Other quality control steps are defined to help ensure the assay is robust and these are reported in a Standard Operating Procedure.

Identification of two key genes controlling chill haze stability of beer in barley (Hordeum vulgare L).

Science.gov (United States)

Ye, Lingzhen; Huang, Yuqing; Dai, Fei; Ning, Huajiang; Li, Chengdao; Zhou, Meixue; Zhang, Guoping

2015-06-11

In bright beer, haze formation is a serious quality problem, degrading beer quality and reducing its shelf life. The quality of barley (Hordeum vulgare L) malt, as the main raw material for beer brewing, largely affects the colloidal stability of beer. In this study, the genetic mechanism of the factors affecting beer haze stability in barley was studied. Quantitative trait loci (QTL) analysis of alcohol chill haze (ACH) in beer was carried out using a Franklin/Yerong double haploid (DH) population. One QTL, named as qACH, was detected for ACH, and it was located on the position of about 108 cM in chromosome 4H and can explain about 20 % of the phenotypic variation. Two key haze active proteins, BATI-CMb and BATI-CMd were identified by proteomics analysis. Bioinformatics analysis showed that BATI-CMb and BATI-CMd had the same position as qACH in the chromosome. It may be deduced that BATI-CMb and BATI-CMd are candidate genes for qACH, controlling colloidal stability of beer. Polymorphism comparison between Yerong and Franklin in the nucleotide and amino acid sequence of BATI-CMb and BATI-CMd detected the corresponding gene specific markers, which could be used in marker-assisted selection for malt barley breeding. We identified a novel QTL, qACH controlling chill haze of beer, and two key haze active proteins, BATI-CMb and BATI-CMd. And further analysis showed that BATI-CMb and BATI-CMd might be the candidate genes associated with beer chill haze.

A proteomics approach to study the molecular basis of enhanced salt tolerance in barley (Hordeum vulgare L.) conferred by the root mutualistic fungus Piriformospora indica.

Science.gov (United States)

Alikhani, Mehdi; Khatabi, Behnam; Sepehri, Mozhgan; Nekouei, Mojtaba Khayam; Mardi, Mohsen; Salekdeh, Ghasem Hosseini

2013-06-01

Piriformospora indica is a root-interacting mutualistic fungus capable of enhancing plant growth, increasing plant resistance to a wide variety of pathogens, and improving plant stress tolerance under extreme environmental conditions. Understanding the molecular mechanisms by which P. indica can improve plant tolerance to stresses will pave the way to identifying the major mechanisms underlying plant adaptability to environmental stresses. We conducted greenhouse experiments at three different salt levels (0, 100 and 300 mM NaCl) on barley (Hordeum vulgare L.) cultivar "Pallas" inoculated with P. indica. Based on the analysis of variance, P. indica had a significant impact on the barley growth and shoot biomass under normal and salt stress conditions. P. indica modulated ion accumulation in colonized plants by increasing the foliar potassium (K(+))/sodium (Na(+)) ratio, as it is considered a reliable indicator of salt stress tolerance. P. indica induced calcium (Ca(2+)) accumulation and likely influenced the stress signal transduction. Subsequently, proteomic analysis of the barley leaf sheath using two-dimensional electrophoresis resulted in detection of 968 protein spots. Of these detected spots, the abundance of 72 protein spots changed significantly in response to salt treatment and P. indica-root colonization. Mass spectrometry analysis of responsive proteins led to the identification of 51 proteins. These proteins belonged to different functional categories including photosynthesis, cell antioxidant defense, protein translation and degradation, energy production, signal transduction and cell wall arrangement. Our results showed that P. indica induced a systemic response to salt stress by altering the physiological and proteome responses of the plant host.

Dawn and Dusk Set States of the Circadian Oscillator in Sprouting Barley (Hordeum vulgare Seedlings.

Directory of Open Access Journals (Sweden)

Weiwei Deng

Full Text Available The plant circadian clock is an internal timekeeper that coordinates biological processes with daily changes in the external environment. The transcript levels of clock genes, which oscillate to control circadian outputs, were examined during early seedling development in barley (Hordeum vulgare, a model for temperate cereal crops. Oscillations of clock gene transcript levels do not occur in barley seedlings grown in darkness or constant light but were observed with day-night cycles. A dark-to-light transition influenced transcript levels of some clock genes but triggered only weak oscillations of gene expression, whereas a light-to-dark transition triggered robust oscillations. Single light pulses of 6, 12 or 18 hours induced robust oscillations. The light-to-dark transition was the primary determinant of the timing of subsequent peaks of clock gene expression. After the light-to-dark transition the timing of peak transcript levels of clock gene also varied depending on the length of the preceding light pulse. Thus, a single photoperiod can trigger initiation of photoperiod-dependent circadian rhythms in barley seedlings. Photoperiod-specific rhythms of clock gene expression were observed in two week old barley plants. Changing the timing of dusk altered clock gene expression patterns within a single day, showing that alteration of circadian oscillator behaviour is amongst the most rapid molecular responses to changing photoperiod in barley. A barley EARLY FLOWERING3 mutant, which exhibits rapid photoperiod-insensitive flowering behaviour, does not establish clock rhythms in response to a single photoperiod. The data presented show that dawn and dusk cues are important signals for setting the state of the circadian oscillator during early development of barley and that the circadian oscillator of barley exhibits photoperiod-dependent oscillation states.

Long-term agricultural fertilization alters arbuscular mycorrhizal fungal community composition and barley (Hordeum vulgare) mycorrhizal carbon and phosphorus exchange.

Science.gov (United States)

Williams, Alwyn; Manoharan, Lokeshwaran; Rosenstock, Nicholas P; Olsson, Pål Axel; Hedlund, Katarina

2017-01-01

Agricultural fertilization significantly affects arbuscular mycorrhizal fungal (AMF) community composition. However, the functional implications of community shifts are unknown, limiting understanding of the role of AMF in agriculture. We assessed AMF community composition at four sites managed under the same nitrogen (N) and phosphorus (P) fertilizer regimes for 55 yr. We also established a glasshouse experiment with the same soils to investigate AMF-barley (Hordeum vulgare) nutrient exchange, using carbon ( 13 C) and 33 P isotopic labelling. N fertilization affected AMF community composition, reducing diversity; P had no effect. In the glasshouse, AMF contribution to plant P declined with P fertilization, but was unaffected by N. Barley C allocation to AMF also declined with P fertilization. As N fertilization increased, C allocation to AMF per unit of P exchanged increased. This occurred with and without P fertilization, and was concomitant with reduced barley biomass. AMF community composition showed no relationship with glasshouse experiment results. The results indicate that plants can reduce C allocation to AMF in response to P fertilization. Under N fertilization, plants allocate an increasing amount of C to AMF and receive relatively less P. This suggests an alteration in the terms of P-C exchange under N fertilization regardless of soil P status. © 2016 The Authors. New Phytologist © 2016 New Phytologist Trust.

TaMSH7: A cereal mismatch repair gene that affects fertility in transgenic barley (Hordeum vulgare L.

Directory of Open Access Journals (Sweden)

Langridge Peter

2007-12-01

Full Text Available Abstract Background Chromosome pairing, recombination and DNA repair are essential processes during meiosis in sexually reproducing organisms. Investigating the bread wheat (Triticum aestivum L. Ph2 (Pairing homoeologous locus has identified numerous candidate genes that may have a role in controlling such processes, including TaMSH7, a plant specific member of the DNA mismatch repair family. Results Sequencing of the three MSH7 genes, located on the short arms of wheat chromosomes 3A, 3B and 3D, has revealed no significant sequence divergence at the amino acid level suggesting conservation of function across the homoeogroups. Functional analysis of MSH7 through the use of RNAi loss-of-function transgenics was undertaken in diploid barley (Hordeum vulgare L.. Quantitative real-time PCR revealed several T0 lines with reduced MSH7 expression. Positive segregants from two T1 lines studied in detail showed reduced MSH7 expression when compared to transformed controls and null segregants. Expression of MSH6, another member of the mismatch repair family which is most closely related to the MSH7 gene, was not significantly reduced in these lines. In both T1 lines, reduced seed set in positive segregants was observed. Conclusion Results presented here indicate, for the first time, a distinct functional role for MSH7 in vivo and show that expression of this gene is necessary for wild-type levels of fertility. These observations suggest that MSH7 has an important function during meiosis and as such remains a candidate for Ph2.

Interactions and Toxicity of Cu-Zn mixtures to Hordeum vulgare in Different Soils Can Be Rationalized with Bioavailability-Based Prediction Models.

Science.gov (United States)

Qiu, Hao; Versieren, Liske; Rangel, Georgina Guzman; Smolders, Erik

2016-01-19

Soil contamination with copper (Cu) is often associated with zinc (Zn), and the biological response to such mixed contamination is complex. Here, we investigated Cu and Zn mixture toxicity to Hordeum vulgare in three different soils, the premise being that the observed interactions are mainly due to effects on bioavailability. The toxic effect of Cu and Zn mixtures on seedling root elongation was more than additive (i.e., synergism) in soils with high and medium cation-exchange capacity (CEC) but less than additive (antagonism) in a low-CEC soil. This was found when we expressed the dose as the conventional total soil concentration. In contrast, antagonism was found in all soils when we expressed the dose as free-ion activities in soil solution, indicating that there is metal-ion competition for binding to the plant roots. Neither a concentration addition nor an independent action model explained mixture effects, irrespective of the dose expressions. In contrast, a multimetal BLM model and a WHAM-Ftox model successfully explained the mixture effects across all soils and showed that bioavailability factors mainly explain the interactions in soils. The WHAM-Ftox model is a promising tool for the risk assessment of mixed-metal contamination in soils.

Use of Co speciation and soil properties to explain variation in Co toxicity to root growth of barley (Hordeum vulgare L.) in different soils

International Nuclear Information System (INIS)

Mico, C.; Li, H.F.; Zhao, F.J.; McGrath, S.P.

2008-01-01

The influence of soil properties on the bioavailability and toxicity of Co to barley (Hordeum vulgare L.) root elongation was investigated. Ten soils varying widely in soil properties were amended with seven doses of CoCl 2 . Soil properties greatly influenced the expression of Co toxicity. The effective concentration of added Co causing 50% inhibition (EC 50 ) ranged from 45 to 863 mg kg -1 , representing almost 20-fold variation among soils. Furthermore, we investigated Co toxicity in relation to Co concentrations and free Co 2+ activity in soil solution. The EC 50 values showed variation among soils of 17- and 29-fold, based on the Co concentration in soil solution and free Co 2+ activity, respectively. Single regressions were carried out between Co toxicity threshold values and selected soil properties. Models obtained showed that soil effective cation exchange capacity (eCEC) and exchangeable calcium were the most consistent single predictors of the EC 50 values based on soil added Co. - Soil eCEC and exchangeable Ca were found to be the best predictors of the toxicity threshold values of Co to barley root growth on different soils

Japon Balığı (Carassius Auratus L. 1758) ve Arpa Bitkisinin (Hordeum Vulgare L.) Gelişimi ve Su Kalitesinin İyileştirilmesi Üzerine Aquaponik Sistemin Etkileri

OpenAIRE

KESKİNBALTA, Mehmet Anıl; HAMZAOĞLU, Gökhan; ÇELİK, Meryem Yeşim; DERNEKBAŞI, Seval

2015-01-01

Bu araştırmada, Japon balığı (Carassius auratus L. 1758) ve arpa bitkisi (Hordeum vulgare L.) kullanılarak model bir akuaponik sistem oluşturulmuştur. Araştırma süresince arpa bitkisinin suyun nitrit, nitrat ve fosfat değerlerinde yaptığı değişim ve balıkların gelişimi üzerindeki etkilerinin belirlenmesi amaçlanmıştır. 30 günlük araştırma süresince günlük olarak pH, sıcaklık ve oksijen değerleri ölçülmüştür. Haftalık olarak bitki yetiştirme yatağına giren ve bitkiden süzülen suyun nitrit (NO2...

Japon Balığı (Carassius auratus L. 1758) ve Arpa Bitkisinin (Hordeum vulgare L.) Gelişimi ve Su Kalitesinin İyileştirilmesi Üzerine Aquaponik Sistemin Etkileri

OpenAIRE

KESKİNBALTA, Mehmet; HAMZAOĞLU, Gökhan; ÇELİK, Meryem; DERNEKBAŞI, Seval

2015-01-01

Bu araştırmada, Japon balığı (Carassius auratus L. 1758) ve arpa bitkisi (Hordeum vulgare L.) kullanılarak model bir akuaponik sistem oluşturulmuştur. Araştırma süresince arpa bitkisinin suyun nitrit, nitrat ve fosfat değerlerinde yaptığı değişim ve balıkların gelişimi üzerindeki etkilerinin belirlenmesi amaçlanmıştır. 30 günlük araştırma süresince günlük olarak pH, sıcaklık ve oksijen değerleri ölçülmüştür. Haftalık olarak bitki yetiştirme yatağına giren ve bitkiden süzülen suyun nitrit (NO2...

Differential responses of two Egyptian barley (Hordeum vulgare L.) cultivars to salt stress.

Science.gov (United States)

Elsawy, Hayam I A; Mekawy, Ahmad Mohammad M; Elhity, Mahmoud A; Abdel-Dayem, Sherif M; Abdelaziz, Maha Nagy; Assaha, Dekoum V M; Ueda, Akihiro; Saneoka, Hirofumi

2018-06-01

Although barley (Hordeum vulgare L.) is considered a salt tolerant crop species, productivity of barley is affected differently by ionic, osmotic, and oxidative stresses resulting from a salty rhizosphere. The current study was conducted to elucidate the mechanism of salt tolerance in two barley cultivars, Giza128 and Giza126. The two cultivars were exposed to 200 mM NaCl hydroponically for 12 days. Although both cultivars accumulated a large amount of Na + in their leaves with similar concentrations, the growth of Giza128 was much better than that of Giza126, as measured by maintaining a higher dry weight, relative growth rate, leaf area, and plant height. To ascertain the underlying mechanisms of this differential tolerance, first, the relative expression patterns of the genes encoding Na + /H + antiporters (NHX) and the associated proton pumps (V-PPase and V-ATPase) as well as the gene encoding the plasma membrane PM H + -ATPase were analyzed in leaf tissues. Salt stress induced higher HvNHX1 expression in Giza128 (3.3-fold) than in Giza126 (1.9-fold), whereas the expression of the other two genes, HvNHX2 and HvNHX3, showed no induction in either cultivar. The expression of HvHVP1 and HvHVA was higher in Giza128 (3.8- and 2.1-fold, respectively) than in Giza126 (1.6- and 1.1-fold, respectively). The expression of the PM H + -ATPase (ha1) gene was induced more in Giza128 (8.8-fold) than in Giza126 (1.8-fold). Second, the capacity for ROS detoxification was assessed using the oxidative stress biomarkers electrolyte leakage ratio (ELR) and the concentrations of malondialdehyde (MDA) and hydrogen peroxide (H 2 O 2 ), and these parameters sharply increased in Giza126 leaves by 66.5%, 42.8% and 50.0%, respectively, compared with those in Giza128 leaves. The antioxidant enzyme (CAT, APX, sPOD, GR, and SOD) activities were significantly elevated by salt treatment in Giza128 leaves, whereas in Giza126, these activities were not significantly altered. Overall, the

Direct Effects of Physcion, Chrysophanol, Emodin, and Pachybasin on Germination and Appressorium Formation of the Barley ( Hordeum vulgare L.) Powdery Mildew Fungus Blumeria graminis f. sp. hordei (DC.) Speer.

Science.gov (United States)

Hildebrandt, Ulrich; Marsell, Alexander; Riederer, Markus

2018-04-04

Several anthraquinone derivatives are active components of fungicidal formulations particularly effective against powdery mildew fungi. The antimildew effect of compounds such as physcion and chrysophanol is largely attributed to host plant defense induction. However, so far a direct fungistatic/fungicidal effect of anthraquinone derivatives on powdery mildew fungi has not been unequivocally demonstrated. By applying a Formvar-based in vitro system we demonstrate a direct, dose-dependent effect of physcion, chrysophanol, emodin, and pachybasin on conidial germination and appressorium formation of Blumeria graminis f. sp. hordei (DC.) Speer, the causative agent of barley ( Hordeum vulgare L.) powdery mildew. Physcion was the most effective among the tested compounds. At higher doses, physcion mainly inhibited conidial germination. At lower rates, however, a distinct interference with appressorium formation became discernible. Physcion and others may act by modulating both the infection capacity of the powdery mildew pathogen and host plant defense. Our results suggest a specific arrangement of substituents at the anthraquinone backbone structure being crucial for the direct antimildew effect.

Improving phenolic bioactive-linked anti-hyperglycemic functions of dark germinated barley sprouts (Hordeum vulgare L.) using seed elicitation strategy.

Science.gov (United States)

Ramakrishna, Ramnarain; Sarkar, Dipayan; Manduri, Avani; Iyer, Shreyas Ganesan; Shetty, Kalidas

2017-10-01

Sprouts of cereal grains, such as barley ( Hordeum vulgare L.), are a good source of beneficial phenolic bioactives. Such health relevant phenolic bioactives of cereal sprouts can be targeted to manage chronic hyperglycemia and oxidative stress commonly associated with type 2 diabetes (T2D). Therefore improving phenolic bioactives by stimulating plant endogenous defense responses such as protective pentose phosphate pathway (PPP) during sprouting has significant merit. Based on this metabolic rationale, this study aimed to enhance phenolic bioactives and associated antioxidant and anti-hyperglycemic functions in dark germinated barley sprouts using exogenous elicitor treatments. Dark-germinated sprouts of two malting barley cultivars (Pinnacle and Celebration), treated with chitosan oligosaccharide (COS) and marine protein hydrolysate (GP), were evaluated. Total soluble phenolic content (TSP), phenolic acid profiles, total antioxidant activity (TA) and in vitro inhibitory activities of hyperglycemia relevant α-amylase and α-glucosidase enzymes of the dark germinated barley sprouts were evaluated at day 2, 4, and 6 post elicitor treatments. Overall, TSP content, TA, and α-amylase inhibitory activity of dark germinated barley sprouts decreased, while α-glucosidase inhibitory activity and gallic acid content increased from day 2 to day 6. Among barley cultivars, high phenolic antioxidant-linked anti-hyperglycemic bioactives were observed in Celebration. Furthermore, GP and COS seed elicitor treatments in selective doses improved T2D relevant phenolic-linked anti-hyperglycemic bioactives of barley spouts at day 6. Therefore, such seed elicitation approach can be strategically used to develop bioactive enriched functional food ingredients from cereal sprouts targeting chronic hyperglycemia and oxidative stress linked to T2D.

Effects of Cerium and Titanium Oxide Nanoparticles in Soil on the Nutrient Composition of Barley (Hordeum vulgare L. Kernels

Directory of Open Access Journals (Sweden)

Filip Pošćić

2016-06-01

Full Text Available The implications of metal nanoparticles (MeNPs are still unknown for many food crops. The purpose of this study was to evaluate the effects of cerium oxide (nCeO2 and titanium oxide (nTiO2 nanoparticles in soil at 0, 500 and 1000 mg·kg−1 on the nutritional parameters of barley (Hordeum vulgare L. kernels. Mineral nutrients, amylose, β-glucans, amino acid and crude protein (CP concentrations were measured in kernels. Whole flour samples were analyzed by ICP-AES/MS, HPLC and Elemental CHNS Analyzer. Results showed that Ce and Ti accumulation under MeNPs treatments did not differ from the control treatment. However, nCeO2 and nTiO2 had an impact on composition and nutritional quality of barley kernels in contrasting ways. Both MeNPs left β-glucans unaffected but reduced amylose content by approximately 21%. Most amino acids and CP increased. Among amino acids, lysine followed by proline saw the largest increase (51% and 37%, respectively. Potassium and S were both negatively impacted by MeNPs, while B was only affected by 500 mg nCeO2·kg−1. On the contrary Zn and Mn concentrations were improved by 500 mg nTiO2·kg−1, and Ca by both nTiO2 treatments. Generally, our findings demonstrated that kernels are negatively affected by nCeO2 while nTiO2 can potentially have beneficial effects. However, both MeNPs have the potential to negatively impact malt and feed production.

Effect of soil nutrients reserves and level of fertilisation on production parameters of spring barley (Hordeum vulgare L.

Directory of Open Access Journals (Sweden)

Petr Škarpa

2006-01-01

Full Text Available The effect of three different doses of basic fertilisers and a subsequent pre-sowing supplementary fertilisation on production parameters (yield of grain, number of spikes, and thousand grains weight was evaluated using experimental data obtained within the framework of a one-year pot experiment with spring barley (Hordeum vulgare L. established at the Department of Agrochemistry and Plant Nutrition, Faculty of Agronomy, Mendel University of Agriculture and Forestry Brno in 2003. Results of statistical analysis indicated that the yield of grain was significantly influenced by different doses of fertilisers especially on sandy soils. As compared with control, the second highest dose of fertilisers (i.e. 83 kg N, 31 kg P and 92 kg K.ha–1 increased the yield by 91.7 % and the third one (i.e. 113 kg N, 43 kg P and 125 kg K.ha–1 even by 124.8 %. This increase in the grain yield was positively affected above all by increasing doses of nitrogen fertilisers. A pre-sowing application of P, K and Mg showed also a positive effect on grain yield not only on sandy but above all on clay soils (as compared with non-fertilised control, this increase ranged from 40.6 to 50.2%. Fertilisation showed also a marked effect on the number of spikes. This factor showed a similar trend as the yield of grain. The thousand grains weight was not significantly influenced on both soil types. This value was increased (by 2.9% to 14.8% after the application of fertilisers prior to sowing but the difference was statistically non-significant.

Molecular dynamics simulations revealed structural differences among WRKY domain-DNA interaction in barley (Hordeum vulgare).

Science.gov (United States)

Pandey, Bharati; Grover, Abhinav; Sharma, Pradeep

2018-02-12

The WRKY transcription factors are a class of DNA-binding proteins involved in diverse plant processes play critical roles in response to abiotic and biotic stresses. Genome-wide divergence analysis of WRKY gene family in Hordeum vulgare provided a framework for molecular evolution and functional roles. So far, the crystal structure of WRKY from barley has not been resolved; moreover, knowledge of the three-dimensional structure of WRKY domain is pre-requisites for exploring the protein-DNA recognition mechanisms. Homology modelling based approach was used to generate structures for WRKY DNA binding domain (DBD) and its variants using AtWRKY1 as a template. Finally, the stability and conformational changes of the generated model in unbound and bound form was examined through atomistic molecular dynamics (MD) simulations for 100 ns time period. In this study, we investigated the comparative binding pattern of WRKY domain and its variants with W-box cis-regulatory element using molecular docking and dynamics (MD) simulations assays. The atomic insight into WRKY domain exhibited significant variation in the intermolecular hydrogen bonding pattern, leading to the structural anomalies in the variant type and differences in the DNA-binding specificities. Based on the MD analysis, residual contribution and interaction contour, wild-type WRKY (HvWRKY46) were found to interact with DNA through highly conserved heptapeptide in the pre- and post-MD simulated complexes, whereas heptapeptide interaction with DNA was missing in variants (I and II) in post-MD complexes. Consequently, through principal component analysis, wild-type WRKY was also found to be more stable by obscuring a reduced conformational space than the variant I (HvWRKY34). Lastly, high binding free energy for wild-type and variant II allowed us to conclude that wild-type WRKY-DNA complex was more stable relative to variants I. The results of our study revealed complete dynamic and structural information

Low-Resolution Structure of the Full-Length Barley (Hordeum vulgare) SGT1 Protein in Solution, Obtained Using Small-Angle X-Ray Scattering

Science.gov (United States)

Taube, Michał; Pieńkowska, Joanna R.; Jarmołowski, Artur; Kozak, Maciej

2014-01-01

SGT1 is an evolutionarily conserved eukaryotic protein involved in many important cellular processes. In plants, SGT1 is involved in resistance to disease. In a low ionic strength environment, the SGT1 protein tends to form dimers. The protein consists of three structurally independent domains (the tetratricopeptide repeats domain (TPR), the CHORD- and SGT1-containing domain (CS), and the SGT1-specific domain (SGS)), and two less conserved variable regions (VR1 and VR2). In the present study, we provide the low-resolution structure of the barley (Hordeum vulgare) SGT1 protein in solution and its dimer/monomer equilibrium using small-angle scattering of synchrotron radiation, ab-initio modeling and circular dichroism spectroscopy. The multivariate curve resolution least-square method (MCR-ALS) was applied to separate the scattering data of the monomeric and dimeric species from a complex mixture. The models of the barley SGT1 dimer and monomer were formulated using rigid body modeling with ab-initio structure prediction. Both oligomeric forms of barley SGT1 have elongated shapes with unfolded inter-domain regions. Circular dichroism spectroscopy confirmed that the barley SGT1 protein had a modular architecture, with an α-helical TPR domain, a β-sheet sandwich CS domain, and a disordered SGS domain separated by VR1 and VR2 regions. Using molecular docking and ab-initio protein structure prediction, a model of dimerization of the TPR domains was proposed. PMID:24714665

Development and Validation of a Reversed-Phase Liquid Chromatography Method for the Simultaneous Determination of Indole-3-Acetic Acid, Indole-3-Pyruvic Acid, and Abscisic Acid in Barley (Hordeum vulgare L.).

Science.gov (United States)

Nakurte, Ilva; Keisa, Anete; Rostoks, Nils

2012-01-01

A simple, sensitive, precise, and specific reverse HPLC method was developed and validated for the determination of plant hormones in barley (Hordeum vulgare L.). The method includes extraction in aqueous organic solvent followed by solid-phase extraction, sample evaporation, and reversed-phase HPLC analysis in a general purpose UV-visible (abscisic acid (ABA)) and fluorescence detection (indole-3-acetic acid (IAA) and indole-3-pyruvic acid (IPA)), high-performance liquid chromatography system. The separation was carried out on Zorbax Eclipse XDB C8 column (150  ×  4.6  mm I.D) with a mobile phase composed of methanol and 1% acetic acid (60 : 40 v/v) in isocratic mode at a flow rate of 1 ml min(-1). The detection was monitored at 270 nm (ABA) and at 282 nm (Ex) and 360 nm (Em) (IAA, IPA). The developed method was validated in terms of accuracy, precision, linearity, limit of detection, limit of quantification, and robustness. The determined validation parameters are in the commonly acceptable ranges for that kind of analysis.

Registration of Food Barley (Hordeum vulgare L.) Variety HB 1307 ...

African Journals Online (AJOL)

Six-rowed food type barley, HB 1307, was developed by Holetta Agricultural Research Center (HARC) from a cross between a landrace line and exotic germplasm (Awra gebs-1 x IBON93/91) and released in 2006 for mid and high altitude areas. The three consecutive years\\' (2002-2004) tests proved its superiority in grain ...

Salinity tolerance in barley (hordeum vulgare l.): effects of varying NaCl, K/sup +/ Na/sup +/ and NaHCO/sub 3/ levels on cultivars differing in tolerance

International Nuclear Information System (INIS)

Mahmood, K.

2011-01-01

Although barley (Hordeum vulgare L.) is regarded as salt tolerant among crop plants, its growth and plant development is severely affected by ionic and osmotic stresses in salt-affected soils. To elucidate the tolerance mechanism, growth and ion uptake of three barley cultivars, differing in salt tolerance, were examined under different levels of NaCl, K/sup +/ Na/sup +/ and NaHCO/sub 3/ in the root medium. The cultivars differed greatly in their responses to varying root medium conditions. Plant growth was more adversely affected by NaHCO/sub 3/ than NaCl. In general, biomass yields were comparable under control and 100 mM NaCl. However, growth of all three cultivars was significantly inhibited by NaHCO/sub 3/ even at low concentration (10 mM). Improved K/sup +/ supply in saline medium increased K/sup +/ uptake and growth of less tolerant cultivars. K/sup +/ uptake was more adversely affected by NaHCO/sub 3/ than NaCl salinity. Selective K/sup +/ uptake and lower Cl/sup -/ in shoots seemed to be associated with the growth responses. K application would help better growth of these cultivars on K-deficient saline-sodic soils and under irrigation with poor quality water having high Residual Sodium Carbonate (RSC) and/or Sodium Adsorption Ratio (SAR). (author)

Foliar flavonoids from Tanacetum vulgare var. boreale and their geographical variation.

Science.gov (United States)

Uehara, Ayumi; Akiyama, Shinobu; Iwashina, Tsukasa

2015-03-01

Foliar flavonoids of Tanacetum vulgare var. boreale were isolated. Eight flavonoid glycosides, 7-O-glucosides of apigenin, luteolin, scutellarein and 6- hydroxyluteolin, and 7-O-glucuronides of apigenin, luteolin, chrysoeriol and eriodictyol were identified. Moreover, eight flavonoid aglycones, apigenin, luteolin, hispidulin, nepetin, eupatilin, jaceosidin, pectolinarigenin and axillarin were also isolated and identified. The flavonoid composition of two varieties of T. vulgare, i.e. var. boreale and var. vulgare, were compared. All samples of var. boreale and one sample of var. vulgare had the same flavonoid pattern, and could be distinguished from almost all the samples of var. vulgare. Thus, the occurrence of chemotypes, which are characterized by either the presence or absence of scutellarein 7-O-glucoside, eriodictyol 7-O-glucuronide and pectolinarigenin was shown in T. vulgare sensu lato.

Population structure revealed by different marker types (SSR or DArT) has an impact on the results of genome-wide association mapping in European barley cultivars

NARCIS (Netherlands)

Matthies, I.E.; Hintum, van T.J.L.; Weise, S.; Röder, M.S.

2012-01-01

Diversity arrays technology (DArT) and simple sequence repeat (SSR) markers were applied to investigate population structure, extent of linkage disequilibrium and genetic diversity (kinship) on a genome-wide level in European barley (Hordeum vulgare L.) cultivars. A set of 183 varieties could be

Giemsa C-banding in two polyploid, South American Hordeum species, H. tetraploidum and H. lechleri, and their aneuploid hybrids with H. vulgare

DEFF Research Database (Denmark)

Linde-Laursen, Ib; Bothmer, R. von

1986-01-01

. The hybrids were stably aneuploid. Both had lost and acquired H. vulgare chromosomes. Thus, somatic elimination of chromosomes was combined with multiplication of chromosomes. The observations of stably aneuploid hybrids have implications for the exploitation of alien germplasm. The activity of non-H. vulgare...

Detection of QTLs for seedling characteristics in barley (Hordeum vulgare L.) grown under hydroponic culture condition.

Science.gov (United States)

Wang, Qifei; Sun, Genlou; Ren, Xifeng; Wang, Jibin; Du, Binbin; Li, Chengdao; Sun, Dongfa

2017-11-07

Seedling characteristics play significant roles in the growth and development of barley (Hordeum vulgare L.), including stable stand establishment, water and nutrients uptake, biotic resistance and abiotic stresses, and can influence yield and quality. However, the genetic mechanisms underlying seedling characteristics in barley are largely unknown and little research has been done. In the present work, 21 seedling-related characteristics are assessed in a barley double haploid (DH) population, grown under hydroponic conditions. Of them, leaf age (LAG), shoot height (SH), maximum root length (MRL), main root number (MRN) and seedling fresh weight (SFW) were investigated at the 13th, 20th, 27th, and 34th day after germination. The objectives were to identify quantitative trait loci (QTLs) underlying these seedling characteristics using a high-density linkage map and to reveal the QTL expression pattern by comparing the QTLs among four different seedling growth stages. A total of 70 QTLs were distributed over all chromosomes except 4H, and, individually, accounted for 5.01%-77.78% of phenotypic variation. Out of the 70 detected QTLs, 23 showed a major effect on 14 seedling-related characteristics. Ten co-localized chromosomal regions on 2H (five regions), 3H (two regions) and 7H (three regions) involved 39 QTLs (55.71%), each simultaneously influenced more than one trait. Meanwhile, 9 co-localized genomic regions involving 22 QTLs for five seedling characteristics (LAG, SH, MRL, MRN and SFW) at the 13th, 20th, 27th and 34th day-old seedling were common for two or more growth stages of seedling. QTL in the vicinity of Vrs1 locus on chromosome 2H with the favorable alleles from Huadamai 6 was found to have the largest main effects on multiple seedling-related traits. Six QTL cluster regions associated with 16 seedling-related characteristics were observed on chromosome 2H, 3H and 7H. The majority of the 29 regions identified for five seedling characteristics were

An eceriferum locus, cer-zv, is associated with a defect in cutin responsible for water retention in barley (Hordeum vulgare) leaves.

Science.gov (United States)

Li, Chao; Wang, Aidong; Ma, Xiaoying; Pourkheirandish, Mohammad; Sakuma, Shun; Wang, Ning; Ning, Shunzong; Nevo, Eviatar; Nawrath, Christiane; Komatsuda, Takao; Chen, Guoxiong

2013-03-01

Drought limits plant growth and threatens crop productivity. A barley (Hordeum vulgare) ethylene imine-induced monogenic recessive mutant cer-zv, which is sensitive to drought, was characterized and genetically mapped in the present study. Detached leaves of cer-zv lost 34.2 % of their initial weight after 1 h of dehydration. The transpiration was much higher in cer-zv leaves than in wild-type leaves under both light and dark conditions. The stomata of cer-zv leaves functioned normally, but the cuticle of cer-zv leaves showed increased permeability to ethanol and toluidine blue dye. There was a 50-90 % reduction in four major cutin monomers, but no reduction in wax loads was found in the cer-zv mutant as compared with the wild type. Two F(2) mapping populations were established by the crosses of 23-19 × cer-zv and cer-zv × OUH602. More polymorphisms were found in EST sequences between cer-zv and OUH602 than between cer-zv and 23-19. cer-zv was located in a pericentromeric region on chromosome 4H in a 10.8 cM interval in the 23-19 × cer-zv map based on 186 gametes tested and a 1.7 cM interval in the cer-zv × OUH602 map based on 176 gametes tested. It co-segregated with EST marker AK251484 in both maps. The results indicated that the cer-zv mutant is defective in cutin, which might be responsible for the increased transpiration rate and drought sensitivity, and that the F(2) of cer-zv × OUH602 might better facilitate high resolution mapping of cer-zv.

Phylogenetic and comparative gene expression analysis of barley (Hordeum vulgare)WRKY transcription factor family reveals putatively retained functions betweenmonocots and dicots

Energy Technology Data Exchange (ETDEWEB)

Mangelsen, Elke; Kilian, Joachim; Berendzen, Kenneth W.; Kolukisaoglu, Uner; Harter, Klaus; Jansson, Christer; Wanke, Dierk

2008-02-01

WRKY proteins belong to the WRKY-GCM1 superfamily of zinc finger transcription factors that have been subject to a large plant-specific diversification. For the cereal crop barley (Hordeum vulgare), three different WRKY proteins have been characterized so far, as regulators in sucrose signaling, in pathogen defense, and in response to cold and drought, respectively. However, their phylogenetic relationship remained unresolved. In this study, we used the available sequence information to identify a minimum number of 45 barley WRKY transcription factor (HvWRKY) genes. According to their structural features the HvWRKY factors were classified into the previously defined polyphyletic WRKY subgroups 1 to 3. Furthermore, we could assign putative orthologs of the HvWRKY proteins in Arabidopsis and rice. While in most cases clades of orthologous proteins were formed within each group or subgroup, other clades were composed of paralogous proteins for the grasses and Arabidopsis only, which is indicative of specific gene radiation events. To gain insight into their putative functions, we examined expression profiles of WRKY genes from publicly available microarray data resources and found group specific expression patterns. While putative orthologs of the HvWRKY transcription factors have been inferred from phylogenetic sequence analysis, we performed a comparative expression analysis of WRKY genes in Arabidopsis and barley. Indeed, highly correlative expression profiles were found between some of the putative orthologs. HvWRKY genes have not only undergone radiation in monocot or dicot species, but exhibit evolutionary traits specific to grasses. HvWRKY proteins exhibited not only sequence similarities between orthologs with Arabidopsis, but also relatedness in their expression patterns. This correlative expression is indicative for a putative conserved function of related WRKY proteins in mono- and dicot species.

A Substantial Fraction of Barley (Hordeum vulgare L. Low Phytic Acid Mutations Have Little or No Effect on Yield across Diverse Production Environments

Directory of Open Access Journals (Sweden)

Victor Raboy

2015-04-01

Full Text Available The potential benefits of the low phytic acid (lpa seed trait for human and animal nutrition, and for phosphorus management in non-ruminant animal production, are well documented. However, in many cases the lpa trait is associated with impaired seed or plant performance, resulting in reduced yield. This has given rise to the perception that the lpa trait is tightly correlated with reduced yield in diverse crop species. Here we report a powerful test of this correlation. We measured grain yield in lines homozygous for each of six barley (Hordeum vulgare L. lpa mutations that greatly differ in their seed phytic acid levels. Performance comparisons were between sibling wild-type and mutant lines obtained following backcrossing, and across two years in five Idaho (USA locations that greatly differ in crop yield potential. We found that one lpa mutation (Hvlpa1-1 had no detectable effect on yield and a second (Hvlpa4-1 resulted in yield losses of only 3.5%, across all locations. When comparing yields in three relatively non-stressful production environments, at least three lpa mutations (Hvlpa1-1, Hvlpa3-1, and Hvlpa4-1 typically had yields similar to or within 5% of the wild-type sibling isoline. Therefore in the case of barley, lpa mutations can be readily identified that when simply incorporated into a cultivar result in adequately performing lines, even with no additional breeding for performance within the lpa line. In conclusion, while some barley lpa mutations do impact field performance, a substantial fraction appears to have little or no effect on yield.

Radiosensitivity study of cultured barley (hordeum vulgare)

International Nuclear Information System (INIS)

Wang Cailian; Shen Mei; Xu Gang; Zhao Kongnan; Chen Qiufang

1991-07-01

For studying the radioactivity, forty seven varieties of dormant barley seeds were irradiated with various doses (0 ∼ 400 Gy) of 137 Cs γ-rays. The results showed that the dose-effects relations of seedling growth inhibition could be fitted by an equation of F(D) = 1 - (1 - e -a 1 D ) N , and the dose-effects of cell-nucleus, the frequency of root tip cell with chromosome aberations and peroxidase isoenzyme band could be expressed by a linear regression equation Y = A + B · X. The radioactivity of naked barley was much higher than of covered barley. According to different radiosensitivities the varieties studied could be divided into five types i.e. extreme resistant, resistant, intermediate, sensitive, and extreme sensitive. The results also showed that there was close relationship between the DNA content of cell-nucleus, peroxidase isoenzyme zymogram and radioactivity. The radiosensitivty was proportional to the DNA content. The volume of cell-nucleus varied inversly as D 50 of nucleus volume and no obvious correlation with the D 50 of seedling growth inhibition

Starch and Free Sugars during Kernel Development of Bomi Barley and its High-Lysine Mutant 1508

DEFF Research Database (Denmark)

Kreis, Michael

1978-01-01

At maturity the high-lysine barley (Hordeum vulgare L.) Ris0 mutants 1508, 527 and 29 kernels contained about 20% less starch and twice as much free sugars as the parent varieties Bomi and Carlsberg II. An enhanched effect on starch reduction and free sugar accumulation was observed during kernel...

Single and combined toxicity of copper and cadmium to H. vulgare growth and heavy metal bioaccumulation

Directory of Open Access Journals (Sweden)

Žaltauskaitė J.

2013-04-01

Full Text Available The single and combined effects of copper (Cu and cadmium (Cd (0.1-10 mg L−1 in spring barley (Hordeum vulgare L. plants grown in hydroponics are investigated. The aim of the study was to investigate the interactive effect of the binary mixture of Cu and Cd to the growth of H. vulgare and accumulation of these metals by the plants. Single and combined metal treatment led to major effects in the growth of roots and shoots and dry weight of barley. Exposure to metals altered the content of photosynthetic pigments and caused lipid peroxidation. It was observed that combined effects of heavy metals to plants are endpoint and concentration depending. The binary mixture Cu+Cd exhibited additive or less than additive interaction for dry weight, root length and shoot height. Analysis of tissue metal concentrations showed that Cu and Cd were mainly accumulated in the roots and the combination of Cu+Cd had less than additive response of metal bioaccumulation in the leaves and roots.

108-110 Registration of Guta Barley (Hordeium vulgare L.)

African Journals Online (AJOL)

adoption potential by the local farmers. Keywords: Guta; Barley (Hordeium vulgare L); Yield ... evaluated along with Aruso and Shage as the local and standard variety, respectively at altitudinal range of 2400- ... 6. Farmers Evaluation of the Variety. To evaluate the perception and preferences of the local farmers, farmers' ...

Chemical composition and antioxidant activity of Origanum vulgare subsp. vulgare essential oil from Iran

Directory of Open Access Journals (Sweden)

M. Vazirian

2015-12-01

Full Text Available Background and Objectives: Essential oils are very complex mixture of components and their composition may vary in different species or varieties or even within the same variety. Origanum vulgare L. subsp. vulgare is one of the most distributed subspecies within the genus Origanum and has been found to be a poor-oil, categorized in cymyl, bornane or sabinyl chemotypes with higher proportion of sesquiterpenes. In this experiment, the Iranian sample was studied for the chemical composition of the oil and evaluation of its antioxidant activity. Methods: Essential oil was obtained by hydro-distillation and analyzed by GC/MS for determination of components. Antioxidant activity was evaluated by radical scavenging ability (DPPH method and reducing power (FRAP assay. Results: The sample belonged to “thymol” chemotype with the main components as thymol (37.13%, gama-terpinene (9.67%, carvacrol (9.57%, carvacrol methyl ether (6.88, cis-alpha-bisabolene (6.80%, eucalyptol (3.82%, p-cymene (3.58% and elemol (2.04%. The oil of plant showed very strong antioxidant activity (IC50=2.5 µg/mL in DPPH method, which was stronger than the standard antioxidants (Vit E and BHA, p

Effects of Net Blotch ( Pyrenophora teres ) on Malt Barley Yield and ...

African Journals Online (AJOL)

Barley (Hordeum vulgare L.) production is constrained by diseases such as net blotch caused by Pyrenophora teres Drechsl. The objectives of this study were to assess the effects of net blotch disease on malt barley yield and grain quality under natural infection. Four malt barley varieties (Beka, HB 120, HB 52 and Holker), ...

Hydrotime Analysis of Yellow Sweetclover (Melilotus officinalis (L. Lam., Wild Mustard (Sinapis arvensis L. and Barley (Hordeum vulgare L. Seed Germination

Directory of Open Access Journals (Sweden)

A. Derakhshan

2017-01-01

Full Text Available Introduction: Seed germination is one of the key stages in the life cycle of plants that can ultimately affect their fitness in the environment. The temporal pattern of seed germination is extremely depended on the soil water potential (Ψ of the germination medium, as this determines the equilibrium water content of the seed. As for temperature, there is a minimum Ψ that must be exceeded in order for seeds complete germination, and seeds in a population vary in the value of this minimum or base Ψ. The germination of a seed population in response to the reduced water potential is modeled using the hydrotime model. According to this model, the time to germination for a given seed fraction (g is inversely related to the difference between the current seed Ψ and the base water potential (Ψb for that fraction (Ψb(g. The hydrotime model functions are well in matching both the timing and the percentage of germination of seed populations in relation to their Ψ environment. In addition, the model outputs which are significant physiologically and ecologically and the parameters of the model can be used to characterize the properties of seed populations. Normal distribution of Ψb among seeds within a population is one of the assumptions of the hydrotime model. However, this assumption may not be met in many species and thus can result in poor predictions. We tried to investigate empirically the validity of this assumption, to compare the fit of alternative distributions and make recommendations to improve germination modeling procedures. Materials and Methods: Seed germination of Melilotus officinalis, Sinapis arvensis and Hordeum vulgare were tested across a range of water potentials (0, -0.2, -0.4, -0.6 and -0.8 MPa for M. officinalis and S. arvensis and 0, -0.3, -0.6, -0.9, -1.2 and -1.5 MPa for H. vulgare and germination responses were described by the hydrotime models based on twelve statistical functions including Normal, Beta, Gamma

Diversity in Indian barley (Hordeum vulgare) cultivars and ...

Indian Academy of Sciences (India)

tinguish varieties of crop plants and establish their purity as a prerequisite for any ... of genetic material in germplasm collection and as a general guide for the choice ... Sixty-nine barley cultivars were grown under field condi- tions in three ...

Evaluation of phytotoxicity effect of olive mill wastewater treated by different technologies on seed germination of barley (Hordeum vulgare L.).

Science.gov (United States)

Rusan, Munir J M; Albalasmeh, Ammar A; Zuraiqi, Said; Bashabsheh, Mohammad

2015-06-01

Olive-mill wastewater (OMW) is a by-product effluent of olive oil extraction process that is produced in large amount in the Mediterranean region. OMW is believed to induce phytotoxic effect on organisms including seed germination and plant growth. The objective of this study was to evaluate the impact of untreated and treated OMW with different techniques on seed germination of barley (Hordeum vulgare L.). The following treatments were investigated: (1) tap water (control); (2) OMW treated by aerobic biological technology in a Jacto Reactor (JR); (3) OMW treated by solar fenton oxidation (SFO); (4) OMW treated by microfiltration followed by nanofiltration (MF+NF); (5) OMW treated by microfiltration followed by reverse osmosis (MF+RO) process; (6) diluted OMW with tap water (25 % OMW); (7) diluted OMW with tap water (50 % OMW); (8) diluted OMW with tap water (75 % OMW); and (9) untreated OMW (100 % OMW). A germination test was conducted in an incubator at temperature of 23 (∘)C. In each petri dish, a filter paper was mounted and ten seeds of barley were placed on the filter paper. Five milliliter of water were added to each petri dish. The seed germination was determined by counting the number of germinated seeds to calculate the percentage of germination (G %). Germination rate index (GRI), seed vigor index (SVI), and phytotoxicity index (PI) were also calculated. Then, the dry weights and lengths of the shoots and the roots of the germinated seeds were measured. The results show that 100, 75, and 50 %OMW were very phytotoxic and completely prohibited seed germination. However, phytotoxicity decreased significantly following treatments of OMW with all techniques investigated and by the 25 % OMW dilution, as results of removing the phenols and other phytotoxic organic compounds from the OMW or by diluting it. This was evidenced by relative enhancement of the dry weights and lengths of shoot and root as well as the G %, GRI, SVG, and PI. It was concluded that if

Leaf rust of cultivated barley: pathology and control.

Science.gov (United States)

Park, Robert F; Golegaonkar, Prashant G; Derevnina, Lida; Sandhu, Karanjeet S; Karaoglu, Haydar; Elmansour, Huda M; Dracatos, Peter M; Singh, Davinder

2015-01-01

Leaf rust of barley is caused by the macrocyclic, heteroecious rust pathogen Puccinia hordei, with aecia reported from selected species of the genera Ornithogalum, Leopoldia, and Dipcadi, and uredinia and telia occurring on Hordeum vulgare, H. vulgare ssp. spontaneum, Hordeum bulbosum, and Hordeum murinum, on which distinct parasitic specialization occurs. Although Puccinia hordei is sporadic in its occurrence, it is probably the most common and widely distributed rust disease of barley. Leaf rust has increased in importance in recent decades in temperate barley-growing regions, presumably because of more intensive agricultural practices. Although total crop loss does not occur, under epidemic conditions yield reductions of up to 62% have been reported in susceptible varieties. Leaf rust is primarily controlled by the use of resistant cultivars, and, to date, 21 seedling resistance genes and two adult plant resistance (APR) genes have been identified. Virulence has been detected for most seedling resistance genes but is unknown for the APR genes Rph20 and Rph23. Other potentially new sources of APR have been reported, and additivity has been described for some of these resistances. Approaches to achieving durable resistance to leaf rust in barley are discussed.

Comparison of foliar anatomy of ten bread wheat (triticum, poaceae) and ten barley (hordeum, poaceae) cultivars

International Nuclear Information System (INIS)

Ardic, M.; Sezer, O.; Ozgdsd, K.; Yaylaci, O. K.; Koyuncu, O.; Olgun, M.; Bascdftcd, Z. B.; Ayter, N. G.

2015-01-01

The aim of this study is to determine anatomical differences and classification of leaf and leaf cell characteristics (cuticle thickness, upper epidermis thickness, lower epidermis thickness, mesophyll thickness, parenchyma thickness and leaf thickness) between 10 bread wheat cultivars (Triticum aestivum L.) and 10 barley cultivars (Hordeum vulgare L.). Classification of leaf characteristics in bread wheat and barley cultivars and relationship between leaf characteristics are made by principal component and correlation analyses. Highest thickness belongs to W8 Mufitbey cultivar in mesophyll and lower epidermis and W1 Sonmez 01 cultivar have the lowest thickness of upper epidermis in bread wheat. In Barley, B1 Ince cultivar has highest leaf thickness mesophyll and parenchyma; lowest thickness of cuticle is included B7 Cumhuriyet 50 cultivar. All other cultivars have homogenous contents of leaf characteristics. (author)

Radiosensitivities of cultured barley of different type (Hordeum vulgare)

International Nuclear Information System (INIS)

Wang Cailian; Shen Mei; Xu Gang; Zhao Kongnan

1990-01-01

The dormant seeds (with 13% moisture) of 47 barley varieties were irradiated with various doses (0-40 krad) of 137 Cs γ-rays. The radiosensitivities of naked barley was significantly higher than that of hulled barley. The sensitive coefficients of seedling height were 0.04945 and 0.03667 for naked barley and hulled barley, respectively. The radiosensitivity of four-row naked barley was significantly higher than that of two-row hulled barley and six-row hulled barley. 47 varieties studied could be divided into five types with different radiosensitivities, i.e. extreme resistant, resistant, intermediate, sensitive and extreme sensitive. It was also found that the dose-effect curves of cell nucleus volume had a peal at 30 krad

BIOCHEMICAL COMPOSITION AND NUTRITIONAL EVALUATION OF BARLEY RIHANE (HORDEUM VULGARE L.).

Science.gov (United States)

Lahouar, Lamia; Ghrairi, Fatma; El Arem, Amira; Medimagh, Sana; El Felah, Mouledi; Salem, Hichem Ben; Achour, Lotfi

2017-01-01

Many experimental studies have suggested an important role for barley Rihane(BR)in the prevention of colon cancer and cardiovascular diseases. The objective of this study was to evaluate the physico-chemical properties and nutritional characterizations of BR compared to other varieties grown in Tunisia (Manel, Roho and Tej). Total, insoluble and soluble dietary fiber(β-glucan), total protein, ash and some minerals of BR and Tunisian barley varieties were determined. The results revealed that BR is good source of dietary fiber mainly β-glucan compared to the other varieties. This variety is a relatively rich source of phosphorous and potassium and it contains many important unsaturated fatty acids. BR has higher nutritional value than other varieties. Barley Rihane has significant nutritional characterizations compared to others Tunisian barleys varieties. Abbreviations: BR, Barley Rihane; LDL, low density lipoprotein; HDL, high density lipoprotein; AOM, azoxymethane; TBV, Tunisian barley varieties; TGW, thousand grain weight; SW, weight specific; TDF, total dietary fiber; IDF, insoluble dietary fiber; SDF, soluble dietary fiber; DM, Dry Matter.

Transgenic barley (Hordeum vulgare L.) expressing the wheat aluminium resistance gene (TaALMT1) shows enhanced phosphorus nutrition and grain production when grown on an acid soil.

Science.gov (United States)

Delhaize, Emmanuel; Taylor, Phillip; Hocking, Peter J; Simpson, Richard J; Ryan, Peter R; Richardson, Alan E

2009-06-01

Barley (Hordeum vulgare L.), genetically modified with the Al(3+) resistance gene of wheat (TaALMT1), was compared with a non-transformed sibling line when grown on an acidic and highly phosphate-fixing ferrosol supplied with a range of phosphorus concentrations. In short-term pot trials (26 days), transgenic barley expressing TaALMT1 (GP-ALMT1) was more efficient than a non-transformed sibling line (GP) at taking up phosphorus on acid soil, but the genotypes did not differ when the soil was limed. Differences in phosphorus uptake efficiency on acid soil could be attributed not only to the differential effects of aluminium toxicity on root growth between the genotypes, but also to differences in phosphorus uptake per unit root length. Although GP-ALMT1 out-performed GP on acid soil, it was still not as efficient at taking up phosphorus as plants grown on limed soil. GP-ALMT1 plants grown in acid soil possessed substantially smaller rhizosheaths than those grown in limed soil, suggesting that root hairs were shorter. This is a probable reason for the lower phosphorus uptake efficiency. When grown to maturity in large pots, GP-ALMT1 plants produced more than twice the grain as GP plants grown on acid soil and 80% of the grain produced by limed controls. Expression of TaALMT1 in barley was not associated with a penalty in either total shoot or grain production in the absence of Al(3+), with both genotypes showing equivalent yields in limed soil. These findings demonstrate that an important crop species can be genetically engineered to successfully increase grain production on an acid soil.

The Phytotoxicity of Designated Pollutants on Plant Species

Science.gov (United States)

1984-03-01

Only seeds collected from those flowers exposed during pollin 20. DISTRIBUTION/AVAILABILITY OF ABSTRACT 21. ABSTRACT SECURITY CLASSIFICATION...acid exposure during pollination lowered the germination rate of mature seeds. Plant injury was chiefly a function of acid concentration, but amount...TESTS Species Name Variety Barley Hordeum vulgare L. CM67 Bean Phaseolus vulgaris L. Pinto Citrus Citrus limon (L.) Lupe Lemon Lettuce Lactuca sativa

Red:far-red light conditions affect the emission of volatile organic compounds from barley (Hordeum vulgare), leading to altered biomass allocation in neighbouring plants

Science.gov (United States)

Kegge, Wouter; Ninkovic, Velemir; Glinwood, Robert; Welschen, Rob A. M.; Voesenek, Laurentius A. C. J.; Pierik, Ronald

2015-01-01

Background and Aims Volatile organic compounds (VOCs) play various roles in plant–plant interactions, and constitutively produced VOCs might act as a cue to sense neighbouring plants. Previous studies have shown that VOCs emitted from the barley (Hordeum vulgare) cultivar ‘Alva’ cause changes in biomass allocation in plants of the cultivar ‘Kara’. Other studies have shown that shading and the low red:far-red (R:FR) conditions that prevail at high plant densities can reduce the quantity and alter the composition of the VOCs emitted by Arabidopsis thaliana, but whether this affects plant–plant signalling remains unknown. This study therefore examines the effects of far-red light enrichment on VOC emissions and plant–plant signalling between ‘Alva’ and ‘Kara’. Methods The proximity of neighbouring plants was mimicked by supplemental far-red light treatment of VOC emitter plants of barley grown in growth chambers. Volatiles emitted by ‘Alva’ under control and far-red light-enriched conditions were analysed using gas chromatography–mass spectrometry (GC-MS). ‘Kara’ plants were exposed to the VOC blend emitted by the ‘Alva’ plants that were subjected to either of the light treatments. Dry matter partitioning, leaf area, stem and total root length were determined for ‘Kara’ plants exposed to ‘Alva’ VOCs, and also for ‘Alva’ plants exposed to either control or far-red-enriched light treatments. Key Results Total VOC emissions by ‘Alva’ were reduced under low R:FR conditions compared with control light conditions, although individual volatile compounds were found to be either suppressed, induced or not affected by R:FR. The altered composition of the VOC blend emitted by ‘Alva’ plants exposed to low R:FR was found to affect carbon allocation in receiver plants of ‘Kara’. Conclusions The results indicate that changes in R:FR light conditions influence the emissions of VOCs in barley, and that these altered emissions

Red:far-red light conditions affect the emission of volatile organic compounds from barley (Hordeum vulgare), leading to altered biomass allocation in neighbouring plants.

Science.gov (United States)

Kegge, Wouter; Ninkovic, Velemir; Glinwood, Robert; Welschen, Rob A M; Voesenek, Laurentius A C J; Pierik, Ronald

2015-05-01

Volatile organic compounds (VOCs) play various roles in plant-plant interactions, and constitutively produced VOCs might act as a cue to sense neighbouring plants. Previous studies have shown that VOCs emitted from the barley (Hordeum vulgare) cultivar 'Alva' cause changes in biomass allocation in plants of the cultivar 'Kara'. Other studies have shown that shading and the low red:far-red (R:FR) conditions that prevail at high plant densities can reduce the quantity and alter the composition of the VOCs emitted by Arabidopsis thaliana, but whether this affects plant-plant signalling remains unknown. This study therefore examines the effects of far-red light enrichment on VOC emissions and plant-plant signalling between 'Alva' and 'Kara'. The proximity of neighbouring plants was mimicked by supplemental far-red light treatment of VOC emitter plants of barley grown in growth chambers. Volatiles emitted by 'Alva' under control and far-red light-enriched conditions were analysed using gas chromatography-mass spectrometry (GC-MS). 'Kara' plants were exposed to the VOC blend emitted by the 'Alva' plants that were subjected to either of the light treatments. Dry matter partitioning, leaf area, stem and total root length were determined for 'Kara' plants exposed to 'Alva' VOCs, and also for 'Alva' plants exposed to either control or far-red-enriched light treatments. Total VOC emissions by 'Alva' were reduced under low R:FR conditions compared with control light conditions, although individual volatile compounds were found to be either suppressed, induced or not affected by R:FR. The altered composition of the VOC blend emitted by 'Alva' plants exposed to low R:FR was found to affect carbon allocation in receiver plants of 'Kara'. The results indicate that changes in R:FR light conditions influence the emissions of VOCs in barley, and that these altered emissions affect VOC-mediated plant-plant interactions. © The Author 2015. Published by Oxford University Press on

Two New American Species of Hordeum (Poaceae)

DEFF Research Database (Denmark)

Bothmer, Roland Von; Jacobsen, Niels; Bagger Jørgensen, Rikke

1985-01-01

Two new species of Hordeum are described, viz. the diploid H. erectifolium, native to Argentina, and H. guatemalense, native to Guatemala.......Two new species of Hordeum are described, viz. the diploid H. erectifolium, native to Argentina, and H. guatemalense, native to Guatemala....

Dicty_cDB: Contig-U03338-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available ) 486099E06.x1 486 - leaf primordia cDNA library fr... 155 1e-33 1 ( FL885969 ) CCGN6504.b1 CCGN Panicum virgatum eti...( CF272843 ) EST3049 Zea mays sperm cell cDNA library Zea mays... 105 1e-18 1 ( FE623651 ) CBYY4925.g1 CBYY Panicum virgatu...22B2F04.f1 BG01 - normalized library Leymus ... 266 1e-90 2 ( EX580446 ) HDP26H23w HDP Hordeum vulgare subsp. vulgare... 2 ( EX571824 ) HDP35N10T HDP Hordeum vulgare subsp. vulgare cDNA... 287 5e-90 2 ( CV056143 ) BNEL14D8 Barley EST endosperm library... rachis EST library... 161 2e-35 1 ( AU173547 ) Oryza sativa Japonica Group cDNA, parti

under water stress conditio

African Journals Online (AJOL)

A. Thameur

2012-05-17

adjustment trait variation in barley (Hordeum vulgare L.). Theor. Appl. Genet., 96: 688-698. Thameur A, Ferchichi A, López-Carbonell M (2011). Quantification of free and conjugated abscisic acid in five genotypes of barley. (Hordeum ...

Cultivate In Vitro Of Anthers Of Barley (Hordeum Vulgare L.) Vars. UNAGRO V-PM6 And DISSA

International Nuclear Information System (INIS)

Marquinez Casas, Xavier

1994-01-01

The barley is a autonomous cereal originated of the wild subspecies H. vulgare L. Only at the end of last century it acquired commercial importance with the establishment of the industry brewer (Chaparro and Moreno 1894); at the moment its national production is far from supplying the demand of the market. The Andean area is the most appropriate region for its cultivation in Colombia, mainly between 1800 and 3200 meters on the level of the sea, in the Boyaca, Cundinamarca and Narino departments. Their production is dedicated in a 80 at 85 for the industry brewer and malt industry and of the 15 at 20 for seeds, human food and animal

Variation of Qingke (Hordeum vulgare linn.var.nudum Hook.f) induced by space flight treatment

International Nuclear Information System (INIS)

Li Xin; Peng Zhengsong; Yang Jun

2007-01-01

108 Dry seeds of Qingke (Hordeum vulgate linn. var. nudum Hook. f) were carried into space by recoverable satellite. after wards, the seeds were germinated into 108 seedlings at room temperature, and root tips were observed with Night microscope, and results and normal mitotic division was found without microkemel at interphase or chromosome bridges at anaphase, which means that chromosomal structure change didn't occur in Qingke seeds during space flight. To investigate whether there were morphology variations taken place, the seedlings were transplanted into field and managed normal. All of plants grew as strong as normal Qingke plants (CK) by eye abservation, except two plants showed abnormal inflorescence morphology, which had two spikes on one tiller. 21 SSR markers on 7 linkage groups were used to analysis the polymorphism of genomic DNA for these Qingke plants. No polymorphism was detected with 20 SSR markers among 63 plants investigated. But varied electrophoretic bands were tested in 10 plants using the marker HVM54 on chromosome 2H, and all the 10 plants showed uniform electrophoretypes. It was concluded that the DNA of the Qingke could be changed during space flight. (authors)

Quantitative Trait Loci and Inter-Organ Partitioning for Essential Metal and Toxic Analogue Accumulation in Barley.

Directory of Open Access Journals (Sweden)

Stefan Reuscher

Full Text Available The concentrations of both essential nutrients and chemically similar toxic analogues accumulated in cereal grains have a major impact on the nutritional quality and safety of crops. Naturally occurring genetic diversity can be exploited for the breeding of improved varieties through introgression lines (ILs. In this study, multi-element analysis was conducted on vegetative leaves, senesced flag leaves and mature grains of a set of 54 ILs of the wild ancestral Hordeum vulgare ssp. spontaneum in the cultivated variety Hordeum vulgare ssp. vulgare cv. Scarlett. Plants were cultivated on an anthropogenically heavy metal-contaminated soil collected in an agricultural field, thus allowing simultaneous localization of quantitative trait loci (QTL for the accumulation of both essential nutrients and toxic trace elements in barley as a model cereal crop. For accumulation of the micronutrients Fe and Zn and the interfering toxin Cd, we identified 25, 16 and 5 QTL, respectively. By examining the gene content of the introgressions, we associated QTL with candidate genes based on homology to known metal homeostasis genes of Arabidopsis and rice. Global comparative analyses suggested the preferential remobilization of Cu and Fe, over Cd, from the flag leaf to developing grains. Our data identifies grain micronutrient filling as a regulated and nutrient-specific process, which operates differently from vegetative micronutrient homoeostasis. In summary, this study provides novel QTL for micronutrient accumulation in the presence of toxic analogues and supports a higher degree of metal specificity of trace element partitioning during grain filling in barley than previously reported for other cereals.

A redox-dependent dimerization switch regulates activity and tolerance for reactive oxygen species of barley seed glutathione peroxidase

DEFF Research Database (Denmark)

Navrot, Nicolas; Skjoldager, Nicklas; Bunkenborg, Jakob

2015-01-01

Monomeric and dimeric forms of recombinant barley (Hordeum vulgare subsp. vulgare) glutathione peroxidase 2 (HvGpx2) are demonstrated to display distinctly different functional properties in vitro. Monomeric HvGpx2 thus has five fold higher catalytic efficiency than the dimer towards tert-butyl h...

Genetic diversity among wild and cultivated barley as revealed by RFLP

DEFF Research Database (Denmark)

Petersen, L.; Østergård, H.; Giese, H.

1994-01-01

Genetic variability of cultivated and wild barley, Hordeum vulgare ssp. vulgare and spontaneum, respectively, was assessed by RFLP analysis. The material consisted of 13 European varietes, single-plant offspring lines of eight land races from Ethiopia and Nepal, and five accessions of ssp. sponta...... an intermediate level. The proportion of gene diversity residing among,geographical groups (F-ST) varied from 0.19 to 0.94 (average 0.54) per RFLP pattern, indicating large diversification between geographical groups....... was estimated and the barley lines clustered into five groups reflecting geographical origin. The geographical groups of land-race lines showed less intragroup variation than the geographical groups of spontaneum lines. The group of European varieties, representing large variation in agronomic traits, showed...

Impact of mineral fertilizers on common winter barley (Hordeum vulgare L. agrophytocenosis development

Directory of Open Access Journals (Sweden)

Я. М. Мукан

2014-04-01

Full Text Available In 2011 to 2013 a study was completed for the impact of varying rates of fertilizing onto the indices of productivity for barley agrophytocenosis of Helios and Commandor, in particular, such its components as a number of productive stems, number of seeds per ear, potential biological activity of ear and photosynthetic apparatus. It is found that the level of spring barley agrophytocenosis productivity is subject both to varietal peculiarities and the rate of mineral fertilizer application. When applying N 60P 60K 60 і N 90P 90K 90 the highest potential and biological productivity of Helios and Commandor was recorder as compared against the control. Impact of varying application rates for fertilizers onto the components of ear biological productivity has been scrutinized. The qualitative composition of ear is a clear expression of variety phenotype and identifies the level of biological yield for spring barley. Application of N 60 P 60 K 60 і N 90 P 90 K 90 mineral fertilizers fairly increased the average leaf surface, photosynthetic lead capacity of varieties in 2 to 2.5 times, as well as FAR efficiency coefficient in 1.5 to 2.0 times as against control that thus contributed to the development of highest biological yield of Helios variety phytomass at the level of 14.9 to 15.0, grain – 7.8 to 8.0 ton per ha and, respectively, 12.7 and 7.5 tons per ha for Comandor variety.

Foeniculum vulgare Mill (Umbelliferae) Attenuates Stress and ...

African Journals Online (AJOL)

Purpose: To evaluate the anti-stress and memory-enhancing properties of F. vulgare extract in experimental rats. Methods: F. vulgare plant extract was obtained using Soxhlet extraction technique. The extract, at doses of 50, 100 and 200 mg/kg body weight, was administered orally with an orogastric tube. Urinary levels of ...

Identification of a Phytase Gene in Barley (Hordeum vulgare L.)

Science.gov (United States)

Dai, Fei; Qiu, Long; Ye, Lingzhen; Wu, Dezhi; Zhou, Meixue; Zhang, Guoping

2011-01-01

Background Endogenous phytase plays a crucial role in phytate degradation and is thus closely related to nutrient efficiency in barley products. The understanding of genetic information of phytase in barley can provide a useful tool for breeding new barley varieties with high phytase activity. Methodology/Principal Findings Quantitative trait loci (QTL) analysis for phytase activity was conducted using a doubled haploid population. Phytase protein was purified and identified by the LC-ESI MS/MS Shotgun method. Purple acid phosphatase (PAP) gene was sequenced and the position was compared with the QTL controlling phytase activity. A major QTL for phytase activity was mapped to chromosome 5 H in barley. The gene controlling phytase activity in the region was named as mqPhy. The gene HvPAP a was mapped to the same position as mqPhy, supporting the colinearity between HvPAP a and mqPhy. Conclusions/Significance It is the first report on QTLs for phytase activity and the results showed that HvPAP a, which shares a same position with the QTL, is a major phytase gene in barley grains. PMID:21533044

Marrubium vulgare L.: A review on phytochemical and pharmacological aspects

Directory of Open Access Journals (Sweden)

Santram Lodhi

2017-12-01

Full Text Available Marrubium vulgare L. (family: Lamiaceae, also known as white horehound, is widely used as herbal remedy for chronic coughs and colds. It is used in various disorders related to skin, liver, gastric, heart and immune system. This review abridges phytochemical, pharmacological studies and medicinal uses of M. vulgare and provides scientific proof for various ethnobotanical claims in order to identify gaps, which will give impulsion for novel research on M. vulgare based herbal medicines. This review summarizes selected scientific evidence on phytochemistry and pharmacological properties of M. vulgare over the past 48 years (1968 to 2016. The work reported on M. vulgare was reviewed from various sources like books, internet source i.e. google search engine, pubmed, sciencedirect and chemical abstract. The exhaustive literature was studied and critical analysis was done according to their phytochemical and pharmacological properties. Phytochemical investigations on different parts of M. vulgare have been reported the presence of flavonoids, steroids, terpenoids, tannins, saponins and volatile oils (0.05%. The aerial parts contain marrubiin, together with ursolic acid and choline. Pharmacological activities like, anti-nociceptive, anti-spasmodic, anti-hypertensive, anti-diabetic, gastroprotective, anti-inflammatory, anti-microbial, anti-cancer, antioxidant, and anti-hepatotoxic activity have been reported. M. vulgare has therapeutic potential in the treatment of inflammatory conditions, liver disorders, pain, cardiovascular, gastric and diabetic conditions. Aerial parts of M. vulgare is a good source of labdane type diterpene especially marrubiin which is present in high concentrations. However, further scientific studies are needed to explore clinical efficacy, toxicity and to explore the therapeutic effect of major secondary metabolites like diterpenes, phenylpropanoid and phenylethanoid glycosides of M. vulgare. [J Complement Med Res 2017; 6

Physical and Mechanical Properties of Sorghum Grains (Sorghum Vulgare

Directory of Open Access Journals (Sweden)

2016-11-01

Full Text Available The physical and mechanical properties of sorghum grains (sorghum vulgare were studied at varying moisture contents of 13%, 20% and 30% (w.b. The four varieties of sorghum grains studied include; Dura, Guinea, Faterita and Kafir. Results indicate that the size ranges were 3.94mm - 4.83mm for Dura variety; 3.75mm - 4.54mm for Guinea variety; 3.21mm - 4.42mm for Kafir variety and 2.70mm - 4.14mm for Faterita variety. Irregularities in the shapes of the grains were observed but all approximated to a sphere. In the mechanical properties, at major diameter, Dura variety had highest rupture force of 1.16kN at 13% moisture content (w.b while the Guinea variety had the lowest rupture force of 0.955kN. In minor diameter, the Dura variety also recorded highest rupture force of 1.12kN at 13% moisture content (w.b while the Kafir variety had the lowest value of 0.952kN. Also at 20% moisture content, the Dura variety had highest rupture force of 1.025kN while the Guinea variety had the lowest rupture force of 0.965kN. The same trend applies in the varieties at 30% moisture content. This is because, increase in moisture content results to decrease in rupture force. And this implies that force beyond these points at these moisture contents may cause damage to the sorghum varieties.

Identification of a phytase gene in barley (Hordeum vulgare L..

Directory of Open Access Journals (Sweden)

Fei Dai

Full Text Available BACKGROUND: Endogenous phytase plays a crucial role in phytate degradation and is thus closely related to nutrient efficiency in barley products. The understanding of genetic information of phytase in barley can provide a useful tool for breeding new barley varieties with high phytase activity. METHODOLOGY/PRINCIPAL FINDINGS: Quantitative trait loci (QTL analysis for phytase activity was conducted using a doubled haploid population. Phytase protein was purified and identified by the LC-ESI MS/MS Shotgun method. Purple acid phosphatase (PAP gene was sequenced and the position was compared with the QTL controlling phytase activity. A major QTL for phytase activity was mapped to chromosome 5 H in barley. The gene controlling phytase activity in the region was named as mqPhy. The gene HvPAP a was mapped to the same position as mqPhy, supporting the colinearity between HvPAP a and mqPhy. CONCLUSIONS/SIGNIFICANCE: It is the first report on QTLs for phytase activity and the results showed that HvPAP a, which shares a same position with the QTL, is a major phytase gene in barley grains.

Haplotype divergence and multiple candidate genes at Rphq2, a partial resistance QTL of barley to Puccinia hordei

Czech Academy of Sciences Publication Activity Database

Yeo, F. K. S.; Wang, Y.; Vozábová, Tereza; Huneau, C.; LeRoy, P.; Chalhoub, B.; Qi, X. Q.; Niks, R. E.; Marcel, T. C.

2016-01-01

Roč. 129, č. 2 (2016), s. 289-304 ISSN 0040-5752 Institutional support: RVO:67985939 Keywords : cartial resistance genes * cloning * Hordeum vulgare Subject RIV: EF - Botanics Impact factor: 4.132, year: 2016

Exploration of beer proteome using OFFGEL prefractionation in combination with two-dimensional gel electrophoresis with narrow pH range gradients.

Science.gov (United States)

Konečná, Hana; Müller, Lukáš; Dosoudilová, Hana; Potěšil, David; Buršíková, Jana; Sedo, Ondrej; Márová, Ivana; Zdráhal, Zbyněk

2012-03-14

Two-dimensional gel electrophoresis in combination with mass spectrometry has already been applied successfully to study beer proteome. Due to the abundance of protein Z in beer samples, prefractionation techniques might help to improve beer proteome coverage. Proteins from four lager beers of different origins were separated by two-dimensional electrophoresis (2-DE) followed by tandem mass spectrometric analysis. Initially 52 proteins mostly from Hordeum vulgare (22 proteins) and Saccharomyces species (25 proteins) were identified. Preparative isoelectric focusing by OFFGEL Fractionator was applied prior to 2-DE to improve its resolution power. As a result of this combined approach, a total of 70 beer proteins from Hordeum vulgare (30 proteins), from Saccharomyces species (31 proteins), and from other sources (9 proteins) were identified. Of these, 37 proteins have not been previously reported in beer samples.

N-acyl-homoserine lactone uptake and systemic transport in barley rest upon active parts of the plant

Czech Academy of Sciences Publication Activity Database

Sieper, T.; Forczek, Sándor; Matucha, Miroslav; Kraemer, P.; Hartmann, A.; Schroeder, P.

2014-01-01

Roč. 201, č. 2 (2014), s. 545-555 ISSN 1469-8137 Institutional support: RVO:61389030 Keywords : barley (Hordeum vulgare) * monoclonal antibodies * N-acyl-homoserine lactones (HSLs) Subject RIV: EF - Botanics Impact factor: 6.545, year: 2013

Analysis of chlorophyll mutations induced by γ-rays in barley (hordeum vulgare)

International Nuclear Information System (INIS)

Wang Cailian; Shen Mei; Xu Gang; Zhao Kongnan; Chen Qiufang

1991-06-01

Thirty varieties of dormant barley seeds were irradiated with 137 Cs γ-rays. Dose-effect relations of chlorophyll mutation frequency in M 2 seedling and differences resulting from cultured types or radiosensitive types were investigated. Experimental results show that the relations between chlorophyll mutation frequency and doses can be fitted by a linear regression equation Y = A + BX. According to analysis of covariance, there is no considerable difference in various cultured types, but the difference of five different radiosensitive types is remarkable. The sensitive and intermediate types need much lower doses than other types to induce maximum chlorophyll mutation

Journal of Genetics Online Resources

Indian Academy of Sciences (India)

pdf. Jaiswal S. K., Pandey S. P., Sharma S., Prasad R., Prasad L. C., Verma R. P. S. and Joshi A. K. 2010 Diversity in Indian barley (Hordeum vulgare) cultivars and identification of genotype-specific fingerprints using microsatellite markers.

Actividade antimicrobiana do óleo essencial do Foeniculum vulgare Miller Antimicrobial activity of Foeniculum vulgare Miller essential oil

OpenAIRE

M. T. Tinoco; M. R. Martins; J. Cruz-Morais

2007-01-01

O Foeniculum vulgare Mill. subsp. vulgare é uma planta espontânea da região mediterrânea, pertencente à família Apiaceae. O seu óleo essencial, principalmente o dos frutos secos, é amplamente utilizado nas indústrias alimentar, farmacêutica, cosmética e perfumaria. Neste trabalho, pretendeu-se avaliar a actividade antimicrobiana do óleo essencial dos frutos verdes e das folhas da variedade de funcho doce colhido no Alentejo, na região de Évora, e relacionar essa actividade com a respectiva co...

Cell size and cell number in dwarf mutants of barley (Hordeum vulgare)

International Nuclear Information System (INIS)

Blonstein, A.D.; Gale, M.D.

1984-01-01

Sixteen height mutants, induced by sodium azide treatment of the two-rowed barley variety Proctor, have been used to investigate the relationship between the extent and nature of stem shortening with alterations in cell size and cell number, and the pleiotropic effects of dwarfing genes on vegetative development and agronomic performance. The studies on epidermal cell number and cell length in the developmentally earliest and latest elongated vegetative tissues - the coleoptile and peduncle resprectively - suggest that cell number may be the primary determinant of plant height. One semi-prostrate and one erectoides mutant are used to illustrate different cell number/cell size strategies and their relationships with gibberellin sensitivity, growth rate and lodging resistance are discussed. (author)

Metabolomic analysis of cooperative adaptation between co-cultured Bacillus cereus and Ketogulonicigenium vulgare.

Directory of Open Access Journals (Sweden)

Ming-Zhu Ding

Full Text Available The cooperative adaptation of subcultivated Bacillus cereus and Ketogulonicigenium vulgare significantly increased the productivity of 2-keto-L-gulonic acid, the precursor of vitamin C. The mechanism of cooperative adaptation of the serial subcultivated B. cereus and K. vulgare was investigated in this study by culturing the two strains orthogonally on agar plates. It was found that the swarming distance of B. cereus along the trace of K. vulgare on the plate decreased after 150 days' subcultivation. Metabolomic analysis on these co-cultured B. cereus and K. vulgare strains showed that their cooperative adaptation was accomplished by three key events: (i the ability of nutrients (e.g., amino acids and purines searching and intaking, and proteins biosynthesis is increased in the evolved B. cereus; (ii the capability of protein degradation and amino acids transportation is enhanced in evolved K. vulgare; (iii the evolved B. cereus was found to provide more nutrients (mostly amino acids and purines to K. vulgare, thus strengthening the oxidation and energy generation of K. vulgare. Our results provided novel insights into the systems-level understanding of the cooperative adaptation between strains in synergistic consortium.

COMPARISON OF THE FROST RESISTANCE OF BARLEY ...

African Journals Online (AJOL)

Preferred Customer

immediate recovery of the photosynthetic quantum yield after freezing. Landraces which showed the highest cold tolerance were found to acclimatize best. Key words/phrases: Barley, chlorophyll fluorescence, cold acclimation, Ethiopia, frost tolerance. INTRODUCTION. Barley (Hordeum vulgare L.) is a traditional crop.

Wheat and barley exposure to nanoceria: Implications for agricultural productivity

Science.gov (United States)

The impacts of man-made nanomaterials on agricultural productivity are not yet well understood. A soil microcosm study was performed to assess the physiological, phenological, and yield responses of wheat (Triticum aestivum) and barley (Hordeum vulgare L.) exposed to nanoceria (n...

Significance and value of non.traded ecosystem services on farmland

DEFF Research Database (Denmark)

Sandhu, Harpinder; Wratten, Steve; Costanza, Robert

2015-01-01

peas (Pisum sativum), beans (Phaseolus vulgaris), barley (Hordeum vulgare), and wheat (Triticum aestivum). Organic systems were chosen as comparators not because they are the only forms of sustainable agriculture, but because they are subject to easily understood standards. Results. We found...

Studies on the histology of partial resistance in barley to leafrust, Puccinia hordei

NARCIS (Netherlands)

Niks, R.E.

1983-01-01

In de gerst (Hordeum vulgare) - dwergroest (Puccinia hordei) relatie zijn twee typen van resistentie te onderscheiden, namelijk overgevoeligheidsresistentie en partiële resistentie. Deze typen kunnen beschouwd worden als voorbeelden van Van der Plank's verticale en horizontale

Induced Variations in Brassinosteroid Genes Define Barley Height and Sturdiness, and Expand the Green Revolution Genetic Toolkit

Czech Academy of Sciences Publication Activity Database

Dockter, C.; Gruszka, D.; Braumann, I.; Druka, A.; Franckowiak, J.; Muller, A.H.; Oklešťková, Jana; Schulz, B.; Zakhrabekova, S.; Hansson, M.

2014-01-01

Roč. 166, č. 4 (2014), s. 1912-1927 ISSN 0032-0889 R&D Projects: GA MŠk LK21306 Institutional support: RVO:61389030 Keywords : HORDEUM-VULGARE L. * GIBBERELLIN-SYNTHESIS * SIGNAL-TRANSDUCTION Subject RIV: EF - Botanics Impact factor: 6.841, year: 2014

Integrated transcriptomics and proteomics analysis of storage protein composition in developing barley grain to improve nutritional profile

DEFF Research Database (Denmark)

Kaczmarczyk, Agnieszka Ewa; Dionisio, Giuseppe; Renaut, Jenny

2012-01-01

The aim of the study was to understand the molecular and biochemical mechanisms underpinning the effect of nitrogen (N) on barley (Hordeum vulgare) storage protein production (hordeins) during grain filling. Using a combination of advanced biochemistry methods, we could comprehensively describe c...

Main: 1BE2 [RPSD[Archive

Lifescience Database Archive (English)

Full Text Available me=Ltp1; Synonyms=Papi; Hordeum Vulgare Molecule: Lipid Transfer Protein; Chain: Null; Synonym: Ltp Lipid Tr...ansport M.H.Lerche, F.M.Poulsen M.H.Lerche, F.M.Poulsen Two Different Binding Modes Of Palmitate In The Homologous Mai

Nitrogen accumulation and residual effects of nitrogen catch crops

DEFF Research Database (Denmark)

Jensen, E.S.

1991-01-01

The nitrogen accumulation in Italian ryegrass (Lolium multiflorum Lam.), perennial ryegrass (Lolium perenne L.), white mustard (Sinapis alba L.) and tansy phacelia (Phacelia tanacetifolia L.), under- or aftersown as nitrogen catch crops to spring barley (Hordeum vulgare L.) and field pea (Pisum s...

Wheat and barley seed systems in Ethiopia and Syria

NARCIS (Netherlands)

Bishaw, Z.

2004-01-01

Keywords: Wheat,Triticumspp., Barley,Hordeumvulgare L., Seed Systems, Formal Seed Sector, Informal Seed Sector, National Seed Program, Seed Source, Seed Selection, Seed Management, Seed Quality,

Chernobyl Doses. Volume 3. Habitat and Vegetation Near the Chernobyl Nuclear Reactor Station

Science.gov (United States)

1993-01-01

Hordeum vulgare, Avena sativa, Fagopyrum esculentum, Beta vulgaris, Solanum tuberosum, Linum usitatissimum , Cannabis satii, Humulus lupulus, Daucus carota... USITATISSIMUM flax It is grown for fiber. Fine-quality fiber can be obtained from plants grown on podzolic and gley soils with considerable fertilizing. In the

Assessment of the nutritive value of cereal and legume straws based on chemical composition and in vitro digestibility

NARCIS (Netherlands)

Lopez, S.; Davies, D.; Dhanoa, M.S.; Dijkstra, J.; France, J.

2005-01-01

The nutritive value of 17 straws was determined on the basis of their chemical composition, in vitro dry matter (DM) digestibility and rumen fermentation kinetics (from gas production curves measured in vitro). Five roughages were from the cereal species Avena sativa (oat), Hordeum vulgare (barley),

Sequencing of 15622 gene-bearing BACs clarifies the gene-dense regions of the barley genome

Czech Academy of Sciences Publication Activity Database

Munoz-Amatriain, M.; Lonardi, S.; Luo, M.C.; Madishetty, K.; Svensson, J.T.; Moscou, M. J.; Wanamaker, S.; Kudrna, D.; Zheng, J.; Šimková, Hana; Doležel, Jaroslav; Grimwood, J.; Mammadov, J.; Close, T.J.

2015-01-01

Roč. 84, č. 1 (2015), s. 216-227 ISSN 0960-7412 R&D Projects: GA MŠk(CZ) LO1204 Institutional support: RVO:61389030 Keywords : Barley * Hordeum vulgare L * BAC sequencing Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 5.468, year: 2015

Farmer’s seed sources and seed quality: 2. seed health

NARCIS (Netherlands)

Bishaw, Z.; Struik, P.C.; Gastel, van A.J.G.

2013-01-01

The study assessed the health quality of wheat (Triticum aestivum L.) and barley (Hordeum vulgare L.) seed samples collected from formal and informal sector in Ethiopia and Syria. In Ethiopia, several seed-borne fungi were found on wheat samples: Cochliobolus sativum, Fusarium avenaceum, F.

Synthesis of the major storage protein, hordein, in barley

DEFF Research Database (Denmark)

Giese, Nanna Henriette; Andersen, B.; Doll, Hans

1983-01-01

A liquid culture system for culturing detached spikes of barley (Hordeum vulgare L.) at different nutritional levels was established. The synthesis of hordein polypeptides was studied by pulse-labeling with [14C]sucrose at different stages of development and nitrogen (N) nutrition. All polypeptides...

Grain Yield Variation in Malting Barley Cultivars in Uruguay and Its Consequences for the Design of a Trials Network

NARCIS (Netherlands)

Ceretta, S.S.E.; Eeuwijk, van F.A.

2008-01-01

The efficiency of cultivar trial networks is an important subject in official cultivar testing. We investigated this efficiency for malting barley (Hordeum vulgare L.) in Uruguay, using data on 213 cultivars tested across an eight-year period at six locations. The variance-components approach was

Comparing Evapotranspiration Rates Estimated from Atmospheric Flux and TDR Soil Moisture Measurements

DEFF Research Database (Denmark)

Schelde, Kirsten; Ringgaard, Rasmus; Herbst, Mathias

2011-01-01

limit estimate (disregarding dew evaporation) of evapotranspiration on dry days. During a period of 7 wk, the two independent measuring techniques were applied in a barley (Hordeum vulgare L.) field, and six dry periods were identified. Measurements of daily root zone soil moisture depletion were...

Investigation of GMO and ancient Grains for Bioplastic and Food Applications

DEFF Research Database (Denmark)

Sagnelli, Domenico

I dette projekt er der udviklet nye koncepter for helt naturlige bioplast systemer og sunde diætfibre. Termoplastisk stivelse (TPS) fremstilles ved anvendelse af traditionelle processer, såsom ekstrudering. I dette projekt anvendes transgen byg (Hordeum vulgare, Hv) med en stivelse der indeholder...

PLANT REMAINS FROM ASIKLI-HOYUK, A PRE-POTTERY NEOLITHIC SITE IN CENTRAL ANATOLIA

NARCIS (Netherlands)

VANZEIST, W; DEROLLER, GJ

Cereal crop plants at Asikli Hayuk included einkorn wheat (Triticum monococcum), emmer wheat (T. dicoccum), free-threshing wheat (T. cf. durum), hulled two-rowed barley (Hordeum distichum) and naked barley (H. vulgare var. nudum). As for pulses, bitter vetch (Vicia ervilia), lentil (Lens culinaris)

Mapping genes in barley for resistance to Puccinia coronata from couch grass and to P. striiformis from brome, wheat and barley

NARCIS (Netherlands)

Niks, R.E.; Alemu, Sisay K.; Marcel, T.C.; Heyzen, van Skye

2015-01-01

Barley (Hordeum vulgare L.) mapping populations have been developed that are useful to study the inheritance of quantitative resistance to adapted and unadapted rust fungi. In a recent host range study, we found that the parents of those mapping populations also differed in their resistance to

The Role of alpha-Glucosidase in Germinating Barley Grains

DEFF Research Database (Denmark)

Stanley, Duncan; Rejzek, Martin; Næsted, Henrik

2011-01-01

The importance of alpha-glucosidase in the endosperm starch metabolism of barley (Hordeum vulgare) seedlings is poorly understood. The enzyme converts maltose to glucose (Glc), but in vitro studies indicate that it can also attack starch granules. To discover its role in vivo, we took complementa...

Journal of Genetics | Indian Academy of Sciences

Indian Academy of Sciences (India)

MAO-A promoter polymorphism and idiopathic pulmonary arterial hypertension · Shivani Vadapalli Sujana Katta B. K. S. Sastry Pratibha Nallari · More Details Fulltext PDF. pp e46-e54. Diversity in Indian barley (Hordeum vulgare) cultivars and identification of genotype-specific fingerprints using microsatellite markers.

Simulation of spring barley yield variability in different climatic zones of Northern and Central Europe

DEFF Research Database (Denmark)

Rötter, R P; Palosuo, T; Kersebaum, K C

2012-01-01

In this study, the performance of nine widely used and accessible crop growth simulation models (APES-ACE, CROPSYST, DAISY, DSSAT-CERES, FASSET, HERMES, MONICA, STICS and WOFOST) was compared during 44 growing seasons of spring barley (Hordeum vulgare L.) at seven sites in Northern and Central...

Effects of free and chelated iron on in vitro androgenesis in barley and wheat

Czech Academy of Sciences Publication Activity Database

Novotný, J.; Vagera, Jiří; Ohnoutková, Ludmila

2000-01-01

Roč. 63, - (2000), s. 35-40 ISSN 0167-6857 R&D Projects: GA ČR GV521/96/K117 Institutional research plan: CEZ:AV0Z5038910 Keywords : ferrous ions * Hordeum vulgare * Triticum aestivum Subject RIV: EF - Botanics Impact factor: 0.444, year: 2000

A new agro-climatic classification for crop suitability zoning in northern semi-arid Ethiopia

NARCIS (Netherlands)

Araya, A.; Keesstra, S.D.; Stroosnijder, L.

2010-01-01

The agro-climatic resources of Giba catchment in northern Ethiopia were assessed and characterized. The objectives were (i) to ascertain the suitability of the climate for growing teff (Eragrostis tef) and barley (Hordeum vulgare); (ii) to determine the onset and length of the growing period (LGP),

Biomass production, symbiotic nitrogen fixation and inorganic N use in dual tri-component annual intercrops

DEFF Research Database (Denmark)

Andersen, M.K.; Hauggaard-Nielsen, H.; Ambus, P.

2005-01-01

The interspecific complementary and competitive interactions between pea (Pisum sativum L.), barley (Hordeum vulgare L.) and oilseed rape (Brassica napus L.), grown as dual and tri-component intercrops were assessed in a field study in Denmark. Total biomass production and N use at two levels of ...

Yield and grain quality of spring barley as affected by biomass formation at early growth stages

Czech Academy of Sciences Publication Activity Database

Křen, J.; Klem, Karel; Svobodová, I.; Míša, P.; Neudert, L.

2014-01-01

Roč. 60, č. 5 (2014), s. 221-227 ISSN 1214-1178 R&D Projects: GA MZe QI111A133 Keywords : Hordeum vulgare L * above-ground biomass * tillering * grain yield formation * grain protein content Subject RIV: EH - Ecology, Behaviour Impact factor: 1.226, year: 2014

Genomic restructuring in Hordeum chilense durum wheat hybrids ...

Indian Academy of Sciences (India)

ANDREIA DELGADO

4John Innes Centre, Norwich Research Park, Norwich NR4 7UH, UK. 5Departament of Genetics and Biotechnology, University of Tras-os-Montes and Alto ... [Delgado A., Carvalho A., Martín A. C., Martín A. and Lima-Brito J. 2017 Genomic restructuring in F1 Hordeum chilense × durum ...... Academic Press, Burlington,.

PENGARUH INFUS BUAH Foeniculum vulgare Mill PADA SIKLUS ESTRUS DAN BOBOT UTERUS TIKUS PUTIH

Directory of Open Access Journals (Sweden)

Sa'roni Sa'roni

2012-10-01

Full Text Available Buah Foeniculum vulgare Mill (adas secara tradisional untuk obat dan campuran jamu pengatur haid. Diduga buah Foeniculum vulgare Mill mempunyai pengaruh pada sistem reproduksi. Oleh karena itu, kami melakukan penelitian pengaruh infus buah Foeniculum vulgare Mill pada siklus estrus dan bobot uterus tikus putih.Infus diberikan secara oral sekali sehari selama 12 hari dengan dosis setara dengan 7,3 mg, 73 mg dan 219 mg/100 g bobot badan. Selama pemberian bahan, siklus estrus diperiksa setiap hari dan pada hari ke-13 diotopsi dan ditimbang bobot uterusnya.Hasil penelitian menunjukkan bahwa infus buah Foeniculum vulgare Mill setara dengan serbuk 7,3 mg, 73 mg dan 219 mg/100 g bobot badan dapat menghambat fase estrus (masa subur. Infus setara dengan serbuk 7 mg dan 219 mg/100 g bobot badan kelihatan dapat menghambat fase estrus yang sangat nyata dibandingkan dengan akuades. Infus buah Foeniculum vulgare Mill setara dengan serbuk 219 mg/100 g bobot badan dapat menurunkan bobot uterus, tetapi secara statistik tidak berbeda nyata dengan akuades. Kata kunci: Obat tradisional; Foeniculum vulgare Mill; Sistem Reproduksi

cultivars and identification of genotype-specific fingerprints using ...

Indian Academy of Sciences (India)

Home; Journals; Journal of Genetics; Volume 89; Online resources. Diversity in Indian barley (Hordeum vulgare) cultivars and identification of genotype-specific fingerprints using microsatellite markers. S. K. Jaiswal Shree P. Pandey S. Sharma R. Prasad L. C. Prasad R. P. S. Verma Arun K. Joshi. Volume 89 Online ...

Zinc biofortification of cereals: rice differs from wheat and barley

NARCIS (Netherlands)

Stomph, T.J.; Jiang, W.; Struik, P.C.

2009-01-01

In their review, mainly focused on bread wheat (Triticum aestivum), durum wheat (Triticum durum) and barley (Hordeum vulgare), Palmgren et al. 1 M.G. Palmgren et al., Zinc biofortification of cereals: problems and solutions, Trends Plant Sci. 13 (2008), pp. 464–473. Article | PDF (905 K) | View

Real-time weed detection, decision making and patch spraying in maize, sugarbeet, winter wheat and winter barley

DEFF Research Database (Denmark)

Gerhards, R; Christensen, Svend

2003-01-01

with weed infestation levels higher than the economic weed threshold; a review of such work is provided. This paper presents a system for site-specific weed control in sugarbeet (Beta vulgaris L.), maize (Zea mays L.), winter wheat (Triticum aestivum L.) and winter barley (Hordeum vulgare L.), including...

Changes in vertical distribution of spectral reflectance within Spring barley canopy as an indicator of nitrogen nutrition, canopy structure and yield parametrs

Czech Academy of Sciences Publication Activity Database

Klem, Karel; Rajsnerová, Petra; Novotná, Kateřina; Míša, P.; Křen, J.

2014-01-01

Roč. 60, č. 2 (2014), s. 50-59 ISSN 0551-3677 R&D Projects: GA MZe QI111A133; GA TA ČR TA02010780 Institutional support: RVO:67179843 Keywords : Hordeum vulgare * spectral reflectance * vertical gradient * vegetation indices * nitrogen * grain yield * protein content Subject RIV: GC - Agronomy

Agricultural drought and spring barley yields in the Czech Republic

Czech Academy of Sciences Publication Activity Database

Trnka, M.; Hlavinka, P.; Semerádová, Daniela; Dubrovský, Martin; Žalud, Z.; Možný, M.

2007-01-01

Roč. 53, č. 7 (2007), s. 306-316 ISSN 1214-1178 Institutional research plan: CEZ:AV0Z30420517 Keywords : Hordeum vulgare L * Palmer Z-index * climatic conditions * yield * drought Subject RIV: DG - Athmosphere Sciences, Meteorology http://journals.uzpi.cz:8050/web/_generovani_8050/pse_2007.htm

Variation in shoot tolerance mechanisms not related to ion toxicity in barley

KAUST Repository

Tilbrook, Joanne

2017-09-27

Soil salinity can severely reduce crop growth and yield. Many studies have investigated salinity tolerance mechanisms in cereals using phenotypes that are relatively easy to measure. The majority of these studies measured the accumulation of shoot Na+ and the effect this has on plant growth. However, plant growth is reduced immediately after exposure to NaCl before Na+ accumulates to toxic concentrations in the shoot. In this study, nondestructive and destructive measurements are used to evaluate the responses of 24 predominately Australian barley (Hordeum vulgare L.) lines at 0, 150 and 250mMNaCl. Considerable variation for shoot tolerance mechanisms not related to ion toxicity (shoot ion-independent tolerance) was found, withsome lines being able to maintain substantial growth rates under salt stress, whereas others stopped growing. Hordeum vulgare spp. spontaneum accessions and barley landraces predominantly had the best shoot ion independent tolerance, although two commercial cultivars, Fathom and Skiff, also had high tolerance. The tolerance of cv. Fathom may be caused by a recent introgression from H. vulgare L. spp. spontaneum. This study shows that the most salt-tolerant barley lines are those that contain both shoot ion-independent tolerance and the ability to exclude Na+ from the shoot (and thus maintain high K+: Na+ ratios).

Variation in shoot tolerance mechanisms not related to ion toxicity in barley

KAUST Repository

Tilbrook, Joanne; Schilling, Rhiannon K.; Berger, Bettina; Garcia, Alexandre F.; Trittermann, Christine; Coventry, Stewart; Rabie, Huwaida; Brien, Chris; Nguyen, Martin; Tester, Mark A.; Roy, Stuart J.

2017-01-01

Soil salinity can severely reduce crop growth and yield. Many studies have investigated salinity tolerance mechanisms in cereals using phenotypes that are relatively easy to measure. The majority of these studies measured the accumulation of shoot Na+ and the effect this has on plant growth. However, plant growth is reduced immediately after exposure to NaCl before Na+ accumulates to toxic concentrations in the shoot. In this study, nondestructive and destructive measurements are used to evaluate the responses of 24 predominately Australian barley (Hordeum vulgare L.) lines at 0, 150 and 250mMNaCl. Considerable variation for shoot tolerance mechanisms not related to ion toxicity (shoot ion-independent tolerance) was found, withsome lines being able to maintain substantial growth rates under salt stress, whereas others stopped growing. Hordeum vulgare spp. spontaneum accessions and barley landraces predominantly had the best shoot ion independent tolerance, although two commercial cultivars, Fathom and Skiff, also had high tolerance. The tolerance of cv. Fathom may be caused by a recent introgression from H. vulgare L. spp. spontaneum. This study shows that the most salt-tolerant barley lines are those that contain both shoot ion-independent tolerance and the ability to exclude Na+ from the shoot (and thus maintain high K+: Na+ ratios).

Chromosome aberration assays in barley (Hordeum vulgare)

Energy Technology Data Exchange (ETDEWEB)

Constantin, M J [Univ. of Tennessee, Knoxville; Nilan, R A

1982-01-01

Barley is an exceellent organism for studies of induced chromosome aberrations because of its few (2n = 2x = 14) relatively large chromosomes. Root-tip and shoot-tip cells have been used extensively for the study of ionizing radiation-induced chromosome aberrations. The general procedures are well known, the technology is simple and easy to learn, and the assays are relatively quick and inexpensive. Both root tips and shoot tips can be used for the study of chemical mutagens as well as ionizing radiations. Pollen mother cells are well suited for studying the effects of mutagens on meiotic chromosomes. The literature review for the Gene-Tox Program reported on 61 chemicals tested for their effects on barley chromosomes. Of these, 90% were reported to be either positive or positive dose-related, while 7% were negative and 3% were questionable. Barley assays based on chromosomal aberrations are useful to detect the clastogenic potency of chemicals under laboratory conditions. Indications are that the data from barley can be used to corroborate data obtained from other organisms. Among the classes of chemicals assayed were: alcohols and phenols; alkaloids; epoxides; alkyl sulfates; amides and sulfonamides; aromatic amines; aryl halides; aziridines; alkenes; carbamates; hydroazides; nitroaromatics; nitrosamides; nitrosources; phenothiazines; and polycyclic aromatic hydrocarbons.

(Hordeum Vulgare) Crop Coefficient and Comparative Assessment

African Journals Online (AJOL)

Bheema

The second prerequisite for sustainable use of water was developing/ ... Following the construction of .... pond capacity, the irrigation method, soil type, major crops grown in the area, and the ... determines the viability of any irrigation project. .... lack of awareness, lack of skill, technology and lack of adequate knowledge in ...

Chemical weed control in barley (hordeum vulgare)

International Nuclear Information System (INIS)

Sarwar, M.; Hassan, S.W.; Abid, A.A.

2008-01-01

Effect of two different pre-emergence herbicides i.e. Terbutryn (lgron-500FW) A, 1.01.25 kg a.t. ha/sup -1/ and Flurochloridone (Racer-25 CS) a 0.31, 0.37, 0.44, 0.50 and 0.56 Kg a.i. ha/sup -1/ on weeds and yield of barley wad studied under field conditions hb/sup -1/. All the herbicides significantly reduce the dry weight of weed Maximum reduction (70%) was observed in terbutryn a 1.0 Kg a.i. ha/sup -1/ Growth and yield parameters like number of spike lets per spike. Number of grams per spike. 1000-grain weight. Biological yield. Grain yield straw yield and harvest index showed significant response to various herbicides doses under study. Application of Flurochloridone (Racer-25 (CS) a 0.44 kg a.i. ha/sup -1/ and Terbutryn (lgran-500 FW) a 1.0 kg a.i). The data further revealed that in general all herbicide application treatments exhibited superior performance in respect of growth and yield over control. (author)

Giemsa C-banded karyotypes of Hordeum taxa from North America

DEFF Research Database (Denmark)

Linde-Laursen, Ib; Bothmer, R. von; Jacobsen, N.

1986-01-01

submetacentrics than previously reported in Hordeum distinguished the genomes of H. arizonicum and H. brachyantherum (4x) from Newfoundland. A partial inactivation of the nucleolus organizers of one parental genome in interspecific hybrids is considered more common than generally appreciated....

Untangling nucleotide diversity and evolution of the H genome in polyploid Hordeum and Elymus species based on the single copy of nuclear gene DMC1.

Directory of Open Access Journals (Sweden)

Dongfa Sun

Full Text Available Numerous hybrid and polypoid species are found within the Triticeae. It has been suggested that the H subgenome of allopolyploid Elymus (wheatgrass species originated from diploid Hordeum (barley species, but the role of hybridization between polyploid Elymus and Hordeum has not been studied. It is not clear whether gene flow across polyploid Hordeum and Elymus species has occurred following polyploid speciation. Answering these questions will provide new insights into the formation of these polyploid species, and the potential role of gene flow among polyploid species during polyploid evolution. In order to address these questions, disrupted meiotic cDNA1 (DMC1 data from the allopolyploid StH Elymus are analyzed together with diploid and polyploid Hordeum species. Phylogenetic analysis revealed that the H copies of DMC1 sequence in some Elymus are very close to the H copies of DMC1 sequence in some polyploid Hordeum species, indicating either that the H genome in theses Elymus and polyploid Hordeum species originated from same diploid donor or that gene flow has occurred among them. Our analysis also suggested that the H genomes in Elymus species originated from limited gene pool, while H genomes in Hordeum polyploids have originated from broad gene pools. Nucleotide diversity (π of the DMC1 sequences on H genome from polyploid species (π = 0.02083 in Elymus, π = 0.01680 in polyploid Hordeum is higher than that in diploid Hordeum (π = 0.01488. The estimates of Tajima's D were significantly departure from the equilibrium neutral model at this locus in diploid Hordeum species (P<0.05, suggesting an excess of rare variants in diploid species which may not contribute to the origination of polyploids. Nucleotide diversity (π of the DMC1 sequences in Elymus polyploid species (π = 0.02083 is higher than that in polyploid Hordeum (π = 0.01680, suggesting that the degree of relationships between two parents of a polyploid might be a factor

Responses of growth and primary metabolism of water-stressed barley roots to rehydration

Science.gov (United States)

Barley seedlings [Hordeum vulgare L. Brant] were grown in pots in controlled environment chambers and drought treatments were imposed 11 days after sowing. Soil water content decreased from 92% to 10% after an additional 14 days of water stress. Shoot and root growth ceased after 4 and 9 days of wat...

Environmental impact from mountainous olive orchards under different soil-management systems (SE Spain)

NARCIS (Netherlands)

Francia-Martinez, J.R.; Duran Zuazo, V.H.; Martinez-Raya, A.

2006-01-01

Soil erosion, runoff and nutrient-loss patterns over a two-year period (1999¿2000) were monitored in erosion plots on a mountainside with olive (Olea europaea cv. Picual) trees under three different types of soil management: (1) non-tillage with barley (Hordeum vulgare) strips of 4 m width (BS); (2)

Biochemistry, Structure and Function of Non-Wheat Proteins: Case Study of Barley ß-Amylase

Science.gov (United States)

The importance of a protein is not always evident and may be due to its multifunctional nature. ß-Amylase in seeds of barley (Hordeum vulgare L.) constitutes approximately 2% of the total protein in mature seeds and is assumed to be important when storage proteins are mobilized to support protein s...

Multi-method research strategy for understanding changes in storage protein composition in developing barley grain to improve nutritional profile

DEFF Research Database (Denmark)

Kaczmarczyk, Agnieszka Ewa

Barley (Hordeum vulgare L.) is cultivated in a range of diverse environments and is widely utilised as feed for animal and as malt in brewing. Nitrogen (N) is a key macronutrient whch directly increases plant growth and is used as a fertiliser to meet the demands for higher yield. However...

Nitrate Leaching, Yields and Carbon Sequestration after Noninversion Tillage, Catch Crops, and Straw Retention

DEFF Research Database (Denmark)

Hansen, Elly Møller; Munkholm, Lars Juhl; Olesen, Jørgen E

2015-01-01

retention did not significantly increase yields, nor did it reduce leaching, while fodder radish (Raphanus sativus L.) as a catch crop was capable of reducing nitrate leaching to a low level. Thus, YSL of winter wheat (Triticum aestivum L.) was higher than for spring barley (Hordeum vulgare L.) grown after...

Aspectos anatômicos de plântulas Foeniculum vulgare Mill. Anatomical aspects of the Foeniculum vulgare Mill. seedling

Directory of Open Access Journals (Sweden)

C.F. Azevedo

2012-01-01

Full Text Available A erva-doce, Foeniculum vulgare Mill. (Apiaceae, é uma erva entouceirada, aromática que apresenta propriedades condimentares e medicinais; tem origem Européia e é amplamente cultivada em todo o Brasil. Devido à deficiência de informações relativas à organização estrutural de plântulas de espécies medicinais, o presente estudo teve como objetivo fornecer informações sobre a anatomia e o desenvolvimento de plântulas de F. vulgare. As sementes de erva-doce foram semeadas em areia e mantidas em casa de vegetação por 25 dias, sendo realizadas regas diárias. Foram selecionadas plântulas normais e de padrão uniforme, que tiveram raiz, zona de transição, caule, cotilédones e primeiras folhas seccionados à mão livre. Este material foi corado e montado em lâminas com glicerina para observação em microscópio. Em todos os órgãos da plântula de erva-doce a epiderme é unisseriada, cuticularizada e com estômatos; sendo que as duas últimas estruturas não são encontradas na raiz, porém esta apresenta pêlos unicelulares e cônicos. Os cotilédones e as folhas apresentam funções fotossintéticas e nutricionais, indicadas pela presença de grande quantidade de estômatos, cloroplastos e amido. A caracterização anatômica de plântulas de F. vulgare auxilia na identificação da espécie e no conhecimento da organização celular, fornecendo informações que auxiliam em estudos fisiológicos, taxonômicos e ecológicos.Fennel, Foeniculum vulgare Mill. (Apiaceae, is a forming clumps herb and presents aromatic, medicinal and condimental properties. It has European origin and is widely cultivated and used in Brazil. Due to lack of information concerning the structural organization of seedlings of medicinal species, this study aimed to provide information about the anatomy and development of F. vulgare seedlings. The seeds fennel was sowed in sand and maintained in greenhouse for 25 days, with daily waterings. Were selected

The use of the oregano (Origanum vulgare L.) essential oil and hydrosol in green olive fermentation

OpenAIRE

M. Musa Özcan; Derya Arslan; Ali Osman Aydar

2008-01-01

The effect of oregano the (Origanum vulgare L.) oil at the levels of 0.05, 0.1 and 0.3% and oregano hydrosol on the physicochemical, microbiological and sensory characteristics of the green olive (Edremit variety) fermentation was investigated. The initial pH of the oregano oil added samples were higher than the other treatments, which were above 5.8. The highest final acidity was observed in the hydrosol+brine combination (0.53%). The initial LAB population on the first day of the fermentati...

Chemical Composition of Essential Oil from Marrubium Vulgare L. Leaves

OpenAIRE

Bayir, Burcu; Gündüz, Hatice; Usta, Tuba; Şahin, Esma; Özdemir, Zeynep; Kayır, Ömer; Sen, Özkan; Akşit, Hüseyin; Elmastaş, Mahfuz; Erenler, Ramazan

2014-01-01

– The essential oils are significant for pharmaceutical, food and cosmetic industries. Marrubium vulgare L. has been used as a traditional medicine to treat the various illnesses. The chemical composition of the essential oil from leaves of Marrubium vulgare L.was obtained by steam distillation using the Clevenger apparatus. The oil was analyzed by gas chromatography and mass spectrometry (GC-MS). The main constituent of the oil was α-pinene (28.85%)

Efficacy of Essential Oils of Thymus vulgaris and Origanum vulgare on Echinococcus granulosus

Directory of Open Access Journals (Sweden)

P. E. Pensel

2014-01-01

Full Text Available The aim of the present work was to determine the in vitro effect of T. vulgaris and O. vulgare essential oils against E. granulosus protoscoleces and cysts. Essential oils were added to the medium resulting in thymol final concentrations of 10 μg/mL. The essential oils had a time-dependent effect provoking the complete loss of protoscolex viability after 72 days of postincubation. The results were confirmed at the ultrastructure level. Loss of infectivity in protoscoleces incubated with O. vulgare after 60 days was observed. On the other hand, the weight of cysts recorded in mice inoculated with T. vulgaris treated protoscoleces was significantly lower than that obtained in control group. Gamma-glutamyl-transpeptidase activity was readily detected in the culture supernatant of protoscoleces treated either with the essential oils or thymol. T. vulgaris and O. vulgare essential oils and thymol can induce cell apoptosis of protoscoleces after short incubation times. The efficacy of T. vulgaris and O. vulgare essential oils was also demonstrated in vitro on E. granulosus murine cysts. Our data suggest that essential oils of T. vulgaris and O. vulgare have anthelmintic effect against protoscoleces and cysts of E. granulosus.

Diterpene synthases of the biosynthetic system of medicinally active diterpenoids in Marrubium vulgare

DEFF Research Database (Denmark)

Zerbe, Philipp; Chiang, Angela; Dullat, Harpreet

2014-01-01

Marrubium vulgare (Lamiaceae) is a medicinal plant whose major bioactive compounds, marrubiin and other labdane-related furanoid diterpenoids, have potential applications as anti-diabetics, analgesics or vasorelaxants. Metabolite and transcriptome profiling of M. vulgare leaves identified five...... different candidate diterpene synthases (diTPSs) of the TPS-c and TPS-e/f clades. We describe the in vitro and in vivo functional characterization of the M. vulgare diTPS family. In addition to MvEKS ent-kaurene synthase of general metabolism, we identified three diTPSs of specialized metabolism: MvCPS3...

Anti-Inflammatory, Antioxidant, Antibiotic, and Cytotoxic Activities of Tanacetum vulgare L. Essential Oil and Its Constituents.

Science.gov (United States)

Coté, Héloïse; Boucher, Marie-Anne; Pichette, André; Legault, Jean

2017-05-25

Background: Tanacetum vulgare L. (Asteraceae) is a perennial herb that has been used to treat multiple ailments. Regional variability of the chemical composition of T. vulgare essential oils is well-known. Despite these regional chemotypes, most relevant studies did not analyze the complete chemical composition of the T. vulgare essential oil and its constituents in relation to their biological activities. Here, we assess the anti-inflammatory, antioxidant, antibacterial, and cytotoxic activities of T. vulgare collected from northern Quebec (Saguenay-Lac-St-Jean), Canada. Methods: Essential oil was extracted from plants by steam distillation and analyzed using GC-FID. Biological activities of essential oil and its main constituents were evaluated in vitro. Results: We identified the major compounds as camphor, borneol, and 1,8-cineole. The oil possesses anti-inflammatory activity inhibiting NO production. It also inhibits intracellular DCFH oxidation induced by tert-butylhydroperoxide. Anti-inflammatory activity of essential oil appears driven mainly by α-humulene while antioxidant activity is provided by α-pinene and caryophyllene oxide. Essential oil from T vulgare was active against both Escherichia coli and Staphylococcus aureus with camphor and caryophyllene oxide responsible for antibacterial activity. Finally, T. vulgare essential oil was slightly cytotoxic against the human healthy cell line WS1 while α-humulene and caryophyllene oxide were moderately cytotoxic against A-549, DLD-1, and WS1. Conclusion: We report, for the first time, links between the specific compounds found in T. vulgare essential oil and anti-inflammatory, antioxidant, antibacterial, and cytotoxic activities. T. vulgare essential oil possesses interesting biological properties.

Anti-Inflammatory, Antioxidant, Antibiotic, and Cytotoxic Activities of Tanacetum vulgare L. Essential Oil and Its Constituents

Directory of Open Access Journals (Sweden)

Héloïse Coté

2017-05-01

Full Text Available Background: Tanacetum vulgare L. (Asteraceae is a perennial herb that has been used to treat multiple ailments. Regional variability of the chemical composition of T. vulgare essential oils is well-known. Despite these regional chemotypes, most relevant studies did not analyze the complete chemical composition of the T. vulgare essential oil and its constituents in relation to their biological activities. Here, we assess the anti-inflammatory, antioxidant, antibacterial, and cytotoxic activities of T. vulgare collected from northern Quebec (Saguenay-Lac-St-Jean, Canada. Methods: Essential oil was extracted from plants by steam distillation and analyzed using GC-FID. Biological activities of essential oil and its main constituents were evaluated in vitro. Results: We identified the major compounds as camphor, borneol, and 1,8-cineole. The oil possesses anti-inflammatory activity inhibiting NO production. It also inhibits intracellular DCFH oxidation induced by tert-butylhydroperoxide. Anti-inflammatory activity of essential oil appears driven mainly by α-humulene while antioxidant activity is provided by α-pinene and caryophyllene oxide. Essential oil from T vulgare was active against both Escherichia coli and Staphylococcus aureus with camphor and caryophyllene oxide responsible for antibacterial activity. Finally, T. vulgare essential oil was slightly cytotoxic against the human healthy cell line WS1 while α-humulene and caryophyllene oxide were moderately cytotoxic against A-549, DLD-1, and WS1. Conclusion: We report, for the first time, links between the specific compounds found in T. vulgare essential oil and anti-inflammatory, antioxidant, antibacterial, and cytotoxic activities. T. vulgare essential oil possesses interesting biological properties.

AFLP genetic polymorphism in wild barley (Hordeum spontaneum) populations in Israel

NARCIS (Netherlands)

Turpeinen, T.; Vanhala, T.; Nevo, E.; Nissila, E.

2003-01-01

The genetic diversity produced by the amplified fragment length polymorphism (AFLP) method was studied in 94 genotypes of wild barley, Hordeum spontaneum (C. Koch) Thell., originating from ten ecologically and geographically different locations in Israel. Eight primer pairs produced 204 discernible

Origanum vulgare (Lamiaceae OVICIDAL POTENTIAL ON GASTROINTESTINAL NEMATODES OF CATTLE

Directory of Open Access Journals (Sweden)

Luciana Laitano Dias de Castro

2013-12-01

Full Text Available Due to anthelmintic resistance in nematodes, several research studies have been developed seeking control alternatives to these parasites. This study evaluated the in vitro action of Origanum vulgare on gastrointestinal nematode eggs of cattle. In order to evaluate the ability to inhibit egg hatch, different dried leaves extracts of this plant were tested, such as dye, hydroalcoholic and aqueous extracts at concentrations varying from 0.62 to 80 mg/mL. Each assay was accompanied by control containing levamisole hydrochloride (0.2 mg/mL, distilled water and 70 ºGL grain alcohol at the same concentration of the extracts. Test results showed that the different O. vulgare extracts inhibited egg hatch of cattle gastrointestinal nematodes at a percentage that varied from 8.8 to 100%; dye and hydroalcoholic extract were the most promising inhibitors. In view of this ovicidal property, O. vulgare may be an important source of viable antiparasitic compounds for nematodiosis control in ruminants.

Actividade antimicrobiana do óleo essencial do Foeniculum vulgare Miller Antimicrobial activity of Foeniculum vulgare Miller essential oil

Directory of Open Access Journals (Sweden)

M. T. Tinoco

2007-01-01

Full Text Available O Foeniculum vulgare Mill. subsp. vulgare é uma planta espontânea da região mediterrânea, pertencente à família Apiaceae. O seu óleo essencial, principalmente o dos frutos secos, é amplamente utilizado nas indústrias alimentar, farmacêutica, cosmética e perfumaria. Neste trabalho, pretendeu-se avaliar a actividade antimicrobiana do óleo essencial dos frutos verdes e das folhas da variedade de funcho doce colhido no Alentejo, na região de Évora, e relacionar essa actividade com a respectiva composição química. A extracção dos óleos essenciais foi efectuada por hidrodestilação e a sua análise foi feita por GC-FID e GC-MS. No óleo das folhas foram identificados como componentes maioritários os fenilpropanóides anetol, fenchona e estragol e o monoterpeno a-felandreno, enquanto que o óleo dos frutos apresentou como constituintes predominantes anetol e fenchona. A actividade antimicrobiana dos óleos foi avaliada face às estirpes Staphylococcus aureus, Escherichia coli, Saccharomyces spp., Fusarium oxysporum e Penicillium sp.. Os óleos essenciais apresentaram actividade antimicrobiana contra S. aureus, Saccharomyces spp. e Fusarium oxysporum.Foeniculum vulgare Mill. ssp. vulgare is a spontaneous plant of Mediterranean region that belongs to the Apiaceae family. Its essential oil is used as additives in food, pharmaceutical, cosmetic and perfume industries mainly that one obtained from dried seeds. The main goal of this work were to evaluate the antimicrobial activity of essential oils obtained from fresh leaves and unripe seeds of sweet fennel, collected in Évora-Alentejo, in face of their chemical composition. The extraction of the essentials oils was made by hydrodistillation. Chemical analyses were carried out by GC-FID and GCMS. Phenylpropanoides anethole, fenchone, estragole and the monoterpene aphellandrene were the most abundant compounds of leaves essential oil. Seeds essential oil showed as main components

Registration of ‘Kardia’, a Two-Rowed Spring Food Barley

Science.gov (United States)

‘Kardia’ (Reg. No. XXXX, XXXX), a two-rowed spring food barley (Hordeum vulgare L.) developed by the USDA-ARS, Aberdeen, ID, in cooperation with the University of Idaho Agricultural Experiment Station, was released in 2015. Kardia is derived from the cross of ‘03AH3054 / 98Ab12019’ and was advanced...

Phytochemical Analysis, Antibacterial Activity of Marrubium vulgare L against Staphylococcus aureus in vitro

Directory of Open Access Journals (Sweden)

Saeide Saeidi

2014-10-01

Full Text Available Background: Herbal medicines are the major remedy in traditional medical systems and made a great contribution in maintaining human health and in preventing many infectious diseases. The present study was carried out to determine the potential antibacterial effect of ethanol extracts and essential oil of Marrubium vulgare L. against Staphylococcus aureus which is antibiotic resistant. Materials and Methods: All 17 strains of S. aureus isolated from nose and throat sample from 160 healthy subjects, hospital staffs and inpatient in the city of Zabol (Amir Al-Momenin hospital, Zabol, south-eastern Iran were screened during years 2010-2011. In this study, the essential oil of Marrubium vulgare L. obtained by hydrodistillation was analyzed by gas chromatography coupled to mass spectrometry (GC-MS in order to determine their chemical composition. The minimum inhibitory concentrations were investigated to characterize the antimicrobial activities of this essential oil and extract. Results: Thirty-one components in the oil of Marrubium vulgare were identified. The results demonstrated that the major components of the essential oil were γ-Eudesmol (11%, Germacrene (10%, D-Citronelly formate (10%, β-Citronellol (8%, Geranyl tiglate (7.1%, Geranyl formate (6.02%. The least MIC value of extract M. vulgare was 2.5 mg/mL and the highest MIC value of essential oil M. vulgare was 2.5 mg/mL. Conclusion: This investigation showed that the M. vulgare essential oil and extract has a potent antimicrobial activity against S. aureus. The present studies confirm the use of this essential oil and extract as antibacterial agent. Further research is required to evaluate the practical values of therapeutic applications.

Primer registro de Conidiobolus coronatus (Zygomycetes: Entomophthorales en crías experimentales de dos especies plaga del maíz: Delphacodes kuscheli y D. haywardi (Hemiptera: Delphacidae en la Argentina First record of Conidiobolus coronatus (Zygomycetes: Entomophthorales in experimental breeding of two pest species of corn: Delphacodes kuscheli and D. haywardi Muir (Hemiptera: Delphacidae in Argentine

Directory of Open Access Journals (Sweden)

A. V. Toledo

Full Text Available Se investigó la ocurrencia natural del hongo entomopatógeno Conidiobolus coronatus (Costantin Batko (Zygomycetes: Entomophthorales en adultos de Delphacodes kuscheli Fennah y D. haywardi Muir (Hemiptera: Delphacidae, criados sobre Hordeum vulgare L. bajo condiciones de invernadero. Los insectos muertos, por una sospechada infección fúngica, fueron recolectados, esterilizados superficialmente, y examinados en el laboratorio. Conidiobolus coronatus fue aislado en cultivos puros, descrito morfológicamente y depositado en colecciones micológicas. Este trabajo presenta el primer registro de C. coronatus contra insectos perjudiciales en la Argentina.The natural occurrence of the entomopathogenic fungus Conidiobolus coronatus (Costantin Batko (Zygomycetes: Entomophthorales in adults of Delphacodes kuscheli Fennah and D. haywardi Muir (Hemiptera: Delphacidae, reared on Hordeum vulgare L. under greenhouse conditions, was investigated. Dead insects, suspected of fungal infection, were collected, surface sterilized, and examined in the laboratory. Conidiobolus coronatus was isolated in pure cultures, described morphologically, and deposited in mycological collections. This paper presents the first record of C. coronatus against harmful insects in Argentina.

Recovery of nitrogen by spring barley following incorporation of 15N-labelled straw and catch crop material

DEFF Research Database (Denmark)

Thomsen, I.K.; Jensen, E.S.

1994-01-01

The recovery by spring barley (Hordeum vulgare L.) of nitrogen mineralized from N-15-labelled straw and ryegrass material was followed for 3 years in the field. The effects of separate and combined applications of straw and ryegrass were studied using cross-labelling with N-15. Reference plots re...... mineral fertilizer was in the second and third barley crop similar to the recovery of N from incorporated plant residues.......The recovery by spring barley (Hordeum vulgare L.) of nitrogen mineralized from N-15-labelled straw and ryegrass material was followed for 3 years in the field. The effects of separate and combined applications of straw and ryegrass were studied using cross-labelling with N-15. Reference plots...... receiving (NH4NO3)-N-15-N-15 were included. Plant samples were taken every second week until maturity during the first growing season and at maturity in the two following years. Incorporation of plant material had no significant influence on the above-ground dry matter yield of the barley. The barley...

Implementation of biochemical screening to improve baking quality of barley

DEFF Research Database (Denmark)

Vincze, Éva; Dionisio, Giuseppe; Aaslo, Per

2011-01-01

Barley (Hordeum vulgare) has the potential to offer considerable human nutritional benefits, especially as supplement to wheat-based breads. Under current commercial baking conditions it is not possible to introduce more that 20% barley flour to the wheat bread without negative impact on the phys......Barley (Hordeum vulgare) has the potential to offer considerable human nutritional benefits, especially as supplement to wheat-based breads. Under current commercial baking conditions it is not possible to introduce more that 20% barley flour to the wheat bread without negative impact...... on the physical chemical properties of the bread products due to the poor baking properties of barley flour. As a consequence, the nutritional advantages of barley are not fully exploited. The inferior leavening and baking properties of barley can, in part, be attributed to the physical properties of the storage...... proteins. Changing the storage protein composition can lessen this problem. Our working hypothesis was that exploiting the substantial genetic variation within the gene pool for storage proteins could enable improving the baking qualities of barley flour. We characterised forty-nine barley cultivars...

Taxonomy, Variation, and Relationships in the Hordeum parodii Group (Poaceae)

DEFF Research Database (Denmark)

Von Bothmer, R.; Jacobsen, N.; Bagger Jørgensen, Rikke

1986-01-01

The Hordeum parodii group contains three species, viz. H. parodii Covas (6x), H. tetraploidum Covas (4x), and H. fuegianum Bothmer, Jacobsen, et Jorgensen, sp. nov. (4x). The former two species mainly occur in C and S Argentina, while H. fuegianum is native to Tierra del Fuego. All three species...

Physiological effects and transport of 24-epibrassinolide in heat-stressed barley

Czech Academy of Sciences Publication Activity Database

Janeczko, A.; Oklešťková, Jana; Pociecha, E.; Koscielniak, J.; Mirek, M.

2011-01-01

Roč. 33, č. 4 (2011), s. 1249-1259 ISSN 0137-5881 R&D Projects: GA AV ČR IAA400550801; GA ČR GA301/08/1649 Institutional research plan: CEZ:AV0Z50380511 Keywords : Brassinosteroid transport * Dark respiration * Hordeum vulgare L * PSII efficiency * Metabolic activity Subject RIV: EF - Botanics Impact factor: 1.639, year: 2011

Effects of slurry pre-treatment and application technique on short-term N₂O emmissions as determind by a new non-linear approach

DEFF Research Database (Denmark)

Thomsen, Ingrid K; Pedersen, Asger R; Nyord, Tavs

2010-01-01

, and losses via N2O. Two field experiments were carried out on a loamy sand. Pig slurry was applied to established crops, i.e., to spring barley (Hordeum vulgare L.) in May 2007, and to winter wheat (Triticum aestivum L.) in April 2008. In 2007 the slurry was applied by direct injection using either winged...

Ridging in autumn as an alternative to mouldboard ploughing in a humid-temperate region

DEFF Research Database (Denmark)

Henriksen, Jens Christian Martin Bugge; Rasmussen, Jesper; Søgaard, Carsten

2006-01-01

and ploughing. Residue treatments were stubble, stubble + straw and stubble + liquid manure in order to create a gradient of C/N ratios. From the time of harvest until planting of a subsequent barley crop (Hordeum vulgare L.), inorganic N was determined 11 times in 1998–1999 and 10 times in 1999–2000 in the 0...

Comparison of fast neutrons and X-rays in respect to genetic effects accompanying induced chromosome aberrations, in relation to the evaluation of the BARN-reactor

International Nuclear Information System (INIS)

Ramulu, K.S.

1980-01-01

The M 2 and M 3 plants derived from both fast neutron and X-ray treatments have been studied to detect and analyse reciprocal translocations in Arabidopsis thaliana (L.) Heynh. cv. Landsberg erecta (2n=10), Hordeum vulgare L. cv. Aramir (2n=14) and Secale cereale L., summer inbred line ZF9 (2n=14). (Auth.)

Effects of 24-epibrassinolide and green light on plastid gene transcription and cytokinin content of barley leaves

Czech Academy of Sciences Publication Activity Database

Efimova, N.V.; Vaňková, Radomíra; Kusnetsov, V.; Litvinovskaya, R. P.; Zlobin, Y.L.; Dobrev, Petre; Vedenicheva, N.P.; Savchuk, A. L.; Karnachuk, R. A.; Kudryakova, N.V.; Kuznetsov, V. D.

2017-01-01

Roč. 120, APR (2017), s. 32-40 ISSN 0039-128X Institutional support: RVO:61389030 Keywords : lupinus-luteus cotyledons * arabidopsis-thaliana * de-etiolation * abscisic-acid * brassinosteroid biosynthesis * plant development * hormonal balance * mutant * expression * growth * Brassinosteroids * Cytokinin * Gene expression * Green light * Hordeum vulgare * Transcription Subject RIV: EF - Botanics OBOR OECD: Plant sciences, botany Impact factor: 2.282, year: 2016

Foeniculum vulgare: A comprehensive review of its traditional use, phytochemistry, pharmacology, and safety

Directory of Open Access Journals (Sweden)

Manzoor A. Rather

2016-11-01

Full Text Available Foeniculum vulgare (Apiaceae commonly known as fennel is a well known and important medicinal and aromatic plant widely used as carminative, digestive, lactogogue and diuretic and in treating respiratory and gastrointestinal disorders. Its seeds are used as flavourings in baked goods, meat and fish dishes, ice cream, alcoholic beverages and herb mixtures. Phenols, phenolic glycosides and volatile aroma compounds such as trans-anethole, estragole and fenchone have been reported as the major phytoconstituents of this species. Different pharmacological experiments in a number of in vitro and in vivo models have convincingly demonstrated the ability of F. vulgare to exhibit antifungal, antibacterial, antioxidant, antithrombotic and hepatoprotective activities, lending support to the rationale behind several of its therapeutic uses. Phenolic compounds isolated from F. vulgare are considered to be responsible for its antioxidant activity while the volatile aroma compounds make it an excellent flavouring agent. The present review is an up-to-date and comprehensive analysis of the chemistry, pharmacology, traditional uses and safety of F. vulgare.

Relationships in the barley genus (Hordeum): An electrophoretic examination of proteins

DEFF Research Database (Denmark)

Bagger Jørgensen, Rikke

1986-01-01

The relationships between all known Hordeum species except H. guatemalense were inferred from the electrophoresis of the six enzyme systems Got, 6-Pgd, Mdh, Idh, .alpha.- and.beta.- amylases. A total of eleven loci were scored for in these systems. Maximum likelihood clusters and Wagner networks...

The genetics and mechanism of avoidance of rust infection in Hordeum chilense

NARCIS (Netherlands)

Vaz Patto, M.C.

2001-01-01

Hordeum chilense is a perennial species occurring in Chile and Argentina. This wild barley species shows a very wide range of variation of morphological and agronomic characters and crosses easily with other members of the Triticeae

Environmental adaptibility of tansy ( Tanacetum vulgare L ...

African Journals Online (AJOL)

Ecological role of essential oils is reflected in the interaction of plants with environmental factors. Environmental adaptability of the plants can be assumed from essential oil contents. Essential oils are agents, which communicate with the plant environment. Tansy (Tanacetum vulgare L.) was selected for laboratory research ...

Environmental adaptibility of tansy (Tanacetum vulgare L.)

African Journals Online (AJOL)

STORAGESEVER

2009-11-16

Nov 16, 2009 ... Ecological role of essential oils is reflected in the interaction of plants with environmental factors. Environmental adaptability of the plants can be assumed from essential oil contents. Essential oils are agents, which communicate with the plant environment. Tansy (Tanacetum vulgare L.) was selected for.

Antibacterial and antioxidant activities of essential oils isolated from Thymbra capitata L. (Cav.) andOriganum vulgare L.

Science.gov (United States)

Faleiro, Leonor; Miguel, Graça; Gomes, Sónia; Costa, Ludmila; Venâncio, Florencia; Teixeira, Adriano; Figueiredo, A Cristina; Barroso, José G; Pedro, Luis G

2005-10-19

Antilisterial activities of Thymbra capitata and Origanum vulgare essential oils were tested against 41 strains of Listeria monocytogenes. The oil of T. capitata was mainly constituted by one component, carvacrol (79%), whereas for O. vulgare three components constituted 70% of the oil, namely, thymol (33%), gamma-terpinene (26%), and p-cymene (11%). T. capitata essential oil had a significantly higher antilisterial activity in comparison to O. vulgare oil and chloramphenicol. No significant differences in L. monocytogenes susceptibilities to the essential oils tested were registered. The minimum inhibitory concentration values of T. capitata essential oil and of carvacrol were quite similar, ranging between 0.05 and 0.2 microL/mL. Antioxidant activity was also tested, the essential oil of T. capitata showing significantly higher antioxidant activity than that of O. vulgare. Use of T. capitata and O. vulgare essential oils can constitute a powerful tool in the control of L. monocytogenes in food and other industries.

Diversity in boron toxicity tolerance of Australian barley (Hordeum vulgare L.) genotypes.

Science.gov (United States)

Hayes, Julie E; Pallotta, Margaret; Garcia, Melissa; Öz, Mehmet Tufan; Rongala, Jay; Sutton, Tim

2015-09-26

Boron (B) is an important micronutrient for plant growth, but is toxic when levels are too high. This commonly occurs in environments with alkaline soils and relatively low rainfall, including many of the cereal growing regions of southern Australia. Four major genetic loci controlling tolerance to high soil B have been identified in the landrace barley, Sahara 3771. Genes underlying two of the loci encode the B transporters HvBot1 and HvNIP2;1. We investigated sequence and expression level diversity in HvBot1 and HvNIP2;1 across barley germplasm, and identified five novel coding sequence alleles for HvBot1. Lines were identified containing either single or multiple copies of the Sahara HvBot1 allele. We established that only the tandemly duplicated Sahara allele conferred B tolerance, and this duplicated allele was found only in a set of nine lines accessioned in Australian collections as Sahara 3763-3771. HvNIP2;1 coding sequences were highly conserved across barley germplasm. We identified the likely causative SNP in the 5'UTR of Sahara HvNIP2;1, and propose that the creation of a small upstream open reading frame interferes with HvNIP2;1 translation in Sahara 3771. Similar to HvBot1, the tolerant HvNIP2;1 allele was unique to the Sahara barley accessions. We identified a new source of the 2H B tolerance allele controlling leaf symptom development, in the landrace Ethiopia 756. Ethiopia 756, as well as the cultivar Sloop Vic which carries both the 2H and HvBot1 B tolerance alleles derived from Sahara 3771, may be valuable as alternative parents in breeding programs targeted to high soil B environments. There is significant diversity in B toxicity tolerance among contemporary Australian barley varieties but this is not related to variation at any of the four known B tolerance loci, indicating that novel, as yet undiscovered, sources of tolerance exist.

DNA replication after mutagenic treatment in Hordeum vulgare.

Science.gov (United States)

Kwasniewska, Jolanta; Kus, Arita; Swoboda, Monika; Braszewska-Zalewska, Agnieszka

2016-12-01

The temporal and spatial properties of DNA replication in plants related to DNA damage and mutagenesis is poorly understood. Experiments were carried out to explore the relationships between DNA replication, chromatin structure and DNA damage in nuclei from barley root tips. We quantitavely analysed the topological organisation of replication foci using pulse EdU labelling during the S phase and its relationship with the DNA damage induced by mutagenic treatment with maleic hydrazide (MH), nitroso-N-methyl-urea (MNU) and gamma ray. Treatment with mutagens did not change the characteristic S-phase patterns in the nuclei; however, the frequencies of the S-phase-labelled cells after treatment differed from those observed in the control cells. The analyses of DNA replication in barley nuclei were extended to the micronuclei induced by mutagens. Replication in the chromatin of the micronuclei was rare. The results of simultanous TUNEL reaction to identify cells with DNA strand breaks and the labelling of the S-phase cells with EdU revealed the possibility of DNA replication occurring in damaged nuclei. For the first time, the intensity of EdU fluorescence to study the rate of DNA replication was analysed. Copyright © 2016 Elsevier B.V. All rights reserved.

Creation of the first ultra-low gluten barley (Hordeum vulgare L.) for coeliac and gluten-intolerant populations.

Science.gov (United States)

Tanner, Gregory J; Blundell, Malcolm J; Colgrave, Michelle L; Howitt, Crispin A

2016-04-01

Coeliac disease is a well-defined condition that is estimated to affect approximately 1% of the population worldwide. Noncoeliac gluten sensitivity is a condition that is less well defined, but is estimated to affect up to 10% of the population, and is often self-diagnosed. At present, the only remedy for both conditions is a lifelong gluten-free diet. A gluten-free diet is often expensive, high in fat and low in fibre, which in themselves can lead to adverse health outcomes. Thus, there is an opportunity to use novel plant breeding strategies to develop alternative gluten-free grains. In this work, we describe the breeding and characterization of a novel ultra-low gluten (ULG) barley variety in which the hordein (gluten) content was reduced to below 5 ppm. This was achieved using traditional breeding strategies to combine three recessive alleles, which act independently of each other to lower the hordein content in the parental varieties. The grain of the initial variety was shrunken compared to wild-type barleys. We implemented a breeding strategy to improve the grain size to near wild-type levels and demonstrated that the grains can be malted and brewed successfully. The ULG barley has the potential to provide novel healthy foods and beverages for those who require a gluten-free diet. © 2015 The Authors. Plant Biotechnology Journal published by Society for Experimental Biology and The Association of Applied Biologists and John Wiley & Sons Ltd.

Coupling amplified DNA from flow-sorted chromosomes to high-density SNP mapping in barley

Czech Academy of Sciences Publication Activity Database

Šimková, Hana; Svensson, J.T.; Condamine, P.; Hřibová, Eva; Suchánková, Pavla; Bhat, P.R.; Bartoš, Jan; Šafář, Jan; Close, T.J.; Doležel, Jaroslav

2008-01-01

Roč. 9, č. 294 (2008), s. 1-9 ISSN 1471-2164 R&D Projects: GA ČR GD521/05/H013; GA MŠk ME 884; GA MŠk(CZ) LC06004 Institutional research plan: CEZ:AV0Z50380511 Keywords : Flow cytometry * DNA amplification * Hordeum vulgare L. Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 3.926, year: 2008

INFLUENCE OF SPATIAL AND TEMPORAL VARIATIONS IN THE HYPERSENSITIVE RESPONSE ON THE ACCUMULATION OF DEFENSE-RELATED TRANSCRIPTS IN POWDERY MILDEW-INFECTED BARLEY

Czech Academy of Sciences Publication Activity Database

Rayapuram, C.; Hemzalová, Vendula; Lyngkjaer, M. E.

2011-01-01

Roč. 93, č. 3 (2011), s. 613-625 ISSN 1125-4653 R&D Projects: GA MZe QH72117 Institutional research plan: CEZ:AV0Z50380511 Keywords : Blumeria graminis f. sp hordei * Hordeum vulgare * hypersensitive response Subject RIV: GF - Plant Pathology, Vermin, Weed, Plant Protection Impact factor: 0.912, year: 2011 http://sipav.org/main/jpp/index.php/jpp/article/view/1229

Radiation induced early maturing mutants in barley

International Nuclear Information System (INIS)

Kumar, R.; Chauhan, S.V.S.; Sharma, R.P.

1978-01-01

In M 2 generation, two early maturing plants were screened from a single spike progeny of a plant obtained from 20 kR of gamma-ray irradiation of a six-rowed barley (Hordeum vulgare L. var. Jyoti). Their true breeding nature was confirmed in M 3 generation. These mutants flower and mature 38 and 22 days earlier than those of control. (auth.)

Development and characterization of polymorphic EST based SSR markers in barley (Hordeum vulgare).

Science.gov (United States)

Jo, Won-Sam; Kim, Hye-Yeong; Kim, Kyung-Min

2017-08-01

In barley, breeding using good genetic characteristics can improve the quality or quantity of crop characters from one generation to the next generation. The development of effective molecular markers in barley is crucial for understanding and analyzing the diversity of useful alleles. In this study, we conducted genetic relationship analysis using expressed sequence tag-simple sequence repeat (EST-SSR) markers for barley identification and assessment of barley cultivar similarity. Seeds from 82 cultivars, including 31 each of naked and hulled barley from the Korea Seed and Variety Service and 20 of malting barley from the RDA-Genebank Information Center, were analyzed in this study. A cDNA library of the cultivar Gwanbori was constructed for use in analysis of genetic relationships, and 58 EST-SSR markers were developed and characterized. In total, 47 SSR markers were employed to analyze polymorphisms. A relationship dendrogram based on the polymorphism data was constructed to compare genetic diversity. We found that the polymorphism information content among the examined cultivars was 0.519, which indicates that there is low genetic diversity among Korean barley cultivars. The results obtained in this study may be useful in preventing redundant investment in new cultivars and in resolving disputes over seed patents. Our approach can be used by companies and government groups to develop different cultivars with distinguishable markers. In addition, the developed markers can be used for quantitative trait locus analysis to improve both the quantity and the quality of cultivated barley.

JST Thesaurus Headwords and Synonyms: Sorghum vulgare [MeCab user dictionary for science technology term[Archive

Lifescience Database Archive (English)

Full Text Available MeCab user dictionary for science technology term Sorghum vulgare 名詞 一般 * * * * モロコ...シ モロコシ モロコシ Thesaurus2015 200906063836088318 C LS06/LS72 UNKNOWN_2 Sorghum vulgare

Omslaget - hvid okseøje (Leucanthemum vulgare)

DEFF Research Database (Denmark)

Friis, Ib

2010-01-01

Artiklen redergør for den historiske baggrund for den illustration (tavle 994 fra Flora Danica, udgivet i 1790) af hvid okseøje (Leucanthemum vulgare), der er anvendt som illustration på festskriftets omslag. De illustratorer, der blev anvendt af Martin Vahl, udgiver af Flora Danica da tavle 994...

Foderstater för ökad konsumtion av vallfoder

DEFF Research Database (Denmark)

Hetta, M.; Lund, Peter; Tahir, M.N.

2011-01-01

nedbrytningen från våmmen till tunntarmen. Nedbrytning av stärkelse i tunntarmen leder till högre energieffektivitet i ämnesomsättningen. Stärkelse hos korn (Hordeum Vulgare, L) anses i litteraturen ha en snabb omsättning i våmmen och stärkelse hos majs (Zea Mays, L) anses ha en långsam nedbrytning (Mills et al...

Toxicities of TNT and RDX to Terrestrial Plants in Five Soils with Contrasting Characteristics

Science.gov (United States)

2013-07-01

lettuce ( Lactuca sativa (L.)) and barley (Hordeum vulgare (L.)), respectively, at analytically determined soil concentrations up to and including 3320... sativa L.), Japanese millet (J. millet; Echinochloa crus-galli L. [Beauv.]), and perennial ryegrass (Lolium perenne L.) in five natural soils that...of the test. The test species in these studies were Medicago sativa (L.) var. Canada no. 1 (alfalfa), Echinochloa crus-galli (L.) P. Beauv. var

Progenitor-derivative relationships of Hordeum polyploids (Poaceae, Triticeae inferred from sequences of TOPO6, a nuclear low-copy gene region.

Directory of Open Access Journals (Sweden)

Jonathan Brassac

Full Text Available Polyploidization is a major mechanism of speciation in plants. Within the barley genus Hordeum, approximately half of the taxa are polyploids. While for diploid species a good hypothesis of phylogenetic relationships exists, there is little information available for the polyploids (4×, 6× of Hordeum. Relationships among all 33 diploid and polyploid Hordeum species were analyzed with the low-copy nuclear marker region TOPO6 for 341 Hordeum individuals and eight outgroup species. PCR products were either directly sequenced or cloned and on average 12 clones per individual were included in phylogenetic analyses. In most diploid Hordeum species TOPO6 is probably a single-copy locus. Most sequences found in polyploid individuals phylogenetically cluster together with sequences derived from diploid species and thus allow the identification of parental taxa of polyploids. Four groups of sequences occurring only in polyploid taxa are interpreted as footprints of extinct diploid taxa, which contributed to allopolyploid evolution. Our analysis identifies three key species involved in the evolution of the American polyploids of the genus. (i All but one of the American tetraploids have a TOPO6 copy originating from the Central Asian diploid H. roshevitzii, the second copy clustering with different American diploid species. (ii All hexaploid species from the New World have a copy of an extinct close relative of H. californicum and (iii possess the TOPO6 sequence pattern of tetraploid H. jubatum, each with an additional copy derived from different American diploids. Tetraploid H. bulbosum is an autopolyploid, while the assumed autopolyploid H. brevisubulatum (4×, 6× was identified as allopolyploid throughout most of its distribution area. The use of a proof-reading DNA polymerase in PCR reduced the proportion of chimerical sequences in polyploids in comparison to Taq polymerase.

Antibacterial activity of whole plant extract of Marrubium vulgare

African Journals Online (AJOL)

SERVER

2007-11-26

Nov 26, 2007 ... Key words: Disc diffusion, antibacterial activity, Marrubium vulgare. INTRODUCTION .... Glossary of Indian Medicinal. Plants, CSIR, V ed. ... 22. E. coli MTCC 443. 0. 0. 0. 10. 15. 400. 25. P. vulgaris MTCC 426. 0. 0. 0. 11. 16.

Foeniculum vulgare Mill: A Review of Its Botany, Phytochemistry, Pharmacology, Contemporary Application, and Toxicology

Directory of Open Access Journals (Sweden)

Shamkant B. Badgujar

2014-01-01

Full Text Available Foeniculum vulgare Mill commonly called fennel has been used in traditional medicine for a wide range of ailments related to digestive, endocrine, reproductive, and respiratory systems. Additionally, it is also used as a galactagogue agent for lactating mothers. The review aims to gather the fragmented information available in the literature regarding morphology, ethnomedicinal applications, phytochemistry, pharmacology, and toxicology of Foeniculum vulgare. It also compiles available scientific evidence for the ethnobotanical claims and to identify gaps required to be filled by future research. Findings based on their traditional uses and scientific evaluation indicates that Foeniculum vulgare remains to be the most widely used herbal plant. It has been used for more than forty types of disorders. Phytochemical studies have shown the presence of numerous valuable compounds, such as volatile compounds, flavonoids, phenolic compounds, fatty acids, and amino acids. Compiled data indicate their efficacy in several in vitro and in vivo pharmacological properties such as antimicrobial, antiviral, anti-inflammatory, antimutagenic, antinociceptive, antipyretic, antispasmodic, antithrombotic, apoptotic, cardiovascular, chemomodulatory, antitumor, hepatoprotective, hypoglycemic, hypolipidemic, and memory enhancing property. Foeniculum vulgare has emerged as a good source of traditional medicine and it provides a noteworthy basis in pharmaceutical biology for the development/formulation of new drugs and future clinical uses.

Interference of heating on the antimicrobial activity and chemical composition of Origanum vulgare L. (Lamiaceae essential oil Interferência do aquecimento sobre a atividade antimicrobiana e composição química do óleo essencial de Origanum vulgare L. (Lamiaceae

Directory of Open Access Journals (Sweden)

Evandro Leite de Souza

2008-06-01

Full Text Available Origanum vulgare L. (oregano, Lamiaceae, essential oil has a variety of biological properties and its antimicrobial activity has received a renewed interest for use in food conservation. The aim of this study was to evaluate the interference of heating on the antimicrobial activity and chemical composition of O. vulgare essential oil. The antimicrobial activity of the essential oil kept at room temperature and exposed to different heating temperatures (60, 80, 100 and 120 °C during 1 hour was evaluated by observing antimicrobial effectiveness at absolute concentration and determining MIC values by the solid medium diffusion procedure. The essential oil chemical composition analysis was performed by GC-MS. O. vulgare essential oil showed interesting antimicrobial activity on all assayed microbial strains (Candida albicans, C.krusei, C. tropicalis, Bacillus cereus, Escherichia coli, Staphylococcus aureus, Yersinia enterocolitica, Salmonella enterica, Serratia marcencens, noted by large growth inhibition zones (30-42 mm. Heating treatment showed no significant interference (p O óleo essencial de Origanum vulgare L. Lamiaceae (orégano apresenta variadas propriedades biológicas, de modo que seu potencial antimicrobiano tem despertado interesse para uso na conservação de alimentos. Este estudo objetivou avaliar a interferência de diferentes tratamentos térmicos (60, 80, 100 e 120 °C/1 hora sobre a efetividade antimicrobiana e composição química do óleo essencial de O. vulgare. A efetividade antimicrobiana do óleo essencial exposto aos diferentes tratamentos térmicos foi avaliada através da observação de sua atividade antimicrobiana em concentração absoluta e através da determinação da sua CIM utilizando-se a técnica de difusão em meio sólido. O estudo da composição do óleo essencial foi realizado através de GC-MS. O óleo essencial apresentou intensa atividade antimicrobiana sobre todas as amostras microbianas ensaiadas

Effect of dietary oregano ( Origanum vulgare L.) essential oil on ...

African Journals Online (AJOL)

Effect of dietary oregano ( Origanum vulgare L.) essential oil on growth performance, cecal microflora and serum antioxidant activity of broiler chickens. ... promoting effects and also displayed potent antibacterial effects against cecal E. coli.

Transfer of radiocaesium to barley, rye grass and pea

International Nuclear Information System (INIS)

Oehlenschlaeger, M.; Gissel-Nielsen, G.

1989-11-01

In areas with intensive farming, as in Denmark, it is of great interest to identify possible countermeasures to be taken in order to reduce the longterm effects of radioactive contamination of arable land. The most important longer-lived radionuclides from the Chernobyl were 137 Cs and 134 Cs. The aim of the present project was to identify crops with relatively low or high root uptake of these two isotopes. Although such differences may be small, a shift in varieties might be a cost-effective way to reduce collective doses. The experiment was carried out at Risoe National Laboratory in the summer of 1988. The species used were: spring barley (Hordeum vulgare L) varieties: Golf, Apex, Anker, Sila; Perennial rye grass (Lolium perenne L.) varieties: Darbo (early) and Patoro (late); Italian rye-grass (Lolium multiflorum) variety: Prego; and pea (Pisum arvense L.) variety: Bodil. Each crop was grown in two types of soil, a clay-loam and an organic soil. 137 Cs was added to the clay-loam. The organic soil, which was contaminated with 137 Cs from the Chernobyl accident, was supplied with 134 Cs. Sila barley and Italian rye-grass were identified among the species tested as plants with a relative high uptake of radio-caesium. (author)

Protective effect of UV-A radiation during acclimation of the photosynthetic apparatus to UV-B treatment

Czech Academy of Sciences Publication Activity Database

Štroch, Michal; Materová, Z.; Vrábl, D.; Karlický, Václav; Šigut, Ladislav; Nezval, J.; Špunda, Vladimír

2015-01-01

Roč. 96, nov (2015), s. 90-96 ISSN 0981-9428 R&D Projects: GA MŠk(CZ) LO1415; GA MŠk(CZ) LM2010007 Grant - others:EHP(CZ) EHP-CZ02-OV-1-014-2014 Program:CZ02 Institutional support: RVO:67179843 Keywords : barley (Hordeum vulgare L.) * chlorophyll fluorescence * photosynthesis * photosynthetic pigments * UV-A radiation * UV-B radiation Subject RIV: BO - Biophysics Impact factor: 2.928, year: 2015

The Effects of Designated Pollutants on Plants

Science.gov (United States)

1978-11-01

Persea americana Mill. Haas and Bacon Barley Hordeum vulgare L. CM 67 Bean Phaseolus vulgaris L. Pinto, U.I. III Briza Briza maxima L. Ornamental...Tagetes patula L. French dwarf double goldie Marigold Tagetes erecta L. American ,Senator Dirksen Petunia Petunia hybrida Vilm. White cascade Radish...Probit analysis of five plant species: citrus seedlings, lemon, orange,, grape, French marigold, American marigold. Probit scale is the probability that a

Variability of barley aleurone layer induced by X-rays

Directory of Open Access Journals (Sweden)

Romuald Kosina

2015-05-01

Full Text Available A series of Hordeum vulgare cultivars was irradiated by X-rays to induce mutations in endosperm. Many structural defects of endosperm were revealed in plants irradiated 8 DAF. Change of a cell cycle was especially frequent and this was visible in the form of clones of small or large cells in the aleurone layer. X-irradiation appeared as a successful tool in the study of development.

Green Fodder Production and Water Use Efficiency of Some Forage Crops under Hydroponic Conditions

OpenAIRE

Ghazi N. Al-Karaki; M. Al-Hashimi

2012-01-01

The objectives of this study were to evaluate five forage crops (alfalfa (Medicago sativa), barley (Hordeum vulgare), cowpea (Vigna unguiculata), sorghum (Sorghum bicolor), and wheat (Triticum aestivum)) for green fodder production and water use efficiency under hydroponic conditions. The experiment has been conducted under temperature-controlled conditions (24 ± 1°C) and natural window illumination at growth room of Soilless Culture Laboratory, Arabian Gulf University, Manama, Bahrain. The r...

Composition and antiproliferative effect of essential oil of Origanum vulgare against tumor cell lines.

Science.gov (United States)

Begnini, Karine Rech; Nedel, Fernanda; Lund, Rafael Guerra; Carvalho, Pedro Henrique de Azambuja; Rodrigues, Maria Regina Alves; Beira, Fátima Tereza Alves; Del-Pino, Francisco Augusto Burkert

2014-10-01

Cancer is a leading cause of death and is responsible for one in eight deaths worldwide. The use of herbs as complementary medicine for cancer, especially advanced cancer, has recently increased. The aim of this study was to evaluate in vitro, the antiproliferative effect of Origanum vulgare against human breast adenocarcinoma (MCF-7), and human colon adenocarcinoma (HT-29). The essential oil (EO) was extracted from a bought amount of O. vulgare dried leaves and analyzed in a gas chromatograph interfaced with a mass selective detector. The cytotoxicity test was performed by sulforhodamine B assay. The results show that the EO is composed mostly of 4-terpineol and induces a high cytotoxicity effect in HT-29. In the MCF-7 cell line the EO was less effective. In conclusion, this study showed that O. vulgare main component is 4-terpineol and was effective in inducing cancer cell growth inhibition.

Sensitivity of spoiling and pathogen food-related bacteria to Origanum vulgare L. (Lamiaceae) essential oil

OpenAIRE

Souza,Evandro Leite de; Stamford,Tânia Lúcia Montenegro; Lima,Edeltrudes de Oliveira

2006-01-01

Origanum vulgare L. (oregano), Lamiaceae, has been known as plant specie with prominent biological properties for a long time. This study aimed to evaluate the antibacterial activity of Origanum vulgare essential oil on various Gram-positive and Gram-negative spoiling and/or pathogen food-related bacteria, as well as to observe its antimicrobial effectiveness in a food conservation micromodel. The results showed a strong antibacterial activity of the assayed essential oil noted by large growt...

Genetic diversity in barley landraces (Hordeum vulgare L. subsp ...

Indian Academy of Sciences (India)

SDS-PAGE was performed to separate the extracted pro- teins by using 12% separating and 5% stacking gels with a. Mini Protean System from Bio-Rad according to Laemmli modified method (Laemmli 1970). In this study, we adopted constant current electrophoresis instead of constant voltage. The loading of sample was ...

Genetic Variability in Barley (Hordeum vulgare l.) Landraces from ...

African Journals Online (AJOL)

segregating progenies with maximum genetic variability for selection. .... cultivar Clipper applied in slots of the first two, the tenth, and the last ... solution (50 ml glacial acetic acid, 200 ml methanol and 250 ml distilled water) ...... Adelaide, South.

Lysine-Rich Proteins in High-Lysine Hordeum Vulgare Grain

DEFF Research Database (Denmark)

Ingversen, J.; Køie, B.

1973-01-01

The salt-soluble proteins in barley grain selected for high-lysine content (Hiproly, CI 7115 and the mutants 29 and 86) and of a control (Carlsberg II) with normal lysine content, contain identical major proteins as determined by MW and electrophoretic mobility. The concentration of a protein gro...

Genetic diversity in barley landraces (Hordeum vulgare L. subsp ...

Indian Academy of Sciences (India)

its nutritional value and low glycemic index (Ullrich 2011). Lebanon belongs to the ... Rim Mzid and Farhat Chibani contributed equally to this work. biochemical accomplished ..... environment interaction of hordein content. J. Cereal Sci. 34,.

Latent manganese deficiency increases transpiration in barley (Hordeum vulgare).

Science.gov (United States)

Hebbern, Christopher A; Laursen, Kristian Holst; Ladegaard, Anne H; Schmidt, Sidsel B; Pedas, Pai; Bruhn, Dan; Schjoerring, Jan K; Wulfsohn, Dvoralai; Husted, Søren

2009-03-01

To investigate if latent manganese (Mn) deficiency leads to increased transpiration, barley plants were grown for 10 weeks in hydroponics with daily additions of Mn in the low nM range. The Mn-starved plants did not exhibit visual leaf symptoms of Mn deficiency, but Chl a fluorescence measurements revealed that the quantum yield efficiency of PSII (F(v)/F(m)) was reduced from 0.83 in Mn-sufficient control plants to below 0.5 in Mn-starved plants. Leaf Mn concentrations declined from 30 to 7 microg Mn g(-1) dry weight in control and Mn-starved plants, respectively. Mn-starved plants had up to four-fold higher transpiration than control plants. Stomatal closure and opening upon light/dark transitions took place at the same rate in both Mn treatments, but the nocturnal leaf conductance for water vapour was still twice as high in Mn-starved plants compared with the control. The observed increase in transpiration was substantiated by (13)C-isotope discrimination analysis and gravimetric measurement of the water consumption, showing significantly lower water use efficiency in Mn-starved plants. The extractable wax content of leaves of Mn-starved plants was approximately 40% lower than that in control plants, and it is concluded that the increased leaf conductance and higher transpirational water loss are correlated with a reduction in the epicuticular wax layer under Mn deficiency.

Incorporation of tritiated thymidine and uridine in normal and endopolyploid nuclei of differentiated tissue

International Nuclear Information System (INIS)

Bansal, Y.K.; Sen, Sumitra

1987-01-01

Rate of replication and transcription between normal and giant endopolyploid nuclei of differentiated tissue of Hordeum vulgare L. (2n=14) roots and Phlox drummondii Hook. (2n=14) and Zea mays L. (2n=20) endosperms were studied by labelling experiments with tritiated thymidine and uridine. The incorporation of thymidine and uridine was identical in both diploid and giant endopolyploid nuclei of the roots of H. vulgare. The endosperm cells of P. drummondii and Z. mays, however, exhibit markedly different labelling pattern in normal (i.e. triploid) and endopolyploid nuclei where both replication and transcription were rather high. The nutritive function of the endosperm is probably responsible for this high degree of activity. (author). 14 refs., 10 figs., 3 tables

In vitro cytotoxicity of allelopathic plants Adonis vernalis L. Origanum vulgare ssp. vulgare L. and Nepeta nuda subsp. nuda

Science.gov (United States)

Koleva, Vanya; Dragoeva, Asya; Stoyanova, Zheni; Yordanova, Zhenia; Ali, Selime; Uzunov, Nikolay M.; Melendez-Alafort, Laura; Rosato, Antonio; Enchev, Dobromir D.

2018-03-01

Medicinal plants produce various secondary metabolites as a part of their chemical defence and survival in nature. These compounds have a wide range of biological activities. Nowadays, medicinal plants are used as source of allelochemicals and new effective anticancer agents. Our previous studies revealed allelopathic potential of water extracts of Adonis vernalis L. (Ranunculaceae), Origanum vulgare ssp. vulgare L. and Nepeta nuda subsp. nuda (Lamiaceae). Present study aimed to evaluate the effect of the same extracts in vitro on human hepatoma cell line SK-HEP-1. Cell proliferation/viability was assessed using Premixed WST-1 Cell Proliferation Reagent. Adonis water extract (1.83mg/ml) had notable negative influence on cancer cell line tested. Oregano (3.5 mg/ml) also exerted negative effect, but to a lesser degree. On the contrary, nepeta water extract (6.59 mg/ml) had an opposite effect, stimulating cell proliferation. One possible explanation could be the type of extraction: after treatment with nepeta methanol extract (6.59 mg/ml) cell viability was significantly reduced. In conclusion, Adonis vernalis and Nepeta nuda subsp. nuda possess metabolites with growth inhibitory effect on human hepatoma cell line SK-HEP-1. Further research is needed to clarify biological activity of lower concentrations which are appropriate to enable the design of new anticancer drugs.

Synthesis of Salt Soluble Proteins in Barley. Pulse-Labeling Study of Grain Filling in Liquid-Cultured Detached Spikes

DEFF Research Database (Denmark)

Giese, Nanna Henriette; Hejgaard, Jørn

1984-01-01

The accumulation of salt-soluble proteins in the endosperm of developing barley (Hordeum vulgare L.) grains was examined. Detached spikes of barley were cultured at different levels of nitrogen nutrition and pulse-labeled with [14C] sucrose at specific times after anthesis. Proteins were extracted...... to increased nitrogen nutrition. Two major components, β-amylase and protein Z in particular, had a synthesis profile almost identical to that of the endosperm storage protein, hordein....

Vulgarization of popular music tradition in Serbia

OpenAIRE

Božilović, Nikola

2011-01-01

The vulgarization of tradition in this paper implies the alteration, false representation, and adaptation of tradition in line with the interests of certain individuals or groups in power. The author observes popular music in Serbia (jazz, pop, rock) under a sociological magnifying glass, attempting to explain and motivate the thesis which proposes a valid historical foundation of popular culture and music in the social life of Serbia. In his opinion, this kind of tradition is being 'swept un...

The effect of abandoned mining ponds on trace elements dynamics in the soil-plant system

Science.gov (United States)

Gabarrón, María; Faz, Ángel; Zornoza, Raúl; Acosta, Jose A.

2017-04-01

In semiarid climate regions lack of vegetation and dryer climate contribute to erosion of abandoned mining surface areas making them up important potential sources of metal pollution into the environment. The objectives of this study were to determine the influence of mine ponds in agriculture and forest soils, and identify the dynamic of metals in the soil-plant system for native plant species (Ballota hirsuta) and crop species (Hordeum vulgare) in two ancient mining districts: La Unión and Mazarrón. To achieve these objectives, wastes samples from mine ponds and soil samples (rhizosphere and non-rhizosphere soils) from natural and agricultural lands were collected. In addition, six plants (Ballota hirsuta) from natural area and 3 plants (Hordeum vulgare) from crops were collected. Physicochemical properties and total, water soluble and bioavailable metals (Cd, Co, Cr, Cu, Fe, Mn, Ni, Pb, and Zn) and arsenic were measured in waste/soil samples. The chemical speciation of metals in soil was estimated by a sequential extraction procedure. For plants analyses, each plant were divided in roots, stem and leaves and metal content measured by ICP-MS. Results indicated that mine, natural and agricultural soils were contaminated by As, Cd, Cu, Pb, and Zn. Chemical partitioning revealed higher mobility of metals in mine ponds than natural and agriculture soils while only Fe and As are completely bound to the soil matrix due to the mineralogical compositions of soils. The accumulation of metals in Ballota hirsuta in La Union decrease as Fe>As>Cr>Ni>Cu>Zn>Cd>Mn>Co>Pb while in Mazarrón did as As>Fe>Cr>Pb>Cu>Ni>Co>Mn>Zn>Cd. Ballota hirsuta showed high ability to bio-accumulate Cu, Cr, Fe, Ni, and As, transferring a large amount to edible parts without exceeding the toxicity limits for animals. Results for barley plants (Hordeum vulgare) showed the ability to absorb and accumulate As, Fe, Mn, Pb and Zn, although the transfer ability of As, Cd and Pb was lower. Although the

Importance of diet in the growth, survivorship and reproduction of the no-tillage pest Armadillidium vulgare (Crustacea: Isopoda Importancia de la dieta en el crecimiento, la supervivencia y la reproducción de Armadillidium vulgare (Crustacea: Isopoda plaga en siembra directa

Directory of Open Access Journals (Sweden)

ARIEL J FABERI

2011-09-01

Full Text Available The studies of Armadillidium vulgare as pest are virtually null worldwide. However under no-tillage systems this species has found an adequate environment for its development and it has become an important pest in some crops in Argentina. It has been shown that the composition of vegetables affects the isopods biology. Our hypothesis was that soybean leaf litter has high nutritive value which allows A. vulgare to grow faster, survive longer, and have higher fecundity favoring the population increase and turning it into a crop pest. Growth and survivorship of juveniles and adults, egg incubation period, offspring number per female and offspring mean body weight were determined in individuals fed with leaf litter of soybean, sunflower, wheat and pasture. The growth rate coefficient, k, in juveniles was higher for soybean, intermediate for pasture and lower for sunflower. Adult growth was faster under the soybean diet. Survivorship under soybean and pasture was longer than under sunflower and wheat in both juveniles and adults. The reproductive parameters were similar in all diets, food did not generate any change in the reproductive aspects of A. vulgare. Results of the present study represent a source of information about the A. vulgare biology under different diets of agricultural origin to establish the basis for Integrated Management of this species as pest. Under soybean litter provision A. vulgare found the best conditions for faster growth, longer survival and relatively higher fecundity. In fields with soybean as preceding crop or in systems with high frequency of soybean in the crop rotation a more abundant population of A. vulgare would be found as well as with larger individuals which could cause more damage to the following crop in the rotation.Los estudios sobre Armadillidium vulgare como plaga son virtualmente nulos a nivel mundial. Sin embargo, en los sistemas bajo siembra directa esta especie ha encontrado un ambiente adecuado para

Strip Tillage and Early-Season Broadleaf Weed Control in Seeded Onion (Allium cepa)

OpenAIRE

Sarah Gegner-Kazmierczak; Harlene Hatterman-Valenti

2016-01-01

Field experiments were conducted in 2007 and 2008 near Oakes, North Dakota (ND), USA, to evaluate if strip tillage could be incorporated into a production system of seeded onion (Allium cepa) to eliminate the standard use of a barley (Hordeum vulgare) companion crop with conventional, full width tillage, yet support common early-season weed control programs. A split-factor design was used with tillage (conventional and strip tillage) as the main plot and herbicide treatments (bromoxynil, DCPA...

Comparing the performance of 11 crop simulation models in predicting yield response to nitrogen fertilization

OpenAIRE

Salo , Tapio J.; Palosuo , Taru; Kersebaum , Kurt Christian; Nendel , Claas; Angulo , Carlos; Ewert , Frank; Bindi , Marco; Calanca , Pierluigi; Klein , Tommy; Moriondo , Marco; Ferrise , Roberto; Olesen , Jørgen Eivind; Patil , Rasmi H.; Ruget , Francoise; Takac , Jozef

2016-01-01

Eleven widely used crop simulation models (APSIM, CERES, CROPSYST, COUP, DAISY, EPIC, FASSET, HERMES, MONICA, STICS and WOFOST) were tested using spring barley (Hordeum vulgare L.) data set under varying nitrogen (N) fertilizer rates from three experimental years in the boreal climate of Jokioinen, Finland. This is the largest standardized crop model inter-comparison under different levels of N supply to date. The models were calibrated using data from 2002 and 2008, of which 2008 included si...

Isozyme differences in barley mutants

International Nuclear Information System (INIS)

AI-Jibouri, A.A.M.; Dham, K.M.

1990-01-01

Full text: Thirty mutants (M 11 ) of barley (Hordeum vulgare L.) induced by physical and chemical mutagens were analysed for isozyme composition using polyacrylamide gel electrophoresis. Results show that these mutants were different in the isozymes leucine aminopeptidase, esterase and peroxidase. The differences included the number of forms of each enzyme, relative mobility value and their intensity on the gel. Glutamate oxaloacetate transaminase isozyme was found in six molecular forms and these forms were similar in all mutants. (author)

Interspecific competition changes photosynthetic and oxidative stress response of barley and barnyard grass to elevated CO2 and temperature

OpenAIRE

Irena Januskaitiene; Jūratė Žaltauskaitė; Austra Dikšaitytė; Gintarė Sujetovienė; Diana Miškelytė; Giedrė Kacienė; Sandra Sakalauskienė; Jurga Miliauskienė; Romualdas Juknys

2018-01-01

This work focuses on the investigation of competition interaction between C3 crop barley (Hordeum vulgare L.) and C4 weed barnyard grass (Echinochloa crus-galli L.) at 2 times higher than ambient [CO2] and +4 0C higher ambient temperature climate conditions. It was hypothesized that interspecific competition will change the response of the investigated plants to increased [CO2] and temperature. The obtained results showed that in the current climate conditions, a higher biomass and photosynth...

Willet M. Hays, great benefactor to plant breeding and the founder of our association.

Science.gov (United States)

Troyer, A F; Stoehr, H

2003-01-01

Willet M. Hays was a great benefactor to plant breeding and the founder of the American Genetic Association (AGA). We commemorate the AGA's centennial. We mined university archives, U.S. Department of Agriculture (USDA) yearbooks, plant breeding textbooks, scientific periodicals, and descendants for information. Willet Hays first recognized the individual plant as the unit of selection and started systematic pure-line selection and progeny tests in 1888. He developed useful plant breeding methods. He selected superior flax (Linum usitatissimum L.), wheat (Triticum vulgare L.), corn (Zea mays L.), barley (Hordeum vulgare L.), and oat (Avena sativa L.) varieties, and discovered Grimm alfalfa (Medicago sativa L.); all became commercially important. He initiated branch stations for better performance testing. Willet Hays befriended colleagues in other universities, in federal stations, in a London conference, and in Europe. He gathered and spread the scientific plant breeding gospel. He also improved rural roads and initiated animal breeding records and agricultural economics records. He started the AGA in 1903, serving as secretary for 10 years. He became assistant secretary of agriculture in 1904. He introduced the project system for agricultural research. He authored or coauthored the Nelson Amendment, the Smith-Lever Act, the Smith-Hughes Act, and the protocol leading to the United Nations Food and Agriculture Organization-all involved teaching agricultural practices that improved the world.

Effect of the aqueous extract of Foeniculum vulgare (fennel on the kidney in experimental PCOS female rats

Directory of Open Access Journals (Sweden)

Somayyeh Sadrefozalayi

2014-02-01

Full Text Available Objective: Foeniculum vulgare seed (F. vulgare is a herbal plant which is used with phytoestrogene compounds for polycystic ovary syndrome (PCOS treatment. In this research, renoprotective effect of the aqueous extract of Foeniculum vulgare (AEF in experimental PCOS female rats is studied. Materials and Methods: Forty female rats were randomly divided into five groups. The first group served as control,was injected with an equivalent volume (0.2 ml of normal saline, and received normal diet. Animals in the second group were non poly cystic ovary syndrome (PCOS rats which were treated with intragastric administration of aqueous extract of F. vulgare (150 mg/kg b.w.. In the third group, the rats were treated with intraperitoneal injection of estradiolvalerate (EV (4 mg in 0.2 ml of sesame oil. The fourth groups were treated with EV and AEF (150mg/kg bw with the same route.  The fifth groups were treated with EV and AEF (100mg/kg bw. After 4 weeks of study, all of the rats were sacrificed, their kidneys tissues were processed for light microscopy, and some biochemical parameters of serum were measured. Results: The mean values of blood urea nitrogen in PCOS rats treated with low dose of AEF and EV and non-treated, was significantly (p

Submergence sensitivity of durum wheat, bread wheat and barley at the germination stage

Directory of Open Access Journals (Sweden)

Iduna Arduini

2016-06-01

Full Text Available Soil waterlogging at initial growth stages can cause heavy yield losses of winter cereals. Therefore, the screening for submergence tolerance traits in seeds of commercial varieties is of high concern worldwide. Ten Italian varieties of durum wheat (Triticum durum Desf., bread wheat (T. aestivum L. and barley (Hordeum vulgare L. were investigated for their ability to germinate in submerged conditions and to recover after submergence periods of three to 15 days. Submergence prevented germination and decreased germinability, at rates that increased with duration of submergence. Sensitivity ranked in the order: barley >durum wheat >bread wheat. We related the higher sensitivity of barley to its slower germination and slightly higher leakage of electrolytes, whereas the percentage of abnormal seedlings was lower than in other species. It was less than 4%, compared to less than 15 and 8% in durum wheat and bread wheat, respectively. Wide varietal differences were found in all species. According to variety, after 6-day submergence, germinability ranged from 2 to 42% in barley, from 5 to 80% in durum wheat, and from 30 to 77% in bread wheat. Varieties with more than 40% seed survival were three, six and seven per species, in the same order. The differential submergence sensitivity of varieties indicates a potential to select for waterlogging tolerance within Italian genotypes of winter cereal crops.

Oreganum vulgare Linn. leaf: An Extensive Pharmacognostical and Phytochemical Quality Assessment

Directory of Open Access Journals (Sweden)

Veni Bharti

2013-08-01

Full Text Available Purpose: Standardization and detailed pharmacognostical studies of Oreganum vulgare Linn. leaf for authentication and commercial utilization. Methods: Oreganum vulgare Linn. leaf was with standardization according to standard procedures described in WHO, 2011 and I.P. 1996. Results: The physicochemical parameters total ash, acid insoluble ash, water soluble ash and sulphated ash were found to be 11.5%, 11%, 5, 10.5% w/w respectively. Foaming index was found be <100. The trace elements were found to be copper, lead, cadmium, zinc, cobalt, manganese, nickel and copper in ethanol extract and phytochemical screening of aqueous and ethanol extract showed the presence of carbohydrates, flavonoids, anthocyanins, phenolic compounds etc. Conclusion: The standardization parameters viz. physico-chemical parameters, macroscopy, microscopy, taxonomy, anatomy and preliminary phytochemical screening, microbial and aflatoxin count, HPTLC profile is being reported to help in authentication and development of monograph of this plant.

Bioaccessible mineral content of malted finger millet (Eleusine coracana), wheat (Triticum aestivum), and barley (Hordeum vulgare).

Science.gov (United States)

Platel, Kalpana; Eipeson, Sushma W; Srinivasan, Krishnapura

2010-07-14

Malted grains are extensively used in weaning and geriatric foods. Malting generally improves the nutrient content and digestibility of foods. The present investigation examined the influence of malting of finger millet, wheat, and barley on the bioaccessibility of iron, zinc, calcium, copper, and manganese. Malting increased the bioaccessibility of iron by >3-fold from the two varieties of finger millet and by >2-fold from wheat, whereas such a beneficial influence was not seen in barley. The bioaccessibility of zinc from wheat and barley increased to an extent of 234 and 100%, respectively, as a result of malting. However, malting reduced the bioaccessibility of zinc from finger millet. Malting marginally increased the bioaccessibility of calcium from white finger millet and wheat. Whereas malting did not exert any influence on bioaccessibility of copper from finger millet and wheat, it significantly decreased (75%) the same from barley. Malting did increase the bioaccessibility of manganese from brown finger millet (17%) and wheat (42%). Thus, malting could be an appropriate food-based strategy to derive iron and other minerals maximally from food grains.

Antioxidant activity of 100% and 80% methanol extracts from barley seeds (Hordeum vulgare L.): stabilization of sunflower oil

Energy Technology Data Exchange (ETDEWEB)

Anwar, F.; Abdul Qayyum, H. M.; Hussein, A. I.; Iqbal, S.

2010-07-01

The antioxidant potential of 100% and 80% methanol extracts from the seeds of three barley varieties (Jou 83, Jou 87 and Haider 93) was assessed. The extract yields from barley seeds ranged from 3.23% (Haider 93,100% methanol) to 5.31% (Jou 83, 80% methanol). The total phenolic contents, DPPH radical scavenging activity (IC50 values) and inhibition of linoleic acid oxidation of barley seed extracts (BSE) were determined to be 88.1-145.7 mg/100g, 90.8-168.6 {mu}g/mL and 62.6-74.6%, respectively. The antioxidant effectiveness of BSE was also assessed by stabilizing sunflower oil (SFO) with BSE at a concentration of 600 ppm (oil weight basis). The stabilized (treated with extract) and the control (without extract addition) SFO samples were subjected to accelerated (oven heating at 60 degree centigrade for 30 days, 8 h heating cycle/day) storage. These were analyzed at regular intervals for the extent of oxidative changes according to the measurements of their contents of peroxide value, para-anisidine value, conjugated dienes and conjugated trienes. Generally, the 80% methanol extract of barely seeds demonstrated better antioxidant action than the 100% methanol extract. The antioxidant activity of BSE was also found to be considerably varied among the varieties tested. The present results suggest that antioxidant extracts from barely seeds might be used to protect vegetable oils from oxidation. (Author) 32 refs.

Atividade in vitro do óleo essencial de Origanum vulgare frente à Sporothrix Schenckii In vitro activity of the essential oil of Origanum vulgare against Sporothrix schenckii

Directory of Open Access Journals (Sweden)

M.B. Cleff

2008-04-01

Full Text Available In vitro activity of the essential oil Origanum vulgare against Sporothrix schenckii was determined by the MIC (Minimum Inhibitory Concentration. For this, seven samples of S. schenckii were studied, two isolated from two cases of human sporotrichosis and five isolated from cats. Analysis of the essential oil was carried out in a gas chromatograph (GC/FID for the identification and quantification of thymol and carvacrol (antifungal agents. MIC was obtained based on the microdilution method according to the adapted document NCCLS-M 27A2 for fitopharmacy. All the isolates presented sensibility to the essential oil. S. schenckii was inhibited in a concentration of 0.25% (250m l/ml. Chromatographic analysis showed that thymol concentration was bigger than carvacrol. The antifungal activity demonstrated by the essential oil of O. vulgare against S. Schenckii stimulates the accomplishment of more studies, including in vivo studies.

Submergence tolerance in Hordeum marinum

DEFF Research Database (Denmark)

Pedersen, Ole; Malik, Al I.; Colmer, Timothy D.

2010-01-01

Floodwaters differ markedly in dissolved CO(2), yet the effects of CO(2) on submergence responses of terrestrial plants have rarely been examined. The influence of dissolved CO(2) on underwater photosynthesis and growth was evaluated for three accessions of the wetland plant Hordeum marinum Huds....... All three accessions tolerated complete submergence, but only when in CO(2) enriched floodwater. Plants submerged for 7 days in water at air equilibrium (18 mM CO(2)) suffered loss of biomass, whereas those with 200 mM CO(2) continued to grow. Higher underwater net photosynthesis at 200 mM CO(2......) increased by 2.7- to 3.2-fold sugar concentrations in roots of submerged plants, compared with at air equilibrium CO(2). Leaf gas films enhancing gas exchange with floodwater, lack of a shoot elongation response conserving tissue sugars and high tissue porosity (24-31% in roots) facilitating internal O(2...

The use of the oregano (Origanum vulgare L. essential oil and hydrosol in green olive fermentation

Directory of Open Access Journals (Sweden)

M. Musa Özcan

2008-06-01

Full Text Available The effect of oregano the (Origanum vulgare L. oil at the levels of 0.05, 0.1 and 0.3% and oregano hydrosol on the physicochemical, microbiological and sensory characteristics of the green olive (Edremit variety fermentation was investigated. The initial pH of the oregano oil added samples were higher than the other treatments, which were above 5.8. The highest final acidity was observed in the hydrosol+brine combination (0.53%. The initial LAB population on the first day of the fermentation was high in the diluted hydrosol (8.89 log cfu ml-1 and control (8.47 log cfu ml-1 samples. But a significant difference was not observed between the LAB counts of the treatments on the 40th day of fermentation. The control and brine+oregano hydrosol samples had the highest sensory scores.

Morphology and AFLP markers suggest three Hordeum chilense ecotypes that differ in avoidance to rust fungi

NARCIS (Netherlands)

Vaz Patto, M.C.; Aardse, A.; Buntjer, J.; Rubiales, D.; Martin, A.; Niks, R.E.

2001-01-01

In Hordeum chilense Roem. & Schult., a high variation in the level of avoidance to infection of barley leaf rust (Puccinia hordei Otth) occurs. Probably resulting from the properties of the stomata, the rust germ tube overgrows stomata, and the infection process fails in an early stage. In the

Isozyme differences in barley mutants

Energy Technology Data Exchange (ETDEWEB)

AI-Jibouri, A A.M.; Dham, K M [Department of Botany, Nuclear Research Centre, Baghdad (Iraq)

1990-01-01

Full text: Thirty mutants (M{sub 11}) of barley (Hordeum vulgare L.) induced by physical and chemical mutagens were analysed for isozyme composition using polyacrylamide gel electrophoresis. Results show that these mutants were different in the isozymes leucine aminopeptidase, esterase and peroxidase. The differences included the number of forms of each enzyme, relative mobility value and their intensity on the gel. Glutamate oxaloacetate transaminase isozyme was found in six molecular forms and these forms were similar in all mutants. (author)

Host genotype is an important determinant of the cereal phyllosphere mycobiome

DEFF Research Database (Denmark)

Sapkota, Rumakanta; Knorr, Kamilla; Jørgensen, Lise Nistrup

2015-01-01

The phyllosphere mycobiome in cereals is an important determinant of crop health. However, an understanding of the factors shaping this community is lacking. Fungal diversity in leaves from a range of cultivars of winter wheat (Triticum aestivum), winter and spring barley (Hordeum vulgare...... and location have minor effects. We found many host-specific fungal pathogens, but also a large diversity of fungi that were relatively insensitive to host genetic background, indicating that host-specific pathogens live in a 'sea' of nonspecific fungi....

DOES JASMONIC ACID PREVENT THE GERMINATION

OpenAIRE

ÇAVUŞOĞLU, Kürşat

2009-01-01

Abstract: Effect of jasmonic acid on seed germination and seedling growth of barley (Hordeum vulgare L. cv. Bülbül 89) was investigated in the present study. Jasmonic acid concentrations less than 1500 µM have not inhibited the seed germination, while 1500 and 2000 µM jasmonic acid levels caused atypical germination. The germination was completely inhibited at 3000 µM level of jasmonic acid. However, the seedling growth clearly slowed down with increasing concentrations of jasmonic acid. Furt...

Integrated transcriptomics and proteomics analysis of storage protein composition in developing barley grain to improve nutritional profile

DEFF Research Database (Denmark)

Kaczmarczyk, Agnieszka Ewa; Dionisio, Giuseppe; Renaut, Jenny

2012-01-01

The aim of the study was to understand the molecular and biochemical mechanisms underpinning the effect of nitrogen (N) on barley (Hordeum vulgare) storage protein production (hordeins) during grain filling. Using a combination of advanced biochemistry methods, we could comprehensively describe......-regimes caused significant differences in both quantity and quality of the storage proteins transcripts. Principal Component Analysis of the amino acid (AA) profiles also indicated dissimilarity in individual AA percentages, correlated to hordein content. The abundance values of proteins of interest confirmed...

Aplicación de modelos en los sistemas agrícolas de secano de la meseta central : Simulación de rotaciones y modelado de la arquitectura de la planta en leguminosas

OpenAIRE

Hernández Díaz-Ambrona, Carlos Gregorio

1999-01-01

Este trabajo profundiza en el estudio de los sistemas agrícolas de secano de la Meseta Central. Sobre la base de la alternativa tradicional ce^eal^arbecho, se han estudiado durante tres años de cultivo 1995/96, 1996/97 y 1997/98 seis rotaciones diferentes: monocultivo de cebada (Hordeum vulgare L.), cebada/barbecho, cebada/habas (Viciafaba L.), cebada/guisantes {Pisum sativum L.), cebada/habas/barbecho y cebada/guisantes/barbecho. Entre las rotaciones, se ha comparado la biomasa, el rendimien...

Resistance to Barley Leaf Stripe

DEFF Research Database (Denmark)

Nørgaard Knudsen, J. C.

1986-01-01

in well adapted Northwest European spring cultivars. Virulence matching two hitherto not overcome resistances was demonstrated. Differences in apparent race nonspecific or partial resistance were also present, changing the percentage of infected plants of susceptible genotypes from about 20 to 44 per cent.......Ten barley [Hordeum vulgare] genotypes were inoculated with twelve isolates of Pyrenophora graminea of diverse European and North African origin. Race specific resistance occurred. Four, possibly five, genetically different sources of race-specific resistance were found, three of them occurring...

Genome Sequence of Bacillus endophyticus and Analysis of Its Companion Mechanism in the Ketogulonigenium vulgare-Bacillus Strain Consortium.

Directory of Open Access Journals (Sweden)

Nan Jia

Full Text Available Bacillus strains have been widely used as the companion strain of Ketogulonigenium vulgare in the process of vitamin C fermentation. Different Bacillus strains generate different effects on the growth of K. vulgare and ultimately influence the productivity. First, we identified that Bacillus endophyticus Hbe603 was an appropriate strain to cooperate with K. vulgare and the product conversion rate exceeded 90% in industrial vitamin C fermentation. Here, we report the genome sequencing of the B. endophyticus Hbe603 industrial companion strain and speculate its possible advantage in the consortium. The circular chromosome of B. endophyticus Hbe603 has a size of 4.87 Mb with GC content of 36.64% and has the highest similarity with that of Bacillus megaterium among all the bacteria with complete genomes. By comparing the distribution of COGs with that of Bacillus thuringiensis, Bacillus cereus and B. megaterium, B. endophyticus has less genes related to cell envelope biogenesis and signal transduction mechanisms, and more genes related to carbohydrate transport and metabolism, energy production and conversion, as well as lipid transport and metabolism. Genome-based functional studies revealed the specific capability of B. endophyticus in sporulation, transcription regulation, environmental resistance, membrane transportation, extracellular proteins and nutrients synthesis, which would be beneficial for K. vulgare. In particular, B. endophyticus lacks the Rap-Phr signal cascade system and, in part, spore coat related proteins. In addition, it has specific pathways for vitamin B12 synthesis and sorbitol metabolism. The genome analysis of the industrial B. endophyticus will help us understand its cooperative mechanism in the K. vulgare-Bacillus strain consortium to improve the fermentation of vitamin C.

Sensitivity of spoiling and pathogen food-related bacteria to Origanum vulgare L. (Lamiaceae essential oil Sensibilidade de bactérias deteriorantes e patogênicas de interesse em alimentos ao óleo essencial de Origanum vulgare L. (Lamiaceae

Directory of Open Access Journals (Sweden)

Evandro Leite de Souza

2006-12-01

Full Text Available Origanum vulgare L. (oregano, Lamiaceae, has been known as plant specie with prominent biological properties for a long time. This study aimed to evaluate the antibacterial activity of Origanum vulgare essential oil on various Gram-positive and Gram-negative spoiling and/or pathogen food-related bacteria, as well as to observe its antimicrobial effectiveness in a food conservation micromodel. The results showed a strong antibacterial activity of the assayed essential oil noted by large growth inhibition zones (30-37 mm. MIC values were between 20-40 µL/mL for the most bacteria strains. Essential oil was able to cause significant (POriganum vulgare L. (orégano, Lamiaceae, tem sido reconhecida como uma espécie vegetal com destacáveis propriedades biológicas por um longo tempo. Este estudo objetivou avaliar a atividade antibacteriana do óleo essencial de Origanum vulgare L. sobre várias bactérias Gram positivas e Gram negativas deteriorantes e/ou patogênicas de interesse em alimentos, bem como observar sua efetividade antimicrobiana em um micromodelo de conservação de alimentos. Os resultados mostraram uma considerável atividade antibacteriana do óleo essencial ensaiado notada por grandes zonas de inibição do crescimento bacteriano (30-37 mm. Os valores de CIM encontrados oscilaram entre 20-40 µL/mL para a maioria das bactérias. A CIM do óleo essencial causou um significante (P<0.05 efeito inibitório sobre a viabilidade bacteriana, sendo caracterizado uma propriedade bacteriostática após 24 horas de exposição. Ainda, a CIM causou uma diminuição significante (P<0.05 da contagem da flora bacteriana autóctone em carne moída armazenada sob refrigeração. Estes dados suportam a possibilidade do uso do óleo essencial de Origanum vulgare L. como composto antimicrobiano alternativo em sistemas de conservação de alimentos.

Isolating Barley ( Hordeum vulgare L.) B1 Hordein Gene Promoter ...

African Journals Online (AJOL)

Promoters play the most important role in determining the temporal and spatial expression pattern and transcript level of a gene. Some strong constitutive promoters, such as cauliflower mosaic virus 35s promoter, are widely used in plant genetic engineering research. However, the expression levels of the foreign genes in ...

Isolating Barley (Hordeum vulgare L.) B1 Hordein Gene Promoter ...

African Journals Online (AJOL)

Yomi

2012-04-10

Apr 10, 2012 ... proline and glutamine (Piston et al., 2004). The four main groups of ... account for approximately 50% of the total protein in the. *Corresponding author. ..... inheritance, chromosomal location, and population dynamics. PNAS,.

Comparison of stability statistics for yield in barley (Hordeum vulgare ...

African Journals Online (AJOL)

STORAGESEVER

2010-03-15

Mar 15, 2010 ... statistics and yield indicated that only TOP method would be useful for simultaneously selecting for high yield and ... metric stability methods; i) they reduce the bias caused by outliers, ii) ...... Biometrics, 43: 45-53. Sabaghnia N ...

Action de I'AlA sur la teneur en azote total et protéinique des graines de céréales cultivées à different niveau de la capacité capillaire en eau

Directory of Open Access Journals (Sweden)

Wiesław Nowakowski

2015-06-01

Full Text Available L'action de I'AIA sur la teneur en azote total et en azote protéinique des graines du Triticum vulgare, d'Hordeum vulgare et d'Avena sativa cultivés a 30%, 60% et 90% de la capacité capillaire en eau du sable a tété étudiée au cours de trois ans (1969, 1970, 1971. La teneur en g-protéines totales liée au rendement des graines de céréales examinees a été plus élevée dans les conditions de sécheresse (30% de la capacite capillaire en eau à la suite d'un traitement auxinique. La teneur (% en azote total et proteinique ne semble pas etre tellement modifiee dans les graines de cereales à la suite d'un traitement auxinique.

Yield improvement in barley by using gamma-irradiation

International Nuclear Information System (INIS)

Benamer, Ibrahim Mohammed

1990-01-01

Breeding work for barley improvement in Libya is very rare. All varieties grown here are foreign varieties. Yield per hectare is low compared with other countries having similar climatic conditions. Productivity, lodging, disease resistance, drought and salt tolerance are the main characteristics that need to be improved. A mutation breeding programme for barley improvement was initiated at the Tajoura Nuclear Research Centre in 1983-1984. The objectives of this programme are the development of new lines that could be used directly or indirectly in the development of new varieties. The locally adapted barley (Hordeum vulgare L.) variety ''California Mariout'' was used as a parent material. Grains with 14% moisture were exposed to 200 Gy gamma-ray from 60 Co source at the Centre. Three experiments were conducted during 1986-1989. From the first experiment (1986-1987), 62 mutant lines were evaluated. From the second and third experiments (1987-1989), only seven mutant lines were evaluated. In the 1988-1989 experiment, the crop was irrigated and fertilised with 0, 100 and 200 kgN/ha. Lodging score was low in 0 kgN/ha and increased significantly by the increase in N level. None of the mutant lines more lodging resistant than the parent or the control. However, yield differences were significant and the application of 100 kgN/ha increased the grain yield

Chromosomal organization of repetitive DNAs in Hordeum bogdanii and H. brevisubulatum (Poaceae

Directory of Open Access Journals (Sweden)

Quanwen Dou

2016-10-01

Full Text Available Molecular karyotypes of H. bogdanii Wilensky, 1918 (2n = 14, and H. brevisubulatum Link, 1844 ssp. brevisubulatum (2n = 28, were characterized by physical mapping of several repetitive sequences. A total of 18 repeats, including all possible di- or trinucleotide SSR (simple sequence repeat motifs and satellite DNAs, such as pAs1, 5S rDNA, 45S rDNA, and pSc119.2, were used as probes for fluorescence in situ hybridization on root-tip metaphase chromosomes. Except for the SSR motifs AG, AT and GC, all the repeats we examined produced detectable hybridization signals on chromosomes of both species. A detailed molecular karyotype of the I genome of H. bogdanii is described for the first time, and each repetitive sequence is physically mapped. A high degree of chromosome variation, including aneuploidy and structural changes, was observed in H. brevisubulatum. Although the distribution of repeats in the chromosomes of H. brevisubulatum is different from that of H. bogdanii, similar patterns between the two species imply that the autopolyploid origin of H. brevisubulatum is from a Hordeum species with an I genome. A comparison of the I genome and the other Hordeum genomes, H, Xa and Xu, shows that colocalization of motifs AAC, ACT and CAT and colocalization of motifs AAG and AGG are characteristic of the I genome. In addition, we discuss the evolutionary significance of repeats in the genome during genome differentiation.

Some Root Traits of Barley (Hordeum vulgare L. as Affected by Mycorrhizal Symbiosis under Drought Stress

Directory of Open Access Journals (Sweden)

R. Bayani

2016-05-01

Full Text Available The effect of drought stress and mycorrhizal symbiosis on the colonization, root and leaf phosphorous content, root and leaf phosphatase activity, root volume and area as well as shoot dry weight of a variety of hulless barley were evaluated using a completely randomized experimental design (CRD with 3 replications. Treatments were three levels of drought stress of 30, 60 and 90% field capacity and two levels of mycorrhizal with and without inoculation. According to the results, the highest value of leaf phosphorous (1.54 mg/g was observed at mycorrhizal symbiosis against severe drought treatment. Root phosphatase activity was highest (297.9 OD min -1 FW-1 at severe drought stress with mycorrhizal symbiosis which in comparison with mild stress in the presence of mycorrhiza showed 16.6 fold increasing. The control and non-mycorrhizal symbiosis treatments had highest root dry weight (0.091 g. The lowest root volume (0.016 cm2 observed at mycorrhizal symbiosis × severe drought treatment. Generally, Inoculation of barley seed with mycorrhiza at severe water stress could transport more phosphorous to shoot, especially leaf via inducing of leaf and root phosphatase activity. Also, in addition to supply of nutrient sources especially phosphorous for plant, mycorrhizal symbiosis could play an important role in withstanding water stress in plant via increasing of root dry weight and area.

Foeniculum vulgare essential oils: chemical composition, antioxidant and antimicrobial activities.

Science.gov (United States)

Miguel, Maria Graça; Cruz, Cláudia; Faleiro, Leonor; Simões, Mariana T F; Figueiredo, Ana Cristina; Barroso, José G; Pedro, Luis G

2010-02-01

The essential oils from Foeniculum vulgare commercial aerial parts and fruits were isolated by hydrodistillation, with different distillation times (30 min, 1 h, 2 h and 3 h), and analyzed by GC and GC-MS. The antioxidant ability was estimated using four distinct methods. Antibacterial activity was determined by the agar diffusion method. Remarkable differences, and worrying from the quality and safety point of view, were detected in the essential oils. trans-Anethole (31-36%), alpha-pinene (14-20%) and limonene (11-13%) were the main components of the essentials oil isolated from F. vulgare dried aerial parts, whereas methyl chavicol (= estragole) (79-88%) was dominant in the fruit oils. With the DPPH method the plant oils showed better antioxidant activity than the fruits oils. With the TBARS method and at higher concentrations, fennel essential oils showed a pro-oxidant activity. None of the oils showed a hydroxyl radical scavenging capacity > 50%, but they showed an ability to inhibit 5-lipoxygenase. The essential oils showed a very low antimicrobial activity. In general, the essential oils isolated during 2 h were as effective, from the biological activity point of view, as those isolated during 3 h.

Roles of Hydroxynitrile Glucosides in Barley

DEFF Research Database (Denmark)

Roelsgaard, Pernille Sølvhøj

on barley (Hordeum vulgare). Barley accumulates five hydroxynitrile glucosides, including one cyanogenic glucoside, in the epidermal cell layer. Cyanogenic glucosides are classically known as hydrogen cyanide-releasing defense compounds which act against generalist insects and herbivores. However...... is proposed. The results obtained in this Ph.D. study provide a unique insight demonstrating that hydroxynitrile glucosides play a far more complex role in barley defense against and susceptibility to Bgh than previously described. Future studies can build on the platforms established in this study to provide...

Studies on /sup 32/P transport and yellow rust resistance in barley

Energy Technology Data Exchange (ETDEWEB)

Schubert, J. (Akademie der Landwirtschaftswissenschaften der DDR, Aschersleben. Inst. fuer Phytopathologie)

1982-01-01

Several cultivars of barley (Hordeum vulgare L.) differing in their resistance to yellow rust were used to study the influence of the infection with Puccinia striiformis West. (strain 24) on /sup 32/P transport in intact plants and isolated leaves. Close correlations exist between transport processes and resistance. For example, resistant plants seem to have a more intensive matter transport than susceptible ones. The importance of the rate of transport to the effectiveness of hypothetic inducers of resistance reactions and defence substances is discussed.

Inter-simple sequence repeat (ISSR) loci mapping in the genome of perennial ryegrass

DEFF Research Database (Denmark)

Pivorienė, O; Pašakinskienė, I; Brazauskas, G

2008-01-01

The aim of this study was to identify and characterize new ISSR markers and their loci in the genome of perennial ryegrass. A subsample of the VrnA F2 mapping family of perennial ryegrass comprising 92 individuals was used to develop a linkage map including inter-simple sequence repeat markers...... demonstrated a 70% similarity to the Hordeum vulgare germin gene GerA. Inter-SSR mapping will provide useful information for gene targeting, quantitative trait loci mapping and marker-assisted selection in perennial ryegrass....

In vitro activity of Origanum vulgare essential oil against Candida species

Directory of Open Access Journals (Sweden)

Marlete Brum Cleff

2010-03-01

Full Text Available The aim of this study was to evaluate the in vitro activity of the essential oil extracted from Origanum vulgare against sixteen Candida species isolates. Standard strains tested comprised C. albicans (ATCC strains 44858, 4053, 18804 and 3691, C. parapsilosis (ATCC 22019, C. krusei (ATCC 34135, C. lusitaniae (ATCC 34449 and C. dubliniensis (ATCC MY646. Six Candida albicans isolates from the vaginal mucous membrane of female dogs, one isolate from the cutaneous tegument of a dog and one isolate of a capuchin monkey were tested in parallel. A broth microdilution technique (CLSI was used, and the inoculum concentration was adjusted to 5 x 10(6 CFU mL-1. The essential oil was obtained by hydrodistillation in a Clevenger apparatus and analyzed by gas chromatography. Susceptibility was expressed as Minimal Inhibitory Concentration (MIC and Minimal Fungicidal Concentration (MFC. All isolates tested in vitro were sensitive to O. vulgare essential oil. The chromatographic analysis revealed that the main compounds present in the essential oil were 4-terpineol (47.95%, carvacrol (9.42%, thymol (8.42% and □-terpineol (7.57%. C. albicans isolates obtained from animal mucous membranes exhibited MIC and MFC values of 2.72 µL mL-1 and 5 µL mL-1, respectively. MIC and MFC values for C. albicans standard strains were 2.97 µL mL-1 and 3.54 µL mL-1, respectively. The MIC and MFC for non-albicans species were 2.10 µL mL-1 and 2.97 µL mL-1, respectively. The antifungal activity of O. vulgare essential oil against Candida spp. observed in vitro suggests its administration may represent an alternative treatment for candidiasis.

Feminizing Wolbachia: a transcriptomics approach with insights on the immune response genes in Armadillidium vulgare

Directory of Open Access Journals (Sweden)

Chevalier Frédéric

2012-01-01

Full Text Available Abstract Background Wolbachia are vertically transmitted bacteria known to be the most widespread endosymbiont in arthropods. They induce various alterations of the reproduction of their host, including feminization of genetic males in isopod crustaceans. In the pill bug Armadillidium vulgare, the presence of Wolbachia is also associated with detrimental effects on host fertility and lifespan. Deleterious effects have been demonstrated on hemocyte density, phenoloxidase activity, and natural hemolymph septicemia, suggesting that infected individuals could have defective immune capacities. Since nothing is known about the molecular mechanisms involved in Wolbachia-A. vulgare interactions and its secondary immunocompetence modulation, we developed a transcriptomics strategy and compared A. vulgare gene expression between Wolbachia-infected animals (i.e., “symbiotic” animals and uninfected ones (i.e., “asymbiotic” animals as well as between animals challenged or not challenged by a pathogenic bacteria. Results Since very little genetic data is available on A. vulgare, we produced several EST libraries and generated a total of 28 606 ESTs. Analyses of these ESTs revealed that immune processes were over-represented in most experimental conditions (responses to a symbiont and to a pathogen. Considering canonical crustacean immune pathways, these genes encode antimicrobial peptides or are involved in pathogen recognition, detoxification, and autophagy. By RT-qPCR, we demonstrated a general trend towards gene under-expression in symbiotic whole animals and ovaries whereas the same gene set tends to be over-expressed in symbiotic immune tissues. Conclusion This study allowed us to generate the first reference transcriptome ever obtained in the Isopoda group and to identify genes involved in the major known crustacean immune pathways encompassing cellular and humoral responses. Expression of immune-related genes revealed a modulation of host

Development of mutants of local barley bakur (T. Hordeum vulgare. c v Bakkur L.) with good quantitative and qualitative traits under rainfed condition

International Nuclear Information System (INIS)

Saif, A. A.; Al-Shamiri, A. A.

2012-12-01

Seeds of local barley bakur were exposed to 150 Gy of gamma rays from cobalt 60 source irradiated seeds were planted in rows as M1.From M1 magnetized population plants , the main spike of each plants were collected, threshed and planted head to row method in 2008 winter season as M2. Evaluation of mutants was done for the increase in long spike and level of resistance to loading in compare with mother variety (untreated) resulted in selecting fifty mutated plants. These plants were planted as plant/ row method along with the mother variety and evaluated for grain yield and level of resistance for lodging which consequent y resulted in selecting of twenty four mutant lines which were varied in plant height long spike and yield. These lines were planted in the research farm during 2009 and the research farm during 2009 and 2011 winter season as M4 and M5 for two consecutive season resulted in selecting eight mutant lines which were distinguished of others in respect of level of resistance and increase of yield. These mutant lines were planted in plots in Kawkban and Bani-Mater locations during 2010 and 2011 seasons along with mother variety and improved variety Kawkban-1 which dominated in the region. Data were collected from the trail analyzed them separate y over each location. Results showed that the mutant line Al-e rra-B-008-15 was the best in grain yield and early maturity followed by Al-erra-B-008-20 and Al-erra-B-008-20. In the meantime these mutant line showed resistance to loading compare with other including the mother variety. There fore it can be recommended to register these mutants as a new varieties for Kawkaban Bain-Mater regions as well as for similar areas in the central and northern regions. This research summarizing results obtained from the trail conducted in both research farm and in farmer fields at Kawkaban and Bani-Mater locations. (Author)

Environmental influence on the effect of gamma irradiation on proximate chemical composition of barley (Hordeum vulgare L.)

International Nuclear Information System (INIS)

Hassan, S.; Farhatullah; Khan, S.; Iqbal, M.

1989-01-01

Effects of 10, 20 and 30 krad gamma rays on Ash, Moisture, Crude protein, Crude fat, Crude fibre and Nitrogen free extract contents of barely variety, C-63 sown on 5th and 20th November and 5th December were observed. Sowing dates had significant effects for all characters except moisture percentage and carbohydrates. Ash, moisture and carbohydrates percentages had increased due to early sowing, while crude protein, fat and fibre percentages had decreased due to late sowing. Radiation effects were highly significant for all characters except moisture percentage. The severity of stimulatory or inhibitory effect, in general, was dependent upon the intensity of radiation doses and time of sowing for all characters studied. Maximum stimulatory effects were due to 30 krad which were 6.23, 32.78, 4.92 and 29.07% for Ash, Protein, fat and fibre, respectively than their respective controls. The retarding effects of 14.57 and 8.20% for moisture and carbohydrate were also found due to 30 krad, as compared with their respective controls

CHARACTERIZATION AND SELECTION OF CEREALS FOR PREPARATION AND UTILIZATION OF FERMENTED FIBER-BETAGLUCAN PRODUCT

Directory of Open Access Journals (Sweden)

Lenka Duchoňová

2013-02-01

Full Text Available Whole grains flours of diverse colored wheat species (Triticum sp. and various varieties of barley (Hordeum vulgare and oat (Avena sativa were analysed for their nutritional composition. The highest protein values were observed in wheat yellow variety BONA DEA (14% and also in blue variety UC 66049 (13%. Lower content of starch was determined in barley and oat varieties in compared to wheat varieties. The lowest levels of betaglucans were observed in wheat (0.3 – 0.6% and the highest content was assessed in barley and oat (2.5 – 3.8%. Variation in dietary fiber was considerable in barley and oat varieties. Barley varieties possessed significantly the highest content of total dietary fiber among all monitored cereals (≈17%, while oat grains showed significantly the lowest values (≤7%. Knowledge of the composition of healthy substances was used to select the best variety for the development of fermented product which was developed using specially prepared oat flour and potentially probiotic lactic acid bacteria Lactobacillus plantarum. The series of fermentation experiments resulted in a final gelatinous product with vital bacterial cell count about 1010 CFU.g-1, significantly reduced level of starch (1.7% and following nutritional characteristics: dry matter of 12.91%, water activity of 0.977, pH value 4.6 and lactic acid content of 2.95 g/l. Final product was added into the dough in different quantities and served also as a starter culture. Rheological properties of dough were evaluated for the purpose of finding a suitable recipe.

Tanacetum vulgare as a bioindicator of trace-metal contamination: a study of a naturally colonized open-pit lignite mine.

Science.gov (United States)

Jasion, Mateusz; Samecka-Cymerman, Aleksandra; Kolon, Krzysztof; Kempers, Alexander J

2013-10-01

We investigated the possibility of use of Tanacetum vulgare (tansy) as an ecological indicator of metal concentration in a naturally colonized open-pit lignite mine in Bełchatów (Poland). Tanacetum vulgare is the only species growing abundantly and spontaneously in the lignite mine waste dumps. Metal concentrations in roots, stems, leaves, flowers, and soil were measured in dump sites differing in type and time of reclamation and therefore differing in pollution levels. Tanacetum vulgare appeared to be an accumulator of chromium and iron in roots, whereas highest concentrations of manganese and zinc were found in leaves. A high bioaccumulation factor for cadmium (Cd) was observed in dumps and control sites, indicating that even small amounts of Cd in the environment may result in significant uptake by the plant. The lowest concentrations of metals were found in plants from sites situated on dumps reclaimed with argillaceous limestone.

Comparative Evaluation of Antifungal Activity of Piper Betel Leaf Oil, Origanum vulgare Essential Oil and Fluconazole Suspension on Candida albicans − An In Vitro Study

Directory of Open Access Journals (Sweden)

Nisha Makkar

2017-01-01

Full Text Available Introduction: Oropharyngeal candidiasis is an opportunistic mucosal infection caused by Candida albicans. It usually responds to topical treatments such as clotrimazole troches, topical fluconazole, chlorhexidine mouthwash and nystatin suspension. Piper betel leaf oil and Origanum vulgare essential oil have shown some topical antifungal activity. Aim: To determine and compare the antifungal efficacy of piper betel leaf oil, O. vulgare essential oil and fluconazole suspension against C. albicans. Materials and Methods: The zone of inhibition was measured by the cup–plate diffusion method using 100 μl volume of piper betel leaf oil, O. vulgare essential oil and fluconazole suspension, which were pipetted into the wells of the inoculated Sabouraud’s dextrose agar plates. The zone of inhibition was measured in millimetres using Vernier calliper. Minimum inhibitory concentration (MIC was determined by the broth macro-dilution test by pouring 1 ml of the respective concentrations of the test material to the individual test tubes along with 10 μl of the diluted test organism inoculum. Finally, MIC was calculated using a reflective viewer. Results: The zone of inhibition for O. vulgare essential oil (>40 mm was more than fluconazole suspension (>35 mm. MIC of O. vulgare essential oil, piper betel leaf oil and fluconazole suspension was 1.6%, 0.4% and 0.8%, respectively. Conclusion: O. vulgare essential oil was found to be a more effective antifungal agent than piper betel leaf oil and fluconazole suspension.

Morphological differentiation of non-glandular and glandular trichomes on Marrubium vulgare L.

Directory of Open Access Journals (Sweden)

Marta Dmitruk

2014-04-01

Full Text Available Marrubium vulgare L., commonly known as a white horehound or common horehound, belongs to the plant family Lamiaceae. It is a perennial aromatic herb which grows naturally in Europe, Asia, and America. Since ancient Egypt, this species has been known as a remedy for upper respiratory tract ailments. Nowadays, horehound is used in herbal medicine for treatment of liver diseases, biliary tract disorders, and for increasing the appetite and supporting the function of the stomach. The main biologically active substances in M. vulgare organs are: marrubiin, tannins, essential oils, and ursolic acid. The paper presents micromorphological analyses of non-glandular and glandular trichomes of M. vulgare. The research material was sampled from the plant collection in the Botanical Garden of the Maria Curie-Sklodowska University in Lublin (51°14′ N, 22°34′ E. The above-ground parts of horehound were collected during the flowering period in July 2013. Using light microscopy (LM and scanning electron microscopy (SEM, the types and sizes of trichomes from the stem, leaf, calyx, and corolla were investigated. The results of the microscopic observations show that the surfaces of M. vulgare vegetative and reproductive organs are densely clothed with glandular and non-glandular trichomes. The glandular trichomes are of two main types: peltate and capitate. Peltate trichomes consist of a short stalk cell and a large head with secretory cells arranged in a circle. The height of a mature trichome is about 31.33 μm and the diameter of the head is 31.47 μm. The substance produced by secretory cells passes through the apical walls and accumulates within a space between the cuticle and the cell wall layer. Capitate long trichomes with a basal cell, long stalk, neck cell, and a unicellular head are 36.65 μm long and the diameter of the head is about 15.6 μm. There are two types of short capitate trichomes: with a bicellular head and a unicellular stalk and with

The chemical defoliation of Ligitstrum vulgare L. and Spiraea x arguta Zab. shrubs in nursery

Directory of Open Access Journals (Sweden)

Szczepan Marczyński

2015-06-01

Full Text Available To defoliate Ligustrum vulgare and Spiraea x arguta – ethephon, KJ, Mg(ClO32•6H2O, CuSO4•5H2O and (NH42SO4 in various concentrations were used alone or in mixtures. Treating plants with potassium iodide gave the best results. KJ concentrations of 0.05-0,1% and 0.1-0.% were sufficient to defoliate Spiraea and Ligusturm respectively. Magnesium chlorate at concentration of 0.24 and 2% CuSO4 were also effective, the latter however, proved slight harmful to the plants. Spraying with defoliants on Sept. 26 gave better results than treating plants on Sept. 16. Chemical defoliation decreased negligibly the frost resistance of Ligusturm vulgare shrubs.

AKTIVITAS ANTIBAKTERI EKSTRAK BUAH ADAS (Foeniculum vulgare, Mill PADA Vibrio harveyi DAN Vibrio alginolyticus Antibacterial Activity of Fennel (Foeniculum vulgare Mill Extract on Vibrio alginolyticus and Vibrio harveyi

Directory of Open Access Journals (Sweden)

Budianto Budianto

2015-10-01

Pada penelitian ini menggunakan ekstrak air dari buah adas untuk mengetahui aktivitas antibakteri terhadap Vibrio harveyi dan Vibrio alginolyticus dengan menggunakan metode uji Minimum Inhibitory Concentration (MIC dan difusi cakram kertas. Hasil yang diperoleh pada uji MIC, konsentrasi terkecil untuk menghambat pertumbuhan adalah 0,060 g/ml, untuk kedua spesies bakteri. Variasi perlakuan pada uji cakram kertas yaitu konsentrasi A (0,065 g/ml, B (0,070 g/ml, C (0,075 g/ml, D (0,080 g/ml, E (0,085 g/ml, F (0,090 g/ml dan kontrol (0,000 g/ml, hasil yang diperoleh adalah konsentrasi 0,090 g/ml memiliki diameter zona hambat tertinggi sebesar 11,17 ± 0,5 mm (V. harveyi dan 12,53 ± 1,14 mm (V. alginolyticus, sehingga dapat disimpulkan bahwa buah adas (F. vulgare Mill memiliki peranan ekologi yang sangat penting sebagai bahan pengobatan alternatif dalam pengendalian penyebaran penyakit Vibriosis yang disebabkan oleh V. harveyi dan V. alginolyticus. Kata kunci: Foeniculum vulgare Mill, Vibrio harveyi, Vibrio alginolyticus, uji MIC dan difusi cakram kertas

The 'Big bang' in the Early Iron Age

Directory of Open Access Journals (Sweden)

Medović Aleksandar

2010-01-01

Full Text Available The Early Iron Age granaries of Tell Gradina upon Bosut exploded in a fire inferno in the 8th century B.C. The result of this catastrophe is 2-5 cm thick layer with mixed carbonized seeds and fruits. Recently, eight samples were taken from Gradina's profile for archaeobotanical analysis. The goal was to obtain basic information on land use and on major crops and weeds of that period. The most abundant were cereals, followed by millets, pulses and oil/fibre plants. The dominant cereals were einkorn (Triticum monococcum and hulled barley (Hordeum vulgare vulgare. Broomcorn millet (Panicum miliaceum was also very important. Pulses were represented with six and oil/fibre plants with three species. Among weeds and ruderals, most common are rye brome (Bromus secalinus, fat hen (Chenopodium album, darnel ryegrass (Lolium temulentum, hairy crabgrass (Digitaria sanguinalis and corncockle (Agrostemma githago.

Assessment of a relaxed eddy accumulation for measurements of fluxes of biogenic volatile organic compounds: Study over arable crops and a mature beech forest

DEFF Research Database (Denmark)

Gallagher, M.W.; Clayborough, R.; Beswick, K.M.

2000-01-01

A relaxed eddy accumulation (REA) system, based on the design by Beverland et al. (Journal of Geophysics Research 101 (D17) 22, 807-22, 815), for the measurement of biogenic VOC species was evaluated by intercomparison with an eddy correlation CO2 flux system over a mature deciduous beech canopy...... (Fagus Sylvatica) during the FOREXNOX program. Measurements from a site where winter wheat and barley (Hordeum Vulgare ann Triticum Aestivum) were being harvested are also presented. The system was inter-compared with two different eddy correlation systems for measuring CO2 fluxes. Good results were...

UCE: A uracil excision (USER^TM)-based toolbox for transformation of cereals

DEFF Research Database (Denmark)

Hebelstrup, Kim H; Christiansen, Michael W; Carciofi, Massimiliano

2010-01-01

Background Cloning of gene casettes and other DNA sequences into the conventional vectors for biolistic or Agrobacterium-mediated transformation is hampered by a limited amount of unique restriction sites and by the difficulties often encountered when ligating small single strand DNA overhangs...... (USER cereal), ready for use in cloning of complex constructs into the T-DNA. A series of the vectors were tested and shown to perform successfully in Agrobacterium-mediated transformation of barley (Hordeum vulgare L.) as well as in biolistic transformation of endosperm cells conferring transient...

Effect of sterilization on mineralization of straw and black carbon

OpenAIRE

Bobul'ská, Lenka; Bruun, Sander; Fazekašová, Danica

2013-01-01

The study was aimed at investigating the role of microorganisms in the degradation of BC (black carbon). CO evolution was measured under sterilized and non-sterilized soil using BC and straw amendments. Black carbon and straw were produced from homogenously C labelled roots of barley (Hordeum vulgare) with a specific activity 2.9 MBq g C. Production of BC was implemented at 300 °C for 24 h in a muffle oven, incubated in soil and C in the evolved CO was measured after 0.5, 1, 2, 4, 8, 16, 26 a...

High-level expression of the native barley alpha-amylase/subtilisin inhibitor in Pichia pastoris

DEFF Research Database (Denmark)

Micheelsen, Pernille Ollendorff; Ostergaard, Peter Rahbek; Lange, Lene

2008-01-01

An expression system for high-level expression of the native Hordeum vulgare alpha-amylase/subtilisin inhibitor (BASI) has been developed in Pichia pastoris, using the methanol inducible alcohol oxidase 1 (AOX1) promoter. To optimize expression, two codon-optimized coding regions have been designed...... and expressed alongside the wild-type coding region. To ensure secretion of the native mature protein, a truncated version of the alpha mating factor secretion signal from Saccharomyces cerevisiae was used. In order to be able to compare expression levels from different clones, single insertion transformants...

Starch bioengineering in Brachypodium distachyon

DEFF Research Database (Denmark)

Tanackovic, Vanja; Svensson, Jan Tommy; Buleon, A

2011-01-01

Brachypodium distachyon was recently introduced as a model plant for temperate cereals (Opanowicz et al., 2008). We aim to establish Brachypodium as a model for cereal starch metabolism. Grain starch from two lines: Bd21 and Bd21-3 are being characterized. Microscopic, chemical and structural data...... including amylopectin chain length distribution, phosphate content and amylose content provided further evidence for the close relationship to temperate cereals even though starch content and starch granule size were considerably lower than that for barley (Hordeum vulgare). Bioinformatics analyses...... in temperate cereals....

GeneCAT--novel webtools that combine BLAST and co-expression analyses

DEFF Research Database (Denmark)

Mutwil, Marek; Obro, Jens; Willats, William G T

2008-01-01

The gene co-expression analysis toolbox (GeneCAT) introduces several novel microarray data analyzing tools. First, the multigene co-expression analysis, combined with co-expressed gene networks, provides a more powerful data mining technique than standard, single-gene co-expression analysis. Second...... orthologs in the plant model organisms Arabidopsis thaliana and Hordeum vulgare (Barley). GeneCAT is equipped with expression data for the model plant A. thaliana, and first to introduce co-expression mining tools for the monocot Barley. GeneCAT is available at http://genecat.mpg.de....

Identification and characterization of barley RNA-directed RNA polymerases

DEFF Research Database (Denmark)

Madsen, Christian Toft; Stephens, Jennifer; Hornyik, Csaba

2009-01-01

in dicot species. In this report, we identi!ed and characterized HvRDR1, HvRDR2 and HvRDR6 genes in the monocot plant barley (Hordeum vulgare). We analysed their expression under various biotic and abiotic stresses including fungal and viral infections, salicylic acid treatment as well as during plant...... development. The different classes and subclasses of barley RDRs displayed contrasting expression patterns during pathogen challenge and development suggesting their involvement in speci!c regulatory pathways. Their response to heat and salicylic acid treatment suggests a conserved pattern of expression...

Estimating legume N-2 fixation in grass-clover mixtures of a grazed organic cropping system using two N-15 methods

DEFF Research Database (Denmark)

Vinther, F.P.; Jensen, E.S.

2000-01-01

The input of Nitrogen (N) through symbiotic N-2 fixation (SNF) in grass-clover mixtures was determined in an organic cropping. system for grazing during 3 years. The mixture of perennial ryegrass (Lolium perenne L.) and white clover (Trifolium repens L.) was established by undersowing in spring...... barley (Hordeum vulgare L.) and maintained subsequently for two production years. Dinitrogen fixation was determined using the N-15 isotope dilution techniques and two labelling procedures. Using either pre-labelling of the soil with immobilisation of the N-15 by addition of a carbon source before...

Phytochemical screening, anticancer and antioxidant activities of Origanum vulgare L. ssp. viride (Boiss.) Hayek, a plant of traditional usage.

Science.gov (United States)

Koldaş, Serkan; Demirtas, Ibrahim; Ozen, Tevfik; Demirci, Mehmet Ali; Behçet, Lütfi

2015-03-15

A detailed phytochemical analysis of Origanum vulgare L. ssp. viride (Boiss.) Hayek was carried out and the antioxidant activities of five different crude extracts were determined. The antiproliferative activities of the extracts were determined using the xCELLigence system (Real Time Cell Analyzer). Differences between the essential oil and volatile organic compound profiles of the plant were shown. The main component of the essential oil was caryophyllene oxide, while the main volatile organic compounds were sabinene and eucalyptol as determined by HS-GC/MS. Phenolic contents of the extracts were determined qualitatively and quantitatively by HPLC/TOF-MS. Ten phenolic compounds were found in the extracts from O. vulgare and Origanum acutidens: rosmarinic acid (in highest abundance), chicoric acid, caffeic acid, p-coumaric acid, gallic acid, quercetin, apigenin-7-glucoside, kaempferol, naringenin and 4-hydroxybenzaldehyde. This study provides first results on the antiproliferative and antioxidant properties and detailed phytochemical screening of O. vulgare ssp. viride (Boiss.) Hayek. © 2014 Society of Chemical Industry.

Carbon nanofibers suppress fungal inhibition of seed germination of maize (Zea mays) and barley (Hordeum vulgare L.) crop

International Nuclear Information System (INIS)

Joshi, Anjali; Sharma, Arti; Nayyar, Harsh; Verma, Gaurav; Dharamvir, Keya

2015-01-01

Carbon nanofibers (CNFs) are one of allotropes of carbon, consists of graphene layers arrangement in the form of stacked cones or like a cup diameter in nanometer and several millimeters in length. Their extraordinary mechanical, chemical and electronic properties are due to their small size. CNFs have been successfully applied in field of medicine in variety of diagnostic methods. They proven to be an excellent system for drug delivery, tissue regeneration, biosensor etc. This research focuses the applications of CNFs in all fields of Agriculture. In the we treated some fungal disease seed of maize and barley using functionalised CNFs. We find that the tested seeds grow just as well as the healthy seeds whereas the untreated fungal disease seeds, by themselves show very poor germination and seedling growth. This simple experiment shows the extraordinary ability of Carbon nanofibers in carrying effectively inside the germinated seeds

Carbon nanofibers suppress fungal inhibition of seed germination of maize (Zea mays) and barley (Hordeum vulgare L.) crop

Science.gov (United States)

Joshi, Anjali; Sharma, Arti; Nayyar, Harsh; Verma, Gaurav; Dharamvir, Keya

2015-08-01

Carbon nanofibers (CNFs) are one of allotropes of carbon, consists of graphene layers arrangement in the form of stacked cones or like a cup diameter in nanometer and several millimeters in length. Their extraordinary mechanical, chemical and electronic properties are due to their small size. CNFs have been successfully applied in field of medicine in variety of diagnostic methods. They proven to be an excellent system for drug delivery, tissue regeneration, biosensor etc. This research focuses the applications of CNFs in all fields of Agriculture. In the we treated some fungal disease seed of maize and barley using functionalised CNFs. We find that the tested seeds grow just as well as the healthy seeds whereas the untreated fungal disease seeds, by themselves show very poor germination and seedling growth. This simple experiment shows the extraordinary ability of Carbon nanofibers in carrying effectively inside the germinated seeds.

Carbon nanofibers suppress fungal inhibition of seed germination of maize (Zea mays) and barley (Hordeum vulgare L.) crop

Energy Technology Data Exchange (ETDEWEB)

Joshi, Anjali, E-mail: joshianjali1982@gmail.com; Sharma, Arti [Centre For Nanoscience and Nanotechnology, Panjab University, Chandigarh (India); Nayyar, Harsh [Department of Botany, Panjab University, Chandigarh (India); Verma, Gaurav [Dr. SS Bhatnagar University Institute of Chemical Engineering and Technology, Panjab University, Chandigarh (India); Dharamvir, Keya [Department of Physics, Panjab University, Chandigarh (India)

2015-08-28

Carbon nanofibers (CNFs) are one of allotropes of carbon, consists of graphene layers arrangement in the form of stacked cones or like a cup diameter in nanometer and several millimeters in length. Their extraordinary mechanical, chemical and electronic properties are due to their small size. CNFs have been successfully applied in field of medicine in variety of diagnostic methods. They proven to be an excellent system for drug delivery, tissue regeneration, biosensor etc. This research focuses the applications of CNFs in all fields of Agriculture. In the we treated some fungal disease seed of maize and barley using functionalised CNFs. We find that the tested seeds grow just as well as the healthy seeds whereas the untreated fungal disease seeds, by themselves show very poor germination and seedling growth. This simple experiment shows the extraordinary ability of Carbon nanofibers in carrying effectively inside the germinated seeds.

Honey Antibacterial Effect Boosting Using Origanum vulgare L. Essential Oil

OpenAIRE

Imtara, Hamada; Elamine, Youssef; Lyoussi, Badiâa

2018-01-01

The appearance of new bacterial strains which cause pathogenic diseases and which are resistant to the most used antibiotics requires probing new antibacterial agents sources. Therefore, the main aim of the present work was to follow the antibacterial activity of honey samples from Palestine and Morocco, after the combination with Origanum vulgare L. essential oil, and figure out whether the honey physicochemical parameters and geographic origin influence the final activity. The results of th...

In vitro antimicrobial activity and chemical composition of the essential oil of Foeniculum vulgare Mill.

Science.gov (United States)

Aprotosoaie, Ana Clara; Hăncianu, Monica; Poiată, Antonia; Tuchiluş, Cristina; Spac, A; Cioană, Oana; Gille, Elvira; Stănescu, Ursula

2008-01-01

In our study, four samples of volatile oil from Foeniculum vulgare, cultivated in different pedoclimatic conditions, were investigated for their antimicrobial activity and chemical composition. Organisms. Staphylococcus aureus ATCC 25923, Bacillus cereus, Pseudomonas aeruginosa, Escherichia coli ATCC 25922, Candida albicans were included in the report. Antimicrobial susceptibility tests. The comparative inhibitory activity of volatile oil samples with other antimicrobial agents was quantitative determined by minimum inhibitory concentration (MIC). Oil samples are the volatile oils extracted by steam distillation, from two ecological vegetative populations of Foeniculum vulgare. Gas chromatography coupled to mass spectrometry (GC-MS) was used to determine the chemical composition of the essential oils. All oil samples have a good activity against E. coli and S. aureus at low concentrations. Against B. cereus and P. aeruginosa these oil samples are less active. The oil samples were generally bactericidal at a concentration up to twofold or fourfold higher than the MIC value. Significantly synergic activity with amoxicillin or tetracycline showed all fennel samples against E. coli, Sarcina lutea and B. subtilis strains. Fennel oil samples have shown high activity against Candida albicans. No significant antimicrobial activity variations were observed for Foeniculum vulgare volatile oil samples obtained after two or three years cultivation period. The most important identified compounds in all samples of fennel volatile oils were trans-anethole, estragole, fenchone, limonene, alpha-pinene and gamma-terpinene.

The 'Green Revolution' dwarfing genes play a role in disease resistance in Triticum aestivum and Hordeum vulgare.

Science.gov (United States)

Saville, R J; Gosman, N; Burt, C J; Makepeace, J; Steed, A; Corbitt, M; Chandler, E; Brown, J K M; Boulton, M I; Nicholson, P

2012-02-01

The Green Revolution dwarfing genes, Rht-B1b and Rht-D1b, encode mutant forms of DELLA proteins and are present in most modern wheat varieties. DELLA proteins have been implicated in the response to biotic stress in the model plant, Arabidopsis thaliana. Using defined wheat Rht near-isogenic lines and barley Sln1 gain of function (GoF) and loss of function (LoF) lines, the role of DELLA in response to biotic stress was investigated in pathosystems representing contrasting trophic styles (biotrophic, hemibiotrophic, and necrotrophic). GoF mutant alleles in wheat and barley confer a resistance trade-off with increased susceptibility to biotrophic pathogens and increased resistance to necrotrophic pathogens whilst the converse was conferred by a LoF mutant allele. The polyploid nature of the wheat genome buffered the effect of single Rht GoF mutations relative to barley (diploid), particularly in respect of increased susceptibility to biotrophic pathogens. A role for DELLA in controlling cell death responses is proposed. Similar to Arabidopsis, a resistance trade-off to pathogens with contrasting pathogenic lifestyles has been identified in monocotyledonous cereal species. Appreciation of the pleiotropic role of DELLA in biotic stress responses in cereals has implications for plant breeding.

Biorestauration of soil polluted by waste motor oil by biostimulation with vermicompost and phytoremediation with Sorghum vulgare inoculated by Bacillus cereus and Rhizobium etli

Directory of Open Access Journals (Sweden)

Juárez-Cisneros Gladys

2014-11-01

Full Text Available Soil pollution by waste motor oil (WMO caused soil´s lost fertility. The aims of this research where a bioremediation of soil polluted by 10000 ppm of WMO for biostimulation with vermicompost (VC at 3 and 6 % (w/w follow by b phytoremediation (PR of the same soil to eliminate remaining WMO with Sorghum vulgare inoculated with Bacillus cereus and/or Rhizobium etli or Promoting Growth Plant Bacteria (PGPB. At the first step of assay WMO concentration was measured before and after bioremediation. At the second step the same soil phytoremediation was applied for remaining WHO sowing S. vulgare inoculated with PGPB, then at flowering stage its biomass and WHO final concentration was determined. Results showed that soil impacted by WMO biostimulated with VC at 3% was eliminated 8630 ppm of WMO. At the second phase in the same soil PR applied for remaining WMO which was reduced until 210 ppm. Soil polluted by remaining WMO applied PR using S. vulgare plus R. etli WMO was decreased at 260 ppm. While S. vulgare´s biomass inoculated with PGPB was higher compared to S. vulgare grown in soil not polluted by WMO according by ANOVA - Tukey (p > 0.05. These results suggested that soil polluted by WMO could be recovering by applying integrated BR and PR better than just using one type.

'Galega Vulgar' - yield indices and quality of elementary olive oil

International Nuclear Information System (INIS)

Almeida, F.; Vitorino, M.C.; Henriques, L.R.; Peres, M.F.

1998-01-01

This paper shows the evolution of two olive yield indexes (humidity and fat) and three olive oil quality parameters (acidity, peroxid value and UV absorbances) for cv. Galega vulgar from the olive grove Quinta Senhora de Mercules, Castelo Branco, during the 1995/96 harvest. It shows also the evolution of fatty acid composition of the same olive oil [pt

Useful mutations in Iraqi black barley

International Nuclear Information System (INIS)

Ibrahim, I.F.

1989-01-01

Full text: Barley (Hordeum vulgare L.) is an important fodder crop in Iraq, with a cultivated area of about 1 392 375 ha and a total production of about 838500 t. The 2-row black barley ''LBB'' is the most desirable one in semi-arid zone in northern part of Iraq, because of its drought tolerance and high protein content. However, this cultivar is susceptible to powdery mildew, and lodges. Gamma rays and EMS were used to induce mutations in ''LBB'' and its hybrid with A rivat''. Nine mutants with improved lodging were selected during the first six generations. Five mutants INRC-BB-1, INRC-BB-3, INRC-BBR-4A, INRC-HB-552 and INRC-HB-553 were resistant to powdery mildew while 2 mutants INRC-BBH-1 and INRC-HBR-3 were moderately resistant. Two mutants INRC-BB-123 and INRC-HBR-3 were also resistant to drought under 350-400 mm rainfall. Three mutants INRC-BB-1, INRC-HBR-3 and INRC-HBR-88 exceeded their original variety in seed weight per spike and TKW. (author)

Exploitation of allelopathy for weed control in annual and perennial cropping systems.

Science.gov (United States)

Putnam, A R; Defrank, J; Barnes, J P

1983-08-01

A variety of crops, cultivars, and accessions have been evaluated over the past six years for superior capability to suppress weed growth. The most successful of these approaches has been to grow cover crops of rye (Secale cereale), wheat (Triticum aestivum), sorghum (Sorghum bicolor), or barley (Hordeum vulgare) to a height of 40-50 cm, desiccate the crops by contact herbicides or freezing, and allow their residues to remain on the soil surface. Often, up to 95% control of important agroecosystem weed species was obtained for a 30- to 60-day period following desiccation of the cover crop. The plant residues on the soil surface exhibit numerous physical and chemical attributes that contribute to weed suppression. Physical aspects include shading and reduced soil temperatures which were similarly achieved using poplar (Populus) excelsior as a control mulch. Chemical aspects apparently include direct release of toxins, as well as production of phytotoxic microbial products. Numerous chemicals appear to work in concert or in an additive or synergistic manner to reduce weed germination and growth.

The in-vitro evaluation of antibacterial, antifungal and cytotoxic properties of Marrubium vulgare L. essential oil grown in Tunisia

Directory of Open Access Journals (Sweden)

Mejdoub Hafedh

2011-09-01

Full Text Available Abstract Background In order to validate its antiseptic and anticancer properties with respect to traditional uses, we have screened for the first time the antimicrobial activity of aerial parts of M. vulgare L. essential oil against different pathogenic microorganisms and the cytotoxic activity against HeLa cell lines. Methods The agar disk diffusion method was used to study the antibacterial activity of M. vulgare essential oil against 12 bacterial and 4 fungi strains. The disc diameters of zone of inhibition (DD, the minimum inhibitory concentrations (MIC and the concentration inhibiting 50% (IC50 were investigated to characterize the antimicrobial activities of this essential oil. The in vitro cytotoxicity of M. vulgare essential oil was examined using a modified MTT assay; the viability and the IC50 were used to evaluate this test. Results The antimicrobial activity of the essential oil was investigated in order to evaluate its efficacy against the different tested microorganisms. The present results results showed a significant activity against microorganisms especially Gram (+ bacteria with inhibition zones and minimal inhibitory concentration values in the range of 6.6-25.2 mm and 1120-2600 μg/ml, respectively, whereas Gram (- bacteria exhibited a higher resistance. As far as the antifungal activity, among four strains tested, Botrytis cinerea exhibited the strongest activity with inhibition zones of 12.6 mm. However, Fusarium solani, Penicillium digitatum and Aspergillus niger were less sensitive to M. vulgare essential oil. About the citotoxicity assay, this finding indicate the capability of this essential oil to inhibited the proliferation of HeLa cell lines under some conditions with IC50 value of 0.258 μg/ml. Conclusion This investigation showed that the M. vulgare essential oil has a potent antimicrobial activity against some Gram (+ pathogenic bacteria and Botrytis cinerea fungi. The present studies confirm the use of this

Foeniculum vulgare essential oil ameliorates acetic acid-induced colitis in rats through the inhibition of NF-kB pathway.

Science.gov (United States)

Rezayat, Seyed Mahdi; Dehpour, Ahmad-Reza; Motamed, Saeed Mohammadi; Yazdanparast, Maryam; Chamanara, Mohsen; Sahebgharani, Mousa; Rashidian, Amir

2017-10-24

The aim of the present study is to investigate the protective effects of Foeniculum vulgare essential oil on intestinal inflammation through the inhibition of NF-kB pathway in acetic acid-induced rat colitis. Acute colitis was induced by intra-rectal administration of 2 mL of diluted acetic acid (4%) solution. Two hours after the induction of colitis, 0.2% tween 80 in normal saline, dexamethasone (2 mg/kg) and F. vulgare essential oil (100, 200, 400 mg/kg) were administered to the animals by oral gavage and continued for 5 consecutive days. Assessment of macroscopic and microscopic lesions was done. MPO activity was evaluated by biochemical method. Furthermore, TNF-α activity was detected by immunohistochemistry (IHC) and the expression level of p-NF-kB p65 protein was measured by western blot analysis. Dexamethasone and F. vulgare essential oil (200, 400 mg/kg) reduced the macroscopic and microscopic lesions compared to the acetic acid group (p kB p65 protein (p kB pathway.

The effect of pre-nutrition of hydroalcoholic extractof Origanum vulgare on brain edema and neurologic deficits in a rat stroke model

Directory of Open Access Journals (Sweden)

Meysam Foroozandeh

2015-10-01

Full Text Available Background and Aim: Stroke is one of the most important factors of mortality and disability in the world. Free radicals are produced following ischemic stroke and they play a central role in breaking the blood-brain barrier and  causing brain edema formation. The aim of the current study was to evaluate the effect of hydro- alcoholic extract of Origanum vulgare on brain edema and neurologic deficit in a rat stroke model. Materials and Methods: In thisexperimental study, 35 male Wistar rats were randomly divided into 5 equal groups.  The first  two groups (control and Sham received distilled water, while three treatment groups received oral Origanum vulgare extract for 30days (50,75and 100 mg/kgdaily, respectively.  Two hours after the last dose of Origanum vulgare extract,each main group underwent  a 60 min middle cerebral artery occlusion.  Then, the assessment of blood brain edema, and neurologic deficits analysis were done . Brain edema (brain water content was analyzed by One-Way ANOVA using LSD method and neurologic deficits analysis by means of Mann-Whitney U, and P<0.05 was taken as the significant level. Results: Origanum vulgare extract reduced brain edema in the experimental groups of 50 (82.49±0.47, 75 (80.89±0.63 and 100 mg/kg/day (80.80±0.66 compared to the control group (84.46±0.67. The neurologic deficit scores in the experimental groups of 75and 100mg/kg/day, compared with control group, but neurologic deficit scores did not affect the group receiving the dose 50 mg/kg. Conclusion:  The obtained data indicate that Origanum vulgar extract via reduction of brain edema and neurologic deficits scorescan have a protective effect on the stroke model.

QTL mapping provides evidence for lack of association of the avoidance of leaf rust in Hordeum chilense with stomata density

NARCIS (Netherlands)

Vaz Patto, M.C.; Rubiales, D.; Martin, A.; Hernandez, P.; Lindhout, W.H.; Niks, R.E.; Stam, P.

2003-01-01

In cereals, rust fungi are among the most harmful pathogens. Breeders usually rely on short-lived hypersensitivity resistance. As an alternative, "avoidance" may be a more durable defence mechanism to protect plants to rust fungi. In Hordeum chilense avoidance is based on extensive wax covering of

Barley (Hordeum vulgare L.) cysteine proteases: heterologous expression, purification and characterization

DEFF Research Database (Denmark)

Rosenkilde, Anne Lind; Dionisio, Giuseppe; Holm, Preben Bach

2011-01-01

During germination of barley seeds, mobilization of protein is essential and cysteine proteases accounts for more than 90 % of the total proteolytic activity in the degradation of barley seed storage proteins. Cysteine proteases exist as pro-enzyme and is activated through reduction of the active...... site cysteines and by removal of the pro-domain. The complement of cysteine proteases is comprehensive and for detailed studies of the individual components of this complement, a fast and efficient eukaryotic expression platform is highly desirable. A cDNA clone of the barley key cysteine endoprotease...

Latent manganese deficiency increases transpiration in barley (Hordeum vulgare)

DEFF Research Database (Denmark)

Hebbern, Christopher Alan; Laursen, Kristian Holst; Ladegaard, Anne Hald

2009-01-01

To investigate if latent manganese (Mn) deficiency leads to increased transpiration, barley plants were grown for 10 weeks in hydroponics with daily additions of Mn in the low nM range. The Mn-starved plants did not exhibit visual leaf symptoms of Mn deficiency, but Chl a fluorescence measurements...

Frequency of Aneuploids in Progenies of Autotriploid Barley, Hordeum Vulgare L

DEFF Research Database (Denmark)

Sandfær, J.

1979-01-01

Chromosome counts of 863 progeny plants originating from 68 autotriploid barley plants revealed a considerable variation in chromosome numbers ranging from the diploid number (2n= 14) to 2n= 39. The most frequent groups were plants with 15 and 16 chromosomes each constituting about 27% of all pro...

Characterization of Gene Candidates for Vacuolar Sodium Transport from Hordeum Vulgare

KAUST Repository

Scheu, Arne Hagen August

2017-01-01

Various potential causes are discussed, including inaccuracies in the genome resource used as reference for primer design and issues inherent to the model system. Finally, I make suggestions on how to proceed to further characterize the candidate genes and hopefully identify novel sodium transporters from barley.

Phosphorus acquisition by barley (Hordeum vulgare L. at suboptimal soil temperature

Directory of Open Access Journals (Sweden)

Kari Ylivainio

2012-12-01

Full Text Available We studied the effects of soil temperature (8 ºC and 15 ºC on barley growth, barley phosphorus (P uptake and soil P solubility. Barley was grown in a pot experiment in two soils with different P fertilization histories for 22 years. The availability of P was estimated by using 33P-labeled fertilizer and calculating L-values. After cultivation for 22 years at ambient soil temperature without P fertilization (-P, soil L-value had decreased compared to soil that received annual P fertilization (P+. Low soil temperature further reduced the L-values, more in the -P soil than in the +P soil. Our results demonstrated that P fertilization can only partially ameliorate poor growth at low soil temperatures. Thus, applying ample fertilization to compensate for poor growth at low soil temperatures would increase the P content and solubility in the soil, but plant uptake would remain inhibited by cold.

Growth and yield of barley (Hordeum vulgare L.) as affected by ...

African Journals Online (AJOL)

Bheema

(2003) reported that about 65% of grain yield variability in barley was attributed to ... of those of the respective non-stressed environments (Cantero-Martínez et ... production stability of barley (Fekadu and Skjelvåg, 2002) and nitrogen and phosphorus are .... of SAS version 9.1 for analysis of variance of non-orthogonal data.

In silico characterization of boron transporter (BOR1 protein sequences in Poaceae species

Directory of Open Access Journals (Sweden)

Ertuğrul Filiz

2013-01-01

Full Text Available Boron (B is essential for the plant growth and development, and its primary function is connected with formation of the cell wall. Moreover, boron toxicity is a shared problem in semiarid and arid regions. In this study, boron transporter protein (BOR1 sequences from some Poaceae species (Hordeum vulgare subsp. vulgare, Zea mays, Brachypodium distachyon, Oryza sativa subsp. japonica, Oryza sativa subsp. indica, Sorghum bicolor, Triticum aestivum were evaluated by bioinformatics tools. Physicochemical analyses revealed that most of BOR1 proteins were basic character and had generally aliphatic amino acids. Analysis of the domains showed that transmembrane domains were identified constantly and three motifs were detected with 50 amino acids length. Also, the motif SPNPWEPGSYDHWTVAKDMFNVPPAYIFGAFIPATMVAGLYYFDHSVASQ was found most frequently with 25 repeats. The phylogenetic tree showed divergence into two main clusters. B. distachyon species were clustered separately. Finally, this study contributes to the new BOR1 protein characterization in grasses and create scientific base for in silico analysis in future.

Sensibilidade de bactérias deteriorantes e patogênicas de interesse em alimentos ao óleo essencial de Origanum vulgare L. (Lamiaceae)

OpenAIRE

Souza, Evandro Leite de; Stamford, Tânia Lúcia Montenegro; Lima, Edeltrudes de Oliveira

2006-01-01

Origanum vulgare L. (oregano), Lamiaceae, has been known as plant specie with prominent biological properties for a long time. This study aimed to evaluate the antibacterial activity of Origanum vulgare essential oil on various Gram-positive and Gram-negative spoiling and/or pathogen food-related bacteria, as well as to observe its antimicrobial effectiveness in a food conservation micromodel. The results showed a strong antibacterial activity of the assayed essential oil noted by large growt...

Chemical composition and bioactivity of different oregano (Origanum vulgare) extracts and essential oil.

Science.gov (United States)

Teixeira, Bárbara; Marques, António; Ramos, Cristina; Serrano, Carmo; Matos, Olívia; Neng, Nuno R; Nogueira, José M F; Saraiva, Jorge Alexandre; Nunes, Maria Leonor

2013-08-30

There is a growing interest in industry to replace synthetic chemicals by natural products with bioactive properties. Aromatic plants are excellent sources of bioactive compounds that can be extracted using several processes. As far as oregano is concerned, studies are lacking addressing the effect of extraction processes in bioactivity of extracts. This study aimed to characterise the in vitro antioxidant and antibacterial properties of oregano (Origanum vulgare) essential oil and extracts (in hot and cold water, and ethanol), and the chemical composition of its essential oil. The major components of oregano essential oil were carvacrol, β-fenchyl alcohol, thymol, and γ-terpinene. Hot water extract had the strongest antioxidant properties and the highest phenolic content. All extracts were ineffective in inhibiting the growth of the seven tested bacteria. In contrast, the essential oil inhibited the growth of all bacteria, causing greater reductions on both Listeria strains (L. monocytogenes and L. innocua). O. vulgare extracts and essential oil from Portuguese origin are strong candidates to replace synthetic chemicals used by the industry. © 2013 Society of Chemical Industry.

Evaluation of recurrent radiation with Cobalt 60 gamma rays on agronomic traits of barley (Hordeum Vulgare L.) in the R2M1 generation

International Nuclear Information System (INIS)

Vega G, M.G.

1994-01-01

The objective of this work was to evaluate the effect of recurrent radiation on agronomic traits in two barley varieties. The research was carried out at experimental fields pertaining to the Instituto de Investigacion Agropecuaria, Acuicola y Forestal of the Estado de Mexico (ICAMEX). The biological material was irradiated in the Gamma Cell 220 at the Instituto Nacional de Investigaciones Nucleares (ININ). The experimental design was divided plots in the randomized blocks, with four replications. The factor varieties (Cerro Prieto and Puebla) was assigned to the big plots mean while in the factor doses was assignated to the small plots (0, 10, 20, 30, 40 and 50 krad of gamma rays). The variables under study were: germination, number of shoots, plant height, incidence of Puccinia striiformis, days to flowering, days to physiological maturity, spike length and yield. The analysis of variance exhibited no significant differences between varieties for all the studied variables. Regarding to dose, most of the studied variables exhibited significant differences, except for incidence of Puccinia striiformis and days to flowering. The interaction variety x doses showed significance only for the variable days to flowering and days to physiological maturity. The mean separation by Tukey test at 0.05 and the regression analysis showed that the variables: germination, number of shoots, plant height, spike length and yield decreased as the dose increased. On the other hand in the variables incidence of Puccinia striiformis, days to flowering and days to physiological maturity exhibited a direct relationship with the dose. (Author)

Mercury in mercury(II)-spiked soils is highly susceptible to plant bioaccumulation.

Science.gov (United States)

Hlodák, Michal; Urík, Martin; Matúš, Peter; Kořenková, Lucia

2016-01-01

Heavy metal phytotoxicity assessments usually use soluble metal compounds in spiked soils to evaluate metal bioaccumulation, growth inhibition and adverse effects on physiological parameters. However, exampling mercury phytotoxicity for barley (Hordeum vulgare) this paper highlights unsuitability of this experimental approach. Mercury(II) in spiked soils is extremely bioavailable, and there experimentally determined bioaccumulation is significantly higher compared to reported mercury bioaccumulation efficiency from soils collected from mercury-polluted areas. Our results indicate this is not affected by soil sorption capacity, thus soil ageing and formation of more stable mercuric complexes with soil fractions is necessary for reasonable metal phytotoxicity assessments.

Does heavy traffic have long term implications for crop yields?

DEFF Research Database (Denmark)

Nielsen, J. Aa.; Munkholm, Lars Juhl; Schjønning, Per

Danish soils are subject to increasingly heavier traffic. Today, wheel loads of 6-12 tons are common on e.g. slurry tankers, combines and sugar beet harvesters. Field trials were started in Denmark in spring 2010 to answer the question: "does heavy traffic have long term implications for crop...... by the contractors delivering the machinery for the experimentation. Each year, spring barley (Hordeum vulgare L.) was established after the compaction treatments. s.ince 2013, investigations on biological tillage (root growth by pioneering crops) have been added to the trials. Significant yield losses up to 12.5 dt...

Effect of lixiviated sediments affected with treated water on Selenastrum capricornutum, Printz and Origanum vulgare L.

Science.gov (United States)

Ramos, Guadalupe E; Lopez, Martin H; Flores, Antonio M; Figueroa, Guadalupe T; De Leon, Fernando G

2010-01-01

Xochimilco is an area of Mexico City fulfilling important ecological functions. However, the water of the canal network in the lacustrine zone of Xochimilco is supplied by the water treatment plants of the city, implying a risk of accumulated contaminants in the sediments. This study reports the effect of lixiviates obtained from sediments collected in the canals of Xochimilco on the growth of the alga Selenastrum capricornutum and the angiosperm Origanum vulgare. Three factors were tested: (a) water source in terms of the effluent from the two water treatment plants (urban waste-water, located at Cerro de la Estrella (CE) and urban-rural waters at San Luis Tlaxialtemalco (SLT); (b) sampling season (January, dry season; May and September, rainy season; and (c) distances from the water discharge point in the Xochimilco's main canal (5200 and 1000 m for CE, and 0, 200 m for SLT). The chemical water properties analyzed were: pH, electrical conductivity, N-NO(3), N-NH(3), N(Total), P-PO(4) and P(Total). The alga was more sensitive to the contaminants than O. vulgare, showing growth inhibition of 93-100%. The effect of sampling season on the inhibition of algal growth was ordered as follows: September > May > January. Lixiviates obtained from sediment samples 200 and 1000 m from the main point of water discharge caused a higher algal growth inhibition than the samples obtained at the source point. Lixiviate promoted the growth of seedlings of O. vulgare.

Using elevated CO2 to increase the biomass of a Sorghum vulgare x Sorghum vulgare var. sudanense hybrid and Trifolium pratense L. and to trigger hyperaccumulation of cesium

International Nuclear Information System (INIS)

Wu Huibin; Tang Shirong; Zhang Ximei; Guo Junkang; Song, Zhengguo; Tian Shuai; Smith, Donald L.

2009-01-01

The most important challenge to use phytoremediation is how to improve its efficiency by increasing the accumulation of metals in plants, or by improving key plant biological traits that should enhance metal uptake. In this paper, we used open-top chambers to investigate the effects of elevated CO 2 (860 μL L -1 ) on biomass and Cs uptake by a Sorghum vulgare x Sorghum vulgare var. sudanense hybrid and Trifolium pratense L. growing on soils spiked with various levels of cesium (0, 300, 1500 and 3000 mg Cs kg -1 ). The results showed that elevated CO 2 not only increased aboveground biomass of the Sorghum and Trifolium species by 32-111%, and by 8-11%, respectively, compared to the ambient CO 2 treatment, but also caused more accumulation of Cs by Sorghum species (up to 73%) than Trifolium species (up to 43%). It was speculated that the increase in biomass and the improvement in Cs accumulation ability at elevated CO 2 could be related to lowered soil pH values, and changes in number and kind of microorganisms in the rhizospheres of the two tested species. This is the first report of a link among elevated CO 2 , increased biomass and hyperaccumulation of Cs by Sorghum and Trifolium species.

Species-Level Phylogeny and Polyploid Relationships in Hordeum (Poaceae) Inferred by Next-Generation Sequencing and In Silico Cloning of Multiple Nuclear Loci.

Science.gov (United States)

Brassac, Jonathan; Blattner, Frank R

2015-09-01

Polyploidization is an important speciation mechanism in the barley genus Hordeum. To analyze evolutionary changes after allopolyploidization, knowledge of parental relationships is essential. One chloroplast and 12 nuclear single-copy loci were amplified by polymerase chain reaction (PCR) in all Hordeum plus six out-group species. Amplicons from each of 96 individuals were pooled, sheared, labeled with individual-specific barcodes and sequenced in a single run on a 454 platform. Reference sequences were obtained by cloning and Sanger sequencing of all loci for nine supplementary individuals. The 454 reads were assembled into contigs representing the 13 loci and, for polyploids, also homoeologues. Phylogenetic analyses were conducted for all loci separately and for a concatenated data matrix of all loci. For diploid taxa, a Bayesian concordance analysis and a coalescent-based dated species tree was inferred from all gene trees. Chloroplast matK was used to determine the maternal parent in allopolyploid taxa. The relative performance of different multilocus analyses in the presence of incomplete lineage sorting and hybridization was also assessed. The resulting multilocus phylogeny reveals for the first time species phylogeny and progenitor-derivative relationships of all di- and polyploid Hordeum taxa within a single analysis. Our study proves that it is possible to obtain a multilocus species-level phylogeny for di- and polyploid taxa by combining PCR with next-generation sequencing, without cloning and without creating a heavy load of sequence data. © The Author(s) 2015. Published by Oxford University Press, on behalf of the Society of Systematic Biologists.

Formulaciones con combinación de ingredientes activos para el control de Armadillidium vulgare (Crustacea: Isopoda, plaga en el cultivo de colza

Directory of Open Access Journals (Sweden)

LÓPEZ, A.N.

2012-04-01

Full Text Available ResumenLa colza (Brassica napus, B. campestris en siembra directa (SD representa una alternativa en los sistemas de rotación actuales. Armadillidium vulgare es una de las plagas principales de los cultivos en SD. El objetivo de este trabajo fue evaluar cebos de acción combinada como estrategia alternativa de control de dicha especie.Se realizaron ensayos de laboratorio y de campo con los siguientes tratamientos: testigo sin tratamiento químico; testigo químico (4 kg/ha de Carbaryl 8%, MataBiBos Acay; 3, 4 y 5 kg/ha de cebo de acción combinada (Carbaryl 8% + Metaldehído 4%, Dual Acay. Se evaluó el número de individuos de A. vulgare muertos, de plantas dañadas y de plantas sanas. En el laboratorio, a los 2, 3, 7 y 9 días después de la aplicación de los cebos, los tratamientos químicos se diferenciaron del testigo y no mostraron diferencias significativas entre ellos. Los tratamientos con aplicaciones de cebos presentaron un número de plantas sanas y totales mayorcon respecto al testigo. En el campo, se detectaron diferencias en el número de individuos muertos entre los tratamientos químicos y el testigo. No se observaron diferencias en la proporción de individuos muertos ni de plantas dañadas entre los tratamiento químicos, sí respecto al testigo. La presencia del molusquicida en el cebo de acción combinada no interfirió en el control de A. vulgare. Se concluye que el cebo de acción combinada representa una alternativa de control de A. vulgare eficaz, que permite la protección del cultivo de colza. AbstractOilseed rape (Brassica napus, B. campestris under No-Tillage (NT represents an alternative in the current crop rotation systems. Armadillidium vulgare is a principal pest in crops under NT. The aim of this study was to evaluate combined action baits as alternative strategy in the control of that species. Laboratory and fields traits were carried out with five treatments: control treatment without chemicals, positive

Composición química y efecto antibacteriano in vitro de extractos de larrea tridentata, origanum vulgare, artemisa ludoviciana y ruta graveolens

Directory of Open Access Journals (Sweden)

Lucía Delgadillo Ruíz

2017-01-01

Full Text Available Introducción . Los extractos de algunas plantas han demostrado tener propiedades antimicr o bianas relacionadas a ciertos compuestos químicos como son el timol, carvacrol, limoneno, linalol y terpineno. El objetivo del presente trabajo fue determinar la concentración de estos compue s tos en los extractos de Larrea tridentata , Origanum vulgare , Artemisa ludoviciana y Ruta graveolens ; así como evaluar su efecto antimicrobiano en Escherichia coli , Acinetoba c ter baumanii , Pseudomona sp y Staphyloc o ccus aureus . Método . Los extractos se obtuvieron por destilación simple empleando alcohol etílico como solvente, la composición química se evaluó mediante cromatografía de gases. La actividad antimicrobia na de cada uno de los extractos de plantas se realizó por los métodos difusión en pozo y difusión en disco. Resultados . Las bacterias mostraron diferentes grados de sensibilidad a los extractos, prese n tando inhibición de crecimiento S. aureus con el extra cto de O. vulgare y R. graveolens , mientras que la bacteria Pseudomona sp. , con los extracto s de A. ludoviciana, L. tridentata y O. vulgare . Discusión . La mayor concentración de timol y carvacrol se encontró en los extractos de O. vulgare y L. tridentata . El compuesto linalol se encontró en una proporción mayor en O. vulgare y en menor proporción en A. ludoviciana . Limoneno se encontró en los extractos de O. vulgare y R. graveolens . De las cuatro plantas evaluadas, el extracto de L. tridentata fue mejor , de bido a que presenta la mayor inhibición en comparación con los otros extractos; y con un efecto similar a los aceites empleados como control. La técnica de dif u sión en disco, permitió observar mejor los efectos inhibitorios de los extra c tos y los aceites s obre cada una de las bacterias empleadas en comparación con el método de difusión en pozo.

Isolation, identification and activity of natural antioxidants from horehound (Marrubium vulgare L.) cultivated in Lithuania

NARCIS (Netherlands)

Pukalskas, A.; Venskutonis, P.R.; Salido, S.; Waard, de P.; Beek, van T.A.

2012-01-01

In an earlier screening of Lithuanian plants, horehound (Marrubium vulgare) showed good antioxidant activity and as this species is used in herbal teas and cough pastilles it was selected for further investigation. Some fractions of the aerial parts were strong scavengers of the model free radicals

Pyrrolizidine Alkaloids from Echium vulgare in Honey Originate Primarily from Floral Nectar.

Science.gov (United States)

Lucchetti, Matteo A; Glauser, Gaetan; Kilchenmann, Verena; Dübecke, Arne; Beckh, Gudrun; Praz, Christophe; Kast, Christina

2016-06-29

Pyrrolizidine alkaloids (PAs) in honey can be a potential human health risk. So far, it has remained unclear whether PAs in honey originate from pollen or floral nectar. We obtained honey, nectar, and plant pollen from two observation sites where Echium vulgare L. was naturally abundant. The PA concentration of honey was determined by targeted analysis using a high pressure liquid chromatography-mass spectrometry system (HPLC-MS/MS), allowing the quantification of six different PAs and PA-N-oxides present in E. vulgare. Echium-type PAs were detected up to 0.153 μg/g in honey. Nectar and plant pollen were analyzed by nontargeted analysis using ultrahigh pressure liquid chromatography-high resolution-mass spectrometry (UHPLC-HR-MS), allowing the detection of 10 alkaloids in small size samples. Echium-type PAs were detected between 0.3-95.1 μg/g in nectar and 500-35000 μg/g in plant pollen. The PA composition in nectar and plant pollen was compared to the composition in honey. Echimidine (+N-oxide) was the main alkaloid detected in honey and nectar samples, while echivulgarine (+N-oxide) was the main PA found in plant pollen. These results suggest that nectar contributes more significantly to PA contamination in honey than plant pollen.

STABILITAS OKSIDATIF MINYAK BIJI KENARI (Canarium indicum DAN Canarium vulgare SELAMA PENYIMPANAN PADA SUHU 30 DAN 40°C [Oxidative Stability of Canarium Nut (Canarium indicum and Canarium vulgare Oil during Storage at 30 and 40°C

Directory of Open Access Journals (Sweden)

Suhartati Djarkasi1

2008-12-01

Full Text Available The aims of this research were to study the effect of temperature and storage on the oxidative stability of crude and refined canarium nut oil extracted from the seeds of Canarium indicum and Canarium vulgare. The experiment was designed to include storage of two type of canarium nut oil at two different temperatures for up to 35 days. The oils (crude and refined used had the similar condition. Parameter used for oxidative deterioration indicators were two peroxide value, TBARS (thiobarbituric acid reactive substances, and free fatty acid value. The result showed that refining oil can decrease component natural antioxidant of canarium oil cause more sensitive to the oxidation. Increased storage temperature can raise oxidation of crude and refined oils from both species Canarium. The peroxide values of crude and refined oils both Canarium indicum and Canarium vulgare stored at 30 °C were 2.17, 4.35, 3.36 and 3.77 meq O2/kg oil, respectively. When they were stored at 4C the similar results were 6.21, 19.09, 8.12 and 17.23 meq O2/kg oil. Furthermore, TBARS value of crude and refined oils both for Canarium indicum and Canarium vulgare stored 30C were 4.55, 7.78, 5.70 and 6.58 µmol MDA/kg oil. When they were stored at 40 °C the similar results were 9.99, 55.46, 12.46 and 43.62 µmol MDA/kg oil.

Antioxidant activity of 100% and 80% methanol extracts from barley seeds (Hordeum vulgare L.: stabilization of sunflower oil

Directory of Open Access Journals (Sweden)

Iqbal, Shahid

2010-09-01

Full Text Available The antioxidant potential of 100% and 80% methanol extracts from the seeds of three barley varieties (Jou 83, Jou 87 and Haider 93 was assessed. The extract yields from barley seeds ranged from 3.23% (Haider 93,100% methanol to 5.31% (Jou 83, 80% methanol. The total phenolic contents, DPPH radical scavenging activity (IC50 values and inhibition of linoleic acid oxidation of barley seed extracts (BSE were determined to be 88.1-145.7 mg/100g, 90.8-168.6 μg/mL and 62.6-74.6%, respectively. The antioxidant effectiveness of BSE was also assessed by stabilizing sunflower oil (SFO with BSE at a concentration of 600 ppm (oil weight basis. The stabilized (treated with extract and the control (without extract addition SFO samples were subjected to accelerated (oven heating at 60ºC for 30 days, 8 h heating cycle/day storage. These were analyzed at regular intervals for the extent of oxidative changes according to the measurements of their contents of peroxide value, para-anisidine value, conjugated dienes and conjugated trienes. Generally, the 80% methanol extract of barely seeds demonstrated better antioxidant action than the 100% methanol extract. The antioxidant activity of BSE was also found to be considerably varied among the varieties tested. The present results suggest that antioxidant extracts from barely seeds might be used to protect vegetable oils from oxidation.El potencial antioxidante de extractos de metanol al 100% y el 80% de semillas de tres variedades de cebada (Jou 83, Jou 87 y Haider 93 fue evaluada. El rendimiento de los extractos de las semillas de cebada vario desde un 3.23% (Haider, 100% methanol a un 5.31% (Jou 83, 80% metanol. El contenido total de fenoles, la actividad atrapadora del radical DPPH (valores IC50 y la inhibición de la oxidación del ácido linoleico de los extractos de semilla de cebada (BSE fueron 88.1-145.7 mg/100g, 90.8-168.6 μg/mL y 62.6- 74.6%, respectivamente. La efectividad antioxidante de BSE fue tambi

Evaluation of Origanum vulgare essential oil as antimicrobial agent in sausage Avaliação da atividade antimicrobiana de óleo essencial de Origanum vulgare em linguiça

OpenAIRE

Cassiano Busatta; Altemir José Mossi; Maria Regina Alves Rodrigues; Rogério Luis Cansian; José Vladimir de Oliveira

2007-01-01

This work reports antimicrobial activity of oregano (Origanum vulgare) essential oil against several bacteria in sausage. The in vitro minimum inhibitory concentration (MIC) was determined for 9 selected aerobic heterotrofic bacteria. The antimicrobial activity of distinct concentrations of the essential oil on the basis of the highest MIC found was tested in a food system comprised of fresh sausage. Batch food samples were also inoculated with Escherichia coli with a fixed concentration and ...

Anthelmintic Activity of Crude Extract and Essential Oil of Tanacetum vulgare (Asteraceae against Adult Worms of Schistosoma mansoni

Directory of Open Access Journals (Sweden)

Loyana Silva Godinho

2014-01-01

Full Text Available Schistosomiasis, a parasitic disease caused by trematode flatworms of the genus Schistosoma, affects more than 200 million people worldwide, and its control is dependent on a single drug, praziquantel. Tanacetum vulgare (Asteraceae is used in folk medicine as a vermifuge. This study aimed to investigate the in vitro schistosomicidal activity of the crude extract (TV and the essential oil (TV-EO from the aerial parts of T. vulgare. TV-EO was obtained by hydrodistillation and analyzed by GC/MS, which allowed the identification of β-thujone (84.13% as the major constituent. TV and TV-EO, at 200 μg/mL, decreased motor activity and caused 100% mortality of all adult worms. At 100 and 50 μg/mL, only TV caused death of all adult worms, while TV-EO was inactive. TV (200 μg/mL was also able to reduce viability and decrease production of developed eggs. Confocal laser scanning microscopy showed morphological alterations in the tegument of the S. mansoni surface after incubation with TV (50 and 100 μg/mL. Quantitative analysis on the schistosomes tegument showed that TV caused changes in the numbers of tubercles of S. mansoni male worms in a dose-dependent manner. The findings suggest that T. vulgare is a potential source of schistosomicidal compounds.

A biomimetic synthesis of stable gold nanoparticles derived from aqueous extract of Foeniculum vulgare seeds and evaluation of their catalytic activity

Science.gov (United States)

Choudhary, Manoj Kumar; Kataria, Jyoti; Sharma, Shweta

2017-10-01

A facile biomimetic approach for the synthesis of gold nanoparticles (AuNPs) using aqueous extract of fennel ( Foeniculum vulgare) seeds have been reported in this article. The seeds of F. vulgare are rich in various plant secondary metabolites (phytochemicals) such as polyphenolic acids, flavonoids, and saponins. The phytochemicals of F. vulgare seeds play dual role of reducing and stabilizing agents. The formation of gold nanoparticles was evidenced from the appearance of intense purple color at room temperature with λ max around 550 nm in the UV-Vis absorption spectra. The stable AuNPs were further characterized by X-ray diffraction (XRD), Fourier transform infrared (FT-IR) spectroscopy and transmission electron microscopy (TEM) analysis. The synthesized nanoparticles were observed to be polydispersed, spherical and ranged from 10 to 30 nm with an average size of 20 ± 2 nm, as obtained from TEM images. The catalytic activity of gold nanoparticles was investigated by studying the reduction of anthropogenic dyes such as methylene blue (MB) and rhodamine B (Rh-B) with sodium borohydride. Results showed the possible applications of biogenic AuNPs in environment related problems.

Effects of aerial pollutants on cereal growth. [Hordeum vulgare var. Maris Otter

Energy Technology Data Exchange (ETDEWEB)

1975-01-01

Winter barley, var. Maris Otter, was grown at Woburn Experimental Farm in three closed plastic chambers with either filtered, ambient or sulfur dioxide-polluted air. The mean sulfur dioxide levels were 7.2 ..mu..g m/sup -3/, 37 ..mu..g m/sup -3/ for the filtered and ambient chambers respectively. In the field the mean value was 51.5 ..mu..g m/sup -3/ . Temperature and relative humidity in these closed houses differed from the outside. No visible damage occurred on any of the plants grown in the filtered or ambient air. In the fumigated chamber a high dose of sulfur dioxide was given for one week (19-25 April 1975), producing a mean concentration of 951 ..mu..g m/sup -3/, at the four-leaf stage. It caused severe necrosis of the leaves. The plants subsequently recovered and no further fumigations were given. At final harvest these plants were not significantly lower in total dry weight and grain weight from the ambient plants. The dry matter yield of the plants grown in filtered air was higher than that of plants in ambient air.

Cell wall polysaccharides hydrolysis of malting barley (Hordeum vulgare L.: a review

Directory of Open Access Journals (Sweden)

Jamar, C.

2011-01-01

Full Text Available Malting quality results from the different steps of the malting process. Malting uses internal changes of the seed occurring during germination, such as enzymes synthesis, to obtain a good hydrolysis process and the components required. Among the three main hydrolytic events observed, that are namely starch degradation, cell wall breakdown and protein hydrolysis, an efficient cell wall polysaccharides hydrolysis is an essential condition for a final product of quality. Indeed, because of the physical barrier of the cell wall, cell wall polysaccharides hydrolysis is one of the first steps expected from the process to gain access to the cell components. Moreover, viscosity problem and haze formation in malting industry are related to their presence during the process when inefficient degradation occurs, leading to increased production time and cost. Understanding the key elements in cell wall degradation is important for a better control. (1-3,1-4-β-glucans and arabinoxylans are the main constituents of cell wall. (1-3,1-4-β-glucans are unbranched chains of β-D-glucopyranose residues with β-(1,3 linkages and β-(1,4 linkages. Arabinoxylan consists in a backbone of D-xylanopyranosyl units linked by β-(1-4 bonds connected to single L-arabinofuranose by α-(1→2 or α-(1→3-linkages. Degradation of (1-3,1-4-β-glucans is processed by the (1-3,1-4-β-glucanases, the β-glucosidases and the β-glucane exohydrolases. It seems that the (1-3-β-glucanases are also involved. Arabinoxylans are mainly decomposed by (1-4-β-xylan endohydrolase, arabinofuranosidase and β-xylosidase.

Hordein gene dose effects in triploid endosperm of barley (Hordeum vulgare L.

Directory of Open Access Journals (Sweden)

Perović Dragan

2009-01-01

Full Text Available The presence of two maternal chromosome sets in triploid barley endosperm allows the distinction of maternal and paternal hordein bands in an electrophoregram: the maternal bands are stronger due to the higher gene dose. In the F1 generation there are differences between reciprocal crosses and in the F2 generation all 16 classes that are theoretically possible for a pair of polymorphic loci can be distinguished. This full classification is rarely possible in genetic studies, and allows more accurate estimates of recombination rates. Two hordein gene clusters (Hor1 and Hor2, corresponding to hordein C and hordein B respectively were analyzed in hybrids obtained by crossing two winter barley cultivars Partizan and HWV-247. Hordein separation was performed by acid-polyacrylamide gel electrophoresis at pH 3.2 (A-PAGE. A set of most informative bands of B and C hordeins was selected in each cross by two criteria: (1 presence or absence of bands in the parents and (2 signal strength to allow doses scoring. The average genetic distance between Hor1 and Hor2 loci was 11 cM. Distances in male and female maps were not significantly different, suggesting a similar recombination rate in male and female meiosis.

Influence of yellow rust infection on /sup 32/P transport in detached barley leaves

Energy Technology Data Exchange (ETDEWEB)

Schubert, J. (Akademie der Landwirtschaftswissenschaften der DDR, Aschersleben. Inst. fuer Phytopathologie)

1982-01-01

Several barley cultivars (Hordeum vulgare L.) differing in their resistance to yellow rust (Puccinia striiformis West.) were tested for relationships between changes of /sup 32/P transport in detached leaves and resistance to yellow rust disease. Investigation carried out with detached second leaves from plants infected at their first leaf revealed a matter transport in these leaves changed by the infection. Transport was also influenced by inoculation with yellow rust uredospores. In that case rust infection influenced the basipetal transport less strongly in resistent plants than in susceptible ones. Connected with the findings the influence of fungal substances on transport processes is discussed in general.

Purification, enzymatic characterization, and nucleotide sequence of a high-isoelectric-point alpha-glucosidase from barley malt

DEFF Research Database (Denmark)

Frandsen, T P; Lok, F; Mirgorodskaya, E

2000-01-01

in the transition state complex. Mass spectrometry of tryptic fragments assigned the 92-kD protein to a barley cDNA (GenBank accession no. U22450) that appears to encode an alpha-glucosidase. A corresponding sequence (HvAgl97; GenBank accession no. AF118226) was isolated from a genomic phage library using a c......High-isoelectric-point (pI) alpha-glucosidase was purified 7, 300-fold from an extract of barley (Hordeum vulgare) malt by ammonium sulfate fractionation, ion-exchange, and butyl-Sepharose chromatography. The enzyme had high activity toward maltose (k(cat) = 25 s(-1)), with an optimum at pH 4...

Influence of yellow rust infextion on 32P transport in detached barley leaves

International Nuclear Information System (INIS)

Schubert, J.

1982-01-01

Several barley cultivars (Hordeum vulgare L.) differing in their resistance to yellow rust (Puccinia striiformis West.) were tested for relationships between changes of 32 P transport in detached leaves and resistance to yellow rust disease. Investigation carried out with detached second leaves from plants infected at their first leaf revealed a matter transport in these leaves changed by the infection. Transport was also influenced by inoculation with yellow rust uredospores. In that case rust infection influenced the basipetal transport less strongly in resistent plants than in susceptible ones. Connected with the findings the influence of fungal substances on transport processes is discussed in general. (author)

Nitrogen acquisition by pea and barley and the effect of their crop residues on available nitrogen for subsequent crops

DEFF Research Database (Denmark)

Jensen, E.S.

1996-01-01

Nitrogen acquisition by field pea (Pisum sativum L.) and spring barley (Hordeum vulgare L.) grown on a sandy loam soil and availability of N in three subsequent sequences of a cropping system were studied in an outdoor pot experiment. The effect of crop residues on the N availability was evaluated....... The dry matter production and total N uptake of a spring barley crop following pea or barley, with a period of unplanted soil in the autumn/winter, were significantly higher after pea than after barley. The barley crop following pea and barley recovered 11% of the pea and 8% of the barley residue N...

Variability in mesophyll conductance between barley genotypes, and effects on transpiration efficiency and carbon isotope discrimination.

Science.gov (United States)

Barbour, Margaret M; Warren, Charles R; Farquhar, Graham D; Forrester, Guy; Brown, Hamish

2010-07-01

Leaf internal, or mesophyll, conductance to CO(2) (g(m)) is a significant and variable limitation of photosynthesis that also affects leaf transpiration efficiency (TE). Genotypic variation in g(m) and the effect of g(m) on TE were assessed in six barley genotypes (four Hordeum vulgare and two H. bulbosum). Significant variation in g(m) was found between genotypes, and was correlated with photosynthetic rate. The genotype with the highest g(m) also had the highest TE and the lowest carbon isotope discrimination as recorded in leaf tissue (Delta(p)). These results suggest g(m) has unexplored potential to provide TE improvement within crop breeding programmes.

Using elevated CO{sub 2} to increase the biomass of a Sorghum vulgare x Sorghum vulgare var. sudanense hybrid and Trifolium pratense L. and to trigger hyperaccumulation of cesium

Energy Technology Data Exchange (ETDEWEB)

Wu Huibin [Centre for Research in Ecotoxicology and Environmental Remediation, Institute of Agro-Environmental Protection, Ministry of Agriculture, Tianjin 300191 (China); Open Key Laboratory of Agro-environment and Agro-product Safety of the Ministry of Agriculture, Tianjin (China); College of Resources and Environment, Huazhong Agricultural University, 430070 Wuhan, Hubei Province (China); Tang Shirong, E-mail: tangshir@hotmail.com [Centre for Research in Ecotoxicology and Environmental Remediation, Institute of Agro-Environmental Protection, The Ministry of Agriculture, Tianjin 300191 (China); Open Key Laboratory of Agro-environment and Agro-product Safety of the Ministry of Agriculture, Tianjin (China); Zhang Ximei; Guo Junkang; Song, Zhengguo; Tian Shuai [Centre for Research in Ecotoxicology and Environmental Remediation, Institute of Agro-Environmental Protection, Ministry of Agriculture, Tianjin 300191 (China); Open Key Laboratory of Agro-environment and Agro-product Safety of the Ministry of Agriculture, Tianjin (China); Smith, Donald L. [Plant Science Department, McGill University, Macdonald Campus, 21111 Lakeshore Road, Ste. Anne de Bellevue, Quebec, H9X 3V9 (Canada)

2009-10-30

The most important challenge to use phytoremediation is how to improve its efficiency by increasing the accumulation of metals in plants, or by improving key plant biological traits that should enhance metal uptake. In this paper, we used open-top chambers to investigate the effects of elevated CO{sub 2} (860 {mu}L L{sup -1}) on biomass and Cs uptake by a Sorghum vulgare x Sorghum vulgare var. sudanense hybrid and Trifolium pratense L. growing on soils spiked with various levels of cesium (0, 300, 1500 and 3000 mg Cs kg{sup -1}). The results showed that elevated CO{sub 2} not only increased aboveground biomass of the Sorghum and Trifolium species by 32-111%, and by 8-11%, respectively, compared to the ambient CO{sub 2} treatment, but also caused more accumulation of Cs by Sorghum species (up to 73%) than Trifolium species (up to 43%). It was speculated that the increase in biomass and the improvement in Cs accumulation ability at elevated CO{sub 2} could be related to lowered soil pH values, and changes in number and kind of microorganisms in the rhizospheres of the two tested species. This is the first report of a link among elevated CO{sub 2}, increased biomass and hyperaccumulation of Cs by Sorghum and Trifolium species.

Composición química y actividad antibacteriana del aceite esencial del Origanum vulgare (orégano

Directory of Open Access Journals (Sweden)

Emilia Albado Plaus

2001-01-01

Full Text Available Objetivo: Determinar la actividad antimicrobiano en el aceite esencial (Carvacrol del Origanum vulgare. Material y métodos: El aceite esencial se obtuvo por destilación por arrastre con vapor de agua, a partir de las hojas y flores desecadas de O. vulgare; se determinó la gravedad especifica con un pinnómetro y el índice de refracción con refractómetro de Abbc; la composición química se evaluó mediante cromatografía de gas con detector de masa (GL-SM. La actividad antimicrobiana del aceite de O. vulgare se realizó por el método semicuantitativo de incorporación y de disco difusión en agar. Resultados: La densidad especifica del producto resultó 0.9234 a 20°C y el índice de refracción 1.4774; el cromatograma mostró un contenido de 9% de Carvacrol, 12.19% de Terpineol, 6.86% de P-cimeno y la presencia de otros compuesto relacionados metabolicamente con los tres antes citados. Las bacterias gram-negativas: Escherichia coli, Pseudomona aeruginosa, Salmonella tiphymurium, Salmonella cholerae suis y Vibrio cholerae y las bacterias gram-positivas: Staphylococcus aureus y Bacillus cereus, mostraron diferentes grados de sensibilidad. De los microorganismos evaluados solo pseudomonas aeruginosa mostró resistencia. Conclusión: El aceite esencial posee actividad microbiana contra todas las bacterias evaluadas, excepto antes para P. aeruginosa.(Rev Med Hered 2001; 12: 16-19 .

Antibacterial Effects of Origanum vulgare Essence Against Multidrug-Resistant Acinetobacter baumannii Isolated From Selected Hospitals of Tehran, Iran

Directory of Open Access Journals (Sweden)

Saghi

2015-02-01

Full Text Available Background Infection due to Acinetobacter baumannii has become a significant challenge to modern healthcare systems. The rapid emergence and global dissemination of A. baumannii as a major nosocomial pathogen is remarkable and it demonstrates its successful adaptation to the 21st century hospital environment. Recent studies have discussed about essential oil of Origanum vulgare against a range of bacteria, including various species of Staphylococcus, Pseudomonas, Bacillus and Escherichia coli. Objectives The present study aimed to investigate the inhibitory effects O. vulgare essence against multidrug-resistant (MDR strains of A. baumannii from selected hospitals in Tehran, Iran. Materials and Methods This oil was obtained using the hydrodistillation method and analyzed by gas chromatography mass spectrography (GC/MS. The antimicrobial activity against MDR isolates was achieved using disc diffusion method and macro-broth dilution assay. Results Analysis of the essential oil revealed the presence of pulegone (68.59% piperitone (7.8%, piperitenone (7.8%, 1, 8-cineole (1.3%, and carvacrol (1.6% as the major components. The results showed a significant activity against MDR A. baumannii with inhibition zones and minimal inhibitory concentration values in the ranges of 7-15 mm and 20-35 µL/mL respectively. Conclusions This investigation showed that the essence oil of O. vulgare had a potent antimicrobial activity against MDR A. baumannii. Further research is required to evaluate the practical values of therapeutic applications.

Comparação de azeites obtidos da cultivar portuguesa Galega Vulgar utilizando dois métodos de extracção Comparison of olive oil from Portuguese cultivar Galega Vulgar with two different methods of oil extraction

Directory of Open Access Journals (Sweden)

L. Torres Vaz-Freire

2007-01-01

Full Text Available A produção do azeite é uma das actividades agrícolas mais características da região mediterrânea e de importância relevante para a sua economia. O objectivo do trabalho foi o estudo da influência dos métodos da extracção na qualidade do azeite obtido. Incidiu principalmente sobre uma das cultivares recomendadas para os azeites de denominação origem protegida (DOP no Alentejo. Foi extraída azeite da variedade portuguesa, Galega Vulgar (Olea europaea L. subsp. europaea, colhida na região de Elvas nas campanhas de 2001 a 2004. Utilizou-se uma prensa hidráulica (extracção descontínua, Vieirinox, Portugal; e um “decanter” centrífugo de duas fases (extracção contínua, Oliomio, Itália. Nas azeitonas determinou-se o índice de maturação, fez-se o controle de pragas e avaliou-se o Índice de gordura (RMN. No azeite para além das análises químicas de controlo foi realizada a análise Sensorial com painel treinado e uma detecção electrónica de aromas (Alpha Mos Fox 3000. Os resultados preliminares mostram haver diferenças significativas para alguns dos parâmetros analisados no caso dos azeites. De todos os parâmetros em que se detectaram diferenças significativas apenas a acidez demonstrou alterações suficientes para classificar o azeite em outra categoria considerando a classificação estabelecida pelo Regulamento (CE N.º 1989/2003 de 6 de Novembro. Estudos como este são importantes na adaptação da tecnologia à variedade com o intuito de aumentar a eficiência de determinado processo tecnológico.Olive oil production is one of the important agricultural activities on the Mediterranean region and has a real impact on local economies. The objective of this work was the study of extraction methods impact on olive oil final quality. The variety studied is one of the varieties allowed for olive oil with Protected Origin Denomination (DOP production in Alentejo. The Portuguese variety extracted was Galega Vulgar

Effectiveness of Origanum vulgare L. and Origanum majorana L. essential oils in inhibiting the growth of bacterial strains isolated from the patients with conjunctivitis

Directory of Open Access Journals (Sweden)

Jana Luíza Toscano Mendes de Oliveira

2009-02-01

Full Text Available This study aimed to evaluate the antibacterial activity of Origanum vulgare L. and O. majorana L. essential oils on Staphylococcus aureus, S. coagulase negative, Enterobacter spp., Proteus spp., Acinetobacter spp., Klebsiella spp. isolated from the patients with conjunctivitis. The results showed a prominent inhibitory effect of both the essential oils on all the bacterial strains, noted by the large bacterial growth inhibition zones (15-32mm. The Minimum Inhibitory Concentrations (MIC values were between 5-20µL/mL and 2.5-10 µL/mL for O. vulgare and O. majorana essential oil, respectively. The MIC were able to cause significant (PEste estudo objetivou analisar a atividade antibacteriana do óleo essencial de O. vulgare L. and O. majorana L. sobre cepas bacterianas (Staphylococcus aureus, S. coagulase negative, Enterobacter spp., Proteus spp., Acinetobacter spp., Klebsiella spp. isoladas de pacientes com conjuntivite. Os resultados mostraram um destacável efeito inibitório de ambos os óleos essenciais ensaiadossobre todas as cepas bacterianas, notado pela formação de amplas zonas de inibição do crescimento bacteriano (15-32 mm. Os valores de Concentração Inibitória Mínima - CIM encontradas estiveram entre 5-20µL/mL e 2.5-10 µL/mL para o óleo essencial de O. vulgare e O. majorana, respectivamente. Os valores de CIM foram capazes de causar significante efeito inibitório sobre a viabilidade celular de Klebisiella spp., Proteus spp. e S. aureus causando uma total eliminação do inóculo microbiano em um tempo máximo de 24 h de exposição. Estes resultados mostraram a efetividade antibacteriana dos óleos essenciais de O. vulgare e O. majorana, bem como suporta a possibilidade do uso de tais produtos como fontes de compostos antimicrobianos.

Understanding rhizosphere processes to enhance phytoextraction of germanium and rare earth elements

Science.gov (United States)

Wiche, Oliver

2017-04-01

Germanium (Ge) and rare earth elements (REEs) are economically valuable raw materials that are not actually rare in terms of concentrations in soils but they are hardly available for plant uptake due to interactions with organic matter (SOM), secondary soil constituents such as Fe/Mn oxides and P bearing soil fractions. Processes in the rhizosphere might influence availability of Ge and REEs in the soil-plant system, since lowering of the pH and presence of carboxylates and siderophores (small molecules that strongly chelate Fe and other elements) strongly influences the chemical speciation of Ge and REEs in soil and consequently this comprehensive knowledge helps us to improve phytomining. In a series of field and greenhouse experiments 16 plant species from the functional groups of grasses, herbs and legumes were tested with regard to their accumulation efficiency of Ge and REEs in shoots. Subsequently, we conducted mixed culture experiments in which inefficient species (e.g. cereals like Avena sativa, Hordeum vulgare, Panicum miliaceum) were cultivated in mixed cultures with efficient species (Lupinus albus, Lupinus angustifolius). Based on the plant concentrations a principal component analysis (PCA) was performed to identify significant factors that explain the accumulation behavior of different plant species with regard to Ge, REEs, Si, Fe and Mn. In this analysis Mn was used to identify plant species with efficient mechanisms to access sparingly available P-resources in soils. Particularly in nonmycorrhizal species concentrations of Mn in leaves often indicate a carboxylate based P-mobilising strategy. Herbaceous plant species accumulated significantly higher amounts of REEs while grasses accumulated significantly higher amounts of Ge. Concentrations of Ge in shoots of grasses correlated significantly positive with Si, but negatively with concentrations of Mn. Indeed, the results of the PCA clearly show that plants with high Mn concentrations tend to have

Luxury as the opposite of vulgarity:a trio of perspectives on luxury brands

OpenAIRE

Reyneke, Mignon

2011-01-01

This thesis, entitled “Luxury as the opposite of vulgarity: A trio of perspectives on luxury brands” considers luxury brands in a trio of contemporary contexts. Despite the academic research surrounding luxury brands being limited, the existent research most often studies luxury brands in a traditional retail context. That is, luxury is viewed from a perspective where the products are sold in luxury retail stores. However, the landscape that these brands function within has changed significan...

Phytochemical constituents, antioxidant activity, total phenolic and flavonoid contents of Arisarum vulgare seeds

OpenAIRE

Hadjer Kadri; Salah Eddine Djilani; Abdelouaheb Djilani

2013-01-01

Background.Arisarum vulgare is screened and its total phenolic compounds and total flavonoid contents were measured. In addition, the antioxidant capacity of the methanol-water (7:3) extract of this plant is evalu- ated by DPPH (2,2-diphenyl-1 picrylhydrazyl) and ABTS (2,2’-azino-bis(3-ethylbenzothiazoline-6-sulfon- ic)) tests expressed by Vitamin C Equivalent Antioxidant Capacity (VCEAC). HPLC analyses are carried out to identify some polyphenols. The aim of this study is to identify, ...

Instrumental neutron activities analysis of Marrubium vulgare L., a valuable medicinal herb

Energy Technology Data Exchange (ETDEWEB)

Nedjimi, Bouzid [Djelfa Univ. (Algeria). Lab. of Exploration and Valorization of Steppe Ecosystem; Beladel, Brahim [Djelfa Univ. (Algeria). Dept. of Physics

2016-08-01

Twenty two chemical elements were identified by Instrumental neutron activation analysis in Marrubium vulgare (Lamiaceae) a traditional medicine plant, used indigenously in Mediterranean basin to cure several diseases. The precision of the results was assessed by analyzing the certified reference material GBW 07605 (GSV-4) Tea leaves. Results showed that K was the dominant chemical element in studied plant (4.40%). The Ca and Fe mass fractions were also relatively high. However potential toxic elements in this Lamiaceae plant were within the safety limits suggested by WHO/FAO.

Antioxidant capacity and total phenolic contents of oregano (Origanum vulgare), lavender (Lavandula angustifolia) and lemon balm (Melissa officinalis) from Romania.

Science.gov (United States)

Spiridon, Iuliana; Colceru, Svetlana; Anghel, Narcis; Teaca, Carmen Alice; Bodirlau, Ruxanda; Armatu, Alice

2011-10-01

The study reported here presents a comparative screening of three medicinal plants including oregano (Origanum vulgare L.), lavender (Lavandula angustifolia) and lemon balm (Melissa officinalis) having the same geographical origin, the Southeast region of Romania, and growing in the same natural conditions. The contents of total phenolics and total flavonoids for the extracts of these were determined. Furthermore, the total antioxidant capacity was also evaluated. It was found that Origanum vulgare and Melissa officinalis extracts present the most effective antioxidant capacity in scavenging DPPH radicals, while Lavandula angustifolia is less active. High performance liquid chromatography-mass spectrometry analysis was used to identify the components of extracts. Major phenolic acids identified in the analysed species were ferulic, rosmarinic, p-coumaric and caffeic, while predominant flavonoids were quercetin, apigenin kaempherol, which were present as glucosides.

The Effect of Citrus Aurantium, Foeniculum Vulgare and Rosmarinus Officinalis Essential Oils on Peroxidase Activity

OpenAIRE

Maryam Mohajerani (PhD); Afsaneh Aghae i ( MSc )

2016-01-01

Background and objective: Peroxidases catalyze protein oxidation and lipid peroxidation. The activity of these enzymes in nerve cells is involved in causing disorders such as Alzheimer's and Parkinson's disease. This study investigated the effect of Citrus aurantium, Foeniculum vulgare and Rosmarinus officinalis essential oils on activity of peroxidase enzyme. Methods: All three medicinal plants were dried at room temperature. Their essential oil was extracted by steam distillation ...

Detection of alien genetic introgressions in bread wheat using dot-blot genomic hybridisation.

Science.gov (United States)

Rey, María-Dolores; Prieto, Pilar

2017-01-01

Simple, reliable methods for the identification of alien genetic introgressions are required in plant breeding programmes. The use of genomic dot-blot hybridisation allows the detection of small Hordeum chilense genomic introgressions in the descendants of genetic crosses between wheat and H. chilense addition or substitution lines in wheat when molecular markers are difficult to use. Based on genomic in situ hybridisation, DNA samples from wheat lines carrying putatively H. chilense introgressions were immobilised on a membrane, blocked with wheat genomic DNA and hybridised with biotin-labelled H. chilense genomic DNA as a probe. This dot-blot screening reduced the number of plants necessary to be analysed by molecular markers or in situ hybridisation, saving time and money. The technique was sensitive enough to detect a minimum of 5 ng of total genomic DNA immobilised on the membrane or about 1/420 dilution of H. chilense genomic DNA in the wheat background. The robustness of the technique was verified by in situ hybridisation. In addition, the detection of other wheat relative species such as Hordeum vulgare , Secale cereale and Agropyron cristatum in the wheat background was also reported .

Genetic Study of the Manganese Use Efficiency Trait in Winter Barley (Hordeum vulgare L.) by Genome- Wide Association and Genomic Selection

DEFF Research Database (Denmark)

Leplat, Florian Jean Victor

Manganese (Mn) deficiency remains an unsolved nutritional problem affecting crop production worldwide. The tolerance to Mn limiting conditions, known as Mn efficiency, is a quantitative abiotic stress trait, generally controlled by several genes. However the underlying genetic background of Mn...... functionality in Mn dependent pathways and processes. In a the second step, a genuine statistical method to assist breeding programs in selecting new varieties, named Genomic Selection (GS), was applied. It was demonstrated that GS is an effective tool to be used in breeding programs for selecting more...

Effects of combined action of γ-irradiation and sulfur dioxide or N-methyl-N'-nitro-N-nitrosoguanidin on bacteria and higher plants

International Nuclear Information System (INIS)

Kal'chenko, V.A.; Lotareva, O.V.; Spirin, D.A.; Karaban', R.T.; Mal'tseva, L.N.; Ignat'ev, A.A.

1988-01-01

Effect of combined action of of gamma-irradiation and sulfur dioxide or N-methyl-N-nitro-N-nitrosoguanidin on baceria (Bacillus subtilis) and higher plants (Hordeum vulgare L., Pinus sylvestris L.) have been studied. The number of barley germ root cells with chromosomal aberrations depends on the order of treatment with the studied agents. The coefficients of SO 2 and gamma-irradiation correlation fluctuate from 1,3 to 2,6 in the above experiments. In experiments with pine seedlings, these correlation coefficients were similar to additive ones. The data obtained suggest that the pattern of action of the agents is determined by the radiation sensitivity of objects and the order of action of the agents

Long-term rotation and tillage effects on soil structure and crop yield

DEFF Research Database (Denmark)

Munkholm, Lars Juhl; Heck, R; Deen, B

2013-01-01

long-term rotation and tillage treatment experiment on a Canadian silt loam soil. Topsoil measurements were carried out for three different rotations: R1, (C–C–C–C) continuous corn (Zea mays L.), R6, (C–C–O(RC), B(RC)) corn, corn, oats (Avena fatua L.) and spring barley (Hordeum vulgare L.) and R8, (C......–C–S–S) corn, corn, soybean (Glycine max L.), soybean. A red clover (Trifolium pretense L.) cover crop was under seeded in oats and spring barley in R6. In 2010, first year corn was grown in R6 and R8. The tillage treatments included no tillage, NT and mouldboard ploughing, MP. Topsoil structural quality...

Long-Term Effects of Rotational Tillage On Visual Evaluation of Soil Structure, Soil Quality and Crop Yield

DEFF Research Database (Denmark)

Munkholm, Lars Juhl; Heck, Richard; Deen, Bill

year old long-term rotation and tillage treatment experiment on a Canadian silt loam soil. Measurements were carried out in the topsoil for three different rotations: R1 (C-C-C-C) continuous corn (Zea mays L.), R6. (C-C-O(RC), B(RC)) corn, corn, oats (Avena fatua L.) and spring barley (Hordeum vulgare...... L.) and R8, (C-C-S-S) corn, corn, soybean (Glycine max L.), soybean. A red clover (Trifolium pretense L.) cover crop was under seeded in oats and spring barley in R6. In 2010, first year corn was grown in R6 and R8. The tillage treatments included no tillage, NT and mouldboard plowing, MP. Topsoil...

Biochemical and Molecular Characterization of a Barley Seed ß-Glucosidase

DEFF Research Database (Denmark)

Leah, R.; Kigel, J.; Svendsen, I.

1995-01-01

blot analysis with the cDNA as probe indicated that BGQ60 is encoded by a single gene, and that BGQ60 mRNA only accumulates in the starchy endosperm tissue of late developing seeds. The bgq60 structural gene of approximately 5 kilobases contains an open reading frame encoding 485 amino acids...... during barley seed development and germination are discussed.......A 60-kDa ß-glucosidase (BGQ60) was purified and characterized from seeds of barley (Hordeum vulgare L.). BGQ60 catalytic activity was restricted to the cleavage of short-chain oligosaccharides composed of(1, 2) -,(1, 2, 3) -, and/or(1, 2, 3, 4) -ß-linked glucose or mannose units...

Labeled Azospirillum brasilense wild type and excretion-ammonium strains in association with barley roots.

Science.gov (United States)

Santos, Adrian Richard Schenberger; Etto, Rafael Mazer; Furmam, Rafaela Wiegand; Freitas, Denis Leandro de; Santos, Karina Freire d'Eça Nogueira; Souza, Emanuel Maltempi de; Pedrosa, Fábio de Oliveira; Ayub, Ricardo Antônio; Steffens, Maria Berenice Reynaud; Galvão, Carolina Weigert

2017-09-01

Soil bacteria colonization in plants is a complex process, which involves interaction between many bacterial characters and plant responses. In this work, we labeled Azospirillum brasilense FP2 (wild type) and HM053 (excretion-ammonium) strains by insertion of the reporter gene gusA-kanamycin into the dinitrogenase reductase coding gene, nifH, and evaluated bacteria colonization in barley (Hordeum vulgare). In addition, we determined inoculation effect based on growth promotion parameters. We report an uncommon endophytic behavior of A. brasilense Sp7 derivative inside the root hair cells of barley and highlight the promising use of A. brasilense HM053 as plant growth-promoting bacterium. Copyright © 2017 Elsevier Masson SAS. All rights reserved.

The Possible Protective Role of Foeniculum vulgare Mill. Against Radiation-Induced Certain Biochemical Changes in Albino Rats

International Nuclear Information System (INIS)

Mohammed, M.M.A.

2010-01-01

This study was conducted to evaluate the modulating efficacy of prolonged oral administration of Foeniculum vulgare Mill. essential oil (FEO) against gamma irradiation-induced biochemical changes in male rats. Essential oil of Foeniculum vulgare Mill. was orally administrated at dose level of 250 mg/kg body wt/day for 21 days before irradiation and 7 days post exposure (6.5 Gy single dose). Rats exposed to ionizing radiation exhibited a potential elevation of serum aspartate aminotransferase (AST) and alkaline phosphatase (ALP) activities, bilirubin, urea and creatinine levels, lipid abnormalities, and an increase in tissue lipid peroxidation (LPO) and metallothioneins (MTs). On the other hand, noticeable drop in liver and kidney glutathione content and serum total protein, albumin and testosterone levels were recorded. Tissue organs displayed some changes in trace element concentrations, which may be due to the radiation ability to induce oxidative stress. The data obtained from rats treated with fennel oil before and after whole body gamma irradiation revealed significant modulation in the biochemical tested parameters and profound improvement in the activity of antioxidant status, glutathione and metallothioneins. The treatment of irradiated rats with fennel oil also appeared to be effective in minimizing the radiation-induced increase in lipid peroxidation as well as changes in essential trace elements in some tissue organs. In addition to its containing many chemical antioxidant constituents such as polyphenols, fennel was found to contain detectable concentrations of essential trace elements (Zn, Cu, Fe, Se, Mg, Mn and Ca) which may be involved in multiple biological processes as constituents of enzymes system including superoxide dismutase (Cu, Zn, Mn, SODs), oxide reductase, glutathione (GSP, GSH, GST), metallothionein MTs, etc. Overall, it could be concluded that Foeniculum vulgare Mill. essential oil exerts beneficial protective role against radiation

An Acylated Kaempferol Glycoside from Flowers of Foeniculum vulgare and F. Dulce

OpenAIRE

Soliman, Fathy M.; Shehata, Afaf H.; Khaleel, Amal E.; Ezzat, Shahera M.

2002-01-01

An acylated kaempferol glycoside, namely kaempferol-3-O-α-L-(2”,3”-di-E-pcoumaroyl)-rhamnoside (1) was isolated from the flowers of Foeniculum vulgare Mill. and F. dulce DC. It is thus isolated for the first time from family Apiaceae. In addition, the different organs of both plants afforded six flavonoid glycosides - namely afzelin (kaempferol-3-O-α-L-rhamnoside) (2), quercitrin (3), isorhamnetin-3-O-β-D-glucoside (4), isoquercitrin (5), rutin (6), and miquelianin (quercetin-3...

Modernization vs. vulgarization in online fashion luxury : how is internet impacting luxury brand equity ?

OpenAIRE

Marrão, Ana Rita Galante de Abreu

2016-01-01

The Internet became an inherent part of people’s daily life and the major source of transformation in the relation between consumers and brands. However, in the luxury branding context, the introduction of prestige brands into a mass channel such as the Internet might bring the risk of vulgarization, loss of control over the brand, loss of the high-luxury appeal, jeopardizing brand equity. Hence, the present thesis paper proposes to answer the dilemma between the imperative of going online an...

Improving nitrogen use efficiency in barley (Hordeum vulgare L.) through the cisgenic approach

DEFF Research Database (Denmark)

Kichey, Thomas Michel René; Holme, Inger; Møller, Inge Skrumsager

2009-01-01

into the pGreenII binary vector. The genes have been inserted into barley by Agrobacterium-mediated transformation using the hygromycin phosphotransferase gene for selection of transformed lines on hygromycin. In this system, the resistance gene is placed on the helper plasmid pSoup allowing for separate...

Diversity for seedling vigor in wild barley (hordeum vulgare L. subs. simpatina) germplasm

International Nuclear Information System (INIS)

Tyagi, K.; Park, M.R.; Lee, H.J.; Lee, C.A.; Rehman, S.; Steffenson, B.; Lee, K.J.; Yun, S.J.

2011-01-01

Seedling vigor is important for improving stand establishment of barley crops, particularly in arid regions and areas where the soil temperature is low at sowing time. Three hundred and fifteen wild barley accessions from the Wild Barley Diversity Collection (WBDC) were evaluated for nine seedling vigor traits in a poly house and growth chamber under hydroponic conditions. The accessions exhibited significant differences for all traits investigated. Traits showing greatest phenotypic variation were seedling visual score, plant height, shoot fresh weight, shoot dry weight and shoot length. Seed weight exhibited the least variation. Seed weight was significantly correlated with visual seedling score and shoot and seedling fresh and dry weight. Correlation analysis showed that the visual seedling score was a reliable method for estimating seedling vigor in wild barley. The first three principal components (PC) explained 82.3% of the variation present in the WBDC with PC1(54.0%) associated with shoot fresh weight, shoot dry weight, seedling dry weight, seedling fresh weight, shoot length and seedling length. Accessions from the southwest portion of the Fertile Crescent, like WBDC020 (Turkey), WBDC238 (Jordan) and WBDC244 (Jordan) exhibited the highest positive values for most of the plant vigor traits investigated. These wild barley accessions likely carry alleles that will be useful for the improvement of plant vigor traits in cultivated barley. (author)

Construction of a map-based reference genome sequence for barley, Hordeum vulgare L.

Czech Academy of Sciences Publication Activity Database

Beier, S.; Himmelbach, A.; Colmsee, C.; Zhang, X. Q.; Barrero, R. A.; Hastie, A.; Šimková, Hana; Staňková, Helena; Vrána, Jan; Chan, S.; Zhou, G.; Poland, J.; Bellgard, M. I.; Houben, A.; Doležel, Jaroslav; Ayling, S.; Lonardi, S.; Scholz, U.; Stein, N.; Mascher, M.

2017-01-01

Roč. 4, APR 27 (2017), č. článku 170044. ISSN 2052-4463 R&D Projects: GA MŠk(CZ) LO1204 Institutional support: RVO:61389030 Keywords : BACTERIAL ARTIFICIAL CHROMOSOMES * PHYSICAL MAP * LIBRARIES Subject RIV: EB - Genetics ; Molecular Biology OBOR OECD: Plant sciences, botany Impact factor: 4.836, year: 2016

Effect of gamma irradiation (60CO) on quatitative characters of barley (Hordeum vulgare)

International Nuclear Information System (INIS)

Santana, T.C.; Gonzalez, F.C.

1984-01-01

Seeds od f a barley line were irradiated with doses ranging from O to 64 Kr of gamma radiation for three consecutive generations (R1,R2 and R3). From these, several mutant generations were obtained in the field, planting at a commercial density and without selection. (M.A.C.) [pt

AFLP marker linked to water-stress-tolerant bulks in barley (Hordeum vulgare L.

Directory of Open Access Journals (Sweden)

A. Altinkut

2003-01-01

Full Text Available The amplified fragment length polymorphism (AFLP assay is an efficient method for the identification of molecular markers, useful in the improvement of numerous crop species. Bulked Segregant Analysis (BSA was used to identify AFLP markers associated with water-stress tolerance in barley, as this would permit rapid selection of water-stress tolerant genotypes in breeding programs. AFLP markers linked to water-stress tolerance was identified in two DNA pools (tolerant and sensitive, which were established using selected F2 individuals resulting from a cross between water-stress-tolerant and sensitive barley parental genotypes, based on their paraquat (PQ tolerance, leaf size, and relative water content (RWC. All these three traits were previously shown to be associated with water-stress tolerance in segregating F2 progeny of the barley cross used in a previous study. AFLP analysis was then performed on these DNA pools, using 40 primer pairs to detect AFLP fragments that are present/absent, respectively, in the two pools and their parental lines. One separate AFLP fragment, which was present in the tolerant parent and in the tolerant bulk, but absent in the sensitive parent and in the sensitive bulk, was identified. Polymorphism of the AFLP marker was tested among tolerant and sensitive F2 individuals. The presence of this marker that is associated with water-stress tolerance will greatly enhance selection for paraquat and water-stress tolerant genotypes in future breeding programs.

Population Growth of Rhopalosiphum padi L. (Homoptera: Aphididae on Different Cereal Crops from the Semiarid Pampas of Argentina under Laboratory Conditions Crecimiento Poblacional de Rhopalosiphum padi L. (Homoptera: Aphididae sobre Diferentes Cereales de la Pampas Semiárida de Argentina en Condiciones de Laboratorio

Directory of Open Access Journals (Sweden)

Lilian R Descamps

2011-09-01

Full Text Available The bird cherry-oat aphid Rhopalosiphum padi L. (Homoptera: Aphididae is one of the main pests in a number of crops in the semiarid Pampas of Argentina. In the present study, the effect of different host plants, including Triticum aestivum L., ×Triticosecale Wittm., Hordeum vulgare L., Hordeum distichum L., Avena sativa L., and Secale cereale L. on biological parameters of R. padi L. was studied in the laboratory at 24 ± 1 °C, 65 ± 10% RH and a 14:10 photoperiod. Longevity, intrinsic rate of natural increase (r m, net reproductive rate (R0, mean generation time (T, doubling time (DT, and finite rate of increase (λ of the bird cherry-oat aphid on the different cereal crops were estimated. Differences in fertility life table parameters of R. padi among host plants were analyzed using pseudo-values, which were produced by Jackknife re-sampling. Results indicated that beer barley might be the most suitable food for R. padi due to greater adult longevity (20.88 d, higher fecundity (41 nymphs female-1, higher intrinsic rate of natural increase (0.309 females female-1 d-1, lower doubling time (2.24, and lower nymphal mortality (22.2%. Therefore, it can be concluded from the present study that R. padi prefers beer barley for fast and healthy development over other cereal crops.El áfido Rhopalosiphum padi L. (Homoptera: Aphididae es una de las principales plagas de numerosos cultivos de la región semiárida pampeana de Argentina. En el presente trabajo se estudió el efecto de diferentes cereales incluidos Triticum aestivum L., ×Triticosecale Wittm., Hordeum vulgare L., Hordeum distichum L., Avena sativa L. and Secale cereale L. sobre los parámetros biológicos de R. padi en laboratorio. Se estimaron longevidad, tasa intrínseca de crecimiento natural (r m, tasa neta de reproducción (R0, tiempo generacional medio (T, tiempo de duplicación (TD, y tasa finita de incremento (λ del pulgón de la avena en diferentes cereales. Las diferencias de

When GIS zooms in: spatio-genetic maps of multipaternity in Armadillidium vulgare.

Science.gov (United States)

Bech, Nicolas; Depeux, Charlotte; Durand, Sylvine; Debenest, Catherine; Lafitte, Alexandra; Beltran-Bech, Sophie

2017-12-01

Geographic information system (GIS) tools are designed to illustrate, analyse and integrate geographic or spatial data, usually on a macroscopic scale. By contrast, genetic tools focus on a microscopic scale. Because in reality, landscapes have no predefined scale, our original study aims to develop a new approach, combining both cartographic and genetic approaches to explore microscopic landscapes. For this, we focused on Armadillidium vulgare, a terrestrial isopod model in which evolutionary pressures imposed by terrestrial life have led to the development of internal fertilisation and, consequently, to associated physiological changes. Among these, the emergence of internal receptacles, found in many taxa ranging from mammals to arthropods, allowed females to store sperm from several partners, enabling multipaternity. Among arthropods, terrestrial isopods like the polygynandrous A. vulgare present a female structure, the marsupium, in which fertilised eggs migrate and develop into mancae (larval stage). To test our innovative combined approach, we proposed different males to four independent females, and at the end of incubation in the marsupium, we mapped (using GIS methods) and genotyped (using 12 microsatellite markers) all the incubated mancae. This methodology permitted to obtain spatio-genetic maps describing heterozygosity and spatial distribution of mancae and of multipaternity within the marsupial landscape. We discussed the interest of this kind of multidisciplinary approach which could improve in this case our understanding of sexual selection mechanisms in this terrestrial crustacean. Beyond the interesting model-focused insights, the main challenge of this study was the transfer of GIS techniques to a microscopic scale and our results appear so as pioneers rendering GIS tools available for studies involving imagery whatever their study scale.

Carlos Jansen and the literary vulgarization for the youth

Directory of Open Access Journals (Sweden)

Lia Araujo Miranda Lima

2015-12-01

Full Text Available In this article we study the translations of Carlos Jansen for the youth, age group corresponding approximately to the contemporary concepts of preadolescence and adolescence, made at the end of the 19th century. Jansen was a pioneer in translating into Brazilian Portuguese works for the youth among which novels by Swift, Defoe, and Cervantes. His widely adapted versions had a pedagogical goal, serving as a reading material for children and adolescents attending schools. For this reason he was called a "vulgarizer" by critics of that period. The research encompassed the analysis of newspapers published between 1880 and 1899, available at the National Library's Hemeroteca Digital Brasileira, which provide data on the advertising and reception of his works. We intend to enrich historical research on children's literature in Brazil and analyse to what degree Jansen's pedagogical project has governed his translation practice.

Biorremediation of soil polluted by 75000 ppm of waste motor oil applying biostimulation and phytoremediation with Sorghum vulgare and Bacillus cereus or Burkholderia cepacia

Directory of Open Access Journals (Sweden)

Balderas-León Iván

2015-02-01

Full Text Available Waste motor oil (WMO pollutes soil and causing lost soil fertility. An alternative to solve this problem its bioremediation (BR by double and following biostimulation (BS with mineral solution (MS and a legume as green manure (GM then using phytoremediation (PR with growth promoting vegetal bacteria (GPVB like Bacillus cereus and Burkholderia cepacia to minimize remaining WMO. The aims of this research were: a bioremediation of polluted soil by 75000 ppm of WMO by biostimulation and then b Its phytoremediation for remaining WMO by Sorghum vulgare inoculated with B. cereus and B. cepacia. Soil polluted by high concentration WMO was biostimulated with MS, and then Phaseolus vulgaris treated by GPVB was incorporated as GM, finally to apply PR to eliminate WMO with S. vulgare with GPVB. Results indicate that soil bioremediated by biostimulation with MS, WMO decreased at 32500 ppm/30 days, and then with GM, WMO was reduced at 10100 ppm after/90 days. Finally, to apply phytoremediation using S. vulgare and GPVB at flowering, WMO was reduced from 2500 ppm to 800 ppm. For recovering soil impacted by high concentration WMO to apply both techniques double and following BS and PR are the best option than each technique separately.

Efectividad de la crema de Aloe vera en pacientes con psoriasis vulgar de la Parroquia San Fernando

Directory of Open Access Journals (Sweden)

Yoisel Belen Ruiz

2014-10-01

Full Text Available Se realizó un estudio de intervención terapéutica en 20 pacientes con psoriasis vulgar, pertenecientes a la Parroquia San Fernando, en Montes, Estado Sucre (Venezuela, de mayo a diciembre del 2013, quienes fueron seleccionados aleatoriamente y asignados en 2 grupos de idéntica cantidad de integrantes: el de control, que utilizó medicación convencional con triamcinolona, y el de estudio, que recibió tratamiento tópico con crema de Aloe vera (sábila de base inerte; a fin de determinar la efectividad de esta última. Para establecer la comparación entre ambos grupos, se emplearon técnicas no paramétricas debido al número reducido de pacientes, y siempre se consideró un nivel de significación de 0,05. Se obtuvo que la modalidad terapéutica con crema de sábila fuera tan efectiva como la aplicación de la triamcinolona, pero a diferencia de esta última, no presentó reacciones adversas. Así, pudo concluirse que la terapia con Aloe vera es efectiva para tratar pacientes con psoriasis vulgar

Essential Oil from Origanum vulgare Completely Inhibits the Growth of Multidrug-Resistant Cystic Fibrosis Pathogens.

Science.gov (United States)

Pesavento, Giovanna; Maggini, Valentina; Maida, Isabel; Lo Nostro, Antonella; Calonico, Carmela; Sassoli, Chiara; Perrin, Elena; Fondi, Marco; Mengoni, Alessio; Chiellini, Carolina; Vannacci, Alfredo; Gallo, Eugenia; Gori, Luigi; Bogani, Patrizia; Bilia, Anna Rita; Campana, Silvia; Ravenni, Novella; Dolce, Daniela; Firenzuoli, Fabio; Fani, Renato

2016-06-01

Essential oils (EOs) are known to inhibit the growth of a wide range of microorganisms. Particularly interesting is the possible use of EOs to treat multidrug-resistant cystic fibrosis (CF) pathogens. We tested the essential oil (EO) from Origanum vulgare for in vitro antimicrobial activity, against three of the major human opportunistic pathogens responsible for respiratory infections in CF patients; these are methicillin-resistant Staphylococcus aureus, Stenotrophomonas maltophilia and Achromobacter xylosoxidans. Antibiotic susceptibility of each strain was previously tested by the standard disk diffusion method. Most strains were resistant to multiple antibiotics and could be defined as multi-drug-resistant (MDR). The antibacterial activity of O. vulgare EO (OEO) against a panel of 59 bacterial strains was evaluated, with MIC and MBC determined at 24, 48 and 72 hours by a microdilution method. The OEO was effective against all tested strains, although to a different extent. The MBC and MIC of OEO for S. aureus strains were either lower or equal to 0.50%, v/v, for A. xylosoxidans strains were lower or equal to 1% and 0.50%, v/v, respectively; and for S. maltophilia strains were lower or equal to 0.25%, v/v. The results from this study suggest that OEO might exert a role as an antimicrobial in the treatment of CF infections.

Root plasma membrane transporters controlling K+/Na+ homeostasis in salt-stressed bBarley1[C][W

DEFF Research Database (Denmark)

Chen, Zhonghua; Pottosin, Igor I.; Cuin, Tracey A.

2007-01-01

are well combined to withstand saline conditions. These mechanisms include: (1) better control of membrane voltage so retaining a more negative membrane potential; (2) intrinsically higher H1 pump activity; (3) better ability of root cells to pump Na1 from the cytosol to the external medium; and (4) higher......Plant salinity tolerance is a polygenic trait with contributions from genetic, developmental, and physiological interactions, in addition to interactions between the plant and its environment. In this study, we show that in salt-tolerant genotypes of barley (Hordeum vulgare), multiple mechanisms...... of the cytosolic K1-to-Na1 ratio being a key determinant of plant salinity tolerance, and suggest multiple pathways of controlling that important feature in salt-tolerant plants....

Possible role for abscisic acid in regulation of photosynthetic and photorespiratory carbon metabolism in barley leaves

International Nuclear Information System (INIS)

Popova, L.P.; Tsonev, T.D.; Vaklinova, S.G.

1987-01-01

The influence of abscisic acid (ABA) on carbon metabolism, rate of photorespiration, and the activity of the photorespiratory enzymes ribulose bisphosphate oxygenase and glycolate oxidase in 7-day-old barley seedlings (Hordeum vulgare L. var. Alfa) was investigated. Plants treated with ABA had enhanced incorporation of labeled carbon from 14 CO 2 into glycolic acid, glycine, and serine, while 14 C incorporation into 3-phosphoglyceric acid and sugarphosphate esters was depressed. Parallel with this effect, treated plants showed a rise in activity of RuBP oxygenase and glycolic acid oxidase. The rate of photorespiration was increased twofold by ABA treatment at IO -6 molar while the CO 2 -compensation point increased 46% and stomatal resistance increased more than twofold over control plants

A laser ablation ICP-MS based method for multiplexed immunoblot analysis

DEFF Research Database (Denmark)

de Bang, Thomas Christian; Petersen, Jørgen; Pedas, Pai Rosager

2015-01-01

developed a multiplexed antibody-based assay and analysed selected PSII subunits in barley (Hordeum vulgare L.). A selection of antibodies were labelled with specific lanthanides and immunoreacted with thylakoids exposed to Mn deficiency after western blotting. Subsequently, western blot membranes were...... analysed by laser ablation inductively coupled plasma mass spectrometry (LA-ICP-MS), which allowed selective and relative quantitative analysis via the different lanthanides. The method was evaluated against established liquid chromatography electrospray ionization tandem mass spectrometry (LC...... by more than one technique. The developed method enables a higher number of proteins to be multiplexed in comparison to existing immunoassays. Furthermore, multiplexed protein analysis by LA-ICP-MS provides an analytical platform with high throughput appropriate for screening large collections of plants....

Evidence for adaptive evolution of low-temperature stress response genes in a Pooideae grass ancestor

DEFF Research Database (Denmark)

Vigeland, Magnus D; Spannagl, Manuel; Asp, Torben

2013-01-01

Adaptation to temperate environments is common in the grass subfamily Pooideae, suggesting an ancestral origin of cold climate adaptation. Here, we investigated substitution rates of genes involved in low-temperature-induced (LTI) stress responses to test the hypothesis that adaptive molecular...... evolution of LTI pathway genes was important for Pooideae evolution. Substitution rates and signatures of positive selection were analyzed using 4330 gene trees including three warm climate-adapted species (maize (Zea mays), sorghum (Sorghum bicolor), and rice (Oryza sativa)) and five temperate Pooideae...... species (Brachypodium distachyon, wheat (Triticum aestivum), barley (Hordeum vulgare), Lolium perenne and Festuca pratensis). Nonsynonymous substitution rate differences between Pooideae and warm habitat-adapted species were elevated in LTI trees compared with all trees. Furthermore, signatures...

Transcriptome assembly and analysis of Tibetan Hulless Barley (Hordeum vulgare L. var. nudum developing grains, with emphasis on quality properties.

Directory of Open Access Journals (Sweden)

Xin Chen

Full Text Available BACKGROUND: Hulless barley is attracting increasing attention due to its unique nutritional value and potential health benefits. However, the molecular biology of the barley grain development and nutrient storage are not well understood. Furthermore, the genetic potential of hulless barley has not been fully tapped for breeding. METHODOLOGY/PRINCIPAL FINDINGS: In the present study, we investigated the transcriptome features during hulless barley grain development. Using Illumina paired-end RNA-Sequencing, we generated two data sets of the developing grain transcriptomes from two hulless barley landraces. A total of 13.1 and 12.9 million paired-end reads with lengths of 90 bp were generated from the two varieties and were assembled to 48,863 and 45,788 unigenes, respectively. A combined dataset of 46,485 All-Unigenes were generated from two transcriptomes with an average length of 542 bp, and 36,278 among were annotated with gene descriptions, conserved protein domains or gene ontology terms. Furthermore, sequences and expression levels of genes related to the biosynthesis of storage reserve compounds (starch, protein, and β-glucan were analyzed, and their temporal and spatial patterns were deduced from the transcriptome data of cultivated barley Morex. CONCLUSIONS/SIGNIFICANCE: We established a sequences and functional annotation integrated database and examined the expression profiles of the developing grains of Tibetan hulless barley. The characterization of genes encoding storage proteins and enzymes of starch synthesis and (1-3;1-4-β-D-glucan synthesis provided an overview of changes in gene expression associated with grain nutrition and health properties. Furthermore, the characterization of these genes provides a gene reservoir, which helps in quality improvement of hulless barley.

Resistance of Hordeum chilense against loose smuts of wheat and barley (Ustilago tritici and U. nuda) and its expression in amphiploids with wheat

OpenAIRE

Rubiales, Diego; Moral, Ana

2011-01-01

Hordeum chilense is wild barley with high potential for cereal breeding purposes given its high crossability with other members of the Triticeae tribe. It is resistant to loose smuts of wheat (Ustilago tritici). The resistance is expressed in xTritordeum amphipoids, offering perspectives for its utilization both in tritordeum breeding and for its transfer to wheat. H. chilense and tritordeums are also resistant to barley loose smut (U. nuda). © 2010 Blackwell Verlag GmbH.

Increases in both acute and chronic temperature potentiate tocotrienol concentrations in wild barley at 'Evolution Canyon'.

Science.gov (United States)

Shen, Yu; Lansky, Ephraim; Traber, Maret; Nevo, Eviatar

2013-09-01

Biosynthesis of tocols (vitamin E isoforms) is linked to response to temperature in plants. 'Evolution Canyon', an ecogeographical microcosm extending over an average of 200 meters (range 100-400) wide area in the Carmel Mountains of northern Israel, has been suggested as a model for studying global warming. Both domestic (Hordeum vulgare) and wild (Hordeum spontaneum) barley compared with wheat, oat, corn, rice, and rye show high tocotrienol/tocopherol ratios. Therefore, we hypothesized that tocol distribution might change in response to global warming. α-, β-, γ-, and δ-tocopherol, and α-, β-, γ-, and δ-tocotrienol concentrations were measured in wild barley (H. spontaneum) seeds harvested from the xeric (African) and mesic (European) slopes of Evolution Canyon over a six-year period from 2005-2011. Additionally, we examined seeds from areas contiguous to and distant from the part of the Canyon severely burned during the Carmel Fire of December 2010. Increased α-tocotrienol (pslope in contrast to the cooler 'European' slope, and 3) to propinquity to the fire. The study illustrates the role of α-tocotrienol in both chronic and acute temperature adaptation in wild barley and suggests future research into thermoregulatory mechanisms in plants. Copyright © 2013 Verlag Helvetica Chimica Acta AG, Zürich.

Comparative studies on the antimicrobial and cytotoxic activities of Tanacetum vulgare L. essential oil and methanol extracts

OpenAIRE

Devrnja, Nina; Anđelković, Boban; Aranđelović, Sandra; Radulović, Siniša; Soković, Marina; Krstić Milošević, Dijana; Ristić, Mihailo; Ćalić, Dušica

2017-01-01

Chemical composition of essential oil (EO) and methanol extracts (MEs) from different parts of Tanacetum vulgare L. plant was analyzed and investigated for potential biological activities and correlated with the main constituents detected in EO and MEs. The EO was characterized by a high content of oxygenated monoterpenes with trans-chrysanthenyl acetate as major compound. All MEs were characterized by neochlorogenic, 3,5-O-dicaffeoylquinic and caffeoylquinic acids. High phenolic content in M...

New knowledge for yield, composition and insecticidal activity ofessential oils obtained from the aerial parts or seeds of fennel(Foeniculum vulgare Mill.)

Czech Academy of Sciences Publication Activity Database

Pavela, R.; Žabka, M.; Bednář, Jan; Tříska, Jan; Vrchotová, Naděžda

2016-01-01

Roč. 83, may (2016), s. 275-282 ISSN 0926-6690 R&D Projects: GA MZe(CZ) QJ1510160 Institutional support: RVO:67179843 Keywords : foeniculum vulgare * botanical insecticides * essential oils * medicinal plants * aromatic plants Subject RIV: EH - Ecology, Behaviour Impact factor: 3.181, year: 2016

Essential oil composition and antifungal activity of Foeniculum vulgare Mill obtained by different distillation conditions.

Science.gov (United States)

Mimica-Dukić, N; Kujundzić, S; Soković, M; Couladis, M

2003-04-01

The influence of different hydrodistillation conditions was evaluated from the standpoint of essential oil yield, chemical composition and antifungal activity from seeds of Foeniculum vulgare Mill. Three hydrodistillation conditions were considered. The main constituents of the oils were: (E)-anethole (72.27%-74.18%), fenchone (11.32%-16.35%) and methyl chavicol (3.78%-5.29%). The method of distillation significantly effected the essential oil yield and quantitative composition, although the antifungal activity of the oils against some fungi was only slightly altered. Copyright 2003 John Wiley & Sons, Ltd.

Essential Oil Composition and Antibacterial Activity of Origanum vulgare subsp. glandulosum Desf. at Different Phenological Stages

OpenAIRE

Béjaoui, Afef; Chaabane, Hédia; Jemli, Maroua; Boulila, Abdennacer; Boussaid, Mohamed

2013-01-01

Variation in the quantity and quality of the essential oil (EO) of wild population of Origanum vulgare at different phenological stages, including vegetative, late vegetative, and flowering set, is reported. The oils of air-dried samples were obtained by hydrodistillation. The yield of oils (w/w%) at different stages were in the order of late vegetative (2.0%), early vegetative (1.7%), and flowering (0.6%) set. The oils were analyzed by gas chromatography (GC) and GC–mass spectrometry (GC-MS)...

Analysis and evaluation of the antimicrobial and anticancer activities of the essential oil isolated from Foeniculum vulgare from Hamedan, Iran.

Science.gov (United States)

Akhbari, Maryam; Kord, Reza; Jafari Nodooshan, Saeedeh; Hamedi, Sepideh

2018-01-07

In this study, biological properties of the essential oil isolated from seeds of Foeniculum vulgare (F. vulgare) were evaluated. GC-MS analysis revealed Trans-Anethole (80.63%), L-Fenchone (11.57%), Estragole (3.67%) and Limonene (2.68%) were the major compounds of the essential oil. Antibacterial activity of the essential oil against nine Gram-positive and Gram-negative strains was studied using disc diffusion and micro-well dilution assays. Essential oil exhibited the antibacterial activity against three Gram-negative strains of Pseudomonas aeruginosa, Escherichia coli, and Shigella dysenteriae. The preliminary study on toxicity of seed oil was performed using Brine Shrimp lethality test (BSLT). Results indicated the high toxicity effect of essential oil (LC50 = 10 μg/mL). In vitro anticancer activity of seed oil was investigated against human breast cancer (MDA-Mb) and cervical epithelioid carcinoma (Hela) cell lines by MTT assay. Results showed the seed oil behave as a very potent anticancer agent with IC50 of lower than 10 μg/mL in both cases.

Effects of herbicide and nitrogen fertilizer on non-target plant reproduction and indirect effects on pollination in Tanacetum vulgare (Asteraceae)

DEFF Research Database (Denmark)

Dupont, Yoko Luise; Strandberg, Beate; Damgaard, Christian Frølund

2018-01-01

and nitrogen fertilizer on reproductive features of Tanacetum vulgare (Asteraceae). The study was carried out in an experimental set-up, in which plots of 7x7 m were treated with one of six treatments: four levels of the herbicide glyphosate (0%, 1%, 5%, and 25% of label rate of 1440 g a.i. ha-1) without...

Antibacterial Effects of Origanum vulgare Essence Against Multidrug-Resistant Acinetobacter baumannii Isolated From Selected Hospitals of Tehran, Iran

OpenAIRE

Saghi; Bahador; Khaledi; Ataee Kachoei; Amiri Dastjerdi; Esmaeili

2015-01-01

Background Infection due to Acinetobacter baumannii has become a significant challenge to modern healthcare systems. The rapid emergence and global dissemination of A. baumannii as a major nosocomial pathogen is remarkable and it demonstrates its successful adaptation to the 21st century hospital environment. Recent studies have discussed about essential oil of Origanum vulgare against a range of bacteria, including various species of Staphylococcus, Pseudomonas, Bacillus and Esc...

Retardation of senescence by UV-A light in barley (Hordeum vulgare L.) leaf segments

International Nuclear Information System (INIS)

Cuello, J.; Sanchez, M.D.; Sabater, B.

1994-01-01

The effects of low intensity (0.9–2.2 W m −2 ) UV-A radiation on barley leaf senescence were investigated. UV-A inhibited chlorophyll loss and caused increases in membrane permeability and chloroplast endopeptidases associated with senescence. The treatment of leaf segments with UV-A changed the type of proteins synthesized by chloroplasts, stimulating the synthesis of some specific polypeptides. It is concluded that the senescence of detached leaves provides an appropriate system for investigating effects of low UV-A intensities which are probably mediated by synthesis of specific proteins. (author)

Effect of herbicide clomazone on photosynthetic processes in primary barley (Hordeum vulgare L.) leaves

Czech Academy of Sciences Publication Activity Database

Kaňa, R.; Špundová, M.; Ilík, P.; Lazár, D.; Klem, K.; Tomek, P.; Nauš, J.; Prášil, Ondřej

2004-01-01

Roč. 78, - (2004), s. 161-170 ISSN 0048-3575 R&D Projects: GA ČR GA522/00/1274; GA ČR GP522/01/P098 Institutional research plan: CEZ:AV0Z5020903 Keywords : clomazone * herbicide * photosynthesis Subject RIV: ED - Physiology Impact factor: 1.133, year: 2004

Mycoflora Of Barley Hordeum Vulgare L. At Different Locations In Hail Area- Saudi Arabia

Directory of Open Access Journals (Sweden)

Elham S. Dawood

2015-05-01

Full Text Available Abstract 400 grain samples collected from barley fields in Hail area at the northern part of Saudi Arabia was used for this study. Isolation and identification of seed-borne fungi were conducted according to standard tests described by the International Seed Testing Association ISTA using YGCA medium. A total of 265 of external mycoflora and 517 of internal mycoflora were grouped into five fungal genera namely Aspergillus Alternaria Penillium Fusarium and Ulocladium spp. were isolated. Comparsion between frequencies and relative densities of external and internal mycoflora was carried out among the species of the predominant genera. Aspergillus flavus and A. niger reaveled high Fr. and RD of external mycoflora A. flavus Fr.60.9 - 40.5 RD 48.3 - 40.9and A. niger Fr. 52.7- 48.6- and RD 38.7- 41.9 as external internal mycoflora mycoflora respectively. All the species of Ulocladium and Alternaria were predominant as internal mycoflora .The most predominant species of Ulocladium and Alternaria were U. atrium Fr 89 -75.5and RD -79- 62.5 as internal external mycoflora respectively and Alternaria alternate Fr. 60 - 46.6 and RD. 55-32.3as externalinternal mycoflora respectively.

Involvement of ABA in induction of secondary dormancy in barley (Hordeum vulgare L.) seeds.

Science.gov (United States)

Leymarie, Juliette; Robayo-Romero, Maria Emilia; Gendreau, Emmanuel; Benech-Arnold, Roberto L; Corbineau, Françoise

2008-12-01

At harvest, barley seeds are dormant because their germination is difficult above 20 degrees C. Incubation of primary dormant seeds at 30 degrees C, a temperature at which they do not germinate, results in a loss of their ability to germinate at 20 degrees C. This phenomenon which corresponds to an induction of a secondary dormancy is already observed after a pre-treatment at 30 degrees C as short as 4-6 h, and is optimal after 24-48 h. It is associated with maintenance of a high level of embryo ABA content during seed incubation at 30 degrees C, and after seed transfer at 20 degrees C, while ABA content decreases rapidly in embryos of primary dormant seeds placed directly at 20 degrees C. Induction of secondary dormancy also results in an increase in embryo responsiveness to ABA at 20 degrees C. Application of ABA during seed treatment at 30 degrees C has no significant additive effect on the further germination at 20 degrees C. In contrast, incubation of primary dormant seeds at 20 degrees C for 48 and 72 h in the presence of ABA inhibits further germination on water similarly to 24-48 h incubation at 30 degrees C. However fluridone, an inhibitor of ABA synthesis, applied during incubation of the grains at 30 degrees C has only a slight effect on ABA content and secondary dormancy. Expression of genes involved in ABA metabolism (HvABA8'OH-1, HvNCED1 and HvNCED2) was studied in relation to the expression of primary and secondary dormancies. The results presented suggest a specific role for HvNCED1 and HvNCED2 in regulation of ABA synthesis in secondary seed dormancy.

Identification of traits and QTLs contributing to salt tolerance in barley (Hordeum vulgare L.)

NARCIS (Netherlands)

Nguyen Viet Long, L.

2012-01-01

Salinity is the most severe abiotic stress perceived by plants and affects about 800 million hectares of land worldwide, including 20% of the world’s highly productive irrigated land. Significant crop yield losses are observed due to salinity. Salinization is increasing because of poor

Microarray Analysis of Late Response to Boron Toxicity in Barley (Hordeum vulgare L.) Leaves

NARCIS (Netherlands)

Oz, M.T.; Yilmaz, R.; Eyidogan, F.; Graaff, de L.H.; Yucel, M.; Oktem, H.A.

2009-01-01

DNA microarrays, being high-density and high-throughput, allow quantitative analyses of thousands of genes and their expression patterns in parallel. In this study, Barley1 GereChip was used to investigate transcriptome changes associated with boron (B) toxicity in a sensitive barley cultivar

The family of DOF transcription factors in Brachypodium distachyon: phylogenetic comparison with rice and barley DOFs and expression profiling

Directory of Open Access Journals (Sweden)

Hernando-Amado Sara

2012-11-01

Full Text Available Abstract Background Transcription factors (TFs are proteins that have played a central role both in evolution and in domestication, and are major regulators of development in living organisms. Plant genome sequences reveal that approximately 7% of all genes encode putative TFs. The DOF (DNA binding with One Finger TF family has been associated with vital processes exclusive to higher plants and to their close ancestors (algae, mosses and ferns. These are seed maturation and germination, light-mediated regulation, phytohormone and plant responses to biotic and abiotic stresses, etc. In Hordeum vulgare and Oryza sativa, 26 and 30 different Dof genes, respectively, have been annotated. Brachypodium distachyon has been the first Pooideae grass to be sequenced and, due to its genomic, morphological and physiological characteristics, has emerged as the model system for temperate cereals, such as wheat and barley. Results Through searches in the B. distachyon genome, 27 Dof genes have been identified and a phylogenetic comparison with the Oryza sativa and the Hordeum vulgare DOFs has been performed. To explore the evolutionary relationship among these DOF proteins, a combined phylogenetic tree has been constructed with the Brachypodium DOFs and those from rice and barley. This phylogenetic analysis has classified the DOF proteins into four Major Cluster of Orthologous Groups (MCOGs. Using RT-qPCR analysis the expression profiles of the annotated BdDof genes across four organs (leaves, roots, spikes and seeds has been investigated. These results have led to a classification of the BdDof genes into two groups, according to their expression levels. The genes highly or preferentially expressed in seeds have been subjected to a more detailed expression analysis (maturation, dry stage and germination. Conclusions Comparison of the expression profiles of the Brachypodium Dof genes with the published functions of closely related DOF sequences from the cereal

Toxicity assessment of untreated/treated electroplating sludge using human and plant bioassay.

Science.gov (United States)

Orescanin, Visnja; Durgo, Ksenija; Mikelic, Ivanka Lovrencic; Halkijevic, Ivan; Kuspilic, Marin

2018-04-30

The purpose of this work was to assess the risk to the environment arising from the electroplating sludge from both chemical and toxicological point of view. Both approaches were used for the assessment of the treatment efficiency which consisted of CaO based solidification followed by thermal treatment at 400°C. The elemental composition was determined in the bulk samples and the leachates of untreated sludge. The toxicity of the leachate was determined using two human colorectal adenocarcinoma cell lines (Caco-2 and SW 480) and Hordeum vulgare L. based plant bioassay. The same toxicity tests were employed to the leachate of the treated sludge. Untreated sludge showed extremely high cytotoxic effect to both human and plant bio-system in dose-dependent manner. The percentages higher than 0.5% and 0.05% of the leachate caused significant cytotoxic effect on Caco-2 and SW 480 cells, respectively. The percentages of the leachate higher than 0.05% also showed significant toxic effect to H. vulgare L. bio-system with complete arrest of seed germination following the treatment with 100% to 5% of the leachate. The leachate of the treated sludge showed no toxicity to any of the test systems confirming the efficiency and justification of the employed procedures for the detoxification of electroplating sludge.

Development of cost-effective Hordeum chilense DNA markers: molecular aids for marker-assisted cereal breeding.

Science.gov (United States)

Hernández, P; Dorado, G; Ramírez, M C; Laurie, D A; Snape, J W; Martín, A

2003-01-01

Hordeum chilense is a potential source of useful genes for wheat breeding. The use of this wild species to increase genetic variation in wheat will be greatly facilitated by marker-assisted introgression. In recent years, the search for the most suitable DNA marker system for tagging H. chilense genomic regions in a wheat background has lead to the development of RAPD and SCAR markers for this species. RAPDs represent an easy way of quickly generating suitable introgression markers, but their use is limited in heterogeneous wheat genetic backgrounds. SCARs are more specific assays, suitable for automatation or multiplexing. Direct sequencing of RAPD products is a cost-effective approach that reduces labour and costs for SCAR development. The use of SSR and STS primers originally developed for wheat and barley are additional sources of genetic markers. Practical applications of the different marker approaches for obtaining derived introgression products are described.

Identification of 6-octadecynoic acid from a methanol extract of Marrubium vulgare L. as a peroxisome proliferator-activated receptor γ agonist

Energy Technology Data Exchange (ETDEWEB)

Ohtera, Anna; Miyamae, Yusaku; Nakai, Naomi [Graduate School of Biostudies, Kyoto University, Kyoto 606-8502 (Japan); Kawachi, Atsushi; Kawada, Kiyokazu; Han, Junkyu; Isoda, Hiroko [Alliance for Research on North Africa (ARENA), University of Tsukuba, Ibaraki 305-8572 (Japan); Faculty of Life and Environment, University of Tsukuba, Ibaraki 305-8572 (Japan); Neffati, Mohamed [Arid Zone Research Institute (IRA), Médenine 4119 (Tunisia); Akita, Toru; Maejima, Kazuhiro [Nippon Shinyaku CO., LTD., Kyoto 601-8550 (Japan); Masuda, Seiji; Kambe, Taiho [Graduate School of Biostudies, Kyoto University, Kyoto 606-8502 (Japan); Mori, Naoki; Irie, Kazuhiro [Graduate School of Agriculture, Kyoto University, Kyoto 606-8502 (Japan); Nagao, Masaya, E-mail: mnagao@kais.kyoto-u.ac.jp [Graduate School of Biostudies, Kyoto University, Kyoto 606-8502 (Japan)

2013-10-18

Highlights: •6-ODA, a rare fatty acid with a triple bond, was identified from Marrubium vulgare. •6-ODA was synthesized from petroselinic acid as a starting material. •6-ODA stimulated lipid accumulation in HSC-T6 and 3T3-L1 cells. •The first report of a fatty acid with a triple bond functioning as a PPARγ agonist. •This study sheds light on novel functions of a fatty acid with a triple bond. -- Abstract: 6-Octadecynoic acid (6-ODA), a fatty acid with a triple bond, was identified in the methanol extract of Marrubium vulgare L. as an agonist of peroxisome proliferator-activated receptor γ (PPARγ). Fibrogenesis caused by hepatic stellate cells is inhibited by PPARγ whose ligands are clinically used for the treatment of diabetes. Plant extracts of Marrubium vulgare L., were screened for activity to inhibit fibrosis in the hepatic stellate cell line HSC-T6 using Oil Red-O staining, which detects lipids that typically accumulate in quiescent hepatic stellate cells. A methanol extract with activity to stimulate accumulation of lipids was obtained. This extract was found to have PPARγ agonist activity using a luciferase reporter assay. After purification using several chromatographic methods, 6-ODA, a fatty acid with a triple bond, was identified as a candidate of PPARγ agonist. Synthesized 6-ODA and its derivative 9-octadecynoic acid (9-ODA), which both have a triple bond but in different positions, activated PPARγ in a luciferase reporter assay and increased lipid accumulation in 3T3-L1 adipocytes in a PPARγ-dependent manner. There is little information about the biological activity of fatty acids with a triple bond, and to our knowledge, this is the first report that 6-ODA and 9-ODA function as PPARγ agonists.

Influence of forage inclusion in the diet on ileal and total tract digestibility

DEFF Research Database (Denmark)

Jørgensen, Henry; Carlson, Dorthe; Lærke, Helle Nygaard

2012-01-01

The present investigation aimed to study the ileal and total tract digestibility of 3 forages (clover–grass, clover–grass silage, and fi eld pea (Pisum sativum)–barley (Hordeum vulgare) silage) supplemented to a basal diet. A total of 24 pigs, adapted to eating forages by supplementing a basal feed...... throughout the whole experiment. The intake of forages was low and quite variable and on average accounted for only 10 to 12% of the DMI. Ileal digestibility of protein estimated by collection from the T-cannula was higher (P = 0.031) than the digestibility estimated by the slaughter technique indicating...... in the diet as forage reduced (P pea– barley silage. In organic slaughter pig production, the overall energy supply from these forages is limited, but they may play an important role in satiety...

Progress in the evaluation, use in breeding, and genetic analysis of semi-dwarf mutants of barley

International Nuclear Information System (INIS)

Ullrich, S.E.; Muir, C.E.; Washington State Univ., Pullman

1984-01-01

Breeding for reduced height in barley (Hordeum vulgare L.) to primarily reduce lodging susceptibility is ongoing in the Washington State University barley breeding program. Two semi-dwarf winter and spring cultivars have been released and a number of advanced lines are being considered for release. Several semi-dwarf sources are utilized, including those from induced mutants in 'Jotun', 'Piroline' and 'Valticky'. In addition, over 200 putative mutants have been selected in the past four years from M 2 sodium azide-treated populations of local cultivars and advanced lines. These are evaluated in the pedigree breeding program and some have been incorporated into male sterile facilitated recurrent selection populations developed for reduced height. The inheritance of dwarfism in one mutant in the cultivar 'Advance' was determined to be controlled by a single recessive gene. (author)

Low Resolution Structure of RAR1-GST-Tag Fusion Protein in Solution

International Nuclear Information System (INIS)

Taube, M.; Kozak, M.; Jarmolowski, A.

2010-01-01

RAR1 is a protein required for resistance mediated by many R genes and function upstream of signaling pathways leading to H 2 O 2 accumulation. The structure and conformation of RAR1-GST-Tag fusion protein from barley (Hordeum vulgare) in solution was studied by the small angle scattering of synchrotron radiation. It was found that the dimer of RAR1-GST-Tag protein is characterized in solution by radius of gyration R G = 6.19 nm and maximal intramolecular vector D max = 23 nm. On the basis of the small angle scattering of synchrotron radiation SAXS data two bead models obtained by ab initio modeling are proposed. Both models show elongated conformations. We also concluded that molecules of fusion protein form: dimers in solution via interaction of GST domains. (authors)

Tracer study on sulphur use efficiency in potato-barley sequence on acid soil of Shimla

International Nuclear Information System (INIS)

Sud, K.C.; Sharma, R.C.; Sharma, N.K.

1999-01-01

Controlled studies were conducted on acidic soil of Fagu (Shimla) to study the efficiency of labelled ammonium sulphate as effected by farmyard manure (FYM) on potato (Solanum tuberosum L.) and its residual effect on succeeding barley (Hordeum vulgare L.). The direct and residual effects of FYM and sulphur on dry matter yield and S concentration in potato and barley plants were significant. Applied FYM had a positive effect on radioassay values i.e. % Sdff and % S utilization by potato from labelled S carrier, whereas, the residual effect of applied S on barley was more than its direct effect on potato. Results indicate that combined application of S and FYM resulted in 3.4 per cent more S contribution to barley crop and was reflected in % S utilization values. (author)

Study of the biochemical effects of ionizing and nonionizing radiation on plant metabolism during development. Progress report, September 1, 1976--November 30, 1977

International Nuclear Information System (INIS)

Klein, W.H.

1977-01-01

Studies on spectral distribution and its control of plant growth and development included spectral quality measurements and biological responses. Spectral quality measurements consisted of spectral monitoring, the erythmal band, and testing of solar collectors. A physiological system for determining biological response was the photoperiodic response to the induction of flowering by long days in Hordeum vulgare; the design of the system was intended to test whether or not changes in the spectral distribution of natural daylight are capable of controlling photoperiodism. Biological responses were also determined by phytochrome measurements. Photostationary states of phytochrome were determined from white light grown tissue and the effect of changes in the red to far-red ratio on phytochrome was assessed. Experimental results are reported for studies on effects of pulsed light on plant productivity

The Perennial Ryegrass GenomeZipper – Targeted Use of Genome Resources for Comparative Grass Genomics

DEFF Research Database (Denmark)

Pfeiffer, Matthias; Martis, Mihaela; Asp, Torben

2013-01-01

(Lolium perenne) genome on the basis of conserved synteny to barley (Hordeum vulgare) and the model grass genome Brachypodium (Brachypodium distachyon) as well as rice (Oryza sativa) and sorghum (Sorghum bicolor). A transcriptome-based genetic linkage map of perennial ryegrass served as a scaffold......Whole-genome sequences established for model and major crop species constitute a key resource for advanced genomic research. For outbreeding forage and turf grass species like ryegrasses (Lolium spp.), such resources have yet to be developed. Here, we present a model of the perennial ryegrass...... to establish the chromosomal arrangement of syntenic genes from model grass species. This scaffold revealed a high degree of synteny and macrocollinearity and was then utilized to anchor a collection of perennial ryegrass genes in silico to their predicted genome positions. This resulted in the unambiguous...

Functional proteomics of barley and barley chloroplasts – strategies, methods and perspectives

DEFF Research Database (Denmark)

Petersen, Jørgen; Rogowska-Wrzesinska, Adelina; Jensen, Ole Nørregaard

2013-01-01

Barley (Hordeum vulgare) is an important cereal grain that is used in a range of products for animal and human consumption. Crop yield and seed quality has been optimized during decades by plant breeding programs supported by biotechnology and molecular biology techniques. The recently completed...... whole-genome sequencing of barley revealed approximately 26,100 open reading frames, which provides a foundation for detailed molecular studies of barley by functional genomics and proteomics approaches. Such studies will provide further insights into the mechanisms of, for example, drought and stress...... tolerance, micronutrient utilization, and photosynthesis in barley. In the present review we present the current state of proteomics research for investigations of barley chloroplasts, i.e., the organelle that contain the photosynthetic apparatus in the plant. We describe several different proteomics...

Allelopathic relations of selected cereal and vegetable species during seed germination and seedling growth

Directory of Open Access Journals (Sweden)

Bojović Biljana M.

2015-01-01

Full Text Available Allelopathy is the direct or indirect harmful effect which one plant produces on another through the production of chemical compounds that escape into the environment. In the presence paper allelopathic relationships were determined in three cereals - wheat (Triticum aestivum L., barley (Hordeum vulgare L., oat (Avena sativa L. and vegetable crops - spinach (Spinacia oleracea L., radish (Raphanus sativus L., pepper (Capsicum annum L.. In addition to the percentage of germination, allelopathic potential was tested measuring root and stem length of tested plant species germinated either alone or in combination with others. The obtained results showed that seed germination and plant growth of cereals and vegetables are depended on the presence of other plants in all tested combinations. In this study has proven largely inhibitory allelopathic effect on germination and plant growth.

EFECTO SINÉRGICO DEL ACEITE ESENCIAL DE Origanum vulgare A LA GENTAMICINA EN CULTIVOS DE Escherichia coli.

Directory of Open Access Journals (Sweden)

Luis Chávez Torres

2012-02-01

Full Text Available Objetivo: El presente trabajo tuvo como propósito determinar el efecto sinérgico antibacteriano entre el aceite esencial de Origanum vulgare y la Gentamicina en aislados de Escherichia coli. Diseño: Estudio experimental Lugar: Centro Latinoamericano de Enseñanza e Investigación en Bacteriología Alimentaria (CLEIBA Participantes: Placas Petri conteniendo E. Coli ATCC 25922, aceite esencial de orégano y Gentamicina. Intervenciones: Se aplicó el método de Kirby Bauer (discos de difusión en 20 placas Petri. Se aisló la cepa Escherichia coli ATCC 25922. El grupo Experimental fue tratado con discos de papel filtro, embebidos con Gentamicina y aceite esencial de orégano al 75%; mientras que el grupo Control, con discos de Gentamicina sola. Se realizó la medición de los halos y se registraron los datos. Principales medidas de resultados: Se evaluó el diámetro de los halos de inhibición Resultados: Los halos de inhibición del grupo Experimental resultaron 22,375 mm., mayores que los del grupo Control (20,75 mm. La prueba T determinó que la diferencia era estadísticamente significativa, p = 0,001 (p < 0,05. Conclusiones: Existe un efecto sinérgico antibacteriano in vitro entre el aceite esencial de Origanum vulgare y la gentamicina en E. coli.

An Acylated Kaempferol Glycoside from Flowers of Foeniculum vulgare and F. Dulce

Directory of Open Access Journals (Sweden)

Shahera M. Ezzat

2002-02-01

Full Text Available An acylated kaempferol glycoside, namely kaempferol-3-O-α-L-(2”,3”-di-E-pcoumaroyl-rhamnoside (1 was isolated from the flowers of Foeniculum vulgare Mill. and F. dulce DC. It is thus isolated for the first time from family Apiaceae. In addition, the different organs of both plants afforded six flavonoid glycosides - namely afzelin (kaempferol-3-O-α-L-rhamnoside (2, quercitrin (3, isorhamnetin-3-O-β-D-glucoside (4, isoquercitrin (5, rutin (6, and miquelianin (quercetin-3-O-β-D-glucuronide (7. Structure elucidation of the above mentioned flavonoids was achieved by UV, 1H- and 13C-NMR, 1H-1H COSY, HMQC and EI-MS.

Investigation on antibacterial synergism of Origanum vulgare and Thymus vulgaris essential oils

Directory of Open Access Journals (Sweden)

Stojković D.

2013-01-01

Full Text Available Essential oils are well known as strong antimicrobial agents of plant origin. In spite of this, the antimicrobial synergism of essential oils isolated from different plant species is poorly investigated. The following study examines the synergism of the essential oils of Origanum vulgare L. and Thymus vulgaris L against pathogenic bacteria, Staphylococcus aureus and Salmonella typhimurium. First, the antibacterial effect of the oils was tested, and the minimal inhibitory concentrations (MIC of both oils were determined using the microdilution method. To test whether the oils act synergistically, every possible combination of essential oil concentrations was used in a dynamic checkerboard method. The results indicated that the oils indeed acted synergistically with fractional inhibitory concentration indexes of 0.45 and 0.50. [Projekat Ministarstva nauke Republike Srbije, br. 173032

Chemical Composition and Antimicrobial Activity of the Essential Oils from Three Chemotypes of Origanum vulgare L. ssp. hirtum (Link Ietswaart Growing Wild in Campania (Southern Italy

Directory of Open Access Journals (Sweden)

Felice Senatore

2009-07-01

Full Text Available Essential oils obtained from inflorescences of three Origanum vulgare L.ssp. hirtum (Link Ietswaart samples, growing wild in different locations in Campania (Southern Italy, were analysed. Three chemotypes were found: the first, with a prevalence of carvacrol/thymol; the second, characterized by the prevalence of thymol/α-terpineol; the third, featuring a prevalence of linalyl acetate and linalool. This chemical study attempts to provide a contribution in shedding light on the relationship between chemical composition and biotypes and/or chemotypes in Origanum vulgare ssp. hirtum. The essential oils were also evaluated for their antibacterial activity against 10 selected microorganisms. The data obtained contribute to the future view to use the essential oils as natural preservatives for food products, due to their positive effect on their safety and shelf life.

Comparative study on the quality of oil extracted from two tucumã varieties using supercritical carbon dioxide

Directory of Open Access Journals (Sweden)

Bárbara Elizabeth Teixeira COSTA

2016-01-01

Full Text Available Abstract The vast Amazon region has considerable territorial peculiarities and plant species diversity, sometimes from the same botanical family, which can exhibit significant differences in physicochemical properties. From this diversity, two species stand out – Amazonas tucumã (Astrocaryum aculeatum Meyer and Pará tucumã (Astrocaryum vulgare Mart.. The research focus is to analyze, comparatively, these oleaginous fruits, their similarities, particularities and potentials regarding the oil quality extracted from two tucumã varieties from the states of Amazonas and Pará, obtained using supercritical carbon dioxide, under different extraction parameters. The results demonstrate the biometric particularities of each species, highlighting the Amazon fruit, which also showed higher oil yield using supercritical CO2 extraction. The fatty acid quality and profile aspects of the oils show their unsaturated predominance, considering carotenoid content and how the extraction temperature can influence the nutritional quality of the oils. The statistical analyses indicated that the Amazon tucumã oil is superior to the Pará tucumã oil. However, in terms of added value both oils have potential applications in various industrial segments.

Evaluation of Some Chemical Characteristics of barley Mutants induced by Gamma Irradiation

International Nuclear Information System (INIS)

Abdeldaiem, M.H.; Ali, H.G.M.

2011-01-01

This study aims to evaluate the antioxidant activity of acetonic extract from some barley mutations (P1, P2 and P3 varieties) induced by gamma irradiation as compared with local barley variety (Hordeum vulgare L.) as control. Barley samples were obtained from Plant Breeding Unit, Plant Research Department, Nuclear Research Centre, Atomic Energy Authority, Egypt. The measurements of the antioxidant activity using a radical scavenging capacity against 2,2-diphenyl-1-picrylhydrazyl (DPPH) and ?-carotene bleaching assay were assessed in the barley acetonic extract. Furthermore, amino acids composition of barley mutant samples was determined. The results indicated that the acetonic extract of barley varieties under investigation possess marked antioxidant and anti radical capacities. The data showed that the acetonic extract of barley mutant P1 possessed the higher antioxidant activity as compared with the antioxidant activities of acetonic extract from control and other barley mutant samples. Meanwhile, the flour of barley mutations under investigation contained trace elements of iron, copper and manganese. GC and mass analyses were used to identify the active compound of extract of control and mutant barley samples. The results illustrated that the main components of the control sample of barely extract was pentane, 3 methyl (47.73%) while gamma irradiation caused noticeable change in the relative percentage of some components of acetonic extract from barley mutant samples. Moreover, the results presented that changes were disappeared, and some compounds of the acetonic extract from mutant barley samples were appeared. Furthermore, the results exhibited that barley flour supplemented with wheat flour at 30% level produced acceptable cookies. Accordingly, the phenolic constituents of barley acetonic extract induced by gamma irradiation, especially samples of P1 mutant, may have a future role as ingredients in the development of functional foods.

Developing a Molecular Identification Assay of Old Landraces for the Genetic Authentication of Typical Agro-Food Products: The Case Study of the Barley ‘Agordino’

Directory of Open Access Journals (Sweden)

Gianni Barcaccia

2017-01-01

Full Text Available The orzo Agordino is a very old local variety of domesticated barley (Hordeum vulgare ssp. distichum L. that is native to the Agordo District, Province of Belluno, and is widespread in the Veneto Region, Italy. Seeds of this landrace are widely used for the preparation of very famous dishes of the dolomitic culinary tradition such as barley soup, bakery products and local beer. Understanding the genetic diversity and identity of the Agordino barley landrace is a key step to establish conservation and valorisation strategies of this local variety and also to provide molecular traceability tools useful to ascertain the authenticity of its derivatives. The gene pool of the Agordino barley landrace was reconstructed using 60 phenotypically representative individual plants and its genotypic relationships with commercial varieties were investigated using 21 pure lines widely cultivated in the Veneto Region. For genomic DNA analysis, following an initial screening of 14 mapped microsatellite (SSR loci, seven discriminant markers were selected on the basis of their genomic position across linkage groups and polymorphic marker alleles per locus. The genetic identity of the local barley landrace was determined by analysing all SSR markers in a single multi-locus PCR assay. Extent of genotypic variation within the Agordino barley landrace and the genotypic differentiation between the landrace individuals and the commercial varieties was determined. Then, as few as four highly informative SSR loci were selected and used to develop a molecular traceability system exploitable to verify the genetic authenticity of food products deriving from the Agordino landrace. This genetic authentication assay was validated using both DNA pools from individual Agordino barley plants and DNA samples from Agordino barley food products. On the whole, our data support the usefulness and robustness of this DNA-based diagnostic tool for the orzo Agordino identification, which

Uniconazole effect on endogenous hormones, proteins and proline contents of barley plants (Hordium vulgare under salinity stress (NaCl

Directory of Open Access Journals (Sweden)

MOHAMED A. BAKHETA

2014-05-01

Full Text Available Bakheta MA, Hussein MM. 2014. Uniconazole effect on endogenous hormones, proteins and proline contents of barley plants (Hordium vulgare under salinity stress (NaCl. Nusantara Bioscience 6: 39-44. Pot experiments were carried out during two growth seasons 2010 / 2011 under greenhouse conditions of the National Research Centre, Dokki, Cairo, Egypt to investigate the response of barley plants (Hordium vulgare L grown under salinity stress (2500 or 5000 ppm to spraying with solutions of uniconazole at 150 or 200 ppm. The obtained results showed that irrigation with saline solutions caused increases in the amounts of abscisic acid (ABA, crude protein, total soluble-protein and proline contents. The results showed that spraying barley plants grown under saline solutions with uniconazole increased endogenous hormone contents of ABA, cytokinins, crude protein, total soluble protein and proline but caused decreases in the amounts of endogenous indole acetic acid (IAA and gibberellic acid (GA3. High protection of abscisic acid in treating plants with uniconazole and under salt stress (interaction effect increases proline, proteins and soluble protein which has been proposed to act as compatible solutes that adjust the osmotic potential in the cytoplasm. Thus, these biochemical characters can be used as a metabolic marker in relation to salinity stress.

The immune cellular effectors of terrestrial isopod Armadillidium vulgare: meeting with their invaders, Wolbachia.

Directory of Open Access Journals (Sweden)

Frédéric Chevalier

2011-04-01

Full Text Available Most of crustacean immune responses are well described for the aquatic forms whereas almost nothing is known for the isopods that evolved a terrestrial lifestyle. The latter are also infected at a high prevalence with Wolbachia, an endosymbiotic bacterium which affects the host immune system, possibly to improve its transmission. In contrast with insect models, the isopod Armadillidium vulgare is known to harbor Wolbachia inside the haemocytes.In A. vulgare we characterized three haemocyte types (TEM, flow cytometry: the hyaline and semi-granular haemocytes were phagocytes, while semi-granular and granular haemocytes performed encapsulation. They were produced in the haematopoietic organs, from central stem cells, maturing as they moved toward the edge (TEM. In infected individuals, live Wolbachia (FISH colonized 38% of the haemocytes but with low, variable densities (6.45±0.46 Wolbachia on average. So far they were not found in hyaline haemocytes (TEM. The haematopoietic organs contained 7.6±0.7×10(3Wolbachia, both in stem cells and differentiating cells (FISH. While infected and uninfected one-year-old individuals had the same haemocyte density, in infected animals the proportion of granular haemocytes in particular decreased by one third (flow cytometry, Pearson's test = 12 822.98, df = 2, p<0.001.The characteristics of the isopod immune system fell within the range of those known from aquatic crustaceans. The colonization of the haemocytes by Wolbachia seemed to stand from the haematopoietic organs, which may act as a reservoir to discharge Wolbachia in the haemolymph, a known route for horizontal transfer. Wolbachia infection did not affect the haemocyte density, but the quantity of granular haemocytes decreased by one third. This may account for the reduced prophenoloxidase activity observed previously in these animals.

La boda de penalty: el romance de Los primos romeros o la resolución poética de un conflicto vulgar

Directory of Open Access Journals (Sweden)

Baltanás, Enrique

1997-06-01

Full Text Available Although superficially the romance of Los primos romeros could be interpreted since a surrealist, anticlerical and incestuous perspective, here it is offered a lecture coherent with most of the romancistic oral texts: a conflict so familiar and vulgar as the "wedding by penalty", viewed since a poetic and inclosed indulgent perspective. For the purpose of this romance, theoretical questions as the role of the transmitter ¿author or reader? and the nature of oral texts are examined at once.Aunque a simple vista el romance de Los primos romeros pueda entenderse desde una perspectiva surrealista, anticlerical o incestuosa, aquí se propone una lectura coherente con la mayoría de los textos romancísticos orales modernos: un conflicto tan familiar y vulgar como la "boda de penalty", visto desde una perspectiva poética e incluso indulgente. Al mismo tiempo, y a propósito de este romance, se dilucidan algunas cuestiones teóricas como el papel del transmisor (¿autor o lector? y la propia naturaleza del texto oral.

Extract of Lillium candidum L. Can Modulate the Genotoxicity of the Antibiotic Zeocin

Directory of Open Access Journals (Sweden)

Peter Bryant

2011-12-01

Full Text Available Lilium candidum L. extract (LE is well known in folk medicine for the treatment of burns, ulcers, inflammations and for healing wounds. This work aims to clarify whether the genotoxic potential of the radiomimetic antibiotic zeocin (Zeo could be modulated by LE. Our results indicate that LE exerts no cytotoxic, DNA-damaging and clastogenic activity in in Chlamydomonas reinhardtii, Pisum sativum L. and Hordeum vulgare L. test systems over a broad concentration range. Weak but statistically significant clastogenic effects due to the induction of micronuclei and chromosome aberrations have been observed in H. vulgare L. after treatment with 200 and 300 μg/mL LE. To discriminate protective from adverse action of LE different experimental designs have been used. Our results demonstrate that the treatment with mixtures of LE and Zeo causes an increase in the level of DNA damage, micronuclei and “metaphases with chromatid aberrations” (MwA. Clear evidence has been also obtained indicating that pretreatment with LE given 4 h before the treatment with Zeo accelerates the rejoining kinetics of Zeo-induced DNA damage in P. sativum L. and C. reinhardtii, and can decrease clastogenic effect of Zeo measured as frequencies of micronuclei and MwA in H. vulgare L. Here, we show for the first time that LE can modulate the genotoxic effects of zeocin. The molecular mode of action strongly depends on the experimental design and varies from synergistic to protective effect (adaptive response–AR. Our results also revealed that LE-induced AR to zeocin involves up-regulation of DSB rejoining in C. reinhardtii and P. sativum L. cells.

Efecto sinérgico del aceite esencial de Origanum vulgare a la Gentamicina en cultivos de Escherichia coli.

Directory of Open Access Journals (Sweden)

Luis Chávez Torres

2008-01-01

Full Text Available Objetivo: El presente trabajo tuvo como propósito determinar el efecto sinérgico antibacteriano entre el aceite esencial de Origanum vulgare y la Gentamicina en aislados de Escherichia coli. Diseño: Estudio experimental Lugar: Centro Latinoamericano de Enseñanza e Investigación en Bacteriología Alimentaria (CLEIBA Participantes: Placas Petri conteniendo E. Coli ATCC 25922, aceite esencial de orégano y Gentamicina. Intervenciones: Se aplicó el método de Kirby Bauer (discos de difusión en 20 placas Petri. Se aisló la cepa Escherichia coli ATCC 25922. El grupo Experimental fue tratado con discos de papel filtro, embebidos con Gentamicina y aceite esencial de orégano al 75%; mientras que el grupo Control, con discos de Gentamicina sola. Se realizó la medición de los halos y se registraron los datos. Principales medidas de resultados: Se evaluó el diámetro de los halos de inhibición Resultados: Los halos de inhibición del grupo Experimental resultaron 22,375 mm., mayores que los del grupo Control (20,75 mm. La prueba T determinó que la diferencia era estadísticamente significativa, p = 0,001 (p < 0,05. Conclusiones: Existe un efecto sinérgico antibacteriano in vitro entre el aceite esencial de Origanum vulgare y la gentamicina en E. coli.

Inhibitory effect of Thymus vulgaris and Origanum vulgare essential oils on virulence factors of phytopathogenic Pseudomonas syringae strains.

Science.gov (United States)

Carezzano, M E; Sotelo, J P; Primo, E; Reinoso, E B; Paletti Rovey, M F; Demo, M S; Giordano, W F; Oliva, M de Las M

2017-07-01

Pseudomonas syringae is a phytopathogenic bacterium that causes lesions in leaves during the colonisation process. The damage is associated with production of many virulence factors, such as biofilm and phytotoxins. The essential oils of Thymus vulgaris (thyme) and Origanum vulgare (oregano) have been demonstrated to inhibit P. syringae. The aim of this study was to investigate the effects of T. vulgaris and O. vulgare essential oils on production of virulence factors of phytopathogenic P. syringae strains, including anti-biofilm and anti-toxins activities. The broth microdilution method was used for determination of MIC and biofilm inhibition assays. Coronatine, syringomycin and tabtoxin were pheno- and genotypically evaluated. Both oils showed good inhibitory activity against P. syringae, with MIC values from 1.43 to 11.5 mg·ml -1 for thyme and 5.8 to 11.6 mg·ml -1 for oregano. Biofilm formation, production of coronatine, syringomycin and tabtoxin were inhibited by thyme and oregano essential oil in most strains. The results presented here are promising, demonstrating the bactericidal activity and reduction of virulence factor production after treatment with thyme and oregano oil, providing insight into how they exert their antibacterial activity. These natural products could be considered in the future for the control of diseases caused by P. syringae. © 2017 German Botanical Society and The Royal Botanical Society of the Netherlands.

Carbon source-sink limitations differ between two species with contrasting growth strategies.

Science.gov (United States)

Burnett, Angela C; Rogers, Alistair; Rees, Mark; Osborne, Colin P

2016-11-01

Understanding how carbon source and sink strengths limit plant growth is a critical knowledge gap that hinders efforts to maximize crop yield. We investigated how differences in growth rate arise from source-sink limitations, using a model system comparing a fast-growing domesticated annual barley (Hordeum vulgare cv. NFC Tipple) with a slow-growing wild perennial relative (Hordeum bulbosum). Source strength was manipulated by growing plants at sub-ambient and elevated CO 2 concentrations ([CO 2 ]). Limitations on vegetative growth imposed by source and sink were diagnosed by measuring relative growth rate, developmental plasticity, photosynthesis and major carbon and nitrogen metabolite pools. Growth was sink limited in the annual but source limited in the perennial. RGR and carbon acquisition were higher in the annual, but photosynthesis responded weakly to elevated [CO 2 ] indicating that source strength was near maximal at current [CO 2 ]. In contrast, photosynthetic rate and sink development responded strongly to elevated [CO 2 ] in the perennial, indicating significant source limitation. Sink limitation was avoided in the perennial by high sink plasticity: a marked increase in tillering and root:shoot ratio at elevated [CO 2 ], and lower non-structural carbohydrate accumulation. Alleviating sink limitation during vegetative development could be important for maximizing growth of elite cereals under future elevated [CO 2 ]. © 2016 John Wiley & Sons Ltd.

Essential oil composition and antibacterial activity of Origanum vulgare subsp. glandulosum Desf. at different phenological stages.

Science.gov (United States)

Béjaoui, Afef; Chaabane, Hédia; Jemli, Maroua; Boulila, Abdennacer; Boussaid, Mohamed

2013-12-01

Variation in the quantity and quality of the essential oil (EO) of wild population of Origanum vulgare at different phenological stages, including vegetative, late vegetative, and flowering set, is reported. The oils of air-dried samples were obtained by hydrodistillation. The yield of oils (w/w%) at different stages were in the order of late vegetative (2.0%), early vegetative (1.7%), and flowering (0.6%) set. The oils were analyzed by gas chromatography (GC) and GC-mass spectrometry (GC-MS). In total, 36, 33, and 16 components were identified and quantified in vegetative, late vegetative, and flowering set, representing 94.47%, 95.91%, and 99.62% of the oil, respectively. Carvacrol was the major compound in all samples. The ranges of major constituents were as follows: carvacrol (61.08-83.37%), p-cymene (3.02-9.87%), and γ-terpinene (4.13-6.34%). Antibacterial activity of the oils was tested against three Gram-positive and two Gram-negative bacteria by the disc diffusion method and determining their diameter of inhibition and the minimum inhibitory concentration (MIC) values. The inhibition zones and MIC values for bacterial strains, which were sensitive to the EO of O. vulgare subsp. glandulosum, were in the range of 9-36 mm and 125-600 μg/mL, respectively. The oils of various phenological stages showed high activity against all tested bacteria, of which Bacillus subtilis was the most sensitive and resistant strain, respectively. Thus, they represent an inexpensive source of natural antibacterial substances that exhibited potential for use in pathogenic systems.

Antibacterial activity of oregano (Origanum vulgare Linn.) against gram positive bacteria.

Science.gov (United States)

Saeed, Sabahat; Tariq, Perween

2009-10-01

The present investigation is focused on antibacterial potential of infusion, decoction and essential oil of oregano (Origanum vulgare) against 111 Gram-positive bacterial isolates belonging to 23 different species related to 3 genera. Infusion and essential oil exhibited antibacterial activity against Staphylococcus saprophyticus, S. aureus, Micrococcus roseus, M. kristinae, M. nishinomiyaensis, M. lylae, M. luteus, M. sedentarius, M. varians, Bacillus megaterium, B. thuringiensis, B. alvei, B. circulans, B. brevis, B. coagulans, B. pumilus, B. laterosporus, B. polymyxa, B. macerans, B. subtilis, B. firmus, B. cereus and B. lichiniformis. The infusion exhibited maximum activity against B. laterosporus (17.5 mm mean zone of inhibition+/-1.5 Standard deviation) followed by B. polymyxa (17.0 mm+/-2.0 SD) and essential oil of oregano exhibited maximum activity against S. saprophyticus (16.8 mm+/-1.8 SD) followed by B. circulans (14.5 mm+/-0.5 SD). While all these tested isolates were found resistant to decoction of oregano.

Density and relative frequency effects on competitive interactions and resource use in pea–barley intercrops

DEFF Research Database (Denmark)

Hauggaard-Nielsen, H.; Andersen, H.K.; Jørnsgaard, B.

2006-01-01

or specific grain yield composition are wanted. Keywords: Competition dynamics; Grain quality; Hordeum vulgare; Intercropping; Nitrogen use; Organic farming; Pisum sativum; Weeds; Yield Abbreviations: IC, mixed intercropping; LER, land equivalent ratio; N, nitrogen; REIc, relative efficiency index; SC, sole...... not increase its reliance on atmospheric nitrogen fixation compared to the pea sole crop. With respect to soil nitrogen uptake there were no effect of plant density but a strong effect of the relative frequency of pea in the intercrop, the greater the proportion the lower the uptake. Changes in the competitive...... and tillering ability of barley are seen as likely explanations of lower weed load in the barley dominated crop treatments. This study points at the potential of employing density and relative crop frequency as "regulators" when specific intercrop objectives such as increased competitiveness towards weeds...

Maize, Sunflower and Barley Sensitivity to the Residual Activity of Clomazone in Soil

Directory of Open Access Journals (Sweden)

Jelena Gajić Umiljendić

2012-01-01

Full Text Available Sensitivity of maize, sunflower and barley to clomazone residues in loamy soil wasassessed in the study using bioassay. Clomazone was applied at a series of concentrationsfrom 0.12 to 12 mg a.i./kg of soil. After 14 days, morphological (shoot height, fresh and dryweight and physiological (content of carotenoids, chlorophyll a and chlorophyll b parameterswere measured. The results showed that morphological parameters are not valid indicatorsof clomazone sensitivity. Based on the results showing inhibition of the physiologicalparameters, I50 values were calculated and used to estimate the difference in sensitivitybetween the species tested. Sunflower was the most sensitive species, while the differencein sensitivity between maize and barley was not significant.Nomenclature: clomazone (2-(2-chlorbenzyl-4,4-dimethyl-1,2-oxazolidin-3-one, maize(Zea mays L., sunflower (Helianthus annuus L., barley (Hordeum vulgare L.

An assessment of the biotechnological use of hemoglobin modulation in cereals

DEFF Research Database (Denmark)

Hebelstrup, Kim; Shah, Jay K; Simpson, Catherine

2014-01-01

Non-symbiotic hemoglobin (nsHb) genes are ubiquitous in plants, but their biological functions have mostly been studied in model plant species rather than in crops. nsHb influences cell signaling and metabolism by modulating the levels of nitric oxide (NO). Class 1 nsHb is upregulated under hypoxia...... and is involved in various biotic and abiotic stress responses. Ectopic overexpression of nsHb in Arabidopsis thaliana accelerates development, whilst targeted overexpression in seeds can increase seed yield. Such observations suggest that manipulating nsHb could be a valid biotechnological target. We studied...... the effects of overexpression of class 1 nsHb in the monocotyledonous crop plant barley (Hordeum vulgare cv. Golden Promise). nsHb was shown to be involved in NO metabolism in barley, as ectopic overexpression reduced the amount of NO released during hypoxia. Further, as in Arabidopsis, nsHb overexpression...

Complex interplay of future climate levels of CO2, ozone and temperature on susceptibility to fungal diseases in barley

DEFF Research Database (Denmark)

Mikkelsen, Bolette Lind; Bagger Jørgensen, Rikke; Lyngkjær, Michael Foged

2015-01-01

efficiency of PSII, both at ambient and elevated [CO2], suggesting that photosynthesis was not limited by [CO2] at ambient temperature. When growing under elevated temperature or [O3], infection by the biotrophic powdery mildew fungus decreased, whereas disease symptoms and growth of the toxin......Barley (Hordeum vulgare) was grown in different climatic environments with elevated [CO2] (700 vs 385 ppm), [O3] (60/90 vs 20 ppb) and temperature (24/19 vs 19/12°C day/night) as single factors and in combinations, to evaluate the impact of these climatic factors on photosynthesis...... and susceptibility to powdery mildew and spot blotch disease. No significant increase in net CO2 assimilation rate was observed in barley grown under elevated [CO2] at ambient temperature. However, this rate was positively stimulated under elevated temperature together with a slightly higher potential quantum...

Brachypodium distachyon

DEFF Research Database (Denmark)

Tanackovic, Vanja

Starch is one of the most abundant polysaccharides on the Earth, the principal energy storage of most plant species and of crucial significance for humans as a major nutrient in human diet. The majority of produced starch comes from cereals, domesticated grasses, characterized by specific en......­hanced traits known as the domestication syndrome. Wild grasses, on the other side, still have traits lost during the process. Brachypodium distachyon (Brachypodium) is one of the wild grass recently introduced as a model plant for temperate cereals, closely related to pre-domesticated cereals such as barley...... (Hordeum vulgare). This thesis focuses on domestication of grasses – the cereal ancestors, starch in the grass Brachypodium distachyon, and its comparison to domesticated cereal. Grasses can potentially be used for the reintroduction of the lost grass traits, like health-promoting carbohydrates. Therefore...

Archaeobotanical study of ancient food and cereal remains at the Astana Cemeteries, Xinjiang, China.

Directory of Open Access Journals (Sweden)

Tao Chen

Full Text Available Starch grain, phytolith and cereal bran fragments were analyzed in order to identify the food remains including cakes, dumplings, as well as porridge unearthed at the Astana Cemeteries in Turpan of Xinjiang, China. The results suggest that the cakes were made from Triticum aestivum while the dumplings were made from Triticum aestivum, along with Setaria italica. The ingredients of the porridge remains emanated from Panicum miliaceum. Moreover, direct macrobotantical evidence of the utilization of six cereal crops, such as Triticum aestivum, Hordeum vulgare var. coeleste, Panicum miliaceum, Setaria italica, Cannabis sativa, and Oryza sativa in the Turpan region during the Jin and Tang dynasties (about 3(rd to 9(th centuries is also presented. All of these cereal crops not only provided food for the survival of the indigenous people, but also spiced up their daily life.

Concerted suppression of all starch branching enzyme genes in barley produces amylose-only starch granules

DEFF Research Database (Denmark)

Carciofi, Massimiliano; Blennow, Per Gunnar Andreas; Jensen, Susanne Langgård

2012-01-01

is preferentially derived from amylose, which can be increased by suppressing amylopectin synthesis by silencing of starch branching enzymes (SBEs). However all the previous works attempting the production of high RS crops resulted in only partly increased amylose-content and/or significant yield loss. Results...... In this study we invented a new method for silencing of multiple genes. Using a chimeric RNAi hairpin we simultaneously suppressed all genes coding for starch branching enzymes (SBE I, SBE IIa, SBE IIb) in barley (Hordeum vulgare L.), resulting in production of amylose-only starch granules in the endosperm...... yield in a living organism. This was achieved by a new method of simultaneous suppression of the entire complement of genes encoding starch branching enzymes. We demonstrate that amylopectin is not essential for starch granule crystallinity and integrity. However the slower initial growth of shoots from...

Archaeobotanical study of ancient food and cereal remains at the Astana Cemeteries, Xinjiang, China.

Science.gov (United States)

Chen, Tao; Wu, Yan; Zhang, Yongbing; Wang, Bo; Hu, Yaowu; Wang, Changsui; Jiang, Hongen

2012-01-01

Starch grain, phytolith and cereal bran fragments were analyzed in order to identify the food remains including cakes, dumplings, as well as porridge unearthed at the Astana Cemeteries in Turpan of Xinjiang, China. The results suggest that the cakes were made from Triticum aestivum while the dumplings were made from Triticum aestivum, along with Setaria italica. The ingredients of the porridge remains emanated from Panicum miliaceum. Moreover, direct macrobotantical evidence of the utilization of six cereal crops, such as Triticum aestivum, Hordeum vulgare var. coeleste, Panicum miliaceum, Setaria italica, Cannabis sativa, and Oryza sativa in the Turpan region during the Jin and Tang dynasties (about 3(rd) to 9(th) centuries) is also presented. All of these cereal crops not only provided food for the survival of the indigenous people, but also spiced up their daily life.

Effects of potentially acidic air pollutants on the intracellular distribution and transport of plant growth regulators in mesophyll cells of leaves. Consequences on stress- and developmental physiology

Energy Technology Data Exchange (ETDEWEB)

Kremer, H.; Pfanz, H.; Hartung, W.

1987-07-11

The influence of SO/sub 2/ on the intracellular distribution of abscisic acid (ABA) and indole-acetic acid (IAA) in mesophyll cells of Picea abies, Tsuga americana and Hordeum vulgare was investigated. The compartmentation of ABA and IAA depends on intracellular pH-gradients. The hydrophilic anions ABA and IAA are accumulated in the alkaline cell compartments cytosol and chloroplasts, which act as anion traps for weak acids. Uptake of sulfur dioxide into leaves leads to an acidification of alkaline cell compartments, thus decreasing intracellular pH-gradients. Consequently this results in an increased release of plant growth regulators from the cell interior into the apoplast. Therefore the target cells of plant hormones i.e. meristems and stomates are exposed to altered hormone concentrations. Obviously this influences the regulation of cellular metabolism plant development and growth.

Comparison of metal toxic impacts between aquatic and terrestrial organisms: is the free ion concentration a sufficient descriptor?

DEFF Research Database (Denmark)

Owsianiak, Mikolaj; Rosenbaum, Ralph K.; Larsen, Henrik Fred

2011-01-01

Characterization of metal toxic impacts in comparative risk assessment and life cycle impact assessment (LCIA) should take into account metal speciation and interactions with soil/water organic constituents, because these mechanisms control metal bioavailability and may influence their toxic...... that the free metal ion is an appropriate “general”descriptor of metal toxicity. Results for 128 laboratory tests on Daphnia magna exposed to copper ions (Cu2+) in water show that variation of several orders of magnitude are observed between the toxicity tests. These variations may be a result of the inability...... of magnitude difference occur for the extreme case of barley (Hordeum vulgare). Given the scarcity of terrestrial effect data compared to aquatic data, reliable and transparent, mechanistic-based predictions of terrestrial toxic impacts from aquatic effect data would be an important step ahead in the context...

Occurrence of barley leaf disease and control strategies in Denmark

DEFF Research Database (Denmark)

Jørgensen, Lise Nistrup; Ørum, Jens Erik; Heick, Thies Marten

Barley (Hordeum vulgare) is one of the major crops in Denmark and of special importance for malting and for pig feed. In 2016, the crop was grown covering a total area of 700,000 ha; approximately 25% of arable area in Denmark. To ensure high yield of around 60 dt ha-1, disease-tolerant cultivars...... have proven to be quite effective against all leaf diseases, aside from brown rust and mildew. Denmark has a national record system for pesticide usages. All farmers upload their fungicide use by crop, creating a good basis for assessing the differences in use pattern across different regions...... and fungicide treatments are required. Each year, barley cultivars are assessed for susceptibility towards leaf diseases in national observation plots. The most predominant fungal leaf diseases in Denmark are barley scald (Rhynchosporium secalis), net blotch (Pyrenophora teres), brown rust (Puccinia hordei...

Barley Seed Germination/Root Elongation Toxicity Test For Evaluation Of Sludge Pre-Treatment

DEFF Research Database (Denmark)

Eriksson, Eva; Kusk, Kresten Ole; Barrett Sørensen, Mie

Application of sludge from wastewater treatment plants (WWTPs) on agricultural land is an approach for nutrient recycling that rise challenges due to recalcitrant and harmful pollutants. In this study we assessed the feasibility of a seed germination test to evaluate sludge ecotoxicity and compared...... germination responses from two test parameters, root elongation and seed germination (sprouts elongation) of the barley (Hordeum vulgare). 2nd objective was to evaluate sewage sludge pre-treatments at batch-scale of sludge samples from two WWTPs using anaerobic digestion, and thermal and ozonation pre......-treatments. Glyphosate and eco-labelled soil were used as references. Inhibition of germination of seeds exposed to the glyphosate and sludge was registered and thus germination was successfully applied for sludge ecotoxicity assessment, and using the root elongation as the end-point was both faster and more precise...

Cloning and Characterization of Purple Acid Phosphatase Phytases from Wheat, Barley, Maize and Rice

DEFF Research Database (Denmark)

Dionisio, Giuseppe; Madsen, Claus Krogh; Holm, Preben Bach

2011-01-01

development and germination. In wheat, it was demonstrated that a and b isogene expression is driven by different promoters (approximately 31% identity). TaPAPhy_a/b promoter reporter gene expression in transgenic grains and peptide mapping of TaPAPhy purified from wheat bran and germinating grains confirmed......Barley (Hordeum vulgare) and wheat (Triticum aestivum) possess significant phytase activity in the mature grains. Maize (Zea mays) and rice (Oryza sativa) possess little or virtually no preformed phytase activity in the mature grain and depend fully on de novo synthesis during germination. Here......, it is demonstrated that wheat, barley, maize, and rice all possess purple acid phosphatase (PAP) genes that, expressed in Pichia pastoris, give fully functional phytases (PAPhys) with very similar enzyme kinetics. Preformed wheat PAPhy was localized to the protein crystalloid of the aleurone vacuole. Phylogenetic...

Are plant endogenous factors like ethylene modulators of the early oxidative stress induced by mercury?

Directory of Open Access Journals (Sweden)

M Belén eMontero-Palmero

2014-08-01

Full Text Available The induction of oxidative stress is one of the quickest symptoms appearing in plants subjected to metal stress. A transcriptional analysis of the early responses of alfalfa (Medicago sativa seedlings to mercury (Hg; 3 µM for 3, 6 and 24 h showed that up-regulation of genes responding to ethylene were up-regulated, a phytohormone known to mediate in the cellular redox homeostasis. In this mini-review we have compared these quick responses with two other concurrent transcriptomic analysis in Barrel medic (Medicago truncatula and barley (Hordeum vulgare under Hg stress. Besides ethylene, ABA and jasmonate related genes were up-regulated, all of them are endogenous factors known to intervene in oxidative stress responses. The information obtained may target future work to understand the cellular mechanisms triggered by Hg, enabling biotechnological approaches to diminish Hg-induced phytotoxicity.

The Localization of Eceriferum Loci in Barley

DEFF Research Database (Denmark)

Søgaard, Bodil

1974-01-01

Three different 3-point tests have been made for gene distances on chromosome 1 in barley (Hordeum vulgare L.). In all cases eceriferum, cer-f9, and albina, ac2, were examined with erectoides as the third gene. The erectoides, ert, genes are ert-a23, ert-d33 and ert-m40, respectively. The analyses...... have been carried through to F3. The experiments demonstrated the following sequence of the five genes: cer-f9 — ac2 — ert-d33 — ert-a23 — ert-m40 and the following distances: cer-f9 — ac2 = 2.3 %, ac2 — ert-a23 = 8.5 %, ac2 — ert-d33 = 2.5 % and ac2 — ert-m40 = 12.8 %. The cer-f9 — ac2 distance, which...

Neuroprotective Effects of Herbal Extract (Rosa canina, Tanacetum vulgare and Urtica dioica) on Rat Model of Sporadic Alzheimer's Disease.

Science.gov (United States)

Daneshmand, Parvaneh; Saliminejad, Kioomars; Dehghan Shasaltaneh, Marzieh; Kamali, Koorosh; Riazi, Gholam Hossein; Nazari, Reza; Azimzadeh, Pedram; Khorram Khorshid, Hamid Reza

2016-01-01

Sporadic Alzheimer's Disease (SAD) is caused by genetic risk factors, aging and oxidative stresses. The herbal extract of Rosa canina (R. canina), Tanacetum vulgare (T. vulgare) and Urtica dioica (U. dioica) has a beneficial role in aging, as an anti-inflammatory and anti-oxidative agent. In this study, the neuroprotective effects of this herbal extract in the rat model of SAD was investigated. The rats were divided into control, sham, model, herbal extract -treated and ethanol-treated groups. Drug interventions were started on the 21(st) day after modeling and each treatment group was given the drugs by intraperitoneal (I.P.) route for 21 days. The expression levels of the five important genes for pathogenesis of SAD including Syp, Psen1, Mapk3, Map2 and Tnf-α were measured by qPCR between the hippocampi of SAD model which were treated by this herbal extract and control groups. The Morris Water Maze was adapted to test spatial learning and memory ability of the rats. Treatment of the rat model of SAD with herbal extract induced a significant change in expression of Syp (p=0.001) and Psen1 (p=0.029). In Morris Water Maze, significant changes in spatial learning seen in the rat model group were improved in herbal-treated group. This herbal extract could have anti-dementia properties and improve spatial learning and memory in SAD rat model.

A pseudo-response regulator is misexpressed in the photoperiod insensitive Ppd-D1a mutant of wheat (Triticum aestivum L.).

Science.gov (United States)

Beales, James; Turner, Adrian; Griffiths, Simon; Snape, John W; Laurie, David A

2007-09-01

Ppd-D1 on chromosome 2D is the major photoperiod response locus in hexaploid wheat (Triticum aestivum). A semi-dominant mutation widely used in the "green revolution" converts wheat from a long day (LD) to a photoperiod insensitive (day neutral) plant, providing adaptation to a broad range of environments. Comparative mapping shows Ppd-D1 to be colinear with the Ppd-H1 gene of barley (Hordeum vulgare) which is a member of the pseudo-response regulator (PRR) gene family. To investigate the relationship between wheat and barley photoperiod genes we isolated homologues of Ppd-H1 from a 'Chinese Spring' wheat BAC library and compared them to sequences from other wheat varieties with known Ppd alleles. Varieties with the photoperiod insensitive Ppd-D1a allele which causes early flowering in short (SD) or LDs had a 2 kb deletion upstream of the coding region. This was associated with misexpression of the 2D PRR gene and expression of the key floral regulator FT in SDs, showing that photoperiod insensitivity is due to activation of a known photoperiod pathway irrespective of day length. Five Ppd-D1 alleles were found but only the 2 kb deletion was associated with photoperiod insensitivity. Photoperiod insensitivity can also be conferred by mutation at a homoeologous locus on chromosome 2B (Ppd-B1). No candidate mutation was found in the 2B PRR gene but polymorphism within the 2B PRR gene cosegregated with the Ppd-B1 locus in a doubled haploid population, suggesting that insensitivity on 2B is due to a mutation outside the sequenced region or to a closely linked gene.

Luteibacter rhizovicinus MIMR1 promotes root development in barley (Hordeum vulgare L.) under laboratory conditions.

Science.gov (United States)

Guglielmetti, Simone; Basilico, Roberto; Taverniti, Valentina; Arioli, Stefania; Piagnani, Claudia; Bernacchi, Andrea

2013-11-01

In order to preserve environmental quality, alternative strategies to chemical-intensive agriculture are strongly needed. In this study, we characterized in vitro the potential plant growth promoting (PGP) properties of a gamma-proteobacterium, named MIMR1, originally isolated from apple shoots in micropropagation. The analysis of the 16S rRNA gene sequence allowed the taxonomic identification of MIMR1 as Luteibacter rhizovicinus. The PGP properties of MIMR1 were compared to Pseudomonas chlororaphis subsp. aurantiaca DSM 19603(T), which was selected as a reference PGP bacterium. By means of in vitro experiments, we showed that L. rhizovicinus MIMR1 and P. chlororaphis DSM 19603(T) have the ability to produce molecules able to chelate ferric ions and solubilize monocalcium phosphate. On the contrary, both strains were apparently unable to solubilize tricalcium phosphate. Furthermore, the ability to produce 3-indol acetic acid by MIMR1 was approximately three times higher than that of DSM 19603(T). By using fluorescent recombinants of strains MIMR1 and DSM 19603(T), we also demonstrated that both bacteria are able to abundantly proliferate and colonize the barley rhizosphere, preferentially localizing on root tips and in the rhizoplane. Finally, we observed a negative effect of DSM 19603(T) on barley seed germination and plant growth, whereas MIMR1, compared to the control, determined a significant increase of the weight of aerial part (+22 %), and the weight and length of roots (+53 and +32 %, respectively). The results obtained in this work make L. rhizovicinus MIMR1 a good candidate for possible use in the formulation of bio-fertilizers.

The composite water and solute transport of barley (Hordeum vulgare) roots: effect of suberized barriers.

Science.gov (United States)

Ranathunge, Kosala; Kim, Yangmin X; Wassmann, Friedrich; Kreszies, Tino; Zeisler, Viktoria; Schreiber, Lukas

2017-03-01

Roots have complex anatomical structures, and certain localized cell layers develop suberized apoplastic barriers. The size and tightness of these barriers depend on the growth conditions and on the age of the root. Such complex anatomical structures result in a composite water and solute transport in roots. Development of apoplastic barriers along barley seminal roots was detected using various staining methods, and the suberin amounts in the apical and basal zones were analysed using gas chromatography-mass spectometry (GC-MS). The hydraulic conductivity of roots ( Lp r ) and of cortical cells ( Lp c ) was measured using root and cell pressure probes. When grown in hydroponics, barley roots did not form an exodermis, even at their basal zones. However, they developed an endodermis. Endodermal Casparian bands first appeared as 'dots' as early as at 20 mm from the apex, whereas a patchy suberin lamellae appeared at 60 mm. The endodermal suberin accounted for the total suberin of the roots. The absolute amount in the basal zone was significantly higher than in the apical zone, which was inversely proportional to the Lp r . Comparison of Lp r and Lp c suggested that cell to cell pathways dominate for water transport in roots. However, the calculation of Lp r from Lp c showed that at least 26 % of water transport occurs through the apoplast. Roots had different solute permeabilities ( P sr ) and reflection coefficients ( σ sr ) for the solutes used. The σ sr was below unity for the solutes, which have virtually zero permeability for semi-permeable membranes. Suberized endodermis significantly reduces Lp r of seminal roots. The water and solute transport across barley roots is composite in nature and they do not behave like ideal osmometers. The composite transport model should be extended by adding components arranged in series (cortex, endodermis) in addition to the currently included components arranged in parallel (apoplastic, cell to cell pathways). © The Author 2017. Published by Oxford University Press on behalf of the Annals of Botany Company.

Transformation of barley (Hordeum vulgare L.) by Agrobacterium tumefaciens infection of in vitro cultured ovules

DEFF Research Database (Denmark)

Holme, Inger; Brinch-Pedersen, Henrik; Lange, Mette

2012-01-01

Agrobacterium-mediated transformation of in vitro cultured barley ovules is an attractive alternative to well-established barley transformation methods of immature embryos. The ovule culture system can be used for transformation with and without selection and has successfully been used to transfo...

Identification and isoforms specificity of barley (Hordeum vulgare) grain proteinaceous inhibitors of commercial feed protease

DEFF Research Database (Denmark)

Dionisio, Giuseppe; Brinch-Pedersen, Henrik

2016-01-01

Protease is commonly used as feed additive. Ronozyme® ProAct, a subtilisin-like serine feed protease is different from the already characterized Bacillus subtilisin-like serine protease. When used in wheat and barley based feed, its degree of efficiency differs according to the cultivar in analys...

Entwicklung transgener Gerste (Hordeum vulgare L.) mit dem Ziel der Lysin- und Threoninanreicherung im Endosperm

OpenAIRE

Ibrahim, Ahmed Shawky Ahmed

2006-01-01

An efficient Agrobacterium-mediated barley transformation system was established with a transformation rate of 13.4 % on average. Towards improving the nutritional value of barley, a set of novel transformation vectors was developed including the dapA and lysC genes encoding the feed-back-inhibition insensitive form of the dihydrodipicolinate synthase (DHDPS) and aspartate kinase (AK) respectively. Both genes under the control of the endosperm-specific D-hordein promoter or the constitutive u...

Intensification of marrubiin concentration by optimization of microwave-assisted (low CO2 yielding) extraction process for Marrubium vulgare using central composite design and antioxidant evaluation.

Science.gov (United States)

Mittal, Vineet; Nanda, Arun

2017-12-01

Marrubium vulgare Linn (Lamiaceae) was generally extracted by conventional methods with low yield of marrubiin; these processes were not considered environment friendly. This study extracts the whole plant of M. vulgare by microwave assisted extraction (MAE) and optimizes the effect of various extraction parameters on the marrubiin yield by using Central Composite Design (CCD). The selected medicinal plant was extracted using ethanol: water (1:1) as solvent by MAE. The plant material was also extracted using a Soxhlet and the various extracts were analyzed by HPTLC to quantify the marrubiin concentration. The optimized conditions for the microwave-assisted extraction of selected medicinal plant was microwave power of 539 W, irradiation time of 373 s and solvent to drug ratio, 32 mL per g of the drug. The marrubiin concentration in MAE almost doubled relative to the traditional method (0.69 ± 0.08 to 1.35 ± 0.04%). The IC 50 for DPPH was reduced to 66.28 ± 0.6 μg/mL as compared to conventional extract (84.14 ± 0.7 μg/mL). The scanning electron micrographs of the treated and untreated drug samples further support the results. The CCD can be successfully applied to optimize the extraction parameters (MAE) for M. vulgare. Moreover, in terms of environmental impact, the MAE technique could be assumed as a 'Green approach' because the MAE approach for extraction of plant released only 92.3 g of CO 2 as compared to 3207.6 g CO 2 using the Soxhlet method of extraction.

Estudio lingüístico de la fitonimia vulgar de las orquídeas en Cuba

Directory of Open Access Journals (Sweden)

López Trabanco, Pedro Jesús

2012-12-01

Full Text Available One of the greatest efforts of modern science has been the symbolic identity and the economy of concepts in the language use at the time of classifying objects. If so, on the one hand, the common names are refused to fulfill the classification objectives. But, on the other hand, the symbolic meanings and functions which are rooted to the popular speech will be thrown over. Names are keys of a sign system or of a determined cosmovision. Thus the study object of this paper is the common orchid names taking into account mainly the naming sources and motivation in order to verify and establish criteria that solve the problem of this part of the Spanish in Cuba.

Uno de los grandes esfuerzos de la ciencia moderna ha sido la identidad simbólica y la economía de conceptos en el uso del lenguaje a la hora de clasificar los objetos. Si bien, por un lado, el desechar los nombres vulgares cumple el objetivo de clasificación, por el otro, se tiran por la borda los contenidos simbólicos y funciones que estos nombres tienen enraizados en el habla popular. Los nombres son claves de un sistema simbólico o de una cosmovisión determinada. Este trabajo tiene como objeto de estudio los nombres vulgares de las orquídeas fundamentalmente a partir de las fuentes de nominación y la motivación para verificar y establecer criterios que resuelvan la problemática de esta parcela del español en Cuba.

Genetic differentiation and geographical Relationship of Asian barley landraces using SSRs

Directory of Open Access Journals (Sweden)

Rehan Naeem

2011-01-01

Full Text Available Genetic diversity in 403 morphologically distinct landraces of barley (Hordeum vulgare L. subsp. vulgare originating from seven geographical zones of Asia was studied using simple sequence repeat (SSR markers from regions of medium to high recombination in the barley genome. The seven polymorphic SSR markers representing each of the chromosomes chosen for the study revealed a high level of allelic diversity among the landraces. Genetic richness was highest in those from India, followed by Pakistan while it was lowest for Uzbekistan and Turkmenistan. Out of the 50 alleles detected, 15 were unique to a geographic region. Genetic diversity was highest for landraces from Pakistan (0.70 ± 0.06 and lowest for those from Uzbekistan (0.18 ± 0.17. Likewise, polymorphic information content (PIC was highest for Pakistan (0.67 ± 0.06 and lowest for Uzbekistan (0.15 ± 0.17. Diversity among groups was 40% compared to 60% within groups. Principal component analysis clustered the barley landraces into three groups to predict their domestication patterns. In total 51.58% of the variation was explained by the first two principal components of the barley germplasm. Pakistan landraces were clustered separately from those of India, Iran, Nepal and Iraq, whereas those from Turkmenistan and Uzbekistan were clustered together into a separate group.

Preliminar toxicological assesement of Ruta graveolens, Origanum vulgare and Persea americana on the preimplantational mouse embryos

Directory of Open Access Journals (Sweden)

V. Benavides

2014-06-01

Full Text Available The growing interest in natural medicine makes it necessary to study plant properties as well as their possible secondary effects. In recent years the toxic effects of many medicinal plants on the preimplantational mouse embryo development have been studied. Many of them produce malformations and alterations in the embryonic development. Ruta graveolens "ruda", Origanum vulgare "oregano" and Persea americana "palta" are used in rural areas to menstrual colic and to provoke abortion (estrella, 1995. This study is aimed at assessing "in vivd'the effect of extracts of "oregano", "ruda" and "palta" to 20% on the morphology and growth of preimplantational mouse embryos.

Combined application of origanum vulgare l. essential oil and acetic acid for controlling the growth of staphylococcus aureus in foods Aplicação combinada do óleo essencial de Origanum vulgare L. e ácido acético para o controle do crescimento de Staphylococcus aureus em alimentos

Directory of Open Access Journals (Sweden)

Evandro Leite de Souza

2009-06-01

Full Text Available This study evaluated the occurrence of an enhancing inhibitory effect of the combined application of Origanum vulgare L. essential oil and acetic acid against Staphylococcus aureus by the determination of Fractional Inhibitory Concentration (FIC index and kill-time assay in nutrient broth, meat broth and in a food model (meat pieces. Acetic acid showed MIC and MFC of 0.6 and 1.25 µL.mL-1, respectively. For O. vulgare essential oil MIC and MBC were 1.25 and 2.5 µL.mL-1, respectively. FIC indexes of the mixture of essential oil and acetic acid at MIC x ½ were £ 1.0, showing an additive effect. No synergy was found at kill-time study. Anti-staphylococcal effect of the antimicrobials alone or in mixture (MIC x ½ was lower in meat than in nutrient and meat broths. The effective combination of essential oils and organic acids could appear as an attractive alternative for the food industry, as the doses to inhibit the microbial growth in foods can be lowered.Este estudo avaliou a ocorrência de um efeito inibitório potencializado quando da aplicação combinada do óleo essencial de O. vulgare e ácido acético sobre Staphylococcus aureus através da determinação Concentração Inibitória Fracional (FIC e de ensaios de tempo de morte em caldo nutriente, caldo base carne e em um modelo alimentar (pedaços de carne. O ácido acético mostrou um valor de CIM e CBM de 0,6 e 1,25 µL.mL-1, respectivamente. Estudos prévios encontraram valores de CIM e CBM para o óleo essencial de O. vulgare sobre as cepas teste de S. aureus de 1,25 e 1,5 µL.mL-1, respectivamente. Valores de índices de CIF da mistura do óleo essencial e ácido acético na concentração de CIM x ½ foram £ 1,0 caracterizando uma interação de adição. Nenhum efeito sinérgico foi encontrado nos ensaios de tempo de morte. O efeito anti-estafilocócico dos antimicrobianos isolados ou em combinação (CIM x ½ foi menor quando aplicado em carne em comparação a sua adição em

Effects of essential oils of Rosmarinus officinalis Linn. and Origanum vulgare Linn. from different origins on Sporothrix brasiliensis and Sporothrix schenckii complex

Directory of Open Access Journals (Sweden)

S.B. Waller

2016-08-01

Full Text Available ABSTRACT Rosmarinus officinalis L. (rosemary and Origanum vulgare L. (oregano are known to have antimicrobial properties, but studies on sporotrichosis are scarce. This study aimed to evaluate the anti-Sporothrix spp. activity of essential oils from commercial products and oils extracted from aerial parts of these plants and analyze their chemical constituents. S. schenckii complex and S. brasiliensis (n: 25 isolated from humans, cats, dogs, and environmental soil were tested through M27-A3 guidelines of CLSI with modification for phytotherapics. The essential oils of R. officinalis L. were similar for MIC50 and MFC50 ≤2.25mg/mL for extracted oil; and 4.5mg/mL and 9mg/mL, respectively, for commercial oil. Both products showed MIC90 of 18mg/mL and MFC90 of 36mg/mL. In O. vulgare L., the extracted oil had better activity with MIC50 and MFC50 ≤2.25mg/mL, and MIC90 and MFC90 of 4.5mg/mL, whereas the commercial oil showed MIC50 and MFC50 of 9mg/mL and MIC90 18mg/mL, respectively, and MFC90 of 36mg/mL. Through gas chromatography (CG/FID, thymol and α-terpinene were majority for extracted oil of O. vulgare L., and carvacrol and γ-terpinene made up the majority of the commercial oil. Both essential oils of R. officinalis L. showed 1,8-cineole and α-pinene as major. The fungal isolates were susceptible to all tested essential oils, including in itraconazole-resistant S. brasiliensis isolates. The extracted and commercial oils of the plants presented in vitro anti-Sporothrix spp. activity, and they are promising for treatment of sporotrichosis, including in cases refractory to itraconazole. More studies should be performed about toxicity and in vivo efficacy for its safe use.

Evolutionary Significance of Wolbachia-to-Animal Horizontal Gene Transfer: Female Sex Determination and the f Element in the Isopod Armadillidium vulgare.

Science.gov (United States)

Cordaux, Richard; Gilbert, Clément

2017-07-21

An increasing number of horizontal gene transfer (HGT) events from bacteria to animals have been reported in the past years, many of which involve Wolbachia bacterial endosymbionts and their invertebrate hosts. Most transferred Wolbachia genes are neutrally-evolving fossils embedded in host genomes. A remarkable case of Wolbachia HGT for which a clear evolutionary significance has been demonstrated is the " f element", a nuclear Wolbachia insert involved in female sex determination in the terrestrial isopod Armadillidium vulgare . The f element represents an instance of bacteria-to-animal HGT that has occurred so recently that it was possible to infer the donor (feminizing Wolbachia closely related to the w VulC Wolbachia strain of A. vulgare ) and the mechanism of integration (a nearly complete genome inserted by micro-homology-mediated recombination). In this review, we summarize our current knowledge of the f element and discuss arising perspectives regarding female sex determination, unstable inheritance, population dynamics and the molecular evolution of the f element. Overall, the f element unifies three major areas in evolutionary biology: symbiosis, HGT and sex determination. Its characterization highlights the tremendous impact sex ratio distorters can have on the evolution of sex determination mechanisms and sex chromosomes in animals and plants.

Evolutionary Significance of Wolbachia-to-Animal Horizontal Gene Transfer: Female Sex Determination and the f Element in the Isopod Armadillidium vulgare

Directory of Open Access Journals (Sweden)

Richard Cordaux

2017-07-01

Full Text Available An increasing number of horizontal gene transfer (HGT events from bacteria to animals have been reported in the past years, many of which involve Wolbachia bacterial endosymbionts and their invertebrate hosts. Most transferred Wolbachia genes are neutrally-evolving fossils embedded in host genomes. A remarkable case of Wolbachia HGT for which a clear evolutionary significance has been demonstrated is the “f element”, a nuclear Wolbachia insert involved in female sex determination in the terrestrial isopod Armadillidium vulgare. The f element represents an instance of bacteria-to-animal HGT that has occurred so recently that it was possible to infer the donor (feminizing Wolbachia closely related to the wVulC Wolbachia strain of A. vulgare and the mechanism of integration (a nearly complete genome inserted by micro-homology-mediated recombination. In this review, we summarize our current knowledge of the f element and discuss arising perspectives regarding female sex determination, unstable inheritance, population dynamics and the molecular evolution of the f element. Overall, the f element unifies three major areas in evolutionary biology: symbiosis, HGT and sex determination. Its characterization highlights the tremendous impact sex ratio distorters can have on the evolution of sex determination mechanisms and sex chromosomes in animals and plants.

Honey Antibacterial Effect Boosting Using Origanum vulgare L. Essential Oil.

Science.gov (United States)

Imtara, Hamada; Elamine, Youssef; Lyoussi, Badiâa

2018-01-01

The appearance of new bacterial strains which cause pathogenic diseases and which are resistant to the most used antibiotics requires probing new antibacterial agents sources. Therefore, the main aim of the present work was to follow the antibacterial activity of honey samples from Palestine and Morocco, after the combination with Origanum vulgare L. essential oil, and figure out whether the honey physicochemical parameters and geographic origin influence the final activity. The results of this study showed good geographical discrimination between the Palestinians and Moroccan honey samples. The antioxidant and antimicrobial activities showed a significant correlation with honey color, melanoidins, and phenolic and flavonoids contents. Furthermore, the possible effect of honey physicochemical parameters on the gained antimicrobial activities was assessed using the principal component analysis (PCA). Some parameters showed a promising effect and seem to be important in the process of honey samples selection. Namely, melanoidins content, phenolic content, electrical conductivity, and mineral content were shown to be positively influencing the gained antibacterial activity after the combination with essential oil against the tested strains, although a significant negative correlation was seen with the FIC only in the case of Escherichia coli (ATB: 57).

Honey Antibacterial Effect Boosting Using Origanum vulgare L. Essential Oil

Directory of Open Access Journals (Sweden)

Hamada Imtara

2018-01-01

Full Text Available The appearance of new bacterial strains which cause pathogenic diseases and which are resistant to the most used antibiotics requires probing new antibacterial agents sources. Therefore, the main aim of the present work was to follow the antibacterial activity of honey samples from Palestine and Morocco, after the combination with Origanum vulgare L. essential oil, and figure out whether the honey physicochemical parameters and geographic origin influence the final activity. The results of this study showed good geographical discrimination between the Palestinians and Moroccan honey samples. The antioxidant and antimicrobial activities showed a significant correlation with honey color, melanoidins, and phenolic and flavonoids contents. Furthermore, the possible effect of honey physicochemical parameters on the gained antimicrobial activities was assessed using the principal component analysis (PCA. Some parameters showed a promising effect and seem to be important in the process of honey samples selection. Namely, melanoidins content, phenolic content, electrical conductivity, and mineral content were shown to be positively influencing the gained antibacterial activity after the combination with essential oil against the tested strains, although a significant negative correlation was seen with the FIC only in the case of Escherichia coli (ATB: 57.

Birationally rigid varieties. I. Fano varieties

International Nuclear Information System (INIS)

Pukhlikov, A V

2007-01-01

The theory of birational rigidity of rationally connected varieties generalises the classical rationality problem. This paper gives a survey of the current state of this theory and traces its history from Noether's theorem and the Lueroth problem to the latest results on the birational superrigidity of higher-dimensional Fano varieties. The main components of the method of maximal singularities are considered.

Effects of the exotic Crustacean, .i.Armadillidium vulgare./i. (Isopoda), and other macrofauna on organic matter dynamics in soil microcosms in a hardwood forest in central Florida

Czech Academy of Sciences Publication Activity Database

Frouz, Jan; Lobinske, R.J.; Kalčík, Jiří; Ali, A.

2008-01-01

Roč. 91, č. 2 (2008), s. 328-331 ISSN 0015-4040 Institutional research plan: CEZ:AV0Z60660521; CEZ:AV0Z6066911 Keywords : Armadillidium vulgare * organic matter dynamics * hardwood forest Subject RIV: EH - Ecology, Behaviour Impact factor: 0.886, year: 2008

The effect of oregano (Origanum vulgare) extract on prevention of S. ineae experimental infection in rainbow trout (Oncorhynchus mykiss)

OpenAIRE

Fakharzade, S.M.E.; Hghighi, M.; Sharif Rohani, M.; Sharifpoor, I.

2017-01-01

This study was performed in order to determine the effect of Oregano (Origanum vulgare) extract on Streptococcus ineae infection in rainbow trout. 063 rainbow trout weighing 15±1 gr were randomly allocated into three treatment groups with three repetition, including: 1) Control group, 2) Oregano extract treated group (1% of diet), 3) Felorfenicol treated group (10mg/kg fish), all feed one time a day for two weeks. At the end of the second week, 5 fish of each repetition collected and sampled ...

Proposta de reconhecimento de padrão de conforto em clientes com pênfigo vulgar utilizando a Lógica Fuzzy

Directory of Open Access Journals (Sweden)

Euzeli da Silva Brandao

2013-08-01

Full Text Available Propuesta de reconocimiento del estándar de comodidad en clientes con pénfigo vulgar utilizando la Lógica Fuzzy O objetivo é propor a Lógica Fuzzy para reconhecimento de padrões de conforto de pessoas submetidas a uma tecnologia de cuidar em Enfermagem por apresentarem pênfigo vulgar, uma doença cutâneo-mucosa rara que acomete principalmente adultos. A proposta aplicável em métodos experimentais com sujeitos submetidos à comparação quali-quantitativa (taxonomia/pertinência do padrão de conforto antes e depois da intervenção. Requer o registro em escala cromática correspondente à intensidade de cada atributo: dor; mobilidade e comprometimento da autoimagem. As regras Fuzzy estabelecidas pela máquina de inferência definem o padrão de conforto em desconforto máximo, mediano e mínimo, traduzindo a eficácia dos cuidados de Enfermagem. Apesar de pouco utilizada na área de Enfermagem, essa lógica viabiliza pesquisas sem dimensionamento a priori do número de sujeitos em função da estimação de parâmetros populacionais. Espera-se avaliação do padrão de conforto do cliente com pênfigo diante da tecnologia aplicada de forma personalizada, conduzindo a avaliação global.

Analytical characteristics of olive oils produced by two different extraction techniques, in Portuguese olive variety 'Galega Vulgar'

Directory of Open Access Journals (Sweden)

Vaz-Freire, Luís

2008-09-01

Full Text Available A metal hammer-decanter (HD olive processing line was compared to a traditional metal hammer-press (HP line, a discontinuous method which, when properly used, yields high-quality virgin olive oils. Galega olives (traditional Portuguese variety were used. Olives were picked at a predetermined maturation stage and plagues and oil content were evaluated before processing. Years, extraction technology, data replicates, and years*extraction, were taken into account and compared using statistical treatment. In spite of significant differences among the results obtained, only acidity was statistically significant and sufficient for classifying the produced olive oil into a lampante category.Se han comparado dos líneas de procesamiento de aceite, utilizando un sistema de prensas (SP o un decantador centrífugo (DC. El procesamiento que recurre al sistema de prensas es un sistema discontinuo que, sin embargo permite obtener aceites vírgenes de gran calidad. Para este estudio se ha utilizado la variedad Portuguesa Galega común. Las aceitunas fueron tratadas contra el ataque de plagas, y recogidas en un punto de maduración predeterminado. Del mismo modo, se evaluó el porcentaje de aceite obtenido de la cosecha. Se han considerado los resultados analíticos teniendo en cuenta la determinación de la influencia de la extracción en el producto final. Este punto ha sido evaluado por medio de un tratamiento estadístico. Aunque se han observado diferencias significativas entre los resultados de algunos de los parámetros analizados, sólo las diferencias verificadas en el grado de acidez son susceptibles de modificar la clasificación final del aceite, situándolo en la categoría lampante.

Archaeogenetic evidence of ancient nubian barley evolution from six to two-row indicates local adaptation.

Directory of Open Access Journals (Sweden)

Sarah A Palmer

Full Text Available BACKGROUND: Archaeobotanical samples of barley (Hordeum vulgare L. found at Qasr Ibrim display a two-row phenotype that is unique to the region of archaeological sites upriver of the first cataract of the Nile, characterised by the development of distinctive lateral bracts. The phenotype occurs throughout all strata at Qasr Ibrim, which range in age from 3000 to a few hundred years. METHODOLOGY AND FINDINGS: We extracted ancient DNA from barley samples from the entire range of occupancy of the site, and studied the Vrs1 gene responsible for row number in extant barley. Surprisingly, we found a discord between the genotype and phenotype in all samples; all the barley had a genotype consistent with the six-row condition. These results indicate a six-row ancestry for the Qasr Ibrim barley, followed by a reassertion of the two-row condition. Modelling demonstrates that this sequence of evolutionary events requires a strong selection pressure. CONCLUSIONS: The two-row phenotype at Qasr Ibrim is caused by a different mechanism to that in extant barley. The strength of selection required for this mechanism to prevail indicates that the barley became locally adapted in the region in response to a local selection pressure. The consistency of the genotype/phenotype discord over time supports a scenario of adoption of this barley type by successive cultures, rather than the importation of new barley varieties associated with individual cultures.

Comparing the performance of 11 crop simulation models in predicting yield response to nitrogen fertilization

DEFF Research Database (Denmark)

Salo, T J; Palosuo, T; Kersebaum, K C

2016-01-01

Eleven widely used crop simulation models (APSIM, CERES, CROPSYST, COUP, DAISY, EPIC, FASSET, HERMES, MONICA, STICS and WOFOST) were tested using spring barley (Hordeum vulgare L.) data set under varying nitrogen (N) fertilizer rates from three experimental years in the boreal climate of Jokioinen......, Finland. This is the largest standardized crop model inter-comparison under different levels of N supply to date. The models were calibrated using data from 2002 and 2008, of which 2008 included six N rates ranging from 0 to 150 kg N/ha. Calibration data consisted of weather, soil, phenology, leaf area...... ranged from 170 to 870 kg/ha. During the test year 2009, most models failed to accurately reproduce the observed low yield without N fertilizer as well as the steep yield response to N applications. The multi-model predictions were closer to observations than most single-model predictions, but multi...

Induced mutations for disease resistance in wheat and barley

International Nuclear Information System (INIS)

Hanis, M.; Hanisova, A.; Knytl, V.; Cerny, J.; Benc, S.

1977-01-01

The induction of mutations in cultivars of wheat (Triticum aestivum), barley (Hordeum vulgare), and field beans (Phaseolus vulgaris) has been part of the breeding programme at the Plant Breeding Station at Stupice since 1960. A total of 26 cultivars or selections of winter wheat, 4 cultivars or selections of spring wheat, 2 cultivars of field beans, and 43 selections of spring barley have been treated since 1960. A total of 140 mutant lines of wheat and 37 mutant lines of barley with improved disease resistance of a race-specific type have been obtained. Several mutation programme derived cultivars have been registered in Czechoslovakia (''Diamant'', ''Ametyst'', ''Favorit'', ''Hana'', ''Rapid'', and ''Atlas'' in barley, and ''Alfa'' in field beans), but none of them is a mutation for disease resistance. A series of mutants have been used in crossing programmes. Approaches to improve the efficiency of mutation breeding for disease resistance are suggested. (author)

Characterization of N-type glycosylation sites and glycan structures of Purple Acid Phosphatase Phytases from Wheat (Triticum aestivum L.)

DEFF Research Database (Denmark)

Dionisio, Giuseppe; Brinch-Pedersen, Henrik; Welinder, Karen Gjesing

2011-01-01

Wheat (Triticum aestivum L.) possesses preformed phytase activity in the grain that is essential to make phosphate available to cell metabolism and in food and feed (Brejnholt S. et al., 2011). Cereals contain the purple acid phosphatase type of phytases, PAPhy (Dionisio G. et al., 2011a). Mature......., Skov L. Brinch-Pedersen H. (2011). The degradation of phytate by microbial and wheat phytases is dependent on the phytate matrix and the phytase origin. J. Sci. Food Agri. (in press). Dionisio G., Madsen C.K., Holm P.B., Welinder K.G., Jørgensen M., Stoger E., Arcalis E., Brinch-Pedersen H. (2011a......) Cloning and Characterization of Purple Acid Phosphatase Phytases from Wheat (Triticum aestivum L.), Barley (Hordeum vulgare L.), Maize (Zea maize L.) and Rice (Oryza sativa L.). Plant Physiol. [in press, Jan 10, Epub ahead of print] Dionisio G., Brinch-Pedersen H., Welinder K.G., Jørgensen M. (2011b...

The Barley Magnesium Chelatase 150-kD Subunit Is Not an Abscisic Acid Receptor1[OA

Science.gov (United States)

Müller, André H.; Hansson, Mats

2009-01-01

Magnesium chelatase is the first unique enzyme of the chlorophyll biosynthetic pathway. It is composed of three gene products of which the largest is 150 kD. This protein was recently identified as an abscisic acid receptor in Arabidopsis (Arabidopsis thaliana). We have evaluated whether the barley (Hordeum vulgare) magnesium chelatase large subunit, XanF, could be a receptor for the phytohormone. The study involved analysis of recombinant magnesium chelatase protein as well as several induced chlorophyll-deficient magnesium chelatase mutants with defects identified at the gene and protein levels. Abscisic acid had no effect on magnesium chelatase activity and binding to the barley 150-kD protein could not be shown. Magnesium chelatase mutants showed a wild-type response in respect to postgermination growth and stomatal aperture. Our results question the function of the large magnesium chelatase subunit as an abscisic acid receptor. PMID:19176716

Application of the Kombucha 'tea fungus' for the enhancement of antioxidant and starch hydrolase inhibitory properties of ten herbal teas.

Science.gov (United States)

Watawana, Mindani I; Jayawardena, Nilakshi; Choo, Candy; Waisundara, Viduranga Y

2016-03-01

Ten herbal teas (Acacia arabica, Aegle marmelos flower, A. marmelos root bark, Aerva lanata, Asteracantha longifolia, Cassia auriculata, Hemidesmus indicus, Hordeum vulgare, Phyllanthus emblica, Tinospora cordifolia) were fermented with the Kombucha 'tea fungus'. The pH values of the fermented beverages ranged from 4.0 to 6.0 by day 7, while the titratable acidity ranged from 2.5 to 5.0g/mL (PKombucha beverages to have statistically significant increases (P<0.05) by day 7. The α-amylase inhibitory activities ranged from 52.5 to 67.2μg/mL in terms of IC50 values following fermentation, while the α-glucosidase inhibitory activities ranged from 95.2 to 196.1μg/mL. In conclusion, an enhancement of the antioxidant and starch hydrolase inhibitory potential of the herbal teas was observed by adding the tea fungus. Copyright © 2015 Elsevier Ltd. All rights reserved.

Micro-PIXE evaluation of Fe distribution in barley roots

International Nuclear Information System (INIS)

Schneider, T.; Povh, B.; Strasser, O.; Gierth, M.; Przybylowicz, W.; Mesjasz-Przybylowicz, J.; Churms, C.; Schuessler, A.

1999-01-01

High Fe concentrations were reported from roots of plants grown in soil. This has been discussed as a possible Fe source for plants, since the concentrations shown in the roots were much higher than in the shoots. There are, however, also some indications that soil contamination at the root surface of soil grown plants could have led to an overestimation of the Fe concentration in roots. Fe distribution in root cross sections of barley (Hordeum vulgare L. cv. Alexis) has been studied to investigate this hypothesis. Micro-PIXE analyses in point and mapping mode were complemented by the STIM technique. Based on the correlation between Fe and soil-related elements (Ti, Al and Si), most of Fe located at the root surface could be attributed to soil contamination. It could also be shown that this soil contamination leads to an overestimation of Fe concentration in roots. (author)

Characteristics of injury and recovery of net NO3- transport of barley seedlings from treatments of NaCl

Science.gov (United States)

Klobus, G.; Ward, M. R.; Huffaker, R. C.

1988-01-01

The nature of the injury and recovery of nitrate uptake (net uptake) from NaCl stress in young barley (Hordeum vulgare L, var CM 72) seedlings was investigated. Nitrate uptake was inhibited rapidly by NaCl, within 1 minute after exposure to 200 millimolar NaCl. The duration of exposure to saline conditions determined the time of recovery of NO3- uptake from NaCl stress. Recovery was dependent on the presence of NO3- and was inhibited by cycloheximide, 6-methylpurine, and cerulenin, respective inhibitors of protein, RNA, and sterol/fatty acid synthesis. These inhibitors also prevented the induction of the NO3- uptake system in uninduced seedlings. Uninduced seedlings exhibited endogenous NO3- transport activity that appeared to be constitutive. This constitutive activity was also inhibited by NaCl. Recovery of constitutive NO3- uptake did not require the presence of NO3-.

Enhanced quantitative resistance against fungal disease by combinatorial expression of different barley antifungal proteins in transgenic tobacco

DEFF Research Database (Denmark)

Jach, G; Görnhardt, B; Mundy, J

1995-01-01

cDNAs encoding three proteins from barley (Hordeum vulgare), a class-II chitinase (CHI), a class-II beta-1,3-glucanase (GLU) and a Type-I ribosome-inactivating protein (RIP) were expressed in tobacco plants under the control of the CaMV 35S-promoter. High-level expression of the transferred genes...... was detected in the transgenic plants by Northern and Western blot analysis. The leader peptides in CHI and GLU led to accumulation of these proteins in the intercellular space of tobacco leaves. RIP, which is naturally deposited in the cytosol of barley endosperm cells, was expressed either in its original...... cytosolic form or fused to a plant secretion peptide (spRIP). Fungal infection assays revealed that expression of the individual genes in each case resulted in an increased protection against the soilborne fungal pathogen Rhizoctonia solani, which infects a range of plant species including tobacco...

Establishment techniques in under-sown perennial ryegrass for seed production

DEFF Research Database (Denmark)

Deleuran, Lise C; Boelt, Birte

2009-01-01

Establishment methods have proven to be of major importance for grass-seed production. The objective of this research was to test the effect of different sowing techniques on plant establishment and the subsequent seed yield. Perennial ryegrass (Lolium perenne L.) is used as the model grass due...... to its large importance in Danish agriculture. In a three-year trial six different methods of under-sowing of perennial ryegrass in a spring barley cover crop were employed. Perennial ryegrass was either sown directly at different depths within the spring barley (Hordeum vulgare L.) rows or placed 2, 6......, or 12 cm from the spring barley rows. Results of dry-matter yield indicate that the best establishment of the grass occurred when placing the grass 6 or 12 cm from the cover-crop row, and this is of importance in less vigorous grasses. Overall, no seed-yield difference has been observed for perennial...

210Pb and 210Po in Finnish cereals

International Nuclear Information System (INIS)

Turtiainen, Tuukka; Kostiainen, Eila; Hallikainen, Anja

2011-01-01

A survey was carried out on the activity concentrations of 210 Pb and 210 Po in cereal grains produced in Finland. The cereal species were wheat (Triticum aestivum), rye (Secale cereale), oats (Avena sativa) and barley (Hordeum vulgare), which account for 90% of the Finnish consumption of cereal products. The survey consisted of 18 flour and 13 unprocessed cereal samples and one hulled grain sample from 22 flour mills. According to the results, the mean 210 Pb/ 210 Po concentrations in wheat grains, wheat flour, rye flour, oat grains and barley grains were 0.29, 0.12, 0.29, 0.36 and 0.36 Bq kg -1 , respectively. Combined with the consumption rates of the products, we assess that the mean effective doses from 210 Pb and 210 Po in cereal products for the adult male and female population are 22 and 17 μSv per year, respectively.

Avaliação biológica de Foeniculum vulgare (Mill. (Umbelliferae/Apiaceae Biological evaluation of Foeniculum vulgare (Mill. (Umbelliferae/Apiaceae

Directory of Open Access Journals (Sweden)

O. Araujo R

2013-01-01

Full Text Available Foeniculum vulgare Mill. é espécie herbácea da família Umbelliferae, nativa da região do Mediterrâneo e da Ásia Menor, amplamente distribuída em todo o território brasileiro. É conhecida popularmente como funcho ou erva-doce e usada na medicina como analgésico, digestivo, carminativo, diurético, expectorante, lactígeno, anti-inflamatório, e antiespasmódico. O extrato bruto etanólico para a verificação das atividades biológicas foi preparado a partir de sementes compradas no comércio. Para a realização do perfil fitoquímico foi utilizada a cromatografia em camada delgada analítica; a atividade antimicrobiana foi determinada pelo teste de difusão em disco de papel e da concentração inibitória mínima (CIM; a atividade antinociceptiva foi realizada pelo método de contorções abdominais em cobaias. Os micro-organismos testados foram isolados clínicos multirresistentes obtidos do Setor de Bacteriologia do Hospital das Clínicas de Pernambuco. O estudo fitoquímico identificou a maioria dos compostos secundários presentes na fração metanólica das sementes, sendo eles: triterpenos, glicosídeos de flavanóides, terpenos menores (monoterpenóides, sesquiterpenóide e diterpenóides, e açúcares redutores. Os resultados obtidos mostraram que o extrato etanólico apresentou maior atividade frente à Micrococcus spp. (CIM=250µg/mL. Os resultados da avaliação da atividade antinociceptiva demonstraram que apenas a dosagem de 298 mg/Kg quando comparado com o padrão indometacina conseguiu uma redução significativa no número de contorções abdominais dos animais. Estudos posteriores deverão ser realizados para a identificação e isolamento de alguns compostos secundários, bem como a realização de outros protocolos de analgesia.Foeniculum vulgare Mill. (Umbelliferae is a herbaceous plant of the family Umbelliferae, native to the Mediterranean and Asia Minor region and widely distributed all over the Brazilian

Antioxidant and antimicrobial activity in the seeds of Origanum vulgare L. subsp. gracile (C. Koch Ietswaart and Origanum acutidens (Hand.-Mazz. Ietswaart from Turkey

Directory of Open Access Journals (Sweden)

Erecevit, P.

2011-12-01

Full Text Available The present study determined some biological compounds (fatty acids, vitamins, sterols and flavonoids, radical scavenging capacity and antimicrobial activity of two Origanum L. species of Origanum vulgare L. subsp. gracile (C. Koch Ietswaart and Origanum acutidens (Hand.-Mazz.. Ietswaart. Linolenic acid was found to be the main fatty acid in both species, which was followed by palmitic acid (C16:0, stearic acid (C18:0, oleic acid (C18:1 n9, linoleic acid (C18:2 n6 and stearidonic acid (C18:4. In addition, the two Origanum species were recorded as containing high levels of stigmasterol. It was also found that Origanum vulgare L. subsp. gracile (C. Koch Ietswaart had a high β-sitosterol content (152.8±2.6 µg/g; high amounts of D3 (33.1±0.8 µg/g, K1 (29.4±0.8 µg/g, K2 (26.0±0.8 µg/g vitamins; and low amounts of α-tocopherol (7.8±0.2 µg/g and D2 (1.8±0.1 µg/g, while Origanum acutidens (Hand.-Mazz. Ietswaart contained high amounts of D2 (42.9±1.5 µg/g vitamin; and low amounts of D3 (2.9±0.1 µg/g, α-tocopherol (3.1±0.1 µg/g, r-tocopherol (3.5±0.2 µg/g, K2 (1.3±0.1 µg/g, retinol (1.3±0.2 µg/g and retinol acetate (1.2±0.1 µg/g vitamins. The present study showed that Origanum vulgare L. subsp. gracile (C. Koch Ietswaart and Origanum acutidens (Hand.-Mazz. Ietswaart contained the lowest amount of flavonoid. Furthermore, methanol extracts were recorded to be the most effective agent against the DPPH radical in both Origanum L. species examined. Experimental results showed that the vitamins, flavonoids and fatty acid extracts of both Origanum L. species were effective in the inhibition of the growth of the tested microorganisms at varying levels.En el presente estudio se han determinado algunos compuestos biológicos (ácidos grasos, vitaminas, esteroles y flavonoides, la capacidad de secuestrar radicales libres y la actividad antimicrobiana de dos especies de orégano, Origanum vulgare L. subsp. gracile (C. Koch Ietswaart y

Trace elements and essential oil composition in chemotypes of the aromatic plant Origanum vulgare

International Nuclear Information System (INIS)

Kanias, G.D.

1998-01-01

Trace elements, essential oil yield and its percentage composition were determined by neutron activation analysis, hydrodistillation and gas chromatography in two chemotypes of Origanum vulgare L. cultivated in the same field. Statistical tests such as analysis of variance, correlation coefficient, t-test, and multiple correlation were applied. The results showed that the samples contain the highest recorded oil yield for aromatic plants. Also, there is a statistically significant difference between the chemotypes of the plant not only in the predominant compound but in a number of other components. Iron, chromium and scandium showed a negative significant correlation with carvacrol and a positive one with thymol. Europium shows characteristic correlations with chromium, cobalt, iron and scandium within each chemotype of the plant. These correlations could make probable a role of this element in the biosynthesis of the predominant compounds. (author)

[Does the sampling locality influence on the antifungal activity of the flavonoids of Marrubium vulgare against Aspergillus niger and Candida albicans?].

Science.gov (United States)

Bouterfas, K; Mehdadi, Z; Aouad, L; Elaoufi, M M; Khaled, M B; Latreche, A; Benchiha, W

2016-09-01

The study was undertaken to determine the effect of the sampling locality on the antifungal activity of the flavonoids extracted from the leaves of Marrubium vulgare L. against two fungal strains; Aspergillus niger ATCC 16404 and Candida albicans ATCC 10231. The leaves were collected from three different sampling localities belonging northwest Algeria: Tessala mount, M'sila forest and Ain Skhouna. The flavonoid extraction was carried out by using organic solvents with increasing polarity. A phytochemical screening was performed by staining test tubes. The inhibition diameters were measured by solid medium diffusion method. The minimum inhibitory concentrations were determined by dilution method on solid medium. The antifungal activity varied significantly (Pflavonoid extract and its concentration, and the strain fungal type. The inhibition diameters varied between 8.16 and recorded 37.5mm even recording a total inhibition of fungal growth and often exceed those induced marketed antifungals (Amphotericin, Fluconazole, Terbinafine and econazole nitrate). The minimum inhibitory concentrations (MICs) obtained range between 6.25 and 100μg/mL; experiencing strong antifungal inhibition. The phytochemical screening revealed the existence of certain flavonoids classes such as flavans and flavanols which may be responsible of this remarkable antifungal power. The sampling locality of Marrubium vulgare leaves influenced on the antifungal activity of flavonoids. These have proven very good fungistatic and worth valuing in pharmacology. Copyright © 2016 Elsevier Masson SAS. All rights reserved.

Neuroprotective Effects of Herbal Extract (Rosa canina, Tanacetum vulgare and Urtica dioica) on Rat Model of Sporadic Alzheimer’s Disease

Science.gov (United States)

Daneshmand, Parvaneh; Saliminejad, Kioomars; Dehghan Shasaltaneh, Marzieh; Kamali, Koorosh; Riazi, Gholam Hossein; Nazari, Reza; Azimzadeh, Pedram; Khorram Khorshid, Hamid Reza

2016-01-01

Background: Sporadic Alzheimer’s Disease (SAD) is caused by genetic risk factors, aging and oxidative stresses. The herbal extract of Rosa canina (R. canina), Tanacetum vulgare (T. vulgare) and Urtica dioica (U. dioica) has a beneficial role in aging, as an anti-inflammatory and anti-oxidative agent. In this study, the neuroprotective effects of this herbal extract in the rat model of SAD was investigated. Methods: The rats were divided into control, sham, model, herbal extract -treated and ethanol-treated groups. Drug interventions were started on the 21st day after modeling and each treatment group was given the drugs by intraperitoneal (I.P.) route for 21 days. The expression levels of the five important genes for pathogenesis of SAD including Syp, Psen1, Mapk3, Map2 and Tnf-α were measured by qPCR between the hippocampi of SAD model which were treated by this herbal extract and control groups. The Morris Water Maze was adapted to test spatial learning and memory ability of the rats. Results: Treatment of the rat model of SAD with herbal extract induced a significant change in expression of Syp (p=0.001) and Psen1 (p=0.029). In Morris Water Maze, significant changes in spatial learning seen in the rat model group were improved in herbal-treated group. Conclusion: This herbal extract could have anti-dementia properties and improve spatial learning and memory in SAD rat model. PMID:27563424

Bio-efficacy of the essential oil of oregano (Origanum vulgare Lamiaceae. Ssp. Hirtum).

Science.gov (United States)

Grondona, Ezequiel; Gatti, Gerardo; López, Abel G; Sánchez, Leonardo Rodolfo; Rivero, Virginia; Pessah, Oscar; Zunino, María P; Ponce, Andrés A

2014-12-01

The aim of this study was to investigate the bioactivity of the essential oil isolated from Origanum vulgare L. (EOv). We analyzed the in vivo anti-inflammatory properties in a mouse-airway inflammation model and the in vitro antimicrobial activity, genotoxicity over the anaphase-telophase with the Allium cepa strain and its cytotoxicity/viability in A549 culture cells. In vivo, EOv modified the levels of tumor necrosis factor -α and viable activated macrophages and was capable to mitigate the effects of degradation of conjugated dienes. In vitro, EOv reduced the viability of cultured A549 cells as well as the mitotic index and a number of chromosomal aberrations; however, it did not change the number of phases. We found that EOv presents antimicrobial activity against different Gram (-) and (+) strains, measured by disc-diffusion test and confirmed with a more accurate method, the AutoCad software. We postulate that EOv presents antibacterial, antioxidant and chemopreventive properties and could be play an important role as bioprotector agent.

Layered double hydroxide films on nanoporous anodic aluminum oxide/aluminum wire: a new fiber for rapid analysis of Origanum vulgare essential oils.

Science.gov (United States)

Piryaei, Marzieh

2018-01-01

Zn/Al layered double hydroxide (LDH) films were fabricated in situ with anodic aluminium oxide aluminium as both the substrate and the sole aluminium source by means of urea hydrolysis. Headspace solid phase microextraction using LDH fibre in combination with capillary GC-MS was utilised as a monitoring technique for the collection and detection of the volatile compounds of Origanum vulgare. Experimental parameters, including the sample weight, microwave power, extraction time and humidity effect, were examined and optimised.

Effect of low doses of gamma radiation on barley's (Hordeum Vulgare L.) susceptibility to cochliobolus sativus

International Nuclear Information System (INIS)

Jawher, M.; Arabi, I. E.

1998-03-01

Two barley genotypes (Tadmor, W12291), and one promising line selected in AECS (76) were exposed to 60 cobalt gamma radiation. The doses used were: 0, 10, 15, 20, 30, 40 and 50 Gy. Susceptibility assessments were scored using a rating scale extending from 1 (highly resistant) to 5 (very susceptible) according to the percentage of infected area at subcrown interodes. In general, doses of 10, 15, 20 and 30 Gy increased the resistance to the pathogen Cochliobolus sativus by 56.29%, 58.29%, 54.57% and 49.71% respectively. The genotypes did not response similarly to the irradiation. The best response was obtained with c.v Tadmor. (author)

Durable resistance to net blotch and agronomic performance in some barley mutants [Hordeum vulgare L.; Syria

International Nuclear Information System (INIS)

Arabi, M.I.E.

2004-01-01

Seeds from the net blotch (Pyrenophora teres) susceptible cultivar Thibaut were treated by gamma ray radiation and subsequently evaluated for reaction to the pathogen in the M2-M5 generations. Grain yield and agronomic characteristics of putative mutants were compared with Thibaut in two different locations. Genetic variation among some mutant lines/cv Thibaut was estimated using Amplified Fragment Length Polymorphism (AFLP) markers. Sixteen mutant lines and their mother cultivar Thibaut were analyzed with 14 EcoR1-Mse1 primer combinations. A total number of 504 AFLP bands were analyzed for each pair mutant/Thibaut. Narrow genetic variation among all genotypes was detected with an average of genetic similarity of 0.96. Cluster analysis with the entire AFLP data divided all genotypes into two major groups. The resistant mutant lines were grouped in one subcluster with 0.98 similarity index. Some resistant mutant lines to net blotch with good agronomic performances were produced [it

Modification of mutation process in radiated seeds oat (Avena sativa L.) and barley (Hordeum vulgare L.)

International Nuclear Information System (INIS)

Shishlov, M.P.

2007-01-01

The results of a long-term investigations for experimental mutagenesis of oats and barley are reported in the article. It was found the problem of modification of a mutant process to spread spectrum and increase the general induction frequency and display of macro- and micro mutations. Application as modificators of salts the heavy metals, inhibitors of nuclein, protein synthesis and energy returned processes and also doses spectrum and its strength of gamma-radiation and ultrasound allowed to increase the general frequency of mutant induction of barley and oats on 1-2 order. On the base of evaluation of correlative links between the attributes variability in M1 and M2 generations it was formulated a conception of guarantied creation of mutant forms of the grain crops. (authors)

Localising QTLs for leaf rust resistance and agronomic traits in barley (¤Hordeum vulgare¤ L.)

DEFF Research Database (Denmark)

Kicherer, S.; Backes, G.; Walther, U.

2000-01-01

to leaf rust by means of artificial infection, heading date, plant height and Kernel weight were assessed. For leaf rust resistance, 4 QTLs were localised, that explained 96.1% of the genetic variation. One QTL on chromosome 4H confirmed a position found in another genetic background and one mapped...

Can barley (Hordeum vulgare L. s.l.) adapt to fast climate changes? A controlled selection experiment

DEFF Research Database (Denmark)

Alemayehu, Fikadu Reta; Frenck, Georg; van der Linden, Leon

2013-01-01

to environmental stress, we conducted a selection experiment over five plant generations (G0–G4) in three scenarios, where atmospheric [CO2] and temperature were increased as single factors and in combination. The treatments represented the expected environmental characteristics in Northern Europe around year 2075...... to environmental change needs to be explored in order to select the most productive genotypes. Presently, it is unknown whether cereal crops like spring barley can adapt to climate stressors over relatively few generations. To evaluate if strong selection pressures could change the performance of barley......, the G4-generation of selected plants did not improve its reproductive output compared to the G0-generation, as G4 produced less seeds and had a lower yield than unselected plants. These results indicate that barley might not respond positively to rapid and strong selection by elevated [CO2...

Armadillidin H, a glycine-rich peptide from the terrestrial crustacean Armadillidium vulgare, displays an unexpected wide antimicrobial spectrum with membranolytic activity.

Directory of Open Access Journals (Sweden)

Julien Verdon

2016-09-01

Full Text Available Antimicrobial peptides (AMPs are key components of innate immunity and are widespread in nature, from bacteria to vertebrate animals. In crustaceans, there are currently 15 distinct AMP families published so far in the literature, mainly isolated from members of the Decapoda order. Up to now, armadillidin is the sole non-decapod AMP isolated from the haemocytes of Armadillidium vulgare, a crustacean isopod. Its first description demonstrated that armadillidin is a linear glycine-rich (47% cationic peptide with an antimicrobial activity directed towards Bacillus megaterium. In the present work, we report identification of armadillidin Q, a variant of armadillidin H (earlier known as armadillidin, from crude haemocyte extracts of A. vulgare using LC-MS approach. We demonstrated that both armadillidins displayed broad spectrum antimicrobial activity against several Gram-positive and Gram negative bacteria, fungi, but were totally inactive against yeasts. Membrane permeabilization assays, only performed with armadillidin H, showed that the peptide is membrane active against bacterial and fungal strains leading to deep changes in cell morphology. This damaging activity visualized by electronic microscopy correlates with a rapid decrease of cell viability leading to highly blebbed cells. In contrast, armadillidin H does not reveal cytotoxicity towards human erythrocytes. Furthermore, no secondary structure could be defined in this study (by CD and NMR even in a membrane mimicking environment. Therefore, armadillidins represent interesting candidates to gain insight into the biology of glycine-rich AMPs.

Genomic and transcriptomic alterations following intergeneric hybridization and polyploidization in the Chrysanthemum nankingense×Tanacetum vulgare hybrid and allopolyploid (Asteraceae).

Science.gov (United States)

Qi, Xiangyu; Wang, Haibin; Song, Aiping; Jiang, Jiafu; Chen, Sumei; Chen, Fadi

2018-01-01

Allopolyploid formation involves two major events: interspecific hybridization and polyploidization. A number of species in the Asteraceae family are polyploids because of frequent hybridization. The effects of hybridization on genomics and transcriptomics in Chrysanthemum nankingense×Tanacetum vulgare hybrids have been reported. In this study, we obtained allopolyploids by applying a colchicine treatment to a synthesized C. nankingense × T. vulgare hybrid. Sequence-related amplified polymorphism (SRAP), methylation-sensitive amplification polymorphism (MSAP), and high-throughput RNA sequencing (RNA-Seq) technologies were used to investigate the genomic, epigenetic, and transcriptomic alterations in both the hybrid and allopolyploids. The genomic alterations in the hybrid and allopolyploids mainly involved the loss of parental fragments and the gain of novel fragments. The DNA methylation level of the hybrid was reduced by hybridization but was restored somewhat after polyploidization. There were more significant differences in gene expression between the hybrid/allopolyploid and the paternal parent than between the hybrid/allopolyploid and the maternal parent. Most differentially expressed genes (DEGs) showed down-regulation in the hybrid/allopolyploid relative to the parents. Among the non-additive genes, transgressive patterns appeared to be dominant, especially repression patterns. Maternal expression dominance was observed specifically for down-regulated genes. Many methylase and methyltransferase genes showed differential expression between the hybrid and parents and between the allopolyploid and parents. Our data indicate that hybridization may be a major factor affecting genomic and transcriptomic changes in newly formed allopolyploids. The formation of allopolyploids may not simply be the sum of hybridization and polyploidization changes but also may be influenced by the interaction between these processes.

The draft genome of Tibetan hulless barley reveals adaptive patterns to the high stressful Tibetan Plateau.

Science.gov (United States)

Zeng, Xingquan; Long, Hai; Wang, Zhuo; Zhao, Shancen; Tang, Yawei; Huang, Zhiyong; Wang, Yulin; Xu, Qijun; Mao, Likai; Deng, Guangbing; Yao, Xiaoming; Li, Xiangfeng; Bai, Lijun; Yuan, Hongjun; Pan, Zhifen; Liu, Renjian; Chen, Xin; WangMu, QiMei; Chen, Ming; Yu, Lili; Liang, Junjun; DunZhu, DaWa; Zheng, Yuan; Yu, Shuiyang; LuoBu, ZhaXi; Guang, Xuanmin; Li, Jiang; Deng, Cao; Hu, Wushu; Chen, Chunhai; TaBa, XiongNu; Gao, Liyun; Lv, Xiaodan; Abu, Yuval Ben; Fang, Xiaodong; Nevo, Eviatar; Yu, Maoqun; Wang, Jun; Tashi, Nyima

2015-01-27

The Tibetan hulless barley (Hordeum vulgare L. var. nudum), also called "Qingke" in Chinese and "Ne" in Tibetan, is the staple food for Tibetans and an important livestock feed in the Tibetan Plateau. The diploid nature and adaptation to diverse environments of the highland give it unique resources for genetic research and crop improvement. Here we produced a 3.89-Gb draft assembly of Tibetan hulless barley with 36,151 predicted protein-coding genes. Comparative analyses revealed the divergence times and synteny between barley and other representative Poaceae genomes. The expansion of the gene family related to stress responses was found in Tibetan hulless barley. Resequencing of 10 barley accessions uncovered high levels of genetic variation in Tibetan wild barley and genetic divergence between Tibetan and non-Tibetan barley genomes. Selective sweep analyses demonstrate adaptive correlations of genes under selection with extensive environmental variables. Our results not only construct a genomic framework for crop improvement but also provide evolutionary insights of highland adaptation of Tibetan hulless barley.

Green manuring effect of pure and mixed barley - hairy vetch winter cover crops on maize and processing tomato N nutrition

DEFF Research Database (Denmark)

Tosti, Giacomo; Benincasa, Paolo; Farneselli, Michela

2012-01-01

this can influence the N uptake and N status of different subsequent summer cash crops. In this study the N effect of barley (Hordeum vulgare L.) and hairy vetch (Vicia villosa Roth.) grown in pure stands or in mixtures with different sowing proportion was tested on maize (Zea Mays L.) and processing......Adopting mixtures between legumes and non legumes can be an efficient tool to merge the advantages of the single species in the fall-sown cover crop practice. Nevertheless there is a lack of information on how the species proportion may affect N accumulation and C/N of the cover crops and how...... of the relationship between cover crop C/N and Neff was confirmed, so mixtures can be used to adjust the extent and timing of mineralisation of the incorporated biomass to the subsequent cash crop requirements. Prediction of the cash crops N status on the cover crop C/N appears to be a useful approach, but, it may...

Effects of Single and Multifactor Treatments with Elevated Temperature, CO2 and Ozone on Oilseed Rape and Barley

DEFF Research Database (Denmark)

Clausen, Sabine Karin; Frenck, Georg; van der Linden, Leon Gareth

2011-01-01

We investigated the effect of elevated [CO2], [O3] and temperature on plant productivity and if these climate factors interacted with each other in multifactor treatments. The climate effects were studied in 14 different cultivars/lines of European spring oilseed rape (Brassica napus L.) and spring...... barley (Hordeum vulgare L.). Seven genotypes of each species were cultivated in six single- and multifactor treatments with ambient or elevated CO2 (385 ppm and 700 ppm), O3 (20 ppb and 60 ppb) and temperature (12/19 °C and 17/24 °C). Growth and production parameters were measured. Elevated CO2 increased....... A significantly decreased yield and thousand grain weight was also seen in barley due to elevated O3. The multifactor combination of elevated CO2, O3 and temperature showed a decrease in growth and production in the two species, though not statistically significant for all parameters. This trend suggests...

MILDEW LOCUS O Mutation Does Not Affect Resistance to Grain Infections with Fusarium spp. and Ramularia collo-cygni.

Science.gov (United States)

Hofer, Katharina; Linkmeyer, Andrea; Textor, Katharina; Hückelhoven, Ralph; Hess, Michael

2015-09-01

MILDEW LOCUS O defines a major susceptibility gene for powdery mildew, and recessive mlo resistance alleles are widely used in breeding for powdery mildew resistance in spring barley. Barley powdery mildew resistance, which is conferred by mlo genes, is considered to be costly in terms of spontaneous defense reactions and enhanced susceptibility to cell-death-inducing pathogens. We assessed fungal infestation of barley (Hordeum vulgare) grain by measuring fungal DNA after natural infection with Fusarium spp. and Ramularia collo-cygni or after inoculation with Fusarium spp. in the field. Powdery-mildew-resistant mlo5 genotypes did not show enhanced Fusarium spp. or R. collo-cygni DNA content of grain over four consecutive years. Data add to our understanding of pleiotropic effects of mlo-mediated powdery mildew resistance and contributes to the discussion of whether or not application of barley mlo mutations may support pathogenesis of cell-death-inducing fungal pathogens under field conditions.

Possible evidence for transport of an iron cyanide complex by plants

International Nuclear Information System (INIS)

Samiotakis, M.; Ebbs, S.D.

2004-01-01

Barley (Hordeum vulgare L.), oat (Avena sativa L.), and wild cane (Sorghum bicolor L.), were exposed to 15 N-labeled ferrocyanide to determine whether these plant species can transport this iron cyanide complex. Plants were treated with ferrocyanide in a nutrient solution that simulated iron cyanide contaminated groundwater and soil solutions. This nutrient solution has been shown to maintain ferrocyanide speciation with minimal dissociation to free cyanide. Following treatment, all three plants showed dramatic enrichments in roots (δ 15 N%o=1000-1500) and shoots (δ 15 N%o=500). Barley and oat showed enrichment primarily in roots while wild cane showed a near equal enrichment in root and shoot tissues. Nitrogen-deficient barley plants treated with ferrocyanide showed a significantly greater 15 N enrichment as compared to nitrogen-sufficient plants. While the results are suggestive of ferrocyanide transport by these plant species, additional study will be required to verify these results. - Results suggest ferrocyanide transport by barley, oat and wild cane

Possible evidence for transport of an iron cyanide complex by plants

Energy Technology Data Exchange (ETDEWEB)

Samiotakis, M.; Ebbs, S.D

2004-01-01

Barley (Hordeum vulgare L.), oat (Avena sativa L.), and wild cane (Sorghum bicolor L.), were exposed to {sup 15}N-labeled ferrocyanide to determine whether these plant species can transport this iron cyanide complex. Plants were treated with ferrocyanide in a nutrient solution that simulated iron cyanide contaminated groundwater and soil solutions. This nutrient solution has been shown to maintain ferrocyanide speciation with minimal dissociation to free cyanide. Following treatment, all three plants showed dramatic enrichments in roots ({delta} {sup 15}N%o=1000-1500) and shoots ({delta} {sup 15}N%o=500). Barley and oat showed enrichment primarily in roots while wild cane showed a near equal enrichment in root and shoot tissues. Nitrogen-deficient barley plants treated with ferrocyanide showed a significantly greater {sup 15}N enrichment as compared to nitrogen-sufficient plants. While the results are suggestive of ferrocyanide transport by these plant species, additional study will be required to verify these results. - Results suggest ferrocyanide transport by barley, oat and wild cane.

The genetics of indirect ecological effects - plant parasites and aphid herbivores

Directory of Open Access Journals (Sweden)

Jennifer K Rowntree

2014-04-01

Full Text Available When parasitic plants and aphid herbivores share a host, both direct and indirect ecological effects (IEEs can influence evolutionary processes. We used a hemiparasitic plant (Rhinanthus minor, a grass host (Hordeum vulgare and a cereal aphid (Sitobion avenae to investigate the genetics of IEEs between the aphid and the parasitic plant, and looked to see how these might affect or be influenced by the genetic diversity of the host plants. Survival of R. minor depended on the parasite’s population of origin, the genotypes of the aphids sharing the host and the genetic diversity in the host plant community. Hence the indirect effects of the aphids on the parasitic plants depended on the genetic environment of the system. Here, we show that genetic variation can be important in determining the outcome of IEEs. Therefore, IEEs have the potential to influence evolutionary processes and the continuity of species interactions over time.

Vacuolar Localization of Endoproteinases EP(1) and EP(2) in Barley Mesophyll Cells.

Science.gov (United States)

Thayer, S S; Huffaker, R C

1984-05-01

The localization of two previously characterized endoproteinases (EP(1) and EP(2)) that comprise more than 95% of the protease activity in primary Hordeum vulgare L. var Numar leaves was determined. Intact vacuoles released from washed mesophyll protoplasts by gentle osmotic shock and increase in pH, were purified by flotation through a four-step Ficoll gradient. These vacuoles contained endoproteinases that rapidly degraded purified barley ribulose-1,5-bisphosphate carboxylase (RuBPCase) substrate. Breakdown products and extent of digestion of RuBPCase were determined using 12% polyacrylamide-sodium dodecyl sulfate gels. Coomassie brilliant blue- or silver-stained gels were scanned, and the peaks were integrated to provide quantitative information. The characteristics of the vacuolar endoproteinases (e.g. sensitivity to various inhibitors and activators, and the molecular weights of the breakdown products, i.e. peptide maps) closely resembled those of purified EP(1) and partially purified EP(2). It is therefore concluded that EP(1) and EP(2) are localized in the vacuoles of mesophyll cells.

Rhizodeposition of N by pea and barley and its effect on soil N dynamics

DEFF Research Database (Denmark)

Jensen, E.S.

1996-01-01

Rhizodeposition of N during plant growth influences the microbial activity in the rhizosphere and constitutes a source of labile organic N, but has not been quantified to the same degree as the rhizodeposition of C. The rhizodeposition of N, defined as root-derived N present in the soil after...... removal of visible roots and root fragments, was determined during field pea (Pisum sativum L.) and spring barley (Hordeum vulgare L.) growth in a sandy soil at a low concentration of mineral N using a continuous split-root N-15-labelling technique. The N rhizodeposition constituted 15 and 48......% of the below-ground N in pea when determined 7 and 14 (maturity) wk after planting (WAP), respectively. In barley 32 and 71% of the below-ground N were present in rhizodeposits at the two samplings. At maturity the rhizodeposition of N amounted to 19 mg N plant(-1) (7% of total plant N) for pea and 17 mg N...

Differences in the diurnal pattern of soil respiration under adjacent Miscanthus x giganteus and barley crops reveal potential flaws in accepted sampling strategies

Science.gov (United States)

Keane, James; Ineson, Phil

2017-04-01

Soil respiration (Rs) plays an important role in the global carbon cycle and contributes ca. 30% of global ecosystem respiration.However, for convenience, measurements used to compare Rs from different land uses, crops or management practices are often made between 09:00 and 16:00, with an implicit assumption that Rs is largely controlled by temperature. Three months' continuous data presented here show distinctly different diurnal patterns of Rs between barley (Hordeum vulgare) and Miscanthus x giganteus (Miscanthus) grown on adjacent fields. Maximum Rs in barley occurred during the afternoon and correlated with soil temperature, whereas Rs peaked in Miscanthus during the night and was significantly correlated with earlier levels of solar radiation, probably due to delays in translocation of recent photosynthate. Since daily mean Rs in Miscanthus coincided with levels 40% greater than the mean in barley, it is vital to select appropriate times to measure Rs if only single daily measurements are to be made.

Intercropping effect on root growth and nitrogen uptake at different nitrogen levels

DEFF Research Database (Denmark)

Ramirez-Garcia, Javier; Martens, Helle Juel; Quemada, Miguel

2015-01-01

of root growth and N foraging for barley (Hordeum vulgare L.) and vetch (Vicia sativa L.), frequently grown in mixtures as cover crops. N was added at 0 (N0), 50 (N1) and 150 (N2) kg N ha−1. The roots discrimination relying on the anatomical and morphological differences observed between dicots......Aims Intercropping legumes and non-legumes may affect the root growth of both components in the mixture, and the non-legume is known to be strongly favored by increasing nitrogen (N) supply. The knowledge of how root systems affect the growth of the individual species is useful for understanding...... the interactions in intercrops as well as for planning cover cropping strategies. The aim of this work was (i) to determine if different levels of N in the topsoil influence root depth (RD) and intensity of barley and vetch as sole crops or as an intercropped mixture and (ii) to test if the choice of a mixture...

Nitrogen immobilization and mineralization during initial decomposition of 15N-labelled pea and barley residues

DEFF Research Database (Denmark)

Jensen, E.S.

1997-01-01

The immobilization and mineralization of N following plant residue incorporation were studied in a sandy loam soil using N-15-labelled field pea (Pisum sativum L.) and spring barley (Hordeum vulgare L.) straw. Both crop residues caused a net immobilization of soil-derived inorganic N during...... the complete incubation period of 84 days. The maximum rate of N immobilization was found to 12 and 18 mg soil-derived N g(-1) added C after incorporation of pea and barley residues, respectively. After 7 days of incubation, 21% of the pea and 17% of the barley residue N were assimilated by the soil microbial...... the decomposition of the barley residue. The net mineralization of residue-derived N was 2% in the barley and 22% in the pea residue treatment after 84 days of incubation. The results demonstrated that even if crop residues have a relative low C/N ratio (15), transient immobilization of soil N in the microbial...

The comparison of nitrogen use and leaching in sole cropped versus intercropped pea and barley

DEFF Research Database (Denmark)

Hauggaard-Nielsen, H.; Ambus, P.; Jensen, E.S.

2003-01-01

The effect of sole and intercropping of field pea (Pisum sativum L.) and spring barley (Hordeum vulgare L.) and of crop residue management on crop yield, NO3- leaching and N balance in the cropping system was tested in a 2-year lysimeter experiment on a temperate sandy loam soil. The crop rotation...... cropping. Crops received no fertilizer in the experimental period. Natural N-15 abundance techniques were used to determine pea N-2 fixation. The pea-barley intercrop yielded 4.0 Mg grain ha(-1), which was about 0.5 Mg lower than the yields of sole cropped pea but about 1.5 Mg greater than harvested...... was pea and barley sole and intercrops followed by winter-rye and a fallow period. The Land Equivalent Ratio (LER), which is defined as the relative land area under sole crops that is required to produce the yields achieved in intercropping, was used to compare intercropping performance relative to sole...

Isolation and characterization of the gene encoding the starch debranching enzyme limit dextrinase from germinating barley

DEFF Research Database (Denmark)

Kristensen, Michael; Lok, Finn; Planchot, Véronique

1999-01-01

with a value of 105 kDa estimated by SDS;;PAGE, The coding sequence is interrupted by 26 introns varying in length from 93 bp to 825 bp. The 27 exons vary in length from 53 bp to 197 bp. Southern blot analysis shows that the limit dextrinase gene is present as a single copy in the barley genome. Gene......The gene encoding the starch debranching enzyme limit dextrinase, LD, from barley (Hordeum vulgare), was isolated from a genomic phage library using a barley cDNA clone as probe. The gene encodes a protein of 904 amino acid residues with a calculated molecular mass of 98.6 kDa. This is in agreement...... expression is high during germination and the steady state transcription level reaches a maximum at day 5 of germination. The deduced amino acid sequence corresponds to the protein sequence of limit dextrinase purified from germinating malt, as determined by automated N-terminal sequencing of tryptic...

Water mobility in the endosperm of high beta-glucan barley mutants as studied by nuclear magnetic resonance imaging

DEFF Research Database (Denmark)

Seefeldt, Helene Fast; van den Berg, Frans W.J.; Köckenberger, Walter

2007-01-01

1H NMR imaging (MRI) was used as a noninvasive technique to study water distribution and mobility in hydrated barley (Hordeum vulgare L.) seeds of accessions with varying content of beta glucan (BG), a highly hygroscopic cell wall component. High contents of BG in barley are unfavorable in malting...... where it leads to clotting of filters and hazing of beer as well as in animal feed where it hinders the rapid uptake of energy. However, a high content of BG has a positive nutritional effect, as it lowers the cholesterol and the glycaemic index. It was studied whether water distribution and mobility...... were related to content and location of BG. Water mobility was investigated by following the rate and mode of desiccation in hydrated single seeds. In order to determine the different water components, a multispin echo experiment was set up to reveal the T2 transverse relaxation rates of water within...

Biochar amendment to coarse sandy subsoil improves root growth and increases water retention

DEFF Research Database (Denmark)

Bruun, Esben; Petersen, C. T.; Hansen, E.

2014-01-01

Crop yields and yield potentials on Danish coarse sandy soils are strongly limited due to restricted root growth and poor water and nutrient retention. We investigated if biochar amendment to subsoil can improve root development in barley and significantly increase soil water retention. Spring...... barley (Hordeum vulgare cv. Anakin) was grown in soil columns (diameter: 30 cm) prepared with 25 cm topsoil, 75 cm biochar-amended subsoil, and 30 cm un-amended subsoil lowermost placed on an impervious surface. Low-temperature gasification straw-biochar (at 0, 0.50, 1.0, 2.0, and 4.0 wt%) and slow...... pyrolysis hardwood-biochar (at 2 wt%) were investigated. One wt% can be scaled up to 102 Mg/ha of char. After full irrigation and drainage, the in-situ moisture content at 30-80 cm depth increased linearly (R2 = 0.99) with straw-biochar content at a rate corresponding to 0.029 m3/m3/%. The lab determined...

Compared cycling in a soil-plant system of pea and barley residue nitrogen

DEFF Research Database (Denmark)

Jensen, E.S.

1996-01-01

Field experiments were carried out on a temperate soil to determine the decline rate, the stabilization in soil organic matter and the plant uptake of N from N-15-labelled crop residues. The fate of N from field pea (Pisum sativum L.) and spring barley (Hordeum vulgare L.) residues was followed...... mineralization of N was highly correlated to the concentrations of soluble C and N and the lignin:N ratio of residues. The contribution of residue-derived N to the inorganic N pool was at its maximum 30 DAI (10-55%) and declined to on average 5% after 3 years of decomposition. Residual organic labelled N...... in the top 10 cm soil declined rapidly during the initial 86 DAI for all residue types. Leaching of soluble organic materials may have contributed to this decline. At 216 DAI 72, 59 and 45% of the barley, mature pea and green pea residue N, respectively, were present in organic N-forms in the topsoil. During...

Senescence-associated barley NAC (NAM, ATAF1,2, CUC) transcription factor interacts with radical-induced cell death 1 through a disordered regulatory domain

DEFF Research Database (Denmark)

Kjaersgaard, Trine; Jensen, Michael K; Christiansen, Michael W

2011-01-01

as a transcriptional activator suggesting that an involvement of HvNAC013 and HvNAC005 in senescence will be different. HvNAC013 interacted with barley radical-induced cell death 1 (RCD1) via the very C-terminal part of its TRD, outside of the region containing the LP motif. No significant secondary structure...... (NAM, ATAF1,2, CUC) TF family are up-regulated during senescence in barley (Hordeum vulgare). Both HvNAC005 and HvNAC013 bound the conserved NAC DNA target sequence. Computational and biophysical analyses showed that both proteins are intrinsically disordered in their large C-terminal domains, which...... was induced in the HvNAC013 TRD upon interaction with RCD1. RCD1 also interacted with regions dominated by intrinsic disorder in TFs of the MYB and basic helix-loop-helix families. We propose that RCD1 is a regulatory protein capable of interacting with many different TFs by exploiting their intrinsic...

Winery wastewater inhibits seed germination and vegetative growth of common crop species.

Science.gov (United States)

Mosse, Kim P M; Patti, Antonio F; Christen, Evan W; Cavagnaro, Timothy R

2010-08-15

The ability to reuse winery wastewater would be of significant benefit to the wine industry, as it could potentially be a cost-effective method of wastewater management, whilst at the same time providing a valuable water resource. This study investigated the effects of different dilutions of a semi-synthetic winery wastewater on the growth and germination of four common crop species in a glasshouse study; barley (Hordeum vulgare), millet (Pennisetum glaucum), lucerne (Medicago sativa) and phalaris (Phalaris aquatica). The wastewater caused a significant delay in the germination of lucerne, millet and phalaris, although overall germination percentage of all species was not affected. Vegetative growth was significantly reduced in all species, with millet being the most severely affected. The germination index of barley correlated very highly (r(2)=0.99) with barley biomass, indicating that barley seed germination bioassays are highly relevant to plant growth, and therefore may be of use as a bioassay for winery wastewater toxicity. Copyright 2010 Elsevier B.V. All rights reserved.

Nitrogen mineralization and denitrification as influenced by crop residue particle size

DEFF Research Database (Denmark)

Ambus, P.; Jensen, E.S.

1997-01-01

1: N-15-labelled ground (less than or equal to 3 mm) and cut (25 mm) barley residue, and microcrystalline cellulose+glucose were mixed into a sandy loam soil with additional inorganic N. Experiment 2: inorganic N-15 and C2H2 were added to soils with barley and pea material after 3, 26, and 109 days......Managing the crop residue particle size has the potential to affect N conservation in agricultural systems. We investigated the influence of barley (Hordeum vulgare) and pea (Pisum sativum) crop residue particle size on N mineralization and denitrification in two laboratory experiments. Experiment...... for measuring gross N mineralization and denitrification. Net N immobilization over 60 days in Experiment 1 cumulated to 63 mg N kg(-1) soil (ground barley), 42 (cut barley), and 122 (cellulose+glucose). More N was seemingly net mineralized from ground barley (3.3 mg N kg(-1) soil) than from cut barley (2.7 mg...

Effects of a 6-phytase on the apparent ileal digestibility of minerals and amino acids in ileorectal anastomosed pigs fed on a corn-soybean meal-barley diet.

Science.gov (United States)

Guggenbuhl, P; Waché, Y; Simoes Nunes, C; Fru, F

2012-12-01

Phosphorus of plant-based feedstuffs for monogastric animals is mainly in the form of phytic P, which has a very low bioavailability. The nondigested phytic P may contribute to P pollution. Furthermore, phytic acid may reduce digestibility of other minerals and protein. This study evaluated effects of the microbial 6-phytase RONOZYME HiPhos on apparent ileal digestibility of P, phytic acid, Ca, CP, energy, and AA in six 60-d-old ileorectal anastomosed pigs. In a duplicated 3 × 3 Latin square design, pigs had free access to alternatively a corn (Zea mays)-soybean (Glycine max) meal-barley (Hordeum vulgare)-based diet or this diet supplemented with RONOZYME HiPhos at either 500 units/kg (RH500) or 1000 units/kg (RH1000). Pigs fed diets supplemented with RH500 or RH1000 increased (P phytase increased apparent ileal digestibility of these indispensable minerals and phytate. The phytase increased digestibility of CP and indispensable AA indicating a better availability of plant-based proteins.