Geography of genetic differentiation in the barley wild relative Hordeum vulgare subsp. spontaneum in Jordan

Science.gov (United States)

Informed collecting, conservation, monitoring and utilization of genetic diversity require knowledge of the distribution and structure of genetic variation occurring in a species. Hordeum vulgare subsp. spontaneum (K. Koch) Thell., a primary wild relative of barley, is an important source of genetic...

Proteomic response of Hordeum vulgare cv. Tadmor and Hordeum marinum to salinity stress: Similarities and differences between a glycophyte and a halophyte

Directory of Open Access Journals (Sweden)

Lucie Maršálová

2016-08-01

Full Text Available Response to a high salinity treatment of 300 mM NaCl was studied in a cultivated barley Hordeum vulgare Syrian cultivar Tadmor and in a halophytic wild barley Hordeum marinum. Differential salinity tolerance of H. marinum and H. vulgare is underlied by qualitative and quantitative differences in proteins involved in a variety of biological processes. The major aim was to identify proteins underlying differential salinity tolerance between the two barley species. Analyses of plant water content, osmotic potential and accumulation of proline and dehydrin proteins under high salinity revealed a relatively higher water saturation deficit in H. marinum than in H. vulgare while H. vulgare had lower osmotic potential corresponding with high levels of proline and dehydrins. Analysis of proteins soluble upon boiling isolated from control and salt-treated crown tissues revealed similarities as well as differences between H. marinum and H. vulgare. The similar salinity responses of both barley species lie in enhanced levels of stress-protective proteins such as defence-related proteins from late-embryogenesis abundant (LEA family, several chaperones from heat shock protein (HSP family, and others such as GrpE. However, there have also been found significant differences between H. marinum and H. vulgare salinity response indicating an active stress acclimation in H. marinum while stress damage in H. vulgare. An active acclimation to high salinity in H. marinum is underlined by enhanced levels of several stress-responsive transcription factors from basic leucine zipper (bZIP and nascent polypeptide-associated complex (NAC families. In salt-treated H. marinum, enhanced levels of proteins involved in energy metabolism such as glycolysis, ATP metabolism, and photosynthesis-related proteins indicate an active acclimation to enhanced energy requirements during an establishment of novel plant homeostasis. In contrast, changes at proteome level in salt-treated H

Structure of Hordeum vulgare NADPH-dependent thioredoxin reductase 2. Unwinding the reaction mechanism

DEFF Research Database (Denmark)

Kirkensgaard, Kristine Groth; Hägglund, Per; Finnie, Christine

2009-01-01

to the active form. Here, the first crystal structure of a cereal NTR, HvNTR2 from Hordeum vulgare (barley), is presented, which is also the first structure of a monocot plant NTR. The structure was determined at 2.6 A resolution and refined to an R (cryst) of 19.0% and an R (free) of 23.8%. The dimeric protein...

Biosynthesis of the leucine derived α-, β- and γ-hydroxynitrile glucosides in barley (Hordeum vulgare L.)

DEFF Research Database (Denmark)

Knoch, Eva; Motawie, Mohammed Saddik; Olsen, Carl Erik

2016-01-01

Barley (Hordeum vulgare L.) produces five leucine-derived hydroxynitrile glucosides (HNGs), of which only epiheterodendrin is a cyanogenic glucoside. The four non-cyanogenic HNGs are the β-HNG epidermin and the γ-HNGs osmaronin, dihydroosmaronin and sutherlandin. By analyzing 247 spring barley...

Characterization and partial purification of beta-1,3-D-glucan (callose) synthase from barley (Hordeum vulgare) leaves

DEFF Research Database (Denmark)

Pedersen, L.H.; Jacobsen, S.; Hejgaard, J.

1993-01-01

The plasma membrane bound beta-1,3-D-glucan (callose) synthase. assumed to be involved in the resistance to the powdery mildew fungus (Erysiphe graminis f.sp. hordei), was partially purified from a microsomal fraction of green barley leaves (Hordeum vulgare L.). Plasma membranes were enriched...

Complete chloroplast genome sequences of Hordeum vulgare, Sorghum bicolor and Agrostis stolonifera, and comparative analyses with other grass genomes

Science.gov (United States)

Saski, Christopher; Lee, Seung-Bum; Fjellheim, Siri; Guda, Chittibabu; Jansen, Robert K.; Luo, Hong; Tomkins, Jeffrey; Rognli, Odd Arne; Clarke, Jihong Liu

2009-01-01

Comparisons of complete chloroplast genome sequences of Hordeum vulgare, Sorghum bicolor and Agrostis stolonifera to six published grass chloroplast genomes reveal that gene content and order are similar but two microstructural changes have occurred. First, the expansion of the IR at the SSC/IRa boundary that duplicates a portion of the 5′ end of ndhH is restricted to the three genera of the subfamily Pooideae (Agrostis, Hordeum and Triticum). Second, a 6 bp deletion in ndhK is shared by Agrostis, Hordeum, Oryza and Triticum, and this event supports the sister relationship between the subfamilies Erhartoideae and Pooideae. Repeat analysis identified 19–37 direct and inverted repeats 30 bp or longer with a sequence identity of at least 90%. Seventeen of the 26 shared repeats are found in all the grass chloroplast genomes examined and are located in the same genes or intergenic spacer (IGS) regions. Examination of simple sequence repeats (SSRs) identified 16–21 potential polymorphic SSRs. Five IGS regions have 100% sequence identity among Zea mays, Saccharum officinarum and Sorghum bicolor, whereas no spacer regions were identical among Oryza sativa, Triticum aestivum, H. vulgare and A. stolonifera despite their close phylogenetic relationship. Alignment of EST sequences and DNA coding sequences identified six C–U conversions in both Sorghum bicolor and H. vulgare but only one in A. stolonifera. Phylogenetic trees based on DNA sequences of 61 protein-coding genes of 38 taxa using both maximum parsimony and likelihood methods provide moderate support for a sister relationship between the subfamilies Erhartoideae and Pooideae. PMID:17534593

Geography of Genetic Structure in Barley Wild Relative Hordeum vulgare subsp. spontaneum in Jordan.

Science.gov (United States)

Thormann, Imke; Reeves, Patrick; Reilley, Ann; Engels, Johannes M M; Lohwasser, Ulrike; Börner, Andreas; Pillen, Klaus; Richards, Christopher M

2016-01-01

Informed collecting, conservation, monitoring and utilization of genetic diversity requires knowledge of the distribution and structure of the variation occurring in a species. Hordeum vulgare subsp. spontaneum (K. Koch) Thell., a primary wild relative of barley, is an important source of genetic diversity for barley improvement and co-occurs with the domesticate within the center of origin. We studied the current distribution of genetic diversity and population structure in H. vulgare subsp. spontaneum in Jordan and investigated whether it is correlated with either spatial or climatic variation inferred from publically available climate layers commonly used in conservation and ecogeographical studies. The genetic structure of 32 populations collected in 2012 was analyzed with 37 SSRs. Three distinct genetic clusters were identified. Populations were characterized by admixture and high allelic richness, and genetic diversity was concentrated in the northern part of the study area. Genetic structure, spatial location and climate were not correlated. This may point out a limitation in using large scale climatic data layers to predict genetic diversity, especially as it is applied to regional genetic resources collections in H. vulgare subsp. spontaneum.

Effects of ultraviolet radiation on viability of isolated Beta vulgaris and Hordeum vulgare protoplasts

International Nuclear Information System (INIS)

Bornman, J.F.; Bjoern, L.O.; Bornman, C.H.

1982-01-01

Estimates of viability as measured by vital straining with fluorescein diacetate were carried out on freshly isolated and partially aged (16-hour-old) Beta vulgaris and Hordeum vulgare mesophyll protoplasts following irradiation with UV-B. Damage to the photosynthetic system by UV-B was determined by delayed light emission (DLE). In the case of freshly isolated Protoplasts Beta was approximately 30% more susceptible than Hordeum following 3h irradiation, with viability decreasing from 90% to 40%. After storage of protoplasts on ice for 16 h UV-B radiation markedly depressed viability in both species, but in the case of Hordeum there was a substantial initial loss of nearly 70% in viability over the first hour of irradiation. The first 10 min of UV-B radiation decreased the intensity of DLE by 40% without appreciably affecting the decay rate. Longer treatment times did not give a proportional effect so that even after 60 min of UV-B the inhibition did not exceed 60%. This suggested that although the enzyme system responsible for FDA hydrolysis may be partially inactivated (viability was 75-80% as compared with 90% in the control), the UV-B did not penetrate the innermost parts of the chloroplasts, but left some thylakoids undamaged. (orig.)

Phytochemical screening, anticancer and antioxidant activities of Origanum vulgare L. ssp. viride (Boiss.) Hayek, a plant of traditional usage.

Science.gov (United States)

Koldaş, Serkan; Demirtas, Ibrahim; Ozen, Tevfik; Demirci, Mehmet Ali; Behçet, Lütfi

2015-03-15

A detailed phytochemical analysis of Origanum vulgare L. ssp. viride (Boiss.) Hayek was carried out and the antioxidant activities of five different crude extracts were determined. The antiproliferative activities of the extracts were determined using the xCELLigence system (Real Time Cell Analyzer). Differences between the essential oil and volatile organic compound profiles of the plant were shown. The main component of the essential oil was caryophyllene oxide, while the main volatile organic compounds were sabinene and eucalyptol as determined by HS-GC/MS. Phenolic contents of the extracts were determined qualitatively and quantitatively by HPLC/TOF-MS. Ten phenolic compounds were found in the extracts from O. vulgare and Origanum acutidens: rosmarinic acid (in highest abundance), chicoric acid, caffeic acid, p-coumaric acid, gallic acid, quercetin, apigenin-7-glucoside, kaempferol, naringenin and 4-hydroxybenzaldehyde. This study provides first results on the antiproliferative and antioxidant properties and detailed phytochemical screening of O. vulgare ssp. viride (Boiss.) Hayek. © 2014 Society of Chemical Industry.

Catabolism of (+/-)-abscisic acid by excised leaves of Hordeum vulgare L. cv Dyan and its modification by chemical and environmental factors

International Nuclear Information System (INIS)

Cowan, A.K.; Railton, I.D.

1987-01-01

Excised light-grown leaves and etiolated leaves of Hordeum vulgare L. cv Dyan catabolized applied (+/-)-[2- 14 C]abscisic acid ([+/-]-[2- 14 C]ABA) to phaseic acid (PA), dihydrophaseic acid (DPA), and 2'-hydroxymethyl ABA (2'-HMABA). Identification of these catabolites was made by microchemical methods and by combined capillary gas chromatography-mass spectrometry (GC-MS) following high dose feeds of nonlabeled substrate to leaves. Circular dichroism analysis revealed that 2'-HMABA was derived from the (-) enantiomer of ABA. Refeeding studies were used to confirm the catabolic route. The methyl ester of (+/-)-[2 14 C]-ABA was hydrolyzed efficiently by light-grown leaves of H. vulgare. Leaf age played a significant role in (+/-)-ABA catabolism, with younger leaves being less able than their older counterparts to catabolize this compound. The catabolism of (+/-)-ABA was inhibited markedly in water-stressed Hordeum leaves which was characterized by a decreased incorporation of label into 2'-HMABA, DPA, and conjugates. The specific, mixed function oxidase inhibitor, ancymidol, did not inhibit, dramatically (+/-)-ABA catabolism in light-grown leaves of Hordeum whereas the 80s ribosome, translational inhibitor, cycloheximide, inhibited this process markedly. The 70s ribosome translational inhibitors, lincomycin and chloramphenicol, were less effective than cycloheximide in inhibiting (+/-)-ABA catabolism, implying that cytoplasmic protein synthesis is necessary for the catabolism of (+/-)-ABA in Hordeum leaves whereas chloroplast protein synthesis plays only a minor role. This further suggests that the enzymes involved in (+/-)-ABA catabolism in this plant are cytoplasmically synthesized and are turned-over rapidly, although the enzyme responsible for glycosylating (+/-)-ABA itself appeared to be stable

Interkingdom signaling: The role of homoserine lactones in early responses and resistance in barley (Hordeum vulgare L.)

OpenAIRE

Rankl, Simone

2017-01-01

N-Acyl-D/L-homoserine lactones (AHLs) are produced as microbial signaling compounds during bacterial intra- and inter-specific communication in the rhizosphere. Thus, plants are naturally exposed to these compounds and respond with tissue-specific reactions. In the present study the impact of AHLs on the monocot barley (Hordeum vulgare L.) was investigated. The treatment with C8- and C12- homoserine lactones (HSL) resulted in root and shoot biomass gain as well as in the formation of lat...

The Influence of Processing by Impulse Pressure on the Productivity of the Don Barley (Hordeum vulgare L.

Directory of Open Access Journals (Sweden)

Pavlova Violetta Aleksandrovna

2014-04-01

Full Text Available Plant productivity is the important indicator, which determines the amount of yield. The productivity of plants depends on the number of bruchids per plant and on the weight of 1000 bruchids. The article studies the influence of impulse pressure of various magnitudes on plant productivity of Don barley (Hordeum vulgare L.. It was found that the pressure of 17 MPa was the most effective for increasing the productivity. Impulse pressure of other magnitudes also had influence on the productivity of Don barley.

Phylogenetic analysis of the genus Hordeum using repetitive DNA sequences

DEFF Research Database (Denmark)

Svitashev, S.; Bryngelsson, T.; Vershinin, A.

1994-01-01

A set of six cloned barley (Hordeum vulgare) repetitive DNA sequences was used for the analysis of phylogenetic relationships among 31 species (46 taxa) of the genus Hordeum, using molecular hybridization techniques. In situ hybridization experiments showed dispersed organization of the sequences...

Zinc blotting assay for detection of zinc binding prolamin in barley (Hordeum vulgare) grain

DEFF Research Database (Denmark)

Uddin, Mohammad Nasir; Nielsen, Ane Langkilde-Lauesen; Vincze, Eva

2014-01-01

In plants, zinc is commonly found bound to proteins. In barley (Hordeum vulgare), major storage proteins are alcohol-soluble prolamins known as hordeins, and some of them have the potential to bind or store zinc. 65Zn overlay and blotting techniques have been widely used for detecting zinc......-binding protein. However, to our knowledge so far this zinc blotting assay has never been applied to detect a prolamin fraction in barley grains. A radioactive zinc (65ZnCl2) blotting technique was optimized to detect zinc-binding prolamins, followed by development of an easy-to-follow nonradioactive colorimetric...... zinc blotting method with a zinc-sensing dye, dithizone. Hordeins were extracted from mature barley grain, separated by SDS-PAGE, blotted on a membrane, renatured, overlaid, and probed with zinc; subsequently, zinc-binding specificity of certain proteins was detected either by autoradiography or color...

Differential Antioxidative Responses to Water Deficit Among four Barley (Hordeum vulgare L. Genotypes

Directory of Open Access Journals (Sweden)

Z Amini

2013-08-01

Full Text Available Future climate changes are expected to increase risks of drought, which already represent the most common stress factor for stable barley (Hordeum vulgare L. production in Iran. Up to now, extensive research projects have been done to study effects of drought stress on the antioxidant enzyme activity. While there is a few works of such studies on the field condition. In order to study of water deficit effects on the antioxidant enzymes activities as a secondary stress, we evaluate the effects of mild and severe drought stress on activities of antioxidative enzymes including superoxide dismutases, ascorbate peroxidase, catalase and peroxidase, among four barley genotypes, differing in the capacity to maintain the grain yield under drought condition during beginning on anthesis, kernel watery ripe and late milk stages under field condition. Results showed that drought increased the activity of antioxidant enzymes in all genotypes. At beginning of anthesis, POX activity of Q22 was higher than it in other genotypes ( P

In vitro cytotoxicity of allelopathic plants Adonis vernalis L. Origanum vulgare ssp. vulgare L. and Nepeta nuda subsp. nuda

Science.gov (United States)

Koleva, Vanya; Dragoeva, Asya; Stoyanova, Zheni; Yordanova, Zhenia; Ali, Selime; Uzunov, Nikolay M.; Melendez-Alafort, Laura; Rosato, Antonio; Enchev, Dobromir D.

2018-03-01

Medicinal plants produce various secondary metabolites as a part of their chemical defence and survival in nature. These compounds have a wide range of biological activities. Nowadays, medicinal plants are used as source of allelochemicals and new effective anticancer agents. Our previous studies revealed allelopathic potential of water extracts of Adonis vernalis L. (Ranunculaceae), Origanum vulgare ssp. vulgare L. and Nepeta nuda subsp. nuda (Lamiaceae). Present study aimed to evaluate the effect of the same extracts in vitro on human hepatoma cell line SK-HEP-1. Cell proliferation/viability was assessed using Premixed WST-1 Cell Proliferation Reagent. Adonis water extract (1.83mg/ml) had notable negative influence on cancer cell line tested. Oregano (3.5 mg/ml) also exerted negative effect, but to a lesser degree. On the contrary, nepeta water extract (6.59 mg/ml) had an opposite effect, stimulating cell proliferation. One possible explanation could be the type of extraction: after treatment with nepeta methanol extract (6.59 mg/ml) cell viability was significantly reduced. In conclusion, Adonis vernalis and Nepeta nuda subsp. nuda possess metabolites with growth inhibitory effect on human hepatoma cell line SK-HEP-1. Further research is needed to clarify biological activity of lower concentrations which are appropriate to enable the design of new anticancer drugs.

Lipid and sugar profiles of various barley cultivars (Hordeum vulgare

Directory of Open Access Journals (Sweden)

Pastor Kristian A.

2015-01-01

Full Text Available The lipid components and soluble sugars in flour samples of different cultivars of barley (Hordeum vulgare, involving winter malting barley, winter forage barley, spring barley, and hulless barley, were identified. Fatty acids were extracted from flour samples with n-hexane, and derivatized into volatile methyl esters, using TMSH (trimethylsulfonium hydroxide in methanol. Soluble sugars were extracted from defatted and dried samples of barley flour with 96% ethanol, and further derivatized into the corresponding trimethylsilyl (TMS oximes, using hydroxylamine hydrochloride solution and BSTFA (N,O-bis-(trimethylsilyl-trifluoroacetamide. The hexane and alcoholic extracts of barley cultivars were analyzed by GC-MS system. Lipid and sugar compositions were very similar in all barley cultivars. Therefore, multivariate analysis was applied to numerical values of automatically integrated areas of the identified fatty acid methyl esters and TMS oximes of soluble sugars. The application of hierarchical cluster analysis showed a great similarity between the investigated flour samples of barley cultivars, according to their fatty acid content (0.96. Also, significant, but somewhat less similarity was observed regarding the content of soluble sugars (0.70. These preliminary results indicate the possibility of distinguishing flour made of barley, regardless of the variety, from flours made of other cereal species, just by the analysis of the contents of fatty acids and soluble sugars.[Projekat Ministarstva nauke Republike Srbije, br. TR 31066

Resistance genes in barley (Hordeum vulgare L.) and their identification with molecular markers.

Science.gov (United States)

Chełkowski, Jerzy; Tyrka, Mirosław; Sobkiewicz, Andrzej

2003-01-01

Current information on barley resistance genes available from scientific papers and on-line databases is summarised. The recent literature contains information on 107 major resistance genes (R genes) against fungal pathogens (excluding powdery mildew), pathogenic viruses and aphids identified in Hordeum vulgare accessions. The highest number of resistance genes was identified against Puccinia hordei, Rhynchosporium secalis, and the viruses BaYMV and BaMMV, with 17, 14 and 13 genes respectively. There is still a lot of confusion regarding symbols for R genes against powdery mildew. Among the 23 loci described to date, two regions Mla and Mlo comprise approximately 31 and 25 alleles. Over 50 R genes have already been localised and over 30 mapped on 7 barley chromosomes. Four barley R genes have been cloned recently: Mlo, Rpg1, Mla1 and Mla6, and their structures (sequences) are available. The paper presents a catalogue of barley resistance gene symbols, their chromosomalocation and the list of available DNA markers useful in characterising cultivars and breeding accessions.

Chemical Composition and Antimicrobial Activity of the Essential Oils from Three Chemotypes of Origanum vulgare L. ssp. hirtum (Link Ietswaart Growing Wild in Campania (Southern Italy

Directory of Open Access Journals (Sweden)

Felice Senatore

2009-07-01

Full Text Available Essential oils obtained from inflorescences of three Origanum vulgare L.ssp. hirtum (Link Ietswaart samples, growing wild in different locations in Campania (Southern Italy, were analysed. Three chemotypes were found: the first, with a prevalence of carvacrol/thymol; the second, characterized by the prevalence of thymol/α-terpineol; the third, featuring a prevalence of linalyl acetate and linalool. This chemical study attempts to provide a contribution in shedding light on the relationship between chemical composition and biotypes and/or chemotypes in Origanum vulgare ssp. hirtum. The essential oils were also evaluated for their antibacterial activity against 10 selected microorganisms. The data obtained contribute to the future view to use the essential oils as natural preservatives for food products, due to their positive effect on their safety and shelf life.

Fungos e micotoxinas em grãos de cevada (Hordeum vulgare L.) cervejeira, descontaminação pelo gás ozônio e segurança de cervejas artesanais

OpenAIRE

Piacentini, Karim Cristina

2015-01-01

Dissertação (mestrado) - Universidade Federal de Santa Catarina, Centro de Ciências Agrárias, Programa de Pós-Graduação em Ciência dos Alimentos, Florianópolis, 2015. A cevada (Hordeum vulgare L sp. vulgare) é considerada um dos cereais mais importantes no contexto mundial. Atualmente, uma preocupação latente da indústria cervejeira é o crescimento de fungos filamentosos nos grãos, que acorre devido ao manejo inadequado da matéria prima durante o armazenamento (excesso de umidade), a conde...

Cytogenetic effect of low dose gamma-radiation in Hordeum vulgare seedlings: non-linear dose-effect relationship.

Science.gov (United States)

Geras'kin, Stanislav A; Oudalova, Alla A; Kim, Jin Kyu; Dikarev, Vladimir G; Dikareva, Nina S

2007-03-01

The induction of chromosome aberrations in Hordeum vulgare germinated seeds was studied after ionizing irradiation with doses in the range of 10-1,000 mGy. The relationship between the frequency of aberrant cells and the absorbed dose was found to be nonlinear. A dose-independent plateau in the dose range from about 50 to 500 mGy was observed, where the level of cytogenetic damage was significantly different from the spontaneous level. The comparison of the goodness of the experimental data fitting with mathematical models of different complexity, using the most common quantitative criteria, demonstrated the advantage of a piecewise linear model over linear and polynomial models in approximating the frequency of cytogenetical disturbances. The results of the study support the hypothesis of indirect mechanisms of mutagenesis induced by low doses. Fundamental and applied implications of these findings are discussed.

Farmers without borders-genetic structuring in century old barley (Hordeum vulgare).

Science.gov (United States)

Forsberg, N E G; Russell, J; Macaulay, M; Leino, M W; Hagenblad, J

2015-02-01

The geographic distribution of genetic diversity can reveal the evolutionary history of a species. For crop plants, phylogeographic patterns also indicate how seed has been exchanged and spread in agrarian communities. Such patterns are, however, easily blurred by the intense seed trade, plant improvement and even genebank conservation during the twentieth century, and discerning fine-scale phylogeographic patterns is thus particularly challenging. Using historical crop specimens, these problems are circumvented and we show here how high-throughput genotyping of historical nineteenth century crop specimens can reveal detailed geographic population structure. Thirty-one historical and nine extant accessions of North European landrace barley (Hordeum vulgare L.), in total 231 individuals, were genotyped on a 384 single nucleotide polymorphism assay. The historical material shows constant high levels of within-accession diversity, whereas the extant accessions show more varying levels of diversity and a higher degree of total genotype sharing. Structure, discriminant analysis of principal components and principal component analysis cluster the accessions in latitudinal groups across country borders in Finland, Norway and Sweden. FST statistics indicate strong differentiation between accessions from southern Fennoscandia and accessions from central or northern Fennoscandia, and less differentiation between central and northern accessions. These findings are discussed in the context of contrasting historical records on intense within-country south to north seed movement. Our results suggest that although seeds were traded long distances, long-term cultivation has instead been of locally available, possibly better adapted, genotypes.

Nitrogen uptake by Azospirillum brasilense inoculated barley (Hordeum vulgare L.) as influenced by N and P fertilization

International Nuclear Information System (INIS)

Negi, Mahima; Tilak, K.V.B.R.; Sachdev, M.S.

1991-01-01

Response of barley (Hordeum vulgare L.) in a sandy-loam soil under potted conditions revealed that application of nitrogen and phosphorus increased the population of Azospirillium in the barley rhizosphere. A two fold increase was observed in the Azospirillium population at 80 days compared to that at 40 days of plant growth. The unsterilized inoculated roots had more population than the surface sterilized inoculated roots. Increased drymatter production of barley was obtained in A. brasilense inoculated N 0 P 1 (0 kg N and 30 kg P 2 O 5 ha -1 ) treatment than uninoculated control. Also N and P uptake was higher in A. brasilense inoculated plants in the presence of both N and P fertilizers. The 15 N data revealed that at harvest nearly 36 per cent of the total N uptake was from the nitrogen fixed by A. brasilense irrespective of P treatment. (author). 16 refs., 4 tabs

Evaluation of barley (hordeum vulgare l.) germplasm for high forage production under salt stress

International Nuclear Information System (INIS)

Saleem, A.; Qurainy, F.A.; Akram, N.A.

2014-01-01

To explore high biomass producing salt tolerant cultivars of a potential forage crop barley (Hordeum vulgare L.), 30-day old plants of 105 different accessions from different origin were subjected to saline and non-saline (control) conditions for 45 days. Salinity stress (150 mM NaCl) markedly suppressed plant growth (shoot and/or root fresh and dry weights), chlorophyll pigments (a and b), internal CO/sub 2/ concentration, stomatal conductance, rate of transpiration and photosynthesis, while a considerable salt-induced increase was observed in all fluorescence related attributes including efficiency of photosystem-II (Fv/Fm), co-efficient of non-photochemical quenching (QN), photochemical quenching (QP), and non-photochemical quenching (NPQ) in all 105 accessions of barley. The response of all 105 barley accessions to salt stress varied significantly for all the morpho-physiological attributes determined in the present study. Overall, on the basis of shoot and root dry weights, accessions, 4050, 4053, 4056, 4163, 4228, 4229, 4244, 4245, 4290, 4414, 4415, 4427, 4452, Mahali, Jesto, 4165, 4229, 4249, 4405, 4409, 4426, 4456, and Giza 123 were found superior while accessions, 4245, 4158, 4166, 4246, 4406, 4423, 4441, 4442 4447, 4453 and 4458 inferior under saline conditions. (author)

Variation in the leaf sodium content of the Hordeum vulgare (barley) cultivar Maythorpe and its derived mutant cv. Golden Promise

International Nuclear Information System (INIS)

Forster, B.P.; Pakniyat, H.; Macaulay, M.; Matheson, W.; Phillips, M.S.; Thomas, W.T.B.; Powell, W.

1994-01-01

Tests for shoot and root sodium content were carried out on various barley cultivars (Hordeum vulgare) and experimental lines including wild barley (H. spontaneum) and derivatives. Lines were grown in hydroculture with and without the addition of salt (NaCl), and sodium concentrations in shoots and roots were determined. Variation in shoot sodium content was found between the various lines; in contrast, no significant differences were found between the lines tested for root sodium content. The most significant finding was the variation in shoot sodium content between the two cultivars Golden Promise and Maythorpe. Golden Promise is a direct gamma-ray induced mutant of the cultivar Maythorpe and the reduced shoot sodium content of Golden Promise can be attributed to radiation treatment. (author)

Impact of Acacia tortilis ssp. raddiana tree on wheat and barley yield in the south of Tunisia

Science.gov (United States)

Noumi, Zouhaier; Abdallah, Fathia; Torre, Franck; Michalet, Richard; Touzard, Blaise; Chaieb, Mohamed

2011-03-01

In the past, Acacia tortilis ssp. raddiana (Savi) Brenan colonised thousands of hectares in central and southern Tunisia. Nowadays, the geographical distribution of A. tortilis ssp. raddiana is restricted to the National Park of Bou-Hedma (central Tunisia). The Acacia is of considerable interest for local populations and may be considered as a "foundation species" under arid climate. This study examines the effects of Acacia canopy on soil fertility and cereal productivity. The improvement in soil fertility and microclimate provided by A. tortilis ssp. raddiana is known to facilitate the establishment of new species, but little is known about the interaction between the tree species and the cereals cultivated by local farmers. We studied the effect of A. tortilis ssp. raddiana canopy on the yield of three cereals crops ( Hordeum vulgare L., Triticum sativum L. and Triticum aestivum L.). We seeded 168 plots (15 × 15 m) under the tree canopy and in open areas on four different landform types (glacis, plain, wadis, and jessours) and measured cereal yield over two contrasting years (wet and dry). We found that: (1) precipitation and geomorphology are more important in determining cereal yield than canopy cover, (2) these effects on water availability are species-specific with no effect on the stress-tolerant barley. We finally discuss the potential negative effects of Acacia trees which may have balanced the positive effects found for nutrient in our study.

Genetic analysis on the competitive ability of barley ( Hordeum ...

African Journals Online (AJOL)

Genetic analysis on the competitive ability of barley ( Hordeum vulgare L.) recombinant inbred lines intercropped with oat ( Avena sativa L.) weeds. ... Furthermore, the commonly used herbicide price is soaring from time to time and out of the reach of the poor farmers in the developing countries. Therefore, this method is an ...

Enhanced Pb Absorption by Hordeum vulgare L. and Helianthus annuus L. Plants Inoculated with an Arbuscular Mycorrhizal Fungi Consortium.

Science.gov (United States)

Arias, Milton Senen Barcos; Peña-Cabriales, Juan José; Alarcón, Alejandro; Maldonado Vega, María

2015-01-01

The effect of an arbuscular mycorrhizal fungi (AMF) consortium conformed by (Glomus intraradices, Glomus albidum, Glomus diaphanum, and Glomus claroideum) on plant growth and absorption of Pb, Fe, Na, Ca, and (32)P in barley (Hordeum vulgare L.) and sunflower (Helianthus annuus L.) plants was evaluated. AMF-plants and controls were grown in a substrate amended with powdered Pb slag at proportions of 0, 10, 20, and 30% v/v equivalent to total Pb contents of 117; 5,337; 13,659, and 19,913 mg Pb kg(-1) substrate, respectively. Mycorrhizal root colonization values were 70, 94, 98, and 90%, for barley and 91, 97, 95, and 97%, for sunflower. AMF inoculum had positive repercussions on plant development of both crops. Mycorrhizal barley absorbed more Pb (40.4 mg Pb kg(-1)) shoot dry weight than non-colonized controls (26.5 mg Pb kg(-1)) when treated with a high Pb slag dosage. This increase was higher in roots than shoots (650.0 and 511.5 mg Pb kg(-1) root dry weight, respectively). A similar pattern was found in sunflower. Plants with AMF absorbed equal or lower amounts of Fe, Na and Ca than controls. H. vulgare absorbed more total P (1.0%) than H. annuus (0.9%). The arbuscular mycorrizal consortium enhanced Pb extraction by plants.

Molecular characterization of barley (Hordeum vulgare L. accessions of the Serbian GeneBank by SSR fingerprinting

Directory of Open Access Journals (Sweden)

Šurlan-Momirović Gordana

2013-01-01

Full Text Available Molecular diversity of 145 barley (Hordeum vulgare subsp. vulgare L. accessions from the Serbian GenBank was assessed by single sequence repeats (SSR markers. A set of 15 SSRs, covering all chromosomes of the diploid barley genome with 2-3 SSR markers per chromosome, with a range of 4-18 alleles per locus were used. In total, 15 loci and 119 alleles were detected, with an average of 7.93 alleles per locus. The Polymorphic information content value ranged from 0.220 to 0.782 with a mean value of 0.534. Regarding the growth habit and row type groups, gene diversity was comparatively higher for the spring (0.616 and six-rowed accessions (0.616 than for the winter and two- rowed accessions (0.322 and 0.478, respectively. Analysis of molecular variance showed that all sources of variation were significant (P < 0.01, but the between-group component was predominant (76.85% for growth habit and 89.45% for row type. Unweighted Pair Group Method with Arithmetic Mean (UPGMA cluster analysis based on the shared allele distance (DSA matrix estimated on the SSR data assigned the genotypes into two clusters - the first smaller consisting of the six 6-rowed spring cultivars and the second comprising six subclusters. Genotype MBR1012 was separated from all other genotypes that constitute UPGMA tree. The associations of genotypes belonging to different growth habit and row type groups were assessed using Principal Coordinate Analysis revealing separation of winter growth habit group from facultative one. The use of the STRUCTURE clustering algorithm allowed the identification of 2 subpopulations of genotypes. [Projekat Ministarstva nauke Republike Srbije, br. TR31092

Bioaccumulation of cadmium by spring barley (Hordeum vulgare L. and its effect on selected physiological and morphological parameters

Directory of Open Access Journals (Sweden)

Miriama Kopernická

2016-01-01

Full Text Available Heavy metals and other toxic elements in the environment, mainly located in soil and groundwater, have a significant effect on plant and its productivity that has a huge attention in recent years. Accumulation of heavy metals in soil cause toxicity to plants, and contaminate the food chain. The industrial areas, as well as developing countries have been contaminated with high concentration of heavy metals. Main sources of contamination are mining and other industrial processes, as well as military and or lanfills, sludge dumps or waste disposal sites. The heavy metals are very dangerous to environment and pose serious danger to public health by entering throught the food chain or into drinking water. Phytoextraction is one way how to remove the contaminants from soil by plants. Phytoextraction of heavy metals is a technology that has been studied for several years. It is more ecological and cheaper way how to clean our environment.Several plant species are known becauce they hyperaccumulate a high contents of metals from the soil. The accumulators are mainly herbaceous species, crops and nowadays angiosperm trees with a high growth such as poplars or willows. We have focused on the determination of some morphological (lenght and weight of roots and biomass and physiological (contents of dry mass and number of lief stomata characteristics and the determination of the bioaccumulation factor and the translocation factor of cadmium by spring barley (Hordeum vulgare L.. Imprints of leaves were evaluated using an optical microscope Axiostar Plus, Carl Zeiss, lens CP Achromat 40x/0.65, eyepiece PI 10x / 18, Canon Utilities Software Zoom Browser EX 4.6 and hardware Acer Travel Mate 4600, Canon Power Shot A95. The density of stomata was evaluated on an area of 1 mm2. Samples of the dried plants (leaves and roots were mineralized by acid digestion using microwave digestion device MARS X - press 5. The end of determination to obtain the cadmium content was

Characterization of Gene Candidates for Vacuolar Sodium Transport from Hordeum Vulgare

KAUST Repository

Scheu, Arne Hagen August

2017-05-01

Soil salinity is a major abiotic stress for land plants, and multiple mechanisms of salt tolerance have evolved. Tissue tolerance is one of these mechanisms, which involves the sequestration of sodium into the vacuole to retain low cytosolic sodium concentrations. This enables the plant to maintain cellular functions, and ultimately maintain growth and yield. However, the molecular components involved in tissue tolerance remain elusive. Several candidate genes for vacuolar sodium sequestration have recently been identified by proteome analysis of vacuolar membranes purified from the salt-tolerant cereal Hordeum vulgare (barley). In this study, I aimed to characterize these candidates in more detail. I successfully cloned coding sequences for the majority of candidate genes with primers designed based on the barley reference genome sequence. During the course of this study a newer genome sequence with improved annotations was published, to which I also compared my observations. To study the candidate genes, I used the heterologous expression system Saccharomyces cerevisiae (yeast). I used several salt sensitive yeast strains (deficient in intrinsic sodium transporters) to test whether the candidate genes would affect their salt tolerance by mediating the sequestration of sodium into the yeast vacuole. I observed a reduction in growth upon expression for several of the gene candidate under salt-stress conditions. However, confocal microscopy suggests that most gene products are subject to degradation, and did not localize to the vacuolar membrane (tonoplast). Therefore, growth effects cannot be linked to protein function without further evidence. Various potential causes are discussed, including inaccuracies in the genome resource used as reference for primer design and issues inherent to the model system. Finally, I make suggestions on how to proceed to further characterize the candidate genes and hopefully identify novel sodium transporters from barley.

High-throughput transcriptome analysis of barley (Hordeum vulgare) exposed to excessive boron.

Science.gov (United States)

Tombuloglu, Guzin; Tombuloglu, Huseyin; Sakcali, M Serdal; Unver, Turgay

2015-02-15

Boron (B) is an essential micronutrient for optimum plant growth. However, above certain threshold B is toxic and causes yield loss in agricultural lands. While a number of studies were conducted to understand B tolerance mechanism, a transcriptome-wide approach for B tolerant barley is performed here for the first time. A high-throughput RNA-Seq (cDNA) sequencing technology (Illumina) was used with barley (Hordeum vulgare), yielding 208 million clean reads. In total, 256,874 unigenes were generated and assigned to known peptide databases: Gene Ontology (GO) (99,043), Swiss-Prot (38,266), Clusters of Orthologous Groups (COG) (26,250), and the Kyoto Encyclopedia of Genes and Genomes (KEGG) (36,860), as determined by BLASTx search. According to the digital gene expression (DGE) analyses, 16% and 17% of the transcripts were found to be differentially regulated in root and leaf tissues, respectively. Most of them were involved in cell wall, stress response, membrane, protein kinase and transporter mechanisms. Some of the genes detected as highly expressed in root tissue are phospholipases, predicted divalent heavy-metal cation transporters, formin-like proteins and calmodulin/Ca(2+)-binding proteins. In addition, chitin-binding lectin precursor, ubiquitin carboxyl-terminal hydrolase, and serine/threonine-protein kinase AFC2 genes were indicated to be highly regulated in leaf tissue upon excess B treatment. Some pathways, such as the Ca(2+)-calmodulin system, are activated in response to B toxicity. The differential regulation of 10 transcripts was confirmed by qRT-PCR, revealing the tissue-specific responses against B toxicity and their putative function in B-tolerance mechanisms. Copyright © 2014. Published by Elsevier B.V.

Evaluation of the allelopathic potential of water-soluble compounds of barley (Hordeum vulgare L. subsp.vulgare and great brome (Bromus diandrus Roth. using a modified bioassay

Directory of Open Access Journals (Sweden)

Bouhaouel, I.

2016-01-01

Full Text Available Description of the subject. The present study focuses on the description of the allelopathic interactions between wild and crop species that may occur in a given ecosystem. Objectives. The objective is the evaluation of the allo- and autoinhibition activity of root exudates of barley (Hordeum vulgare L. subsp. vulgare and great brome (Bromus diandrus Roth. seedlings by water-soluble allelochemicals. Method. The allelopathic activities of five Tunisian barley genotypes (modern varieties and landraces, one Saudi Arabian barley landrace and great brome were assessed using a modified laboratory bioassay named "seedling-after-seedling agar method". Results. The barley or the great brome reduced, to a greater extent, the root growth compared to the shoot growth of receiver species. The response of the root system architecture of the great brome towards barley root exudates was studied in detail. All the measured root traits were highly sensitive to the presence of barley. In our conditions, the allelopathic activity of barley root exudates had no apparent relationship with the size of the root and a prominent action of genetic determinants in the allelopathic potential between genotypes is proposed. The alloinhibitory activity of barley or great brome root exudates deferred between the receiver species but was always higher than the autoinhibition potential. The autoinhibition in barley proved to depend on whether the genotypes used as donor and receiver are identical or different, suggesting a specific interaction of allelochemicals with the receiver plant. These molecules seem to be the main actors in the allelopathic barley potential as external factors such variations of pH have no evident relevance in the inhibition process. Conclusions. Barley and great brome exude molecules in their surroundings. This affects the growth of the receiver plants, suggesting that these compounds might contribute to the plant community dynamics.

Efeitos de potenciais de água no solo, em diferentes estádios fenológicos da cultura da cevada (Hordeum vulgare L. Effects of soil water potentials at different phenological phases of barley crop (Hordeum vulgare L.

Directory of Open Access Journals (Sweden)

M.A. Urchei

1994-12-01

Full Text Available Objetivando avaliar os efeitos de défices hídricos, em três estádios fonológicos da cultura da cevada (Hordeum vulgare L., foi conduzido experimento em vasos, com delineamento em blocos ao acaso. Foram utilizados nove tratamentos decorrentes da combinação dos potenciais mínimos de água no solo de -0,05, -0,20 e -1,50 MPa, com os estádios fenológicos de máximo perfilhamento, florescimento e grão leitoso, permanecendo uniformizados durante o restante do ciclo, entre os potenciais de -0,01 a -0,05 MPa. Os resultados de produção, peso e teor de proteína dos grãos, tamanho de espigas, número total e número de espigas chochas, mostraram que os efeitos de défices hídricos variaram com a intensidade, duração e estádio fenológico da cultura, onde o estádio de florescimento mostrou-se mais sensível ao défice de água. A ocorrência de défice hídrico intenso, em cada um dos estádios, bem como ciclos repetidos de défices moderados ou intensos, levaram à diminuições significativas na produção de grãos, além de ocorrer tendência ao aumento do teor de protema dos grãos. O manejo da irrigação na cultura da cevada, quando se busca a máxima eficiência no uso da água, deve levar em conta os diferentes estádios fenológicos.The experiment was carried out under greenhouse conditions, with the objective of evaluating the effects of water deficits in three phenological phases of barley crop (Hordeum vulgare L.. Pots were arranged in a randomized block design with nine treatments. They originated from the combination of minimum soil water potentials of -0,05, -0,20 and -1,50 MPa, with the phenological phases of maximum tillering, flowering and milky grain, having been hold uniformly along the rest of the cycle, between -0,01 and -0,05 MPa potentials. Weight of grain, protein content, spike sizes, spike total number and number of hollow spikes, showed that water deficit effects varied with the intensity, duration and

Structure of Hordeum vulgare NADPH-dependent thioredoxin reductase 2. Unwinding the reaction mechanism

International Nuclear Information System (INIS)

Kirkensgaard, Kristine G.; Hägglund, Per; Finnie, Christine; Svensson, Birte; Henriksen, Anette

2009-01-01

The first crystal structure of a cereal NTR, a protein involved in seed development and germination, has been determined. The structure is in a conformation that excludes NADPH binding and indicates that a domain reorientation facilitated by Trx binding precedes NADPH binding in the reaction mechanism. Thioredoxins (Trxs) are protein disulfide reductases that regulate the intracellular redox environment and are important for seed germination in plants. Trxs are in turn regulated by NADPH-dependent thioredoxin reductases (NTRs), which provide reducing equivalents to Trx using NADPH to recycle Trxs to the active form. Here, the first crystal structure of a cereal NTR, HvNTR2 from Hordeum vulgare (barley), is presented, which is also the first structure of a monocot plant NTR. The structure was determined at 2.6 Å resolution and refined to an R cryst of 19.0% and an R free of 23.8%. The dimeric protein is structurally similar to the structures of AtNTR-B from Arabidopsis thaliana and other known low-molecular-weight NTRs. However, the relative position of the two NTR cofactor-binding domains, the FAD and the NADPH domains, is not the same. The NADPH domain is rotated by 25° and bent by a 38% closure relative to the FAD domain in comparison with AtNTR-B. The structure may represent an intermediate between the two conformations described previously: the flavin-oxidizing (FO) and the flavin-reducing (FR) conformations. Here, analysis of interdomain contacts as well as phylogenetic studies lead to the proposal of a new reaction scheme in which NTR–Trx interactions mediate the FO to FR transformation

Structure of Hordeum vulgare NADPH-dependent thioredoxin reductase 2. Unwinding the reaction mechanism

Energy Technology Data Exchange (ETDEWEB)

Kirkensgaard, Kristine G. [Carlsberg Laboratory (Denmark); Enzyme and Protein Chemistry, Department of Systems BioIogy, Technical University of Denmark (Denmark); Hägglund, Per; Finnie, Christine; Svensson, Birte [Enzyme and Protein Chemistry, Department of Systems BioIogy, Technical University of Denmark (Denmark); Henriksen, Anette, E-mail: anette@crc.dk [Carlsberg Laboratory (Denmark)

2009-09-01

The first crystal structure of a cereal NTR, a protein involved in seed development and germination, has been determined. The structure is in a conformation that excludes NADPH binding and indicates that a domain reorientation facilitated by Trx binding precedes NADPH binding in the reaction mechanism. Thioredoxins (Trxs) are protein disulfide reductases that regulate the intracellular redox environment and are important for seed germination in plants. Trxs are in turn regulated by NADPH-dependent thioredoxin reductases (NTRs), which provide reducing equivalents to Trx using NADPH to recycle Trxs to the active form. Here, the first crystal structure of a cereal NTR, HvNTR2 from Hordeum vulgare (barley), is presented, which is also the first structure of a monocot plant NTR. The structure was determined at 2.6 Å resolution and refined to an R{sub cryst} of 19.0% and an R{sub free} of 23.8%. The dimeric protein is structurally similar to the structures of AtNTR-B from Arabidopsis thaliana and other known low-molecular-weight NTRs. However, the relative position of the two NTR cofactor-binding domains, the FAD and the NADPH domains, is not the same. The NADPH domain is rotated by 25° and bent by a 38% closure relative to the FAD domain in comparison with AtNTR-B. The structure may represent an intermediate between the two conformations described previously: the flavin-oxidizing (FO) and the flavin-reducing (FR) conformations. Here, analysis of interdomain contacts as well as phylogenetic studies lead to the proposal of a new reaction scheme in which NTR–Trx interactions mediate the FO to FR transformation.

Genetic diversity among wild and cultivated barley as revealed by RFLP

DEFF Research Database (Denmark)

Petersen, L.; Østergård, H.; Giese, H.

1994-01-01

Genetic variability of cultivated and wild barley, Hordeum vulgare ssp. vulgare and spontaneum, respectively, was assessed by RFLP analysis. The material consisted of 13 European varietes, single-plant offspring lines of eight land races from Ethiopia and Nepal, and five accessions of ssp. sponta...... an intermediate level. The proportion of gene diversity residing among,geographical groups (F-ST) varied from 0.19 to 0.94 (average 0.54) per RFLP pattern, indicating large diversification between geographical groups....... was estimated and the barley lines clustered into five groups reflecting geographical origin. The geographical groups of land-race lines showed less intragroup variation than the geographical groups of spontaneum lines. The group of European varieties, representing large variation in agronomic traits, showed...

Hordein Variation in Wild (Hordeum Spontaneum) and Cultivated (H. Vulgare) Barley

DEFF Research Database (Denmark)

Doll, Hans; Brown, A. H. D.

1979-01-01

The storage protein hordein contains two major groups of polypeptides which are highly polymorphic in barley, and in its evolutionary progenitor Hordeum spontaneum Koch. Crosses between the two species showed that the complex electrophoretic phenotypes within the two groups of polypeptides are go...

The Effect of Trichoderma harzianum and Cadmium on Tolerance Index and Yield of Barley (Hordeum vulgare L.

Directory of Open Access Journals (Sweden)

F. Taghavi Ghasemkheyli

2015-01-01

Full Text Available To investigate the effect of Trichoderma harzianum, as a bioabsorbant to ameliorate the harmful effects of cadmium (Cd on growth and yield of barley (Hordeum vulgare L. variety ‘Sahra’, a factorial pot experiment based on completely randomized design with three replicates was conducted. Trichoderma harzianum withtwo levels (with and without inoculation and cadmium nitrate with four levels (0, 50, 100 and 150 mg.L-1 were the treatments. Results of ANOVA revealed that there was a significant interaction between Trichoderma and cadmium nitrate in terms of biological yield, straw yield, harvest index, spike number per plant and seed number per spike. Mean comparisons showed that Trichoderma inoculation at all Cd levels significantly improved both biological and straw yields. Trichoderma at 50 and 100 mg.L-1 of Cd also increased the spike number per plant (up to 120 and 66%, respectively significantly. Increasing Cd levels decreased seed yield (19%, 1000 seed weight (18%, partitioning coefficient (57% and tolerance index (23% significantly. Inoculation of Trichoderma into growth medium had a significant effect on seed yield and tolerance index (up to 17 and 22%, respectively. In conclusion, Trichoderma harzianum inoculation at lower concentrations of Cd (50 and 100 mg.L-1 could be effective to improve growth parameters of barley plant.

Regrowth in Barley (Hordeum vulgare L.) and Rye (Secale cereale L.)

DEFF Research Database (Denmark)

Christiansen, J L; Jørgensen, Johannes Ravn; Jørnsgård, B

1998-01-01

Regrowth after cutting at four development stages, from heading to grain maturity, was investigated in a pot experiment containing three rye and four barley varieties (including 2 Hordeum spontaneum lines). Regrowth in the barley varieties decreased strongly from heading to grain maturity. Rye ge...

Genome-Wide Association Mapping of Stem Rust Resistance in Hordeum vulgare subsp. spontaneum.

Science.gov (United States)

Sallam, Ahmad H; Tyagi, Priyanka; Brown-Guedira, Gina; Muehlbauer, Gary J; Hulse, Alex; Steffenson, Brian J

2017-10-05

Stem rust was one of the most devastating diseases of barley in North America. Through the deployment of cultivars with the resistance gene Rpg1 , losses to stem rust have been minimal over the past 70 yr. However, there exist both domestic (QCCJB) and foreign (TTKSK aka isolate Ug99) pathotypes with virulence for this important gene. To identify new sources of stem rust resistance for barley, we evaluated the Wild Barley Diversity Collection (WBDC) (314 ecogeographically diverse accessions of Hordeum vulgare subsp. spontaneum ) for seedling resistance to four pathotypes (TTKSK, QCCJB, MCCFC, and HKHJC) of the wheat stem rust pathogen ( Puccinia graminis f. sp. tritici , Pgt ) and one isolate (92-MN-90) of the rye stem rust pathogen ( P. graminis f. sp. secalis , Pgs ). Based on a coefficient of infection, the frequency of resistance in the WBDC was low ranging from 0.6% with HKHJC to 19.4% with 92-MN-90. None of the accessions was resistant to all five cultures of P. graminis A genome-wide association study (GWAS) was conducted to map stem rust resistance loci using 50,842 single-nucleotide polymorphic markers generated by genotype-by-sequencing and ordered using the new barley reference genome assembly. After proper accounting for genetic relatedness and structure among accessions, 45 quantitative trait loci were identified for resistance to P. graminis across all seven barley chromosomes. Three novel loci associated with resistance to TTKSK, QCCJB, MCCFC, and 92-MN-90 were identified on chromosomes 5H and 7H, and two novel loci associated with resistance to HKHJC were identified on chromosomes 1H and 3H. These novel alleles will enhance the diversity of resistance available for cultivated barley. Copyright © 2017 Sallam et al.

Barley (Hordeum vulgare) circadian clock genes can respond rapidly to temperature in an EARLY FLOWERING 3-dependent manner

Science.gov (United States)

Ford, Brett; Deng, Weiwei; Clausen, Jenni; Oliver, Sandra; Boden, Scott; Hemming, Megan; Trevaskis, Ben

2016-01-01

An increase in global temperatures will impact future crop yields. In the cereal crops wheat and barley, high temperatures accelerate reproductive development, reducing the number of grains per plant and final grain yield. Despite this relationship between temperature and cereal yield, it is not clear what genes and molecular pathways mediate the developmental response to increased temperatures. The plant circadian clock can respond to changes in temperature and is important for photoperiod-dependent flowering, and so is a potential mechanism controlling temperature responses in cereal crops. This study examines the relationship between temperature, the circadian clock, and the expression of flowering-time genes in barley (Hordeum vulgare), a crop model for temperate cereals. Transcript levels of barley core circadian clock genes were assayed over a range of temperatures. Transcript levels of core clock genes CCA1, GI, PRR59, PRR73, PRR95, and LUX are increased at higher temperatures. CCA1 and PRR73 respond rapidly to a decrease in temperature whereas GI and PRR59 respond rapidly to an increase in temperature. The response of GI and the PRR genes to changes in temperature is lost in the elf3 mutant indicating that their response to temperature may be dependent on a functional ELF3 gene. PMID:27580625

Development and validation of a terrestrial biotic ligand model predicting the effect of cobalt on root growth of barley (Hordeum vulgare)

International Nuclear Information System (INIS)

Lock, K.; De Schamphelaere, K.A.C.; Becaus, S.; Criel, P.; Van Eeckhout, H.; Janssen, C.R.

2007-01-01

A Biotic Ligand Model was developed predicting the effect of cobalt on root growth of barley (Hordeum vulgare) in nutrient solutions. The extent to which Ca 2+ , Mg 2+ , Na + , K + ions and pH independently affect cobalt toxicity to barley was studied. With increasing activities of Mg 2+ , and to a lesser extent also K + , the 4-d EC50 Co2+ increased linearly, while Ca 2+ , Na + and H + activities did not affect Co 2+ toxicity. Stability constants for the binding of Co 2+ , Mg 2+ and K + to the biotic ligand were obtained: log K CoBL = 5.14, log K MgBL = 3.86 and log K KBL = 2.50. Limited validation of the model with one standard artificial soil and one standard field soil showed that the 4-d EC50 Co2+ could only be predicted within a factor of four from the observed values, indicating further refinement of the BLM is needed. - Biotic Ligand Models are not only a useful tool to assess metal toxicity in aquatic systems but can also be used for terrestrial plants

Response of the rhizosphere prokaryotic community of barley (Hordeum vulgare L.) to elevated atmospheric CO2 concentration in open-top chambers.

Science.gov (United States)

Szoboszlay, Márton; Näther, Astrid; Mitterbauer, Esther; Bender, Jürgen; Weigel, Hans-Joachim; Tebbe, Christoph C

2017-08-01

The effect of elevated atmospheric CO 2 concentration [CO 2 ] on the diversity and composition of the prokaryotic community inhabiting the rhizosphere of winter barley (Hordeum vulgare L.) was investigated in a field experiment, using open-top chambers. Rhizosphere samples were collected at anthesis (flowering stage) from six chambers with ambient [CO 2 ] (approximately 400 ppm) and six chambers with elevated [CO 2 ] (700 ppm). The V4 region of the 16S rRNA gene was PCR-amplified from the extracted DNA and sequenced on an Illumina MiSeq instrument. Above-ground plant biomass was not affected by elevated [CO 2 ] at anthesis, but plants exposed to elevated [CO 2 ] had significantly higher grain yield. The composition of the rhizosphere prokaryotic communities was very similar under ambient and elevated [CO 2 ]. The dominant taxa were Bacteroidetes, Actinobacteria, Alpha-, Gamma-, and Betaproteobacteria. Elevated [CO 2 ] resulted in lower prokaryotic diversity in the rhizosphere, but did not cause a significant difference in community structure. © 2017 The Authors. MicrobiologyOpen published by John Wiley & Sons Ltd.

A Spectrophotometric Assay for Robust Viability Testing of Seed Batches Using 2,3,5-Triphenyl Tetrazolium Chloride: Using Hordeum vulgare L. as a Model

Directory of Open Access Journals (Sweden)

Laura Lopez Del Egido

2017-05-01

Full Text Available A comparative analysis was carried out of published methods to assess seed viability using 2,3,5-triphenyltetrazolium chloride (TTC based assays of seed batches. The tests were carried out on seeds of barley (Hordeum vulgare cv. Optic as a model. We established that 10% [w/v] trichloroacetic acid (TCA/methanol is superior to the acetone and methanol-only based methods: allowing the highest recovery of formazan and the lowest background optical density (OD readings, across seed lots comprising different ratios of viable and dead seeds. The method allowed a linear-model to accurately capture the statistically significant relationship between the quantity of formazan that could be extracted using the method we developed and the seed temperature-response, and seed viability as a function of artificially aged seed lots. Other quality control steps are defined to help ensure the assay is robust and these are reported in a Standard Operating Procedure.

Identification of two key genes controlling chill haze stability of beer in barley (Hordeum vulgare L).

Science.gov (United States)

Ye, Lingzhen; Huang, Yuqing; Dai, Fei; Ning, Huajiang; Li, Chengdao; Zhou, Meixue; Zhang, Guoping

2015-06-11

In bright beer, haze formation is a serious quality problem, degrading beer quality and reducing its shelf life. The quality of barley (Hordeum vulgare L) malt, as the main raw material for beer brewing, largely affects the colloidal stability of beer. In this study, the genetic mechanism of the factors affecting beer haze stability in barley was studied. Quantitative trait loci (QTL) analysis of alcohol chill haze (ACH) in beer was carried out using a Franklin/Yerong double haploid (DH) population. One QTL, named as qACH, was detected for ACH, and it was located on the position of about 108 cM in chromosome 4H and can explain about 20 % of the phenotypic variation. Two key haze active proteins, BATI-CMb and BATI-CMd were identified by proteomics analysis. Bioinformatics analysis showed that BATI-CMb and BATI-CMd had the same position as qACH in the chromosome. It may be deduced that BATI-CMb and BATI-CMd are candidate genes for qACH, controlling colloidal stability of beer. Polymorphism comparison between Yerong and Franklin in the nucleotide and amino acid sequence of BATI-CMb and BATI-CMd detected the corresponding gene specific markers, which could be used in marker-assisted selection for malt barley breeding. We identified a novel QTL, qACH controlling chill haze of beer, and two key haze active proteins, BATI-CMb and BATI-CMd. And further analysis showed that BATI-CMb and BATI-CMd might be the candidate genes associated with beer chill haze.

Dawn and Dusk Set States of the Circadian Oscillator in Sprouting Barley (Hordeum vulgare Seedlings.

Directory of Open Access Journals (Sweden)

Weiwei Deng

Full Text Available The plant circadian clock is an internal timekeeper that coordinates biological processes with daily changes in the external environment. The transcript levels of clock genes, which oscillate to control circadian outputs, were examined during early seedling development in barley (Hordeum vulgare, a model for temperate cereal crops. Oscillations of clock gene transcript levels do not occur in barley seedlings grown in darkness or constant light but were observed with day-night cycles. A dark-to-light transition influenced transcript levels of some clock genes but triggered only weak oscillations of gene expression, whereas a light-to-dark transition triggered robust oscillations. Single light pulses of 6, 12 or 18 hours induced robust oscillations. The light-to-dark transition was the primary determinant of the timing of subsequent peaks of clock gene expression. After the light-to-dark transition the timing of peak transcript levels of clock gene also varied depending on the length of the preceding light pulse. Thus, a single photoperiod can trigger initiation of photoperiod-dependent circadian rhythms in barley seedlings. Photoperiod-specific rhythms of clock gene expression were observed in two week old barley plants. Changing the timing of dusk altered clock gene expression patterns within a single day, showing that alteration of circadian oscillator behaviour is amongst the most rapid molecular responses to changing photoperiod in barley. A barley EARLY FLOWERING3 mutant, which exhibits rapid photoperiod-insensitive flowering behaviour, does not establish clock rhythms in response to a single photoperiod. The data presented show that dawn and dusk cues are important signals for setting the state of the circadian oscillator during early development of barley and that the circadian oscillator of barley exhibits photoperiod-dependent oscillation states.

Long-term agricultural fertilization alters arbuscular mycorrhizal fungal community composition and barley (Hordeum vulgare) mycorrhizal carbon and phosphorus exchange.

Science.gov (United States)

Williams, Alwyn; Manoharan, Lokeshwaran; Rosenstock, Nicholas P; Olsson, Pål Axel; Hedlund, Katarina

2017-01-01

Agricultural fertilization significantly affects arbuscular mycorrhizal fungal (AMF) community composition. However, the functional implications of community shifts are unknown, limiting understanding of the role of AMF in agriculture. We assessed AMF community composition at four sites managed under the same nitrogen (N) and phosphorus (P) fertilizer regimes for 55 yr. We also established a glasshouse experiment with the same soils to investigate AMF-barley (Hordeum vulgare) nutrient exchange, using carbon ( 13 C) and 33 P isotopic labelling. N fertilization affected AMF community composition, reducing diversity; P had no effect. In the glasshouse, AMF contribution to plant P declined with P fertilization, but was unaffected by N. Barley C allocation to AMF also declined with P fertilization. As N fertilization increased, C allocation to AMF per unit of P exchanged increased. This occurred with and without P fertilization, and was concomitant with reduced barley biomass. AMF community composition showed no relationship with glasshouse experiment results. The results indicate that plants can reduce C allocation to AMF in response to P fertilization. Under N fertilization, plants allocate an increasing amount of C to AMF and receive relatively less P. This suggests an alteration in the terms of P-C exchange under N fertilization regardless of soil P status. © 2016 The Authors. New Phytologist © 2016 New Phytologist Trust.

TaMSH7: A cereal mismatch repair gene that affects fertility in transgenic barley (Hordeum vulgare L.

Directory of Open Access Journals (Sweden)

Langridge Peter

2007-12-01

Full Text Available Abstract Background Chromosome pairing, recombination and DNA repair are essential processes during meiosis in sexually reproducing organisms. Investigating the bread wheat (Triticum aestivum L. Ph2 (Pairing homoeologous locus has identified numerous candidate genes that may have a role in controlling such processes, including TaMSH7, a plant specific member of the DNA mismatch repair family. Results Sequencing of the three MSH7 genes, located on the short arms of wheat chromosomes 3A, 3B and 3D, has revealed no significant sequence divergence at the amino acid level suggesting conservation of function across the homoeogroups. Functional analysis of MSH7 through the use of RNAi loss-of-function transgenics was undertaken in diploid barley (Hordeum vulgare L.. Quantitative real-time PCR revealed several T0 lines with reduced MSH7 expression. Positive segregants from two T1 lines studied in detail showed reduced MSH7 expression when compared to transformed controls and null segregants. Expression of MSH6, another member of the mismatch repair family which is most closely related to the MSH7 gene, was not significantly reduced in these lines. In both T1 lines, reduced seed set in positive segregants was observed. Conclusion Results presented here indicate, for the first time, a distinct functional role for MSH7 in vivo and show that expression of this gene is necessary for wild-type levels of fertility. These observations suggest that MSH7 has an important function during meiosis and as such remains a candidate for Ph2.

Leaf rust of cultivated barley: pathology and control.

Science.gov (United States)

Park, Robert F; Golegaonkar, Prashant G; Derevnina, Lida; Sandhu, Karanjeet S; Karaoglu, Haydar; Elmansour, Huda M; Dracatos, Peter M; Singh, Davinder

2015-01-01

Leaf rust of barley is caused by the macrocyclic, heteroecious rust pathogen Puccinia hordei, with aecia reported from selected species of the genera Ornithogalum, Leopoldia, and Dipcadi, and uredinia and telia occurring on Hordeum vulgare, H. vulgare ssp. spontaneum, Hordeum bulbosum, and Hordeum murinum, on which distinct parasitic specialization occurs. Although Puccinia hordei is sporadic in its occurrence, it is probably the most common and widely distributed rust disease of barley. Leaf rust has increased in importance in recent decades in temperate barley-growing regions, presumably because of more intensive agricultural practices. Although total crop loss does not occur, under epidemic conditions yield reductions of up to 62% have been reported in susceptible varieties. Leaf rust is primarily controlled by the use of resistant cultivars, and, to date, 21 seedling resistance genes and two adult plant resistance (APR) genes have been identified. Virulence has been detected for most seedling resistance genes but is unknown for the APR genes Rph20 and Rph23. Other potentially new sources of APR have been reported, and additivity has been described for some of these resistances. Approaches to achieving durable resistance to leaf rust in barley are discussed.

Interactions and Toxicity of Cu-Zn mixtures to Hordeum vulgare in Different Soils Can Be Rationalized with Bioavailability-Based Prediction Models.

Science.gov (United States)

Qiu, Hao; Versieren, Liske; Rangel, Georgina Guzman; Smolders, Erik

2016-01-19

Soil contamination with copper (Cu) is often associated with zinc (Zn), and the biological response to such mixed contamination is complex. Here, we investigated Cu and Zn mixture toxicity to Hordeum vulgare in three different soils, the premise being that the observed interactions are mainly due to effects on bioavailability. The toxic effect of Cu and Zn mixtures on seedling root elongation was more than additive (i.e., synergism) in soils with high and medium cation-exchange capacity (CEC) but less than additive (antagonism) in a low-CEC soil. This was found when we expressed the dose as the conventional total soil concentration. In contrast, antagonism was found in all soils when we expressed the dose as free-ion activities in soil solution, indicating that there is metal-ion competition for binding to the plant roots. Neither a concentration addition nor an independent action model explained mixture effects, irrespective of the dose expressions. In contrast, a multimetal BLM model and a WHAM-Ftox model successfully explained the mixture effects across all soils and showed that bioavailability factors mainly explain the interactions in soils. The WHAM-Ftox model is a promising tool for the risk assessment of mixed-metal contamination in soils.

Quantitative Trait Loci and Inter-Organ Partitioning for Essential Metal and Toxic Analogue Accumulation in Barley.

Directory of Open Access Journals (Sweden)

Stefan Reuscher

Full Text Available The concentrations of both essential nutrients and chemically similar toxic analogues accumulated in cereal grains have a major impact on the nutritional quality and safety of crops. Naturally occurring genetic diversity can be exploited for the breeding of improved varieties through introgression lines (ILs. In this study, multi-element analysis was conducted on vegetative leaves, senesced flag leaves and mature grains of a set of 54 ILs of the wild ancestral Hordeum vulgare ssp. spontaneum in the cultivated variety Hordeum vulgare ssp. vulgare cv. Scarlett. Plants were cultivated on an anthropogenically heavy metal-contaminated soil collected in an agricultural field, thus allowing simultaneous localization of quantitative trait loci (QTL for the accumulation of both essential nutrients and toxic trace elements in barley as a model cereal crop. For accumulation of the micronutrients Fe and Zn and the interfering toxin Cd, we identified 25, 16 and 5 QTL, respectively. By examining the gene content of the introgressions, we associated QTL with candidate genes based on homology to known metal homeostasis genes of Arabidopsis and rice. Global comparative analyses suggested the preferential remobilization of Cu and Fe, over Cd, from the flag leaf to developing grains. Our data identifies grain micronutrient filling as a regulated and nutrient-specific process, which operates differently from vegetative micronutrient homoeostasis. In summary, this study provides novel QTL for micronutrient accumulation in the presence of toxic analogues and supports a higher degree of metal specificity of trace element partitioning during grain filling in barley than previously reported for other cereals.

Use of Co speciation and soil properties to explain variation in Co toxicity to root growth of barley (Hordeum vulgare L.) in different soils

International Nuclear Information System (INIS)

Mico, C.; Li, H.F.; Zhao, F.J.; McGrath, S.P.

2008-01-01

The influence of soil properties on the bioavailability and toxicity of Co to barley (Hordeum vulgare L.) root elongation was investigated. Ten soils varying widely in soil properties were amended with seven doses of CoCl 2 . Soil properties greatly influenced the expression of Co toxicity. The effective concentration of added Co causing 50% inhibition (EC 50 ) ranged from 45 to 863 mg kg -1 , representing almost 20-fold variation among soils. Furthermore, we investigated Co toxicity in relation to Co concentrations and free Co 2+ activity in soil solution. The EC 50 values showed variation among soils of 17- and 29-fold, based on the Co concentration in soil solution and free Co 2+ activity, respectively. Single regressions were carried out between Co toxicity threshold values and selected soil properties. Models obtained showed that soil effective cation exchange capacity (eCEC) and exchangeable calcium were the most consistent single predictors of the EC 50 values based on soil added Co. - Soil eCEC and exchangeable Ca were found to be the best predictors of the toxicity threshold values of Co to barley root growth on different soils

Japon Balığı (Carassius Auratus L. 1758) ve Arpa Bitkisinin (Hordeum Vulgare L.) Gelişimi ve Su Kalitesinin İyileştirilmesi Üzerine Aquaponik Sistemin Etkileri

OpenAIRE

KESKİNBALTA, Mehmet Anıl; HAMZAOĞLU, Gökhan; ÇELİK, Meryem Yeşim; DERNEKBAŞI, Seval

2015-01-01

Bu araştırmada, Japon balığı (Carassius auratus L. 1758) ve arpa bitkisi (Hordeum vulgare L.) kullanılarak model bir akuaponik sistem oluşturulmuştur. Araştırma süresince arpa bitkisinin suyun nitrit, nitrat ve fosfat değerlerinde yaptığı değişim ve balıkların gelişimi üzerindeki etkilerinin belirlenmesi amaçlanmıştır. 30 günlük araştırma süresince günlük olarak pH, sıcaklık ve oksijen değerleri ölçülmüştür. Haftalık olarak bitki yetiştirme yatağına giren ve bitkiden süzülen suyun nitrit (NO2...

Japon Balığı (Carassius auratus L. 1758) ve Arpa Bitkisinin (Hordeum vulgare L.) Gelişimi ve Su Kalitesinin İyileştirilmesi Üzerine Aquaponik Sistemin Etkileri

OpenAIRE

KESKİNBALTA, Mehmet; HAMZAOĞLU, Gökhan; ÇELİK, Meryem; DERNEKBAŞI, Seval

2015-01-01

Bu araştırmada, Japon balığı (Carassius auratus L. 1758) ve arpa bitkisi (Hordeum vulgare L.) kullanılarak model bir akuaponik sistem oluşturulmuştur. Araştırma süresince arpa bitkisinin suyun nitrit, nitrat ve fosfat değerlerinde yaptığı değişim ve balıkların gelişimi üzerindeki etkilerinin belirlenmesi amaçlanmıştır. 30 günlük araştırma süresince günlük olarak pH, sıcaklık ve oksijen değerleri ölçülmüştür. Haftalık olarak bitki yetiştirme yatağına giren ve bitkiden süzülen suyun nitrit (NO2...

Differential responses of two Egyptian barley (Hordeum vulgare L.) cultivars to salt stress.

Science.gov (United States)

Elsawy, Hayam I A; Mekawy, Ahmad Mohammad M; Elhity, Mahmoud A; Abdel-Dayem, Sherif M; Abdelaziz, Maha Nagy; Assaha, Dekoum V M; Ueda, Akihiro; Saneoka, Hirofumi

2018-06-01

Although barley (Hordeum vulgare L.) is considered a salt tolerant crop species, productivity of barley is affected differently by ionic, osmotic, and oxidative stresses resulting from a salty rhizosphere. The current study was conducted to elucidate the mechanism of salt tolerance in two barley cultivars, Giza128 and Giza126. The two cultivars were exposed to 200 mM NaCl hydroponically for 12 days. Although both cultivars accumulated a large amount of Na + in their leaves with similar concentrations, the growth of Giza128 was much better than that of Giza126, as measured by maintaining a higher dry weight, relative growth rate, leaf area, and plant height. To ascertain the underlying mechanisms of this differential tolerance, first, the relative expression patterns of the genes encoding Na + /H + antiporters (NHX) and the associated proton pumps (V-PPase and V-ATPase) as well as the gene encoding the plasma membrane PM H + -ATPase were analyzed in leaf tissues. Salt stress induced higher HvNHX1 expression in Giza128 (3.3-fold) than in Giza126 (1.9-fold), whereas the expression of the other two genes, HvNHX2 and HvNHX3, showed no induction in either cultivar. The expression of HvHVP1 and HvHVA was higher in Giza128 (3.8- and 2.1-fold, respectively) than in Giza126 (1.6- and 1.1-fold, respectively). The expression of the PM H + -ATPase (ha1) gene was induced more in Giza128 (8.8-fold) than in Giza126 (1.8-fold). Second, the capacity for ROS detoxification was assessed using the oxidative stress biomarkers electrolyte leakage ratio (ELR) and the concentrations of malondialdehyde (MDA) and hydrogen peroxide (H 2 O 2 ), and these parameters sharply increased in Giza126 leaves by 66.5%, 42.8% and 50.0%, respectively, compared with those in Giza128 leaves. The antioxidant enzyme (CAT, APX, sPOD, GR, and SOD) activities were significantly elevated by salt treatment in Giza128 leaves, whereas in Giza126, these activities were not significantly altered. Overall, the

Direct Effects of Physcion, Chrysophanol, Emodin, and Pachybasin on Germination and Appressorium Formation of the Barley ( Hordeum vulgare L.) Powdery Mildew Fungus Blumeria graminis f. sp. hordei (DC.) Speer.

Science.gov (United States)

Hildebrandt, Ulrich; Marsell, Alexander; Riederer, Markus

2018-04-04

Several anthraquinone derivatives are active components of fungicidal formulations particularly effective against powdery mildew fungi. The antimildew effect of compounds such as physcion and chrysophanol is largely attributed to host plant defense induction. However, so far a direct fungistatic/fungicidal effect of anthraquinone derivatives on powdery mildew fungi has not been unequivocally demonstrated. By applying a Formvar-based in vitro system we demonstrate a direct, dose-dependent effect of physcion, chrysophanol, emodin, and pachybasin on conidial germination and appressorium formation of Blumeria graminis f. sp. hordei (DC.) Speer, the causative agent of barley ( Hordeum vulgare L.) powdery mildew. Physcion was the most effective among the tested compounds. At higher doses, physcion mainly inhibited conidial germination. At lower rates, however, a distinct interference with appressorium formation became discernible. Physcion and others may act by modulating both the infection capacity of the powdery mildew pathogen and host plant defense. Our results suggest a specific arrangement of substituents at the anthraquinone backbone structure being crucial for the direct antimildew effect.

Improving phenolic bioactive-linked anti-hyperglycemic functions of dark germinated barley sprouts (Hordeum vulgare L.) using seed elicitation strategy.

Science.gov (United States)

Ramakrishna, Ramnarain; Sarkar, Dipayan; Manduri, Avani; Iyer, Shreyas Ganesan; Shetty, Kalidas

2017-10-01

Sprouts of cereal grains, such as barley ( Hordeum vulgare L.), are a good source of beneficial phenolic bioactives. Such health relevant phenolic bioactives of cereal sprouts can be targeted to manage chronic hyperglycemia and oxidative stress commonly associated with type 2 diabetes (T2D). Therefore improving phenolic bioactives by stimulating plant endogenous defense responses such as protective pentose phosphate pathway (PPP) during sprouting has significant merit. Based on this metabolic rationale, this study aimed to enhance phenolic bioactives and associated antioxidant and anti-hyperglycemic functions in dark germinated barley sprouts using exogenous elicitor treatments. Dark-germinated sprouts of two malting barley cultivars (Pinnacle and Celebration), treated with chitosan oligosaccharide (COS) and marine protein hydrolysate (GP), were evaluated. Total soluble phenolic content (TSP), phenolic acid profiles, total antioxidant activity (TA) and in vitro inhibitory activities of hyperglycemia relevant α-amylase and α-glucosidase enzymes of the dark germinated barley sprouts were evaluated at day 2, 4, and 6 post elicitor treatments. Overall, TSP content, TA, and α-amylase inhibitory activity of dark germinated barley sprouts decreased, while α-glucosidase inhibitory activity and gallic acid content increased from day 2 to day 6. Among barley cultivars, high phenolic antioxidant-linked anti-hyperglycemic bioactives were observed in Celebration. Furthermore, GP and COS seed elicitor treatments in selective doses improved T2D relevant phenolic-linked anti-hyperglycemic bioactives of barley spouts at day 6. Therefore, such seed elicitation approach can be strategically used to develop bioactive enriched functional food ingredients from cereal sprouts targeting chronic hyperglycemia and oxidative stress linked to T2D.

Effects of Cerium and Titanium Oxide Nanoparticles in Soil on the Nutrient Composition of Barley (Hordeum vulgare L. Kernels

Directory of Open Access Journals (Sweden)

Filip Pošćić

2016-06-01

Full Text Available The implications of metal nanoparticles (MeNPs are still unknown for many food crops. The purpose of this study was to evaluate the effects of cerium oxide (nCeO2 and titanium oxide (nTiO2 nanoparticles in soil at 0, 500 and 1000 mg·kg−1 on the nutritional parameters of barley (Hordeum vulgare L. kernels. Mineral nutrients, amylose, β-glucans, amino acid and crude protein (CP concentrations were measured in kernels. Whole flour samples were analyzed by ICP-AES/MS, HPLC and Elemental CHNS Analyzer. Results showed that Ce and Ti accumulation under MeNPs treatments did not differ from the control treatment. However, nCeO2 and nTiO2 had an impact on composition and nutritional quality of barley kernels in contrasting ways. Both MeNPs left β-glucans unaffected but reduced amylose content by approximately 21%. Most amino acids and CP increased. Among amino acids, lysine followed by proline saw the largest increase (51% and 37%, respectively. Potassium and S were both negatively impacted by MeNPs, while B was only affected by 500 mg nCeO2·kg−1. On the contrary Zn and Mn concentrations were improved by 500 mg nTiO2·kg−1, and Ca by both nTiO2 treatments. Generally, our findings demonstrated that kernels are negatively affected by nCeO2 while nTiO2 can potentially have beneficial effects. However, both MeNPs have the potential to negatively impact malt and feed production.

Effect of soil nutrients reserves and level of fertilisation on production parameters of spring barley (Hordeum vulgare L.

Directory of Open Access Journals (Sweden)

Petr Škarpa

2006-01-01

Full Text Available The effect of three different doses of basic fertilisers and a subsequent pre-sowing supplementary fertilisation on production parameters (yield of grain, number of spikes, and thousand grains weight was evaluated using experimental data obtained within the framework of a one-year pot experiment with spring barley (Hordeum vulgare L. established at the Department of Agrochemistry and Plant Nutrition, Faculty of Agronomy, Mendel University of Agriculture and Forestry Brno in 2003. Results of statistical analysis indicated that the yield of grain was significantly influenced by different doses of fertilisers especially on sandy soils. As compared with control, the second highest dose of fertilisers (i.e. 83 kg N, 31 kg P and 92 kg K.ha–1 increased the yield by 91.7 % and the third one (i.e. 113 kg N, 43 kg P and 125 kg K.ha–1 even by 124.8 %. This increase in the grain yield was positively affected above all by increasing doses of nitrogen fertilisers. A pre-sowing application of P, K and Mg showed also a positive effect on grain yield not only on sandy but above all on clay soils (as compared with non-fertilised control, this increase ranged from 40.6 to 50.2%. Fertilisation showed also a marked effect on the number of spikes. This factor showed a similar trend as the yield of grain. The thousand grains weight was not significantly influenced on both soil types. This value was increased (by 2.9% to 14.8% after the application of fertilisers prior to sowing but the difference was statistically non-significant.

Chemical composition and biological activity of the essential oil of Origanum vulgare ssp. hirtum from different areas in the Southern Apennines (Italy).

Science.gov (United States)

Mancini, Emilia; Camele, Ippolito; Elshafie, Hazem S; De Martino, Laura; Pellegrino, Carlo; Grulova, Daniela; De Feo, Vincenzo

2014-04-01

The chemical composition of the essential oils of Origanum vulgare ssp. hirtum, growing wild in three different localities in the Southern Apennines, was studied by GC-FID and GC/MS analyses. In total, 103 compounds were identified. The oils were mainly composed of phenolic compounds and all oils belonged to the chemotype carvacrol/thymol. The three essential oils were evaluated for their in vitro phytotoxic activity by determining their influence on the germination and initial radicle elongation of Sinapis arvensis L., Phalaris canariensis L., Lepidium sativum L., and Raphanus sativus L. The seed germination and radicle growth were affected in various degrees. Moreover, the antifungal activity of the three essential oils was assayed against three species causing pre- and postharvest fruit decay (Monilinia laxa, M. fructigena, and M. fructicola). At 1000 ppm, the three oils completely inhibited fungal growth. The hemolytic activity of the oils was assayed and showed no effect on the cell membranes of bovine erythrocytes. Copyright © 2014 Verlag Helvetica Chimica Acta AG, Zürich.

Molecular dynamics simulations revealed structural differences among WRKY domain-DNA interaction in barley (Hordeum vulgare).

Science.gov (United States)

Pandey, Bharati; Grover, Abhinav; Sharma, Pradeep

2018-02-12

The WRKY transcription factors are a class of DNA-binding proteins involved in diverse plant processes play critical roles in response to abiotic and biotic stresses. Genome-wide divergence analysis of WRKY gene family in Hordeum vulgare provided a framework for molecular evolution and functional roles. So far, the crystal structure of WRKY from barley has not been resolved; moreover, knowledge of the three-dimensional structure of WRKY domain is pre-requisites for exploring the protein-DNA recognition mechanisms. Homology modelling based approach was used to generate structures for WRKY DNA binding domain (DBD) and its variants using AtWRKY1 as a template. Finally, the stability and conformational changes of the generated model in unbound and bound form was examined through atomistic molecular dynamics (MD) simulations for 100 ns time period. In this study, we investigated the comparative binding pattern of WRKY domain and its variants with W-box cis-regulatory element using molecular docking and dynamics (MD) simulations assays. The atomic insight into WRKY domain exhibited significant variation in the intermolecular hydrogen bonding pattern, leading to the structural anomalies in the variant type and differences in the DNA-binding specificities. Based on the MD analysis, residual contribution and interaction contour, wild-type WRKY (HvWRKY46) were found to interact with DNA through highly conserved heptapeptide in the pre- and post-MD simulated complexes, whereas heptapeptide interaction with DNA was missing in variants (I and II) in post-MD complexes. Consequently, through principal component analysis, wild-type WRKY was also found to be more stable by obscuring a reduced conformational space than the variant I (HvWRKY34). Lastly, high binding free energy for wild-type and variant II allowed us to conclude that wild-type WRKY-DNA complex was more stable relative to variants I. The results of our study revealed complete dynamic and structural information

A flavonoid mutant of barley (Hordeum vulgare L.) exhibits increased sensitivity to UV-B radiation in the primary leaf

International Nuclear Information System (INIS)

Reuber, S.; Bornman, J.F.; Weissenböck, G.

1996-01-01

The aim of the present investigation was to define the role of soluble flavonoids as UV-B protectants in the primary leaf of barley (Hordeum vulgare L.). For this purpose we used a mutant line (Ant 287) from the Carlsberg collection of proanthocyanidin-free barley containing only 7% of total extractable flavonoids in the primary leaf as compared to the mother variety (Hiege 550/75). Seven-day-old leaves from plants grown under high visible light with or without supplementary UV-B radiation were used for the determination of UV-B sensitivity. UV-B-induced changes were assessed from parameters of chlorophyll fluorescence of photosystem II, including initial and maximum fluorescence, apparent quantum yield, and photochemical and non-photochemical quenching. A quartz fibre-optic microprobe was used to evaluate the amount of potentially harmful UV-B (310 nm radiation) penetrating into the leaf as a direct consequence of flavonoid deficiency. Our data indicate an essential role of flavonoids in UV-B protection of barley primary leaves. In leaves of the mutant line grown under supplementary UV-B, an increase in 310nm radiation in the mesophyll and a strong decrease in the quantum yield of photosynthesis were observed as compared to the corresponding mother variety. Primary leaves of liege responded to supplementary UV-B radiation with a 30% increase in the major flavonoid saponarin and a 500% increase in the minor compound lutonarin. This is assumed to be an efficient protective response since no changes in variable chlorophyll fluorescence were apparent. In addition, a further reduction in UV-B penetration into the mesophyll was recorded in these leaves

Low-Resolution Structure of the Full-Length Barley (Hordeum vulgare) SGT1 Protein in Solution, Obtained Using Small-Angle X-Ray Scattering

Science.gov (United States)

Taube, Michał; Pieńkowska, Joanna R.; Jarmołowski, Artur; Kozak, Maciej

2014-01-01

SGT1 is an evolutionarily conserved eukaryotic protein involved in many important cellular processes. In plants, SGT1 is involved in resistance to disease. In a low ionic strength environment, the SGT1 protein tends to form dimers. The protein consists of three structurally independent domains (the tetratricopeptide repeats domain (TPR), the CHORD- and SGT1-containing domain (CS), and the SGT1-specific domain (SGS)), and two less conserved variable regions (VR1 and VR2). In the present study, we provide the low-resolution structure of the barley (Hordeum vulgare) SGT1 protein in solution and its dimer/monomer equilibrium using small-angle scattering of synchrotron radiation, ab-initio modeling and circular dichroism spectroscopy. The multivariate curve resolution least-square method (MCR-ALS) was applied to separate the scattering data of the monomeric and dimeric species from a complex mixture. The models of the barley SGT1 dimer and monomer were formulated using rigid body modeling with ab-initio structure prediction. Both oligomeric forms of barley SGT1 have elongated shapes with unfolded inter-domain regions. Circular dichroism spectroscopy confirmed that the barley SGT1 protein had a modular architecture, with an α-helical TPR domain, a β-sheet sandwich CS domain, and a disordered SGS domain separated by VR1 and VR2 regions. Using molecular docking and ab-initio protein structure prediction, a model of dimerization of the TPR domains was proposed. PMID:24714665

Antibacterial activity and GC/MS analysis of the essential oils from flower, leaf and stem of Origanum vulgare ssp. viride growing wild in north-west Iran.

Science.gov (United States)

Shafaghat, Ali

2011-09-01

Essential oils obtained from flowers, leaves and stems of Origanum vulgare L. ssp. viride (Boiss.) Hayek., growing wild in Ardabil Province (north-west Iran), were analyzed by GC and GC/MS. beta-Caryophyllene was the major constituent in all three oils (48.1%, 50.1% and 60.2%, respectively). Of the 19 components detected in the flower oil, comprising 96.3% of the total, the major components were 1,8-cineole (11.6%), alpha-pinene (6.9%), and gamma-cadinene (4.8%). 1-Octen-3-ol (23.8%), and 1,8-cineole (8.5%) predominated in the leafoil. In the stem oil, other main constituents were bicyclogermacrene (9.8%), 1,8-cineole (6.4%), borneol (5.1%), and pinocarvone (4.4%). The essential oils were evaluated for their antibacterial activity against 10 selected microorganisms. The data obtained contribute to the future use of certain essential oils as natural preservatives for food products, due to their safety and positive effect on shelf life.

Development and Validation of a Reversed-Phase Liquid Chromatography Method for the Simultaneous Determination of Indole-3-Acetic Acid, Indole-3-Pyruvic Acid, and Abscisic Acid in Barley (Hordeum vulgare L.).

Science.gov (United States)

Nakurte, Ilva; Keisa, Anete; Rostoks, Nils

2012-01-01

A simple, sensitive, precise, and specific reverse HPLC method was developed and validated for the determination of plant hormones in barley (Hordeum vulgare L.). The method includes extraction in aqueous organic solvent followed by solid-phase extraction, sample evaporation, and reversed-phase HPLC analysis in a general purpose UV-visible (abscisic acid (ABA)) and fluorescence detection (indole-3-acetic acid (IAA) and indole-3-pyruvic acid (IPA)), high-performance liquid chromatography system. The separation was carried out on Zorbax Eclipse XDB C8 column (150  ×  4.6  mm I.D) with a mobile phase composed of methanol and 1% acetic acid (60 : 40 v/v) in isocratic mode at a flow rate of 1 ml min(-1). The detection was monitored at 270 nm (ABA) and at 282 nm (Ex) and 360 nm (Em) (IAA, IPA). The developed method was validated in terms of accuracy, precision, linearity, limit of detection, limit of quantification, and robustness. The determined validation parameters are in the commonly acceptable ranges for that kind of analysis.

Salinity tolerance in barley (hordeum vulgare l.): effects of varying NaCl, K/sup +/ Na/sup +/ and NaHCO/sub 3/ levels on cultivars differing in tolerance

International Nuclear Information System (INIS)

Mahmood, K.

2011-01-01

Although barley (Hordeum vulgare L.) is regarded as salt tolerant among crop plants, its growth and plant development is severely affected by ionic and osmotic stresses in salt-affected soils. To elucidate the tolerance mechanism, growth and ion uptake of three barley cultivars, differing in salt tolerance, were examined under different levels of NaCl, K/sup +/ Na/sup +/ and NaHCO/sub 3/ in the root medium. The cultivars differed greatly in their responses to varying root medium conditions. Plant growth was more adversely affected by NaHCO/sub 3/ than NaCl. In general, biomass yields were comparable under control and 100 mM NaCl. However, growth of all three cultivars was significantly inhibited by NaHCO/sub 3/ even at low concentration (10 mM). Improved K/sup +/ supply in saline medium increased K/sup +/ uptake and growth of less tolerant cultivars. K/sup +/ uptake was more adversely affected by NaHCO/sub 3/ than NaCl salinity. Selective K/sup +/ uptake and lower Cl/sup -/ in shoots seemed to be associated with the growth responses. K application would help better growth of these cultivars on K-deficient saline-sodic soils and under irrigation with poor quality water having high Residual Sodium Carbonate (RSC) and/or Sodium Adsorption Ratio (SAR). (author)

Giemsa C-banding in two polyploid, South American Hordeum species, H. tetraploidum and H. lechleri, and their aneuploid hybrids with H. vulgare

DEFF Research Database (Denmark)

Linde-Laursen, Ib; Bothmer, R. von

1986-01-01

. The hybrids were stably aneuploid. Both had lost and acquired H. vulgare chromosomes. Thus, somatic elimination of chromosomes was combined with multiplication of chromosomes. The observations of stably aneuploid hybrids have implications for the exploitation of alien germplasm. The activity of non-H. vulgare...

Detection of QTLs for seedling characteristics in barley (Hordeum vulgare L.) grown under hydroponic culture condition.

Science.gov (United States)

Wang, Qifei; Sun, Genlou; Ren, Xifeng; Wang, Jibin; Du, Binbin; Li, Chengdao; Sun, Dongfa

2017-11-07

Seedling characteristics play significant roles in the growth and development of barley (Hordeum vulgare L.), including stable stand establishment, water and nutrients uptake, biotic resistance and abiotic stresses, and can influence yield and quality. However, the genetic mechanisms underlying seedling characteristics in barley are largely unknown and little research has been done. In the present work, 21 seedling-related characteristics are assessed in a barley double haploid (DH) population, grown under hydroponic conditions. Of them, leaf age (LAG), shoot height (SH), maximum root length (MRL), main root number (MRN) and seedling fresh weight (SFW) were investigated at the 13th, 20th, 27th, and 34th day after germination. The objectives were to identify quantitative trait loci (QTLs) underlying these seedling characteristics using a high-density linkage map and to reveal the QTL expression pattern by comparing the QTLs among four different seedling growth stages. A total of 70 QTLs were distributed over all chromosomes except 4H, and, individually, accounted for 5.01%-77.78% of phenotypic variation. Out of the 70 detected QTLs, 23 showed a major effect on 14 seedling-related characteristics. Ten co-localized chromosomal regions on 2H (five regions), 3H (two regions) and 7H (three regions) involved 39 QTLs (55.71%), each simultaneously influenced more than one trait. Meanwhile, 9 co-localized genomic regions involving 22 QTLs for five seedling characteristics (LAG, SH, MRL, MRN and SFW) at the 13th, 20th, 27th and 34th day-old seedling were common for two or more growth stages of seedling. QTL in the vicinity of Vrs1 locus on chromosome 2H with the favorable alleles from Huadamai 6 was found to have the largest main effects on multiple seedling-related traits. Six QTL cluster regions associated with 16 seedling-related characteristics were observed on chromosome 2H, 3H and 7H. The majority of the 29 regions identified for five seedling characteristics were

An eceriferum locus, cer-zv, is associated with a defect in cutin responsible for water retention in barley (Hordeum vulgare) leaves.

Science.gov (United States)

Li, Chao; Wang, Aidong; Ma, Xiaoying; Pourkheirandish, Mohammad; Sakuma, Shun; Wang, Ning; Ning, Shunzong; Nevo, Eviatar; Nawrath, Christiane; Komatsuda, Takao; Chen, Guoxiong

2013-03-01

Drought limits plant growth and threatens crop productivity. A barley (Hordeum vulgare) ethylene imine-induced monogenic recessive mutant cer-zv, which is sensitive to drought, was characterized and genetically mapped in the present study. Detached leaves of cer-zv lost 34.2 % of their initial weight after 1 h of dehydration. The transpiration was much higher in cer-zv leaves than in wild-type leaves under both light and dark conditions. The stomata of cer-zv leaves functioned normally, but the cuticle of cer-zv leaves showed increased permeability to ethanol and toluidine blue dye. There was a 50-90 % reduction in four major cutin monomers, but no reduction in wax loads was found in the cer-zv mutant as compared with the wild type. Two F(2) mapping populations were established by the crosses of 23-19 × cer-zv and cer-zv × OUH602. More polymorphisms were found in EST sequences between cer-zv and OUH602 than between cer-zv and 23-19. cer-zv was located in a pericentromeric region on chromosome 4H in a 10.8 cM interval in the 23-19 × cer-zv map based on 186 gametes tested and a 1.7 cM interval in the cer-zv × OUH602 map based on 176 gametes tested. It co-segregated with EST marker AK251484 in both maps. The results indicated that the cer-zv mutant is defective in cutin, which might be responsible for the increased transpiration rate and drought sensitivity, and that the F(2) of cer-zv × OUH602 might better facilitate high resolution mapping of cer-zv.

Phylogenetic and comparative gene expression analysis of barley (Hordeum vulgare)WRKY transcription factor family reveals putatively retained functions betweenmonocots and dicots

Energy Technology Data Exchange (ETDEWEB)

Mangelsen, Elke; Kilian, Joachim; Berendzen, Kenneth W.; Kolukisaoglu, Uner; Harter, Klaus; Jansson, Christer; Wanke, Dierk

2008-02-01

WRKY proteins belong to the WRKY-GCM1 superfamily of zinc finger transcription factors that have been subject to a large plant-specific diversification. For the cereal crop barley (Hordeum vulgare), three different WRKY proteins have been characterized so far, as regulators in sucrose signaling, in pathogen defense, and in response to cold and drought, respectively. However, their phylogenetic relationship remained unresolved. In this study, we used the available sequence information to identify a minimum number of 45 barley WRKY transcription factor (HvWRKY) genes. According to their structural features the HvWRKY factors were classified into the previously defined polyphyletic WRKY subgroups 1 to 3. Furthermore, we could assign putative orthologs of the HvWRKY proteins in Arabidopsis and rice. While in most cases clades of orthologous proteins were formed within each group or subgroup, other clades were composed of paralogous proteins for the grasses and Arabidopsis only, which is indicative of specific gene radiation events. To gain insight into their putative functions, we examined expression profiles of WRKY genes from publicly available microarray data resources and found group specific expression patterns. While putative orthologs of the HvWRKY transcription factors have been inferred from phylogenetic sequence analysis, we performed a comparative expression analysis of WRKY genes in Arabidopsis and barley. Indeed, highly correlative expression profiles were found between some of the putative orthologs. HvWRKY genes have not only undergone radiation in monocot or dicot species, but exhibit evolutionary traits specific to grasses. HvWRKY proteins exhibited not only sequence similarities between orthologs with Arabidopsis, but also relatedness in their expression patterns. This correlative expression is indicative for a putative conserved function of related WRKY proteins in mono- and dicot species.

Effects of dietary Greek oregano (Origanum vulgare ssp. hirtum) supplementation on rumen fermentation, enzyme profile and microbial communities in goats.

Science.gov (United States)

Paraskevakis, N

2017-10-14

This study was conducted to examine in vivo long-term effects of dietary dried oregano (Origanum vulgare ssp. hirtum) whole plant on rumen fermentation, enzyme profile and microbial communities. For this purpose, eight healthy, adult, non-lactating Alpine goats were kept in tie stalls equipped for individual feeding and randomly divided into two homogeneous groups: one fed 0.6 kg of a concentrate mixture and 0.6 kg of wheat straw without any supplementation and served as control group (CON) while the other group (OR) fed the same diet of CON but supplemented with 20 g of dried oregano plants (OPs) to provide daily dosage of 1 ml of essential oil (EO) per animal. The experimental period lasted 69 days and individual rumen fluid samples were obtained every 2 weeks at 0 and 4 hr after feeding. The results showed that dietary supplementation with OPs increased the protease activity (p < .001) and ammonia concentration (p < .05) in the rumen. Among the studied microbial populations, Peptostreptococcus anaerobius (p = .028) and Clostridium sticklandii (p < .001) were found to be the most sensitive to oregano at the current dosage. Furthermore, the total methanogen population significantly decreased (p < .05). It is concluded that a long-term dietary administration of OPs can suppress specific rumen micro-organisms and modify rumen fermentation favourably at least by means of suppressing methanogens. © 2017 Blackwell Verlag GmbH.

A Substantial Fraction of Barley (Hordeum vulgare L. Low Phytic Acid Mutations Have Little or No Effect on Yield across Diverse Production Environments

Directory of Open Access Journals (Sweden)

Victor Raboy

2015-04-01

Full Text Available The potential benefits of the low phytic acid (lpa seed trait for human and animal nutrition, and for phosphorus management in non-ruminant animal production, are well documented. However, in many cases the lpa trait is associated with impaired seed or plant performance, resulting in reduced yield. This has given rise to the perception that the lpa trait is tightly correlated with reduced yield in diverse crop species. Here we report a powerful test of this correlation. We measured grain yield in lines homozygous for each of six barley (Hordeum vulgare L. lpa mutations that greatly differ in their seed phytic acid levels. Performance comparisons were between sibling wild-type and mutant lines obtained following backcrossing, and across two years in five Idaho (USA locations that greatly differ in crop yield potential. We found that one lpa mutation (Hvlpa1-1 had no detectable effect on yield and a second (Hvlpa4-1 resulted in yield losses of only 3.5%, across all locations. When comparing yields in three relatively non-stressful production environments, at least three lpa mutations (Hvlpa1-1, Hvlpa3-1, and Hvlpa4-1 typically had yields similar to or within 5% of the wild-type sibling isoline. Therefore in the case of barley, lpa mutations can be readily identified that when simply incorporated into a cultivar result in adequately performing lines, even with no additional breeding for performance within the lpa line. In conclusion, while some barley lpa mutations do impact field performance, a substantial fraction appears to have little or no effect on yield.

Single and combined toxicity of copper and cadmium to H. vulgare growth and heavy metal bioaccumulation

Directory of Open Access Journals (Sweden)

Žaltauskaitė J.

2013-04-01

Full Text Available The single and combined effects of copper (Cu and cadmium (Cd (0.1-10 mg L−1 in spring barley (Hordeum vulgare L. plants grown in hydroponics are investigated. The aim of the study was to investigate the interactive effect of the binary mixture of Cu and Cd to the growth of H. vulgare and accumulation of these metals by the plants. Single and combined metal treatment led to major effects in the growth of roots and shoots and dry weight of barley. Exposure to metals altered the content of photosynthetic pigments and caused lipid peroxidation. It was observed that combined effects of heavy metals to plants are endpoint and concentration depending. The binary mixture Cu+Cd exhibited additive or less than additive interaction for dry weight, root length and shoot height. Analysis of tissue metal concentrations showed that Cu and Cd were mainly accumulated in the roots and the combination of Cu+Cd had less than additive response of metal bioaccumulation in the leaves and roots.

A proteomics approach to study the molecular basis of enhanced salt tolerance in barley (Hordeum vulgare L.) conferred by the root mutualistic fungus Piriformospora indica.

Science.gov (United States)

Alikhani, Mehdi; Khatabi, Behnam; Sepehri, Mozhgan; Nekouei, Mojtaba Khayam; Mardi, Mohsen; Salekdeh, Ghasem Hosseini

2013-06-01

Piriformospora indica is a root-interacting mutualistic fungus capable of enhancing plant growth, increasing plant resistance to a wide variety of pathogens, and improving plant stress tolerance under extreme environmental conditions. Understanding the molecular mechanisms by which P. indica can improve plant tolerance to stresses will pave the way to identifying the major mechanisms underlying plant adaptability to environmental stresses. We conducted greenhouse experiments at three different salt levels (0, 100 and 300 mM NaCl) on barley (Hordeum vulgare L.) cultivar "Pallas" inoculated with P. indica. Based on the analysis of variance, P. indica had a significant impact on the barley growth and shoot biomass under normal and salt stress conditions. P. indica modulated ion accumulation in colonized plants by increasing the foliar potassium (K(+))/sodium (Na(+)) ratio, as it is considered a reliable indicator of salt stress tolerance. P. indica induced calcium (Ca(2+)) accumulation and likely influenced the stress signal transduction. Subsequently, proteomic analysis of the barley leaf sheath using two-dimensional electrophoresis resulted in detection of 968 protein spots. Of these detected spots, the abundance of 72 protein spots changed significantly in response to salt treatment and P. indica-root colonization. Mass spectrometry analysis of responsive proteins led to the identification of 51 proteins. These proteins belonged to different functional categories including photosynthesis, cell antioxidant defense, protein translation and degradation, energy production, signal transduction and cell wall arrangement. Our results showed that P. indica induced a systemic response to salt stress by altering the physiological and proteome responses of the plant host.

Actividade antimicrobiana do óleo essencial do Foeniculum vulgare Miller Antimicrobial activity of Foeniculum vulgare Miller essential oil

Directory of Open Access Journals (Sweden)

M. T. Tinoco

2007-01-01

Full Text Available O Foeniculum vulgare Mill. subsp. vulgare é uma planta espontânea da região mediterrânea, pertencente à família Apiaceae. O seu óleo essencial, principalmente o dos frutos secos, é amplamente utilizado nas indústrias alimentar, farmacêutica, cosmética e perfumaria. Neste trabalho, pretendeu-se avaliar a actividade antimicrobiana do óleo essencial dos frutos verdes e das folhas da variedade de funcho doce colhido no Alentejo, na região de Évora, e relacionar essa actividade com a respectiva composição química. A extracção dos óleos essenciais foi efectuada por hidrodestilação e a sua análise foi feita por GC-FID e GC-MS. No óleo das folhas foram identificados como componentes maioritários os fenilpropanóides anetol, fenchona e estragol e o monoterpeno a-felandreno, enquanto que o óleo dos frutos apresentou como constituintes predominantes anetol e fenchona. A actividade antimicrobiana dos óleos foi avaliada face às estirpes Staphylococcus aureus, Escherichia coli, Saccharomyces spp., Fusarium oxysporum e Penicillium sp.. Os óleos essenciais apresentaram actividade antimicrobiana contra S. aureus, Saccharomyces spp. e Fusarium oxysporum.Foeniculum vulgare Mill. ssp. vulgare is a spontaneous plant of Mediterranean region that belongs to the Apiaceae family. Its essential oil is used as additives in food, pharmaceutical, cosmetic and perfume industries mainly that one obtained from dried seeds. The main goal of this work were to evaluate the antimicrobial activity of essential oils obtained from fresh leaves and unripe seeds of sweet fennel, collected in Évora-Alentejo, in face of their chemical composition. The extraction of the essentials oils was made by hydrodistillation. Chemical analyses were carried out by GC-FID and GCMS. Phenylpropanoides anethole, fenchone, estragole and the monoterpene aphellandrene were the most abundant compounds of leaves essential oil. Seeds essential oil showed as main components

Hydrotime Analysis of Yellow Sweetclover (Melilotus officinalis (L. Lam., Wild Mustard (Sinapis arvensis L. and Barley (Hordeum vulgare L. Seed Germination

Directory of Open Access Journals (Sweden)

A. Derakhshan

2017-01-01

Full Text Available Introduction: Seed germination is one of the key stages in the life cycle of plants that can ultimately affect their fitness in the environment. The temporal pattern of seed germination is extremely depended on the soil water potential (Ψ of the germination medium, as this determines the equilibrium water content of the seed. As for temperature, there is a minimum Ψ that must be exceeded in order for seeds complete germination, and seeds in a population vary in the value of this minimum or base Ψ. The germination of a seed population in response to the reduced water potential is modeled using the hydrotime model. According to this model, the time to germination for a given seed fraction (g is inversely related to the difference between the current seed Ψ and the base water potential (Ψb for that fraction (Ψb(g. The hydrotime model functions are well in matching both the timing and the percentage of germination of seed populations in relation to their Ψ environment. In addition, the model outputs which are significant physiologically and ecologically and the parameters of the model can be used to characterize the properties of seed populations. Normal distribution of Ψb among seeds within a population is one of the assumptions of the hydrotime model. However, this assumption may not be met in many species and thus can result in poor predictions. We tried to investigate empirically the validity of this assumption, to compare the fit of alternative distributions and make recommendations to improve germination modeling procedures. Materials and Methods: Seed germination of Melilotus officinalis, Sinapis arvensis and Hordeum vulgare were tested across a range of water potentials (0, -0.2, -0.4, -0.6 and -0.8 MPa for M. officinalis and S. arvensis and 0, -0.3, -0.6, -0.9, -1.2 and -1.5 MPa for H. vulgare and germination responses were described by the hydrotime models based on twelve statistical functions including Normal, Beta, Gamma

Evaluation of phytotoxicity effect of olive mill wastewater treated by different technologies on seed germination of barley (Hordeum vulgare L.).

Science.gov (United States)

Rusan, Munir J M; Albalasmeh, Ammar A; Zuraiqi, Said; Bashabsheh, Mohammad

2015-06-01

Olive-mill wastewater (OMW) is a by-product effluent of olive oil extraction process that is produced in large amount in the Mediterranean region. OMW is believed to induce phytotoxic effect on organisms including seed germination and plant growth. The objective of this study was to evaluate the impact of untreated and treated OMW with different techniques on seed germination of barley (Hordeum vulgare L.). The following treatments were investigated: (1) tap water (control); (2) OMW treated by aerobic biological technology in a Jacto Reactor (JR); (3) OMW treated by solar fenton oxidation (SFO); (4) OMW treated by microfiltration followed by nanofiltration (MF+NF); (5) OMW treated by microfiltration followed by reverse osmosis (MF+RO) process; (6) diluted OMW with tap water (25 % OMW); (7) diluted OMW with tap water (50 % OMW); (8) diluted OMW with tap water (75 % OMW); and (9) untreated OMW (100 % OMW). A germination test was conducted in an incubator at temperature of 23 (∘)C. In each petri dish, a filter paper was mounted and ten seeds of barley were placed on the filter paper. Five milliliter of water were added to each petri dish. The seed germination was determined by counting the number of germinated seeds to calculate the percentage of germination (G %). Germination rate index (GRI), seed vigor index (SVI), and phytotoxicity index (PI) were also calculated. Then, the dry weights and lengths of the shoots and the roots of the germinated seeds were measured. The results show that 100, 75, and 50 %OMW were very phytotoxic and completely prohibited seed germination. However, phytotoxicity decreased significantly following treatments of OMW with all techniques investigated and by the 25 % OMW dilution, as results of removing the phenols and other phytotoxic organic compounds from the OMW or by diluting it. This was evidenced by relative enhancement of the dry weights and lengths of shoot and root as well as the G %, GRI, SVG, and PI. It was concluded that if

Comparison of foliar anatomy of ten bread wheat (triticum, poaceae) and ten barley (hordeum, poaceae) cultivars

International Nuclear Information System (INIS)

Ardic, M.; Sezer, O.; Ozgdsd, K.; Yaylaci, O. K.; Koyuncu, O.; Olgun, M.; Bascdftcd, Z. B.; Ayter, N. G.

2015-01-01

The aim of this study is to determine anatomical differences and classification of leaf and leaf cell characteristics (cuticle thickness, upper epidermis thickness, lower epidermis thickness, mesophyll thickness, parenchyma thickness and leaf thickness) between 10 bread wheat cultivars (Triticum aestivum L.) and 10 barley cultivars (Hordeum vulgare L.). Classification of leaf characteristics in bread wheat and barley cultivars and relationship between leaf characteristics are made by principal component and correlation analyses. Highest thickness belongs to W8 Mufitbey cultivar in mesophyll and lower epidermis and W1 Sonmez 01 cultivar have the lowest thickness of upper epidermis in bread wheat. In Barley, B1 Ince cultivar has highest leaf thickness mesophyll and parenchyma; lowest thickness of cuticle is included B7 Cumhuriyet 50 cultivar. All other cultivars have homogenous contents of leaf characteristics. (author)

Chromosomal organization of repetitive DNAs in Hordeum bogdanii and H. brevisubulatum (Poaceae

Directory of Open Access Journals (Sweden)

Quanwen Dou

2016-10-01

Full Text Available Molecular karyotypes of H. bogdanii Wilensky, 1918 (2n = 14, and H. brevisubulatum Link, 1844 ssp. brevisubulatum (2n = 28, were characterized by physical mapping of several repetitive sequences. A total of 18 repeats, including all possible di- or trinucleotide SSR (simple sequence repeat motifs and satellite DNAs, such as pAs1, 5S rDNA, 45S rDNA, and pSc119.2, were used as probes for fluorescence in situ hybridization on root-tip metaphase chromosomes. Except for the SSR motifs AG, AT and GC, all the repeats we examined produced detectable hybridization signals on chromosomes of both species. A detailed molecular karyotype of the I genome of H. bogdanii is described for the first time, and each repetitive sequence is physically mapped. A high degree of chromosome variation, including aneuploidy and structural changes, was observed in H. brevisubulatum. Although the distribution of repeats in the chromosomes of H. brevisubulatum is different from that of H. bogdanii, similar patterns between the two species imply that the autopolyploid origin of H. brevisubulatum is from a Hordeum species with an I genome. A comparison of the I genome and the other Hordeum genomes, H, Xa and Xu, shows that colocalization of motifs AAC, ACT and CAT and colocalization of motifs AAG and AGG are characteristic of the I genome. In addition, we discuss the evolutionary significance of repeats in the genome during genome differentiation.

Regulation of Streptococcus gordonii sspB by the sspA Gene Product

OpenAIRE

El-Sabaeny, Azza; Demuth, Donald R.; Lamont, Richard J.

2001-01-01

Streptococcus gordonii expresses two related adhesins, SspA and SspB, the genes for which are adjacent on the chromosome and are regulated independently. Although the adhesins are functionally similar, the sspA promoter is more active than that of sspB. In this study we show an additional role for SspA in the control of sspB activity. Gel shift and DNA footprinting assays demonstrate that the SspA protein binds to the sspB promoter and protects a region 233 to 264 bp upstream of the predicted...

Transgenic barley (Hordeum vulgare L.) expressing the wheat aluminium resistance gene (TaALMT1) shows enhanced phosphorus nutrition and grain production when grown on an acid soil.

Science.gov (United States)

Delhaize, Emmanuel; Taylor, Phillip; Hocking, Peter J; Simpson, Richard J; Ryan, Peter R; Richardson, Alan E

2009-06-01

Barley (Hordeum vulgare L.), genetically modified with the Al(3+) resistance gene of wheat (TaALMT1), was compared with a non-transformed sibling line when grown on an acidic and highly phosphate-fixing ferrosol supplied with a range of phosphorus concentrations. In short-term pot trials (26 days), transgenic barley expressing TaALMT1 (GP-ALMT1) was more efficient than a non-transformed sibling line (GP) at taking up phosphorus on acid soil, but the genotypes did not differ when the soil was limed. Differences in phosphorus uptake efficiency on acid soil could be attributed not only to the differential effects of aluminium toxicity on root growth between the genotypes, but also to differences in phosphorus uptake per unit root length. Although GP-ALMT1 out-performed GP on acid soil, it was still not as efficient at taking up phosphorus as plants grown on limed soil. GP-ALMT1 plants grown in acid soil possessed substantially smaller rhizosheaths than those grown in limed soil, suggesting that root hairs were shorter. This is a probable reason for the lower phosphorus uptake efficiency. When grown to maturity in large pots, GP-ALMT1 plants produced more than twice the grain as GP plants grown on acid soil and 80% of the grain produced by limed controls. Expression of TaALMT1 in barley was not associated with a penalty in either total shoot or grain production in the absence of Al(3+), with both genotypes showing equivalent yields in limed soil. These findings demonstrate that an important crop species can be genetically engineered to successfully increase grain production on an acid soil.

Red:far-red light conditions affect the emission of volatile organic compounds from barley (Hordeum vulgare), leading to altered biomass allocation in neighbouring plants

Science.gov (United States)

Kegge, Wouter; Ninkovic, Velemir; Glinwood, Robert; Welschen, Rob A. M.; Voesenek, Laurentius A. C. J.; Pierik, Ronald

2015-01-01

Background and Aims Volatile organic compounds (VOCs) play various roles in plant–plant interactions, and constitutively produced VOCs might act as a cue to sense neighbouring plants. Previous studies have shown that VOCs emitted from the barley (Hordeum vulgare) cultivar ‘Alva’ cause changes in biomass allocation in plants of the cultivar ‘Kara’. Other studies have shown that shading and the low red:far-red (R:FR) conditions that prevail at high plant densities can reduce the quantity and alter the composition of the VOCs emitted by Arabidopsis thaliana, but whether this affects plant–plant signalling remains unknown. This study therefore examines the effects of far-red light enrichment on VOC emissions and plant–plant signalling between ‘Alva’ and ‘Kara’. Methods The proximity of neighbouring plants was mimicked by supplemental far-red light treatment of VOC emitter plants of barley grown in growth chambers. Volatiles emitted by ‘Alva’ under control and far-red light-enriched conditions were analysed using gas chromatography–mass spectrometry (GC-MS). ‘Kara’ plants were exposed to the VOC blend emitted by the ‘Alva’ plants that were subjected to either of the light treatments. Dry matter partitioning, leaf area, stem and total root length were determined for ‘Kara’ plants exposed to ‘Alva’ VOCs, and also for ‘Alva’ plants exposed to either control or far-red-enriched light treatments. Key Results Total VOC emissions by ‘Alva’ were reduced under low R:FR conditions compared with control light conditions, although individual volatile compounds were found to be either suppressed, induced or not affected by R:FR. The altered composition of the VOC blend emitted by ‘Alva’ plants exposed to low R:FR was found to affect carbon allocation in receiver plants of ‘Kara’. Conclusions The results indicate that changes in R:FR light conditions influence the emissions of VOCs in barley, and that these altered emissions

Red:far-red light conditions affect the emission of volatile organic compounds from barley (Hordeum vulgare), leading to altered biomass allocation in neighbouring plants.

Science.gov (United States)

Kegge, Wouter; Ninkovic, Velemir; Glinwood, Robert; Welschen, Rob A M; Voesenek, Laurentius A C J; Pierik, Ronald

2015-05-01

Volatile organic compounds (VOCs) play various roles in plant-plant interactions, and constitutively produced VOCs might act as a cue to sense neighbouring plants. Previous studies have shown that VOCs emitted from the barley (Hordeum vulgare) cultivar 'Alva' cause changes in biomass allocation in plants of the cultivar 'Kara'. Other studies have shown that shading and the low red:far-red (R:FR) conditions that prevail at high plant densities can reduce the quantity and alter the composition of the VOCs emitted by Arabidopsis thaliana, but whether this affects plant-plant signalling remains unknown. This study therefore examines the effects of far-red light enrichment on VOC emissions and plant-plant signalling between 'Alva' and 'Kara'. The proximity of neighbouring plants was mimicked by supplemental far-red light treatment of VOC emitter plants of barley grown in growth chambers. Volatiles emitted by 'Alva' under control and far-red light-enriched conditions were analysed using gas chromatography-mass spectrometry (GC-MS). 'Kara' plants were exposed to the VOC blend emitted by the 'Alva' plants that were subjected to either of the light treatments. Dry matter partitioning, leaf area, stem and total root length were determined for 'Kara' plants exposed to 'Alva' VOCs, and also for 'Alva' plants exposed to either control or far-red-enriched light treatments. Total VOC emissions by 'Alva' were reduced under low R:FR conditions compared with control light conditions, although individual volatile compounds were found to be either suppressed, induced or not affected by R:FR. The altered composition of the VOC blend emitted by 'Alva' plants exposed to low R:FR was found to affect carbon allocation in receiver plants of 'Kara'. The results indicate that changes in R:FR light conditions influence the emissions of VOCs in barley, and that these altered emissions affect VOC-mediated plant-plant interactions. © The Author 2015. Published by Oxford University Press on

Two New American Species of Hordeum (Poaceae)

DEFF Research Database (Denmark)

Bothmer, Roland Von; Jacobsen, Niels; Bagger Jørgensen, Rikke

1985-01-01

Two new species of Hordeum are described, viz. the diploid H. erectifolium, native to Argentina, and H. guatemalense, native to Guatemala.......Two new species of Hordeum are described, viz. the diploid H. erectifolium, native to Argentina, and H. guatemalense, native to Guatemala....

Dicty_cDB: Contig-U03338-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available ) 486099E06.x1 486 - leaf primordia cDNA library fr... 155 1e-33 1 ( FL885969 ) CCGN6504.b1 CCGN Panicum virgatum eti...( CF272843 ) EST3049 Zea mays sperm cell cDNA library Zea mays... 105 1e-18 1 ( FE623651 ) CBYY4925.g1 CBYY Panicum virgatu...22B2F04.f1 BG01 - normalized library Leymus ... 266 1e-90 2 ( EX580446 ) HDP26H23w HDP Hordeum vulgare subsp. vulgare... 2 ( EX571824 ) HDP35N10T HDP Hordeum vulgare subsp. vulgare cDNA... 287 5e-90 2 ( CV056143 ) BNEL14D8 Barley EST endosperm library... rachis EST library... 161 2e-35 1 ( AU173547 ) Oryza sativa Japonica Group cDNA, parti

under water stress conditio

African Journals Online (AJOL)

A. Thameur

2012-05-17

adjustment trait variation in barley (Hordeum vulgare L.). Theor. Appl. Genet., 96: 688-698. Thameur A, Ferchichi A, López-Carbonell M (2011). Quantification of free and conjugated abscisic acid in five genotypes of barley. (Hordeum ...

Bio-efficacy of the essential oil of oregano (Origanum vulgare Lamiaceae. Ssp. Hirtum).

Science.gov (United States)

Grondona, Ezequiel; Gatti, Gerardo; López, Abel G; Sánchez, Leonardo Rodolfo; Rivero, Virginia; Pessah, Oscar; Zunino, María P; Ponce, Andrés A

2014-12-01

The aim of this study was to investigate the bioactivity of the essential oil isolated from Origanum vulgare L. (EOv). We analyzed the in vivo anti-inflammatory properties in a mouse-airway inflammation model and the in vitro antimicrobial activity, genotoxicity over the anaphase-telophase with the Allium cepa strain and its cytotoxicity/viability in A549 culture cells. In vivo, EOv modified the levels of tumor necrosis factor -α and viable activated macrophages and was capable to mitigate the effects of degradation of conjugated dienes. In vitro, EOv reduced the viability of cultured A549 cells as well as the mitotic index and a number of chromosomal aberrations; however, it did not change the number of phases. We found that EOv presents antimicrobial activity against different Gram (-) and (+) strains, measured by disc-diffusion test and confirmed with a more accurate method, the AutoCad software. We postulate that EOv presents antibacterial, antioxidant and chemopreventive properties and could be play an important role as bioprotector agent.

Cultivate In Vitro Of Anthers Of Barley (Hordeum Vulgare L.) Vars. UNAGRO V-PM6 And DISSA

International Nuclear Information System (INIS)

Marquinez Casas, Xavier

1994-01-01

The barley is a autonomous cereal originated of the wild subspecies H. vulgare L. Only at the end of last century it acquired commercial importance with the establishment of the industry brewer (Chaparro and Moreno 1894); at the moment its national production is far from supplying the demand of the market. The Andean area is the most appropriate region for its cultivation in Colombia, mainly between 1800 and 3200 meters on the level of the sea, in the Boyaca, Cundinamarca and Narino departments. Their production is dedicated in a 80 at 85 for the industry brewer and malt industry and of the 15 at 20 for seeds, human food and animal

Lactobacillus delbrueckii ssp. lactis and ssp. bulgaricus: a chronicle of evolution in action.

Science.gov (United States)

El Kafsi, Hela; Binesse, Johan; Loux, Valentin; Buratti, Julien; Boudebbouze, Samira; Dervyn, Rozenn; Kennedy, Sean; Galleron, Nathalie; Quinquis, Benoît; Batto, Jean-Michel; Moumen, Bouziane; Maguin, Emmanuelle; van de Guchte, Maarten

2014-05-28

Lactobacillus delbrueckii ssp. lactis and ssp. bulgaricus are lactic acid producing bacteria that are largely used in dairy industries, notably in cheese-making and yogurt production. An earlier in-depth study of the first completely sequenced ssp. bulgaricus genome revealed the characteristics of a genome in an active phase of rapid evolution, in what appears to be an adaptation to the milk environment. Here we examine for the first time if the same conclusions apply to the ssp. lactis, and discuss intra- and inter-subspecies genomic diversity in the context of evolutionary adaptation. Both L. delbrueckii ssp. show the signs of reductive evolution through the elimination of superfluous genes, thereby limiting their carbohydrate metabolic capacities and amino acid biosynthesis potential. In the ssp. lactis this reductive evolution has gone less far than in the ssp. bulgaricus. Consequently, the ssp. lactis retained more extended carbohydrate metabolizing capabilities than the ssp. bulgaricus but, due to high intra-subspecies diversity, very few carbohydrate substrates, if any, allow a reliable distinction of the two ssp. We further show that one of the most important traits, lactose fermentation, of one of the economically most important dairy bacteria, L. delbruecki ssp. bulgaricus, relies on horizontally acquired rather than deep ancestral genes. In this sense this bacterium may thus be regarded as a natural GMO avant la lettre. The dairy lactic acid producing bacteria L. delbrueckii ssp. lactis and ssp. bulgaricus appear to represent different points on the same evolutionary track of adaptation to the milk environment through the loss of superfluous functions and the acquisition of functions that allow an optimized utilization of milk resources, where the ssp. bulgaricus has progressed further away from the common ancestor.

Variation of Qingke (Hordeum vulgare linn.var.nudum Hook.f) induced by space flight treatment

International Nuclear Information System (INIS)

Li Xin; Peng Zhengsong; Yang Jun

2007-01-01

108 Dry seeds of Qingke (Hordeum vulgate linn. var. nudum Hook. f) were carried into space by recoverable satellite. after wards, the seeds were germinated into 108 seedlings at room temperature, and root tips were observed with Night microscope, and results and normal mitotic division was found without microkemel at interphase or chromosome bridges at anaphase, which means that chromosomal structure change didn't occur in Qingke seeds during space flight. To investigate whether there were morphology variations taken place, the seedlings were transplanted into field and managed normal. All of plants grew as strong as normal Qingke plants (CK) by eye abservation, except two plants showed abnormal inflorescence morphology, which had two spikes on one tiller. 21 SSR markers on 7 linkage groups were used to analysis the polymorphism of genomic DNA for these Qingke plants. No polymorphism was detected with 20 SSR markers among 63 plants investigated. But varied electrophoretic bands were tested in 10 plants using the marker HVM54 on chromosome 2H, and all the 10 plants showed uniform electrophoretypes. It was concluded that the DNA of the Qingke could be changed during space flight. (authors)

The botanical macroremains from the prehistoric settlement Kalnik-Igrišče (NW Croatia in the context of current knowledge about cultivation and plant consumption in Croatia and neighboring countries during the Bronze Age

Directory of Open Access Journals (Sweden)

Sara Mareković

2015-07-01

Full Text Available This paper presents the results of the first extensive archaeobotanical research into a Bronze Age site in Croatia. The aim of the study was to reveal what plants were consumed (grown at Kalnik-Igrišče (NW Croatia in the Bronze Age and to realize if the plant diet of the local population differed from that of the inhabitants in neighboring countries. The results show that all plant macrofossils found at Kalnik-Igrišče can be classified into one of four functional groups: cereals, cultivated legumes, useful trees and weeds. As much as 98% of the findings are of cereals and legumes. The most abundant species found are Panicum miliaceum (millet, Hordeum vulgare (barley, Vicia faba (faba bean, Triticum aestivum ssp. aestivum (bread wheat, Triticum turgidum ssp. dicoccon (emmer wheat and Lens culinaris (lentils. The findings from Kalnik-Igrišče do not differ from the findings of neighboring countries, indicating that there were similar diets and agricultural/plant-collecting activities throughout the whole of the studied area (Bosnia and Herzegovina, Slovenia, Serbia, Italy, Austria and Hungary.

A redox-dependent dimerization switch regulates activity and tolerance for reactive oxygen species of barley seed glutathione peroxidase

DEFF Research Database (Denmark)

Navrot, Nicolas; Skjoldager, Nicklas; Bunkenborg, Jakob

2015-01-01

Monomeric and dimeric forms of recombinant barley (Hordeum vulgare subsp. vulgare) glutathione peroxidase 2 (HvGpx2) are demonstrated to display distinctly different functional properties in vitro. Monomeric HvGpx2 thus has five fold higher catalytic efficiency than the dimer towards tert-butyl h...

Foliar flavonoids from Tanacetum vulgare var. boreale and their geographical variation.

Science.gov (United States)

Uehara, Ayumi; Akiyama, Shinobu; Iwashina, Tsukasa

2015-03-01

Foliar flavonoids of Tanacetum vulgare var. boreale were isolated. Eight flavonoid glycosides, 7-O-glucosides of apigenin, luteolin, scutellarein and 6- hydroxyluteolin, and 7-O-glucuronides of apigenin, luteolin, chrysoeriol and eriodictyol were identified. Moreover, eight flavonoid aglycones, apigenin, luteolin, hispidulin, nepetin, eupatilin, jaceosidin, pectolinarigenin and axillarin were also isolated and identified. The flavonoid composition of two varieties of T. vulgare, i.e. var. boreale and var. vulgare, were compared. All samples of var. boreale and one sample of var. vulgare had the same flavonoid pattern, and could be distinguished from almost all the samples of var. vulgare. Thus, the occurrence of chemotypes, which are characterized by either the presence or absence of scutellarein 7-O-glucoside, eriodictyol 7-O-glucuronide and pectolinarigenin was shown in T. vulgare sensu lato.

Foeniculum vulgare Mill (Umbelliferae) Attenuates Stress and ...

African Journals Online (AJOL)

Purpose: To evaluate the anti-stress and memory-enhancing properties of F. vulgare extract in experimental rats. Methods: F. vulgare plant extract was obtained using Soxhlet extraction technique. The extract, at doses of 50, 100 and 200 mg/kg body weight, was administered orally with an orogastric tube. Urinary levels of ...

Marrubium vulgare L.: A review on phytochemical and pharmacological aspects

Directory of Open Access Journals (Sweden)

Santram Lodhi

2017-12-01

Full Text Available Marrubium vulgare L. (family: Lamiaceae, also known as white horehound, is widely used as herbal remedy for chronic coughs and colds. It is used in various disorders related to skin, liver, gastric, heart and immune system. This review abridges phytochemical, pharmacological studies and medicinal uses of M. vulgare and provides scientific proof for various ethnobotanical claims in order to identify gaps, which will give impulsion for novel research on M. vulgare based herbal medicines. This review summarizes selected scientific evidence on phytochemistry and pharmacological properties of M. vulgare over the past 48 years (1968 to 2016. The work reported on M. vulgare was reviewed from various sources like books, internet source i.e. google search engine, pubmed, sciencedirect and chemical abstract. The exhaustive literature was studied and critical analysis was done according to their phytochemical and pharmacological properties. Phytochemical investigations on different parts of M. vulgare have been reported the presence of flavonoids, steroids, terpenoids, tannins, saponins and volatile oils (0.05%. The aerial parts contain marrubiin, together with ursolic acid and choline. Pharmacological activities like, anti-nociceptive, anti-spasmodic, anti-hypertensive, anti-diabetic, gastroprotective, anti-inflammatory, anti-microbial, anti-cancer, antioxidant, and anti-hepatotoxic activity have been reported. M. vulgare has therapeutic potential in the treatment of inflammatory conditions, liver disorders, pain, cardiovascular, gastric and diabetic conditions. Aerial parts of M. vulgare is a good source of labdane type diterpene especially marrubiin which is present in high concentrations. However, further scientific studies are needed to explore clinical efficacy, toxicity and to explore the therapeutic effect of major secondary metabolites like diterpenes, phenylpropanoid and phenylethanoid glycosides of M. vulgare. [J Complement Med Res 2017; 6

Self-stabilized pinch (SSP) concept

International Nuclear Information System (INIS)

Sugisaki, Kiwamu; Hirano, Keiichi.

1985-01-01

Self-Stabilized pinch (SSP) consept is revealed. SSP providcs many attractive features for application to a fusion reactor. Design studies for high temperature plasma production are carried out. Use of adiabatic compression leads to a remarkable reduction of required power source. (author)

Technical Analysis of SSP-21 Protocol

Energy Technology Data Exchange (ETDEWEB)

Bromberger, S. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States)

2017-06-09

As part of the California Energy Systems for the Twenty-First Century (CES-21) program, in December 2016 San Diego Gas and Electric (SDG&E) contracted with Lawrence Livermore National Laboratory (LLNL) to perform an independent verification and validation (IV&V) of a white paper describing their Secure SCADA Protocol for the Twenty-First Century (SSP-21) in order to analyze the effectiveness and propriety of cryptographic protocol use within the SSP-21 specification. SSP-21 is designed to use cryptographic protocols to provide (optional) encryption, authentication, and nonrepudiation, among other capabilities. The cryptographic protocols to be used reflect current industry standards; future versions of SSP-21 will use other advanced technologies to provide a subset of security services.

Haplotype divergence and multiple candidate genes at Rphq2, a partial resistance QTL of barley to Puccinia hordei

Czech Academy of Sciences Publication Activity Database

Yeo, F. K. S.; Wang, Y.; Vozábová, Tereza; Huneau, C.; LeRoy, P.; Chalhoub, B.; Qi, X. Q.; Niks, R. E.; Marcel, T. C.

2016-01-01

Roč. 129, č. 2 (2016), s. 289-304 ISSN 0040-5752 Institutional support: RVO:67985939 Keywords : cartial resistance genes * cloning * Hordeum vulgare Subject RIV: EF - Botanics Impact factor: 4.132, year: 2016

Exploration of beer proteome using OFFGEL prefractionation in combination with two-dimensional gel electrophoresis with narrow pH range gradients.

Science.gov (United States)

Konečná, Hana; Müller, Lukáš; Dosoudilová, Hana; Potěšil, David; Buršíková, Jana; Sedo, Ondrej; Márová, Ivana; Zdráhal, Zbyněk

2012-03-14

Two-dimensional gel electrophoresis in combination with mass spectrometry has already been applied successfully to study beer proteome. Due to the abundance of protein Z in beer samples, prefractionation techniques might help to improve beer proteome coverage. Proteins from four lager beers of different origins were separated by two-dimensional electrophoresis (2-DE) followed by tandem mass spectrometric analysis. Initially 52 proteins mostly from Hordeum vulgare (22 proteins) and Saccharomyces species (25 proteins) were identified. Preparative isoelectric focusing by OFFGEL Fractionator was applied prior to 2-DE to improve its resolution power. As a result of this combined approach, a total of 70 beer proteins from Hordeum vulgare (30 proteins), from Saccharomyces species (31 proteins), and from other sources (9 proteins) were identified. Of these, 37 proteins have not been previously reported in beer samples.

The bright-star masks for the HSC-SSP survey

Science.gov (United States)

Coupon, Jean; Czakon, Nicole; Bosch, James; Komiyama, Yutaka; Medezinski, Elinor; Miyazaki, Satoshi; Oguri, Masamune

2018-01-01

We present the procedure to build and validate the bright-star masks for the Hyper-Suprime-Cam Strategic Subaru Proposal (HSC-SSP) survey. To identify and mask the saturated stars in the full HSC-SSP footprint, we rely on the Gaia and Tycho-2 star catalogues. We first assemble a pure star catalogue down to GGaia SSP, finding that our star catalogue is 99.2% pure down to GGaia SSP observations at "ftp://obsftp.unige.ch/pub/coupon/brightStarMasks/HSC-SSP/".

Chloroplast genomes of Arabidopsis halleri ssp. gemmifera and Arabidopsis lyrata ssp. petraea: Structures and comparative analysis.

Science.gov (United States)

Asaf, Sajjad; Khan, Abdul Latif; Khan, Muhammad Aaqil; Waqas, Muhammad; Kang, Sang-Mo; Yun, Byung-Wook; Lee, In-Jung

2017-08-08

We investigated the complete chloroplast (cp) genomes of non-model Arabidopsis halleri ssp. gemmifera and Arabidopsis lyrata ssp. petraea using Illumina paired-end sequencing to understand their genetic organization and structure. Detailed bioinformatics analysis revealed genome sizes of both subspecies ranging between 154.4~154.5 kbp, with a large single-copy region (84,197~84,158 bp), a small single-copy region (17,738~17,813 bp) and pair of inverted repeats (IRa/IRb; 26,264~26,259 bp). Both cp genomes encode 130 genes, including 85 protein-coding genes, eight ribosomal RNA genes and 37 transfer RNA genes. Whole cp genome comparison of A. halleri ssp. gemmifera and A. lyrata ssp. petraea, along with ten other Arabidopsis species, showed an overall high degree of sequence similarity, with divergence among some intergenic spacers. The location and distribution of repeat sequences were determined, and sequence divergences of shared genes were calculated among related species. Comparative phylogenetic analysis of the entire genomic data set and 70 shared genes between both cp genomes confirmed the previous phylogeny and generated phylogenetic trees with the same topologies. The sister species of A. halleri ssp. gemmifera is A. umezawana, whereas the closest relative of A. lyrata spp. petraea is A. arenicola.

N-acyl-homoserine lactone uptake and systemic transport in barley rest upon active parts of the plant

Czech Academy of Sciences Publication Activity Database

Sieper, T.; Forczek, Sándor; Matucha, Miroslav; Kraemer, P.; Hartmann, A.; Schroeder, P.

2014-01-01

Roč. 201, č. 2 (2014), s. 545-555 ISSN 1469-8137 Institutional support: RVO:61389030 Keywords : barley (Hordeum vulgare) * monoclonal antibodies * N-acyl-homoserine lactones (HSLs) Subject RIV: EF - Botanics Impact factor: 6.545, year: 2013

Journal of Genetics Online Resources

Indian Academy of Sciences (India)

pdf. Jaiswal S. K., Pandey S. P., Sharma S., Prasad R., Prasad L. C., Verma R. P. S. and Joshi A. K. 2010 Diversity in Indian barley (Hordeum vulgare) cultivars and identification of genotype-specific fingerprints using microsatellite markers.

Actividade antimicrobiana do óleo essencial do Foeniculum vulgare Miller Antimicrobial activity of Foeniculum vulgare Miller essential oil

OpenAIRE

M. T. Tinoco; M. R. Martins; J. Cruz-Morais

2007-01-01

O Foeniculum vulgare Mill. subsp. vulgare é uma planta espontânea da região mediterrânea, pertencente à família Apiaceae. O seu óleo essencial, principalmente o dos frutos secos, é amplamente utilizado nas indústrias alimentar, farmacêutica, cosmética e perfumaria. Neste trabalho, pretendeu-se avaliar a actividade antimicrobiana do óleo essencial dos frutos verdes e das folhas da variedade de funcho doce colhido no Alentejo, na região de Évora, e relacionar essa actividade com a respectiva co...

Metabolomic analysis of cooperative adaptation between co-cultured Bacillus cereus and Ketogulonicigenium vulgare.

Directory of Open Access Journals (Sweden)

Ming-Zhu Ding

Full Text Available The cooperative adaptation of subcultivated Bacillus cereus and Ketogulonicigenium vulgare significantly increased the productivity of 2-keto-L-gulonic acid, the precursor of vitamin C. The mechanism of cooperative adaptation of the serial subcultivated B. cereus and K. vulgare was investigated in this study by culturing the two strains orthogonally on agar plates. It was found that the swarming distance of B. cereus along the trace of K. vulgare on the plate decreased after 150 days' subcultivation. Metabolomic analysis on these co-cultured B. cereus and K. vulgare strains showed that their cooperative adaptation was accomplished by three key events: (i the ability of nutrients (e.g., amino acids and purines searching and intaking, and proteins biosynthesis is increased in the evolved B. cereus; (ii the capability of protein degradation and amino acids transportation is enhanced in evolved K. vulgare; (iii the evolved B. cereus was found to provide more nutrients (mostly amino acids and purines to K. vulgare, thus strengthening the oxidation and energy generation of K. vulgare. Our results provided novel insights into the systems-level understanding of the cooperative adaptation between strains in synergistic consortium.

COMPARISON OF THE FROST RESISTANCE OF BARLEY ...

African Journals Online (AJOL)

Preferred Customer

immediate recovery of the photosynthetic quantum yield after freezing. Landraces which showed the highest cold tolerance were found to acclimatize best. Key words/phrases: Barley, chlorophyll fluorescence, cold acclimation, Ethiopia, frost tolerance. INTRODUCTION. Barley (Hordeum vulgare L.) is a traditional crop.

Wheat and barley exposure to nanoceria: Implications for agricultural productivity

Science.gov (United States)

The impacts of man-made nanomaterials on agricultural productivity are not yet well understood. A soil microcosm study was performed to assess the physiological, phenological, and yield responses of wheat (Triticum aestivum) and barley (Hordeum vulgare L.) exposed to nanoceria (n...

Significance and value of non.traded ecosystem services on farmland

DEFF Research Database (Denmark)

Sandhu, Harpinder; Wratten, Steve; Costanza, Robert

2015-01-01

peas (Pisum sativum), beans (Phaseolus vulgaris), barley (Hordeum vulgare), and wheat (Triticum aestivum). Organic systems were chosen as comparators not because they are the only forms of sustainable agriculture, but because they are subject to easily understood standards. Results. We found...

Studies on the histology of partial resistance in barley to leafrust, Puccinia hordei

NARCIS (Netherlands)

Niks, R.E.

1983-01-01

In de gerst (Hordeum vulgare) - dwergroest (Puccinia hordei) relatie zijn twee typen van resistentie te onderscheiden, namelijk overgevoeligheidsresistentie en partiële resistentie. Deze typen kunnen beschouwd worden als voorbeelden van Van der Plank's verticale en horizontale

Induced Variations in Brassinosteroid Genes Define Barley Height and Sturdiness, and Expand the Green Revolution Genetic Toolkit

Czech Academy of Sciences Publication Activity Database

Dockter, C.; Gruszka, D.; Braumann, I.; Druka, A.; Franckowiak, J.; Muller, A.H.; Oklešťková, Jana; Schulz, B.; Zakhrabekova, S.; Hansson, M.

2014-01-01

Roč. 166, č. 4 (2014), s. 1912-1927 ISSN 0032-0889 R&D Projects: GA MŠk LK21306 Institutional support: RVO:61389030 Keywords : HORDEUM-VULGARE L. * GIBBERELLIN-SYNTHESIS * SIGNAL-TRANSDUCTION Subject RIV: EF - Botanics Impact factor: 6.841, year: 2014

Integrated transcriptomics and proteomics analysis of storage protein composition in developing barley grain to improve nutritional profile

DEFF Research Database (Denmark)

Kaczmarczyk, Agnieszka Ewa; Dionisio, Giuseppe; Renaut, Jenny

2012-01-01

The aim of the study was to understand the molecular and biochemical mechanisms underpinning the effect of nitrogen (N) on barley (Hordeum vulgare) storage protein production (hordeins) during grain filling. Using a combination of advanced biochemistry methods, we could comprehensively describe c...

Main: 1BE2 [RPSD[Archive

Lifescience Database Archive (English)

Full Text Available me=Ltp1; Synonyms=Papi; Hordeum Vulgare Molecule: Lipid Transfer Protein; Chain: Null; Synonym: Ltp Lipid Tr...ansport M.H.Lerche, F.M.Poulsen M.H.Lerche, F.M.Poulsen Two Different Binding Modes Of Palmitate In The Homologous Mai

Nitrogen accumulation and residual effects of nitrogen catch crops

DEFF Research Database (Denmark)

Jensen, E.S.

1991-01-01

The nitrogen accumulation in Italian ryegrass (Lolium multiflorum Lam.), perennial ryegrass (Lolium perenne L.), white mustard (Sinapis alba L.) and tansy phacelia (Phacelia tanacetifolia L.), under- or aftersown as nitrogen catch crops to spring barley (Hordeum vulgare L.) and field pea (Pisum s...

Wheat and barley seed systems in Ethiopia and Syria

NARCIS (Netherlands)

Bishaw, Z.

2004-01-01

Keywords: Wheat,Triticumspp., Barley,Hordeumvulgare L., Seed Systems, Formal Seed Sector, Informal Seed Sector, National Seed Program, Seed Source, Seed Selection, Seed Management, Seed Quality,

Desenvolvimento de populações duplo-haplóides de cevada cervejeira associadas à atividade das enzimas (1-3, 1-4-β-glucanases Development of doubled-haploids populations in malting barley associated to activity of enzymes (1-3, 1-4-β-glucanases

Directory of Open Access Journals (Sweden)

Janaína Endres Georg-Kraemer

2011-05-01

Full Text Available Populações duplo-haplóides apresentam especial vantagem para análises genéticas, uma vez que a informação que elas oferecem pode ser maximizada, devido ao fato que todos os locos encontram-se em homozigose. O objetivo deste trabalho foi o desenvolvimento de duas populações duplo-haplóides (DHs de cevada (Hordeum vulgare ssp. vulgare L. segregantes para a atividade das enzimas (1-3, 1-4-β-glucanases, através da técnica de cultura de anteras. Foram realizados dois cruzamentos com cultivares contrastantes para esta característica. As cultivares parentais selecionadas foram 'MN 698' e 'CEV 97047', para o desenvolvimento da população "malte verde" (MV, e 'Embrapa 127' e 'CEV 96025' para o desenvolvimento da população "malte seco" (MS. Foram cultivadas 10.734 anteras da população MS e 4.139 anteras da população MV. A população MV produziu 50% mais plântulas verdes quando comparada à população MS, refletindo a importância do genótipo na resposta à cultura de anteras e na regeneração. A maioria das plantas adultas duplo-haplóides foi obtida através da duplicação espontânea in vitro do genoma haplóide, ocorrendo em 66% das plantas da população MS e 76% das plantas da população MV. Também foram observadas, em menor frequência, plantas haplóides, triplóides e tetraplóides. Através da técnica de cultura de anteras, foram desenvolvidas 204 linhagens duplo-haplóides, das quais 72 linhagens são da população "malte seco" e 132 linhagens são da população "malte verde". Este material constitui um importante germoplasma para o melhoramento genético da cevada.Doubled haploid populations offer special advantages in genetic analyses, since the information they provide may be maximized due to the fact that all loci are homozygous. The aim of this study was to develop two barley (Hordeum vulgare ssp.vulgare L. doubled-haploid (DHs populations segregating to (1-3, 1-4-β-glucanases activity, utilizing the anther

Chernobyl Doses. Volume 3. Habitat and Vegetation Near the Chernobyl Nuclear Reactor Station

Science.gov (United States)

1993-01-01

Hordeum vulgare, Avena sativa, Fagopyrum esculentum, Beta vulgaris, Solanum tuberosum, Linum usitatissimum , Cannabis satii, Humulus lupulus, Daucus carota... USITATISSIMUM flax It is grown for fiber. Fine-quality fiber can be obtained from plants grown on podzolic and gley soils with considerable fertilizing. In the

Assessment of the nutritive value of cereal and legume straws based on chemical composition and in vitro digestibility

NARCIS (Netherlands)

Lopez, S.; Davies, D.; Dhanoa, M.S.; Dijkstra, J.; France, J.

2005-01-01

The nutritive value of 17 straws was determined on the basis of their chemical composition, in vitro dry matter (DM) digestibility and rumen fermentation kinetics (from gas production curves measured in vitro). Five roughages were from the cereal species Avena sativa (oat), Hordeum vulgare (barley),

Sequencing of 15622 gene-bearing BACs clarifies the gene-dense regions of the barley genome

Czech Academy of Sciences Publication Activity Database

Munoz-Amatriain, M.; Lonardi, S.; Luo, M.C.; Madishetty, K.; Svensson, J.T.; Moscou, M. J.; Wanamaker, S.; Kudrna, D.; Zheng, J.; Šimková, Hana; Doležel, Jaroslav; Grimwood, J.; Mammadov, J.; Close, T.J.

2015-01-01

Roč. 84, č. 1 (2015), s. 216-227 ISSN 0960-7412 R&D Projects: GA MŠk(CZ) LO1204 Institutional support: RVO:61389030 Keywords : Barley * Hordeum vulgare L * BAC sequencing Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 5.468, year: 2015

Farmer’s seed sources and seed quality: 2. seed health

NARCIS (Netherlands)

Bishaw, Z.; Struik, P.C.; Gastel, van A.J.G.

2013-01-01

The study assessed the health quality of wheat (Triticum aestivum L.) and barley (Hordeum vulgare L.) seed samples collected from formal and informal sector in Ethiopia and Syria. In Ethiopia, several seed-borne fungi were found on wheat samples: Cochliobolus sativum, Fusarium avenaceum, F.

Synthesis of the major storage protein, hordein, in barley

DEFF Research Database (Denmark)

Giese, Nanna Henriette; Andersen, B.; Doll, Hans

1983-01-01

A liquid culture system for culturing detached spikes of barley (Hordeum vulgare L.) at different nutritional levels was established. The synthesis of hordein polypeptides was studied by pulse-labeling with [14C]sucrose at different stages of development and nitrogen (N) nutrition. All polypeptides...

Grain Yield Variation in Malting Barley Cultivars in Uruguay and Its Consequences for the Design of a Trials Network

NARCIS (Netherlands)

Ceretta, S.S.E.; Eeuwijk, van F.A.

2008-01-01

The efficiency of cultivar trial networks is an important subject in official cultivar testing. We investigated this efficiency for malting barley (Hordeum vulgare L.) in Uruguay, using data on 213 cultivars tested across an eight-year period at six locations. The variance-components approach was

Comparing Evapotranspiration Rates Estimated from Atmospheric Flux and TDR Soil Moisture Measurements

DEFF Research Database (Denmark)

Schelde, Kirsten; Ringgaard, Rasmus; Herbst, Mathias

2011-01-01

limit estimate (disregarding dew evaporation) of evapotranspiration on dry days. During a period of 7 wk, the two independent measuring techniques were applied in a barley (Hordeum vulgare L.) field, and six dry periods were identified. Measurements of daily root zone soil moisture depletion were...

Investigation of GMO and ancient Grains for Bioplastic and Food Applications

DEFF Research Database (Denmark)

Sagnelli, Domenico

I dette projekt er der udviklet nye koncepter for helt naturlige bioplast systemer og sunde diætfibre. Termoplastisk stivelse (TPS) fremstilles ved anvendelse af traditionelle processer, såsom ekstrudering. I dette projekt anvendes transgen byg (Hordeum vulgare, Hv) med en stivelse der indeholder...

PLANT REMAINS FROM ASIKLI-HOYUK, A PRE-POTTERY NEOLITHIC SITE IN CENTRAL ANATOLIA

NARCIS (Netherlands)

VANZEIST, W; DEROLLER, GJ

Cereal crop plants at Asikli Hayuk included einkorn wheat (Triticum monococcum), emmer wheat (T. dicoccum), free-threshing wheat (T. cf. durum), hulled two-rowed barley (Hordeum distichum) and naked barley (H. vulgare var. nudum). As for pulses, bitter vetch (Vicia ervilia), lentil (Lens culinaris)

Population structure revealed by different marker types (SSR or DArT) has an impact on the results of genome-wide association mapping in European barley cultivars

NARCIS (Netherlands)

Matthies, I.E.; Hintum, van T.J.L.; Weise, S.; Röder, M.S.

2012-01-01

Diversity arrays technology (DArT) and simple sequence repeat (SSR) markers were applied to investigate population structure, extent of linkage disequilibrium and genetic diversity (kinship) on a genome-wide level in European barley (Hordeum vulgare L.) cultivars. A set of 183 varieties could be

Efficiency of PCR-based methods in discriminating Bifidobacterium longum ssp. longum and Bifidobacterium longum ssp. infantis strains of human origin.

Science.gov (United States)

Srůtková, Dagmar; Spanova, Alena; Spano, Miroslav; Dráb, Vladimír; Schwarzer, Martin; Kozaková, Hana; Rittich, Bohuslav

2011-10-01

Bifidobacterium longum is considered to play an important role in health maintenance of the human gastrointestinal tract. Probiotic properties of bifidobacterial isolates are strictly strain-dependent and reliable methods for the identification and discrimination of this species at both subspecies and strain levels are thus required. Differentiation between B. longum ssp. longum and B. longum ssp. infantis is difficult due to high genomic similarities. In this study, four molecular-biological methods (species- and subspecies-specific PCRs, random amplified polymorphic DNA (RAPD) method using 5 primers, repetitive sequence-based (rep)-PCR with BOXA1R and (GTG)(5) primers and amplified ribosomal DNA restriction analysis (ARDRA)) and biochemical analysis, were compared for the classification of 30 B. longum strains (28 isolates and 2 collection strains) on subspecies level. Strains originally isolated from the faeces of breast-fed healthy infants (25) and healthy adults (3) showed a high degree of genetic homogeneity by PCR with subspecies-specific primers and rep-PCR. When analysed by RAPD, the strains formed many separate clusters without any potential for subspecies discrimination. These methods together with arabionose/melezitose fermentation analysis clearly differentiated only the collection strains into B. longum ssp. longum and B. longum ssp. infantis at the subspecies level. On the other hand, ARDRA analysis differentiated the strains into the B. longum/infantis subspecies using the cleavage analysis of genus-specific amplicon with just one enzyme, Sau3AI. According to our results the majority of the strains belong to the B. longum ssp. infantis (75%). Therefore we suggest ARDRA using Sau3AI restriction enzyme as the first method of choice for distinguishing between B. longum ssp. longum and B. longum ssp. infantis. Copyright © 2011 Elsevier B.V. All rights reserved.

The SSP4: A world of deepening inequality

Energy Technology Data Exchange (ETDEWEB)

Calvin, Katherine; Bond-Lamberty, Ben; Clarke, Leon; Edmonds, James; Eom, Jiyong; Hartin, Corinne; Kim, Sonny; Kyle, Page; Link, Robert; Moss, Richard; McJeon, Haewon; Patel, Pralit; Smith, Steve; Waldhoff, Stephanie; Wise, Marshall

2017-01-01

The Shared Socioeconomic Pathway 4 (SSP4), “Inequality” or “A Road Divided,” is one of the five SSPs developed to guide the creation of new scenarios for the “Parallel Process”. We describe, in quantitative terms, the SSP4 as implemented by the Global Change Assessment Model (GCAM), the marker model for this scenario. We use demographic and economic assumptions, in combination with technology and non-climate policy assumptions to develop a quantitative representation of energy, land-use and land-cover that are consistent with the SSP4 storyline. The resulting scenario is one with stark differences across regions. High-income regions prosper, continuing to increase their demand for energy and food. Electrification increases in these regions, with the increased generation being met by nuclear and renewables. Low-income regions, however, stagnate due to limited growth in income. These regions continue to depend on traditional biofuels, leading to high pollutant emissions. Due to a declining dependence on fossil fuels in all regions, total radiative forcing only reaches 6.4 Wm-2 in 2100, making this a world with relatively low challenges to mitigation. We explore the effects of mitigation effort on the SSP4 world, finding that the imposition of a carbon price has a varied effect across regions. In particular, the SSP4 mitigation scenarios are characterized by afforestation in the high-income regions and deforestation in the low-income regions. Finally, we compare the GCAM SSP4 results to other integrated assessment model (IAM) quantifications of the SSP4 and to other SSPs, both those generated by GCAM and those of the other IAMs.

Essential-oil composition of Daucus carota ssp. major (Pastinocello Carrot) and nine different commercial varieties of Daucus carota ssp. sativus fruits.

Science.gov (United States)

Flamini, Guido; Cosimi, Elena; Cioni, Pier Luigi; Molfetta, Ilaria; Braca, Alessandra

2014-07-01

The chemical composition of the essential oils obtained by hydrodistillation from the pastinocello carrot, Daucus carota ssp. major (Vis.) Arcang. (flowers and achenes), and from nine different commercial varieties of D. carota L. ssp. sativus (achenes) was investigated by GC/MS analyses. Selective breeding over centuries of a naturally occurring subspecies of the wild carrot, D. carota L. ssp. sativus, has produced the common garden vegetable with reduced bitterness, increased sweetness, and minimized woody core. On the other hand, the cultivation of the pastinocello carrot has been abandoned, even if, recently, there has been renewed interest in the development of this species, which risks genetic erosion. The cultivated carrot (D. carota ssp. sativus) and the pastinocello carrot (D. carota ssp. major) were classified as different subspecies of the same species. This close relationship between the two subspecies urged us to compare the chemical composition of their essential oils, to evaluate the differences. The main essential-oil constituents isolated from the pastinocello fruits were geranyl acetate (34.2%), α-pinene (12.9%), geraniol (6.9%), myrcene (4.7%), epi-α-bisabolol (4.5%), sabinene (3.3%), and limonene (3.0%). The fruit essential oils of the nine commercial varieties of D. carota ssp. sativus were very different from that of pastinocello, as also confirmed by multivariate statistical analyses. Copyright © 2014 Verlag Helvetica Chimica Acta AG, Zürich.

Binding Properties of Streptococcus gordonii SspA and SspB (Antigen I/II Family) Polypeptides Expressed on the Cell Surface of Lactococcus lactis MG1363

OpenAIRE

Holmes, Ann R.; Gilbert, Christophe; Wells, Jeremy M.; Jenkinson, Howard F.

1998-01-01

The oral bacterium Streptococcus gordonii expresses two cell wall-associated polypeptides, designated SspA (1,542 amino acid residues) and SspB (1,462 amino acid residues), that have 70% sequence identity. These polypeptides are members of the antigen I/II family of oral streptococcal adhesins and mediate the binding of streptococci to salivary glycoproteins, collagen, and other oral microorganisms such as Actinomyces naeslundii. To determine if SspA and SspB have differential binding propert...

Essential oil composition and antibacterial activity of Tanacetum argenteum (Lam.) Willd. ssp. argenteum and T. densum (Lab.) Schultz Bip. ssp. amani heywood from Turkey.

Science.gov (United States)

Polatoğlu, Kaan; Demirci, Fatih; Demirci, Betül; Gören, Nezhun; Başer, Kemal Hüsnü Can

2010-01-01

Water-distilled essential oils from aerial parts of Tanacetum argenteum ssp. argenteum and T. densum ssp. amani from Turkey were analyzed by GC and GC/MS. The essential oil of T. argenteum ssp. argenteum was characterized with alpha-pinene 36.7%, beta-pinene 27.5% and 1,8-cineole 9.8%. T. densum ssp. amani was characterized with beta-pinene 27.2%, 1,8-cineole 13.1%, alpha-pinene 9.7% and p-cymene 8.9%. Antibacterial activity of the oils were evaluated for five Gram-positive and five Gram-negative bacteria by using a broth microdilution assay. The highest inhibitory activity was observed against Bacillus cereus for T. argenteum ssp. argenteum oil (125 microg/mL) when compared with positive control chloramphenicol it showed the same inhibition potency. However, the same oil showed lower inhibitory activity against B. subtilis when compared. The oil of T. densum ssp. amani did not show significant activity against the tested microorganisms. DPPH radical scavenging activity of the T. argenteum ssp. argenteum oil was investigated for 15 and 10 mg/mL concentrations. However, the oil did not show significant activity when compared to positive control alpha-tocopherol. Both oils showed toxicity to Vibrio fischeri in the TLC-bioluminescence assay.

Mapping genes in barley for resistance to Puccinia coronata from couch grass and to P. striiformis from brome, wheat and barley

NARCIS (Netherlands)

Niks, R.E.; Alemu, Sisay K.; Marcel, T.C.; Heyzen, van Skye

2015-01-01

Barley (Hordeum vulgare L.) mapping populations have been developed that are useful to study the inheritance of quantitative resistance to adapted and unadapted rust fungi. In a recent host range study, we found that the parents of those mapping populations also differed in their resistance to

The Role of alpha-Glucosidase in Germinating Barley Grains

DEFF Research Database (Denmark)

Stanley, Duncan; Rejzek, Martin; Næsted, Henrik

2011-01-01

The importance of alpha-glucosidase in the endosperm starch metabolism of barley (Hordeum vulgare) seedlings is poorly understood. The enzyme converts maltose to glucose (Glc), but in vitro studies indicate that it can also attack starch granules. To discover its role in vivo, we took complementa...

Journal of Genetics | Indian Academy of Sciences

Indian Academy of Sciences (India)

MAO-A promoter polymorphism and idiopathic pulmonary arterial hypertension · Shivani Vadapalli Sujana Katta B. K. S. Sastry Pratibha Nallari · More Details Fulltext PDF. pp e46-e54. Diversity in Indian barley (Hordeum vulgare) cultivars and identification of genotype-specific fingerprints using microsatellite markers.

Simulation of spring barley yield variability in different climatic zones of Northern and Central Europe

DEFF Research Database (Denmark)

Rötter, R P; Palosuo, T; Kersebaum, K C

2012-01-01

In this study, the performance of nine widely used and accessible crop growth simulation models (APES-ACE, CROPSYST, DAISY, DSSAT-CERES, FASSET, HERMES, MONICA, STICS and WOFOST) was compared during 44 growing seasons of spring barley (Hordeum vulgare L.) at seven sites in Northern and Central...

Effects of free and chelated iron on in vitro androgenesis in barley and wheat

Czech Academy of Sciences Publication Activity Database

Novotný, J.; Vagera, Jiří; Ohnoutková, Ludmila

2000-01-01

Roč. 63, - (2000), s. 35-40 ISSN 0167-6857 R&D Projects: GA ČR GV521/96/K117 Institutional research plan: CEZ:AV0Z5038910 Keywords : ferrous ions * Hordeum vulgare * Triticum aestivum Subject RIV: EF - Botanics Impact factor: 0.444, year: 2000

A new agro-climatic classification for crop suitability zoning in northern semi-arid Ethiopia

NARCIS (Netherlands)

Araya, A.; Keesstra, S.D.; Stroosnijder, L.

2010-01-01

The agro-climatic resources of Giba catchment in northern Ethiopia were assessed and characterized. The objectives were (i) to ascertain the suitability of the climate for growing teff (Eragrostis tef) and barley (Hordeum vulgare); (ii) to determine the onset and length of the growing period (LGP),

Biomass production, symbiotic nitrogen fixation and inorganic N use in dual tri-component annual intercrops

DEFF Research Database (Denmark)

Andersen, M.K.; Hauggaard-Nielsen, H.; Ambus, P.

2005-01-01

The interspecific complementary and competitive interactions between pea (Pisum sativum L.), barley (Hordeum vulgare L.) and oilseed rape (Brassica napus L.), grown as dual and tri-component intercrops were assessed in a field study in Denmark. Total biomass production and N use at two levels of ...

Classification and salt tolerance analysis of barley varieties

NARCIS (Netherlands)

Katerji, N.; Hoorn, van J.W.; Hamdy, A.; Mastrorilli, M.; Fares, C.; Ceccarelli, S.; Grando, S.; Oweis, T.

2006-01-01

Six varieties of barley (Hordeum vulgare), five of which were provided by ICARDA, were tested in a green house experiment for their salt tolerance. Afterwards the ICARDA variety Melusine, selected from this experiment for its combination of high yield and salt tolerance, was compared in a lysimeter

Yield and grain quality of spring barley as affected by biomass formation at early growth stages

Czech Academy of Sciences Publication Activity Database

Křen, J.; Klem, Karel; Svobodová, I.; Míša, P.; Neudert, L.

2014-01-01

Roč. 60, č. 5 (2014), s. 221-227 ISSN 1214-1178 R&D Projects: GA MZe QI111A133 Keywords : Hordeum vulgare L * above-ground biomass * tillering * grain yield formation * grain protein content Subject RIV: EH - Ecology, Behaviour Impact factor: 1.226, year: 2014

Genomic restructuring in Hordeum chilense durum wheat hybrids ...

Indian Academy of Sciences (India)

ANDREIA DELGADO

4John Innes Centre, Norwich Research Park, Norwich NR4 7UH, UK. 5Departament of Genetics and Biotechnology, University of Tras-os-Montes and Alto ... [Delgado A., Carvalho A., Martín A. C., Martín A. and Lima-Brito J. 2017 Genomic restructuring in F1 Hordeum chilense × durum ...... Academic Press, Burlington,.

PENGARUH INFUS BUAH Foeniculum vulgare Mill PADA SIKLUS ESTRUS DAN BOBOT UTERUS TIKUS PUTIH

Directory of Open Access Journals (Sweden)

Sa'roni Sa'roni

2012-10-01

Full Text Available Buah Foeniculum vulgare Mill (adas secara tradisional untuk obat dan campuran jamu pengatur haid. Diduga buah Foeniculum vulgare Mill mempunyai pengaruh pada sistem reproduksi. Oleh karena itu, kami melakukan penelitian pengaruh infus buah Foeniculum vulgare Mill pada siklus estrus dan bobot uterus tikus putih.Infus diberikan secara oral sekali sehari selama 12 hari dengan dosis setara dengan 7,3 mg, 73 mg dan 219 mg/100 g bobot badan. Selama pemberian bahan, siklus estrus diperiksa setiap hari dan pada hari ke-13 diotopsi dan ditimbang bobot uterusnya.Hasil penelitian menunjukkan bahwa infus buah Foeniculum vulgare Mill setara dengan serbuk 7,3 mg, 73 mg dan 219 mg/100 g bobot badan dapat menghambat fase estrus (masa subur. Infus setara dengan serbuk 7 mg dan 219 mg/100 g bobot badan kelihatan dapat menghambat fase estrus yang sangat nyata dibandingkan dengan akuades. Infus buah Foeniculum vulgare Mill setara dengan serbuk 219 mg/100 g bobot badan dapat menurunkan bobot uterus, tetapi secara statistik tidak berbeda nyata dengan akuades. Kata kunci: Obat tradisional; Foeniculum vulgare Mill; Sistem Reproduksi

The SSP Syndrome

Science.gov (United States)

Radakovitz, Richard

1975-01-01

Describes a cure for the high school chemistry student with Second Semester Poisoning (SSP), the student disease of apathy which occurs in the spring. Remedy: an outdoor (preferably) demonstration of a series of controlled combustion experiments, with accompanying explanations of the chemistry involved. (MLH)

Aryltetralin lignans from Linum mucronatum Bertol. ssp mucronatum

NARCIS (Netherlands)

Koulman, A; Konuklugil, B; Evren, H

2005-01-01

The dried and aerial part of Linum mucronatum ssp. mucronatum was analyzed by gas chromatographymass spectrometry (GC-MS). Two aryltetralin lignans, podophylloyoxin, 6-methoxypodophylloyoxin, and P-peltatin, were identified. This is the first report of the analysis of L. mucronatum ssp. mucronatum.

cultivars and identification of genotype-specific fingerprints using ...

Indian Academy of Sciences (India)

Home; Journals; Journal of Genetics; Volume 89; Online resources. Diversity in Indian barley (Hordeum vulgare) cultivars and identification of genotype-specific fingerprints using microsatellite markers. S. K. Jaiswal Shree P. Pandey S. Sharma R. Prasad L. C. Prasad R. P. S. Verma Arun K. Joshi. Volume 89 Online ...

Zinc biofortification of cereals: rice differs from wheat and barley

NARCIS (Netherlands)

Stomph, T.J.; Jiang, W.; Struik, P.C.

2009-01-01

In their review, mainly focused on bread wheat (Triticum aestivum), durum wheat (Triticum durum) and barley (Hordeum vulgare), Palmgren et al. 1 M.G. Palmgren et al., Zinc biofortification of cereals: problems and solutions, Trends Plant Sci. 13 (2008), pp. 464–473. Article | PDF (905 K) | View

Real-time weed detection, decision making and patch spraying in maize, sugarbeet, winter wheat and winter barley

DEFF Research Database (Denmark)

Gerhards, R; Christensen, Svend

2003-01-01

with weed infestation levels higher than the economic weed threshold; a review of such work is provided. This paper presents a system for site-specific weed control in sugarbeet (Beta vulgaris L.), maize (Zea mays L.), winter wheat (Triticum aestivum L.) and winter barley (Hordeum vulgare L.), including...

Changes in vertical distribution of spectral reflectance within Spring barley canopy as an indicator of nitrogen nutrition, canopy structure and yield parametrs

Czech Academy of Sciences Publication Activity Database

Klem, Karel; Rajsnerová, Petra; Novotná, Kateřina; Míša, P.; Křen, J.

2014-01-01

Roč. 60, č. 2 (2014), s. 50-59 ISSN 0551-3677 R&D Projects: GA MZe QI111A133; GA TA ČR TA02010780 Institutional support: RVO:67179843 Keywords : Hordeum vulgare * spectral reflectance * vertical gradient * vegetation indices * nitrogen * grain yield * protein content Subject RIV: GC - Agronomy

Agricultural drought and spring barley yields in the Czech Republic

Czech Academy of Sciences Publication Activity Database

Trnka, M.; Hlavinka, P.; Semerádová, Daniela; Dubrovský, Martin; Žalud, Z.; Možný, M.

2007-01-01

Roč. 53, č. 7 (2007), s. 306-316 ISSN 1214-1178 Institutional research plan: CEZ:AV0Z30420517 Keywords : Hordeum vulgare L * Palmer Z-index * climatic conditions * yield * drought Subject RIV: DG - Athmosphere Sciences, Meteorology http://journals.uzpi.cz:8050/web/_generovani_8050/pse_2007.htm

Variation in shoot tolerance mechanisms not related to ion toxicity in barley

KAUST Repository

Tilbrook, Joanne

2017-09-27

Soil salinity can severely reduce crop growth and yield. Many studies have investigated salinity tolerance mechanisms in cereals using phenotypes that are relatively easy to measure. The majority of these studies measured the accumulation of shoot Na+ and the effect this has on plant growth. However, plant growth is reduced immediately after exposure to NaCl before Na+ accumulates to toxic concentrations in the shoot. In this study, nondestructive and destructive measurements are used to evaluate the responses of 24 predominately Australian barley (Hordeum vulgare L.) lines at 0, 150 and 250mMNaCl. Considerable variation for shoot tolerance mechanisms not related to ion toxicity (shoot ion-independent tolerance) was found, withsome lines being able to maintain substantial growth rates under salt stress, whereas others stopped growing. Hordeum vulgare spp. spontaneum accessions and barley landraces predominantly had the best shoot ion independent tolerance, although two commercial cultivars, Fathom and Skiff, also had high tolerance. The tolerance of cv. Fathom may be caused by a recent introgression from H. vulgare L. spp. spontaneum. This study shows that the most salt-tolerant barley lines are those that contain both shoot ion-independent tolerance and the ability to exclude Na+ from the shoot (and thus maintain high K+: Na+ ratios).

Variation in shoot tolerance mechanisms not related to ion toxicity in barley

KAUST Repository

Tilbrook, Joanne; Schilling, Rhiannon K.; Berger, Bettina; Garcia, Alexandre F.; Trittermann, Christine; Coventry, Stewart; Rabie, Huwaida; Brien, Chris; Nguyen, Martin; Tester, Mark A.; Roy, Stuart J.

2017-01-01

Soil salinity can severely reduce crop growth and yield. Many studies have investigated salinity tolerance mechanisms in cereals using phenotypes that are relatively easy to measure. The majority of these studies measured the accumulation of shoot Na+ and the effect this has on plant growth. However, plant growth is reduced immediately after exposure to NaCl before Na+ accumulates to toxic concentrations in the shoot. In this study, nondestructive and destructive measurements are used to evaluate the responses of 24 predominately Australian barley (Hordeum vulgare L.) lines at 0, 150 and 250mMNaCl. Considerable variation for shoot tolerance mechanisms not related to ion toxicity (shoot ion-independent tolerance) was found, withsome lines being able to maintain substantial growth rates under salt stress, whereas others stopped growing. Hordeum vulgare spp. spontaneum accessions and barley landraces predominantly had the best shoot ion independent tolerance, although two commercial cultivars, Fathom and Skiff, also had high tolerance. The tolerance of cv. Fathom may be caused by a recent introgression from H. vulgare L. spp. spontaneum. This study shows that the most salt-tolerant barley lines are those that contain both shoot ion-independent tolerance and the ability to exclude Na+ from the shoot (and thus maintain high K+: Na+ ratios).

Chromosome aberration assays in barley (Hordeum vulgare)

Energy Technology Data Exchange (ETDEWEB)

Constantin, M J [Univ. of Tennessee, Knoxville; Nilan, R A

1982-01-01

Barley is an exceellent organism for studies of induced chromosome aberrations because of its few (2n = 2x = 14) relatively large chromosomes. Root-tip and shoot-tip cells have been used extensively for the study of ionizing radiation-induced chromosome aberrations. The general procedures are well known, the technology is simple and easy to learn, and the assays are relatively quick and inexpensive. Both root tips and shoot tips can be used for the study of chemical mutagens as well as ionizing radiations. Pollen mother cells are well suited for studying the effects of mutagens on meiotic chromosomes. The literature review for the Gene-Tox Program reported on 61 chemicals tested for their effects on barley chromosomes. Of these, 90% were reported to be either positive or positive dose-related, while 7% were negative and 3% were questionable. Barley assays based on chromosomal aberrations are useful to detect the clastogenic potency of chemicals under laboratory conditions. Indications are that the data from barley can be used to corroborate data obtained from other organisms. Among the classes of chemicals assayed were: alcohols and phenols; alkaloids; epoxides; alkyl sulfates; amides and sulfonamides; aromatic amines; aryl halides; aziridines; alkenes; carbamates; hydroazides; nitroaromatics; nitrosamides; nitrosources; phenothiazines; and polycyclic aromatic hydrocarbons.

Radiosensitivity study of cultured barley (hordeum vulgare)

International Nuclear Information System (INIS)

Wang Cailian; Shen Mei; Xu Gang; Zhao Kongnan; Chen Qiufang

1991-07-01

For studying the radioactivity, forty seven varieties of dormant barley seeds were irradiated with various doses (0 ∼ 400 Gy) of 137 Cs γ-rays. The results showed that the dose-effects relations of seedling growth inhibition could be fitted by an equation of F(D) = 1 - (1 - e -a 1 D ) N , and the dose-effects of cell-nucleus, the frequency of root tip cell with chromosome aberations and peroxidase isoenzyme band could be expressed by a linear regression equation Y = A + B · X. The radioactivity of naked barley was much higher than of covered barley. According to different radiosensitivities the varieties studied could be divided into five types i.e. extreme resistant, resistant, intermediate, sensitive, and extreme sensitive. The results also showed that there was close relationship between the DNA content of cell-nucleus, peroxidase isoenzyme zymogram and radioactivity. The radiosensitivty was proportional to the DNA content. The volume of cell-nucleus varied inversly as D 50 of nucleus volume and no obvious correlation with the D 50 of seedling growth inhibition

(Hordeum Vulgare) Crop Coefficient and Comparative Assessment

African Journals Online (AJOL)

Bheema

The second prerequisite for sustainable use of water was developing/ ... Following the construction of .... pond capacity, the irrigation method, soil type, major crops grown in the area, and the ... determines the viability of any irrigation project. .... lack of awareness, lack of skill, technology and lack of adequate knowledge in ...

Chemical weed control in barley (hordeum vulgare)

International Nuclear Information System (INIS)

Sarwar, M.; Hassan, S.W.; Abid, A.A.

2008-01-01

Effect of two different pre-emergence herbicides i.e. Terbutryn (lgron-500FW) A, 1.01.25 kg a.t. ha/sup -1/ and Flurochloridone (Racer-25 CS) a 0.31, 0.37, 0.44, 0.50 and 0.56 Kg a.i. ha/sup -1/ on weeds and yield of barley wad studied under field conditions hb/sup -1/. All the herbicides significantly reduce the dry weight of weed Maximum reduction (70%) was observed in terbutryn a 1.0 Kg a.i. ha/sup -1/ Growth and yield parameters like number of spike lets per spike. Number of grams per spike. 1000-grain weight. Biological yield. Grain yield straw yield and harvest index showed significant response to various herbicides doses under study. Application of Flurochloridone (Racer-25 (CS) a 0.44 kg a.i. ha/sup -1/ and Terbutryn (lgran-500 FW) a 1.0 kg a.i). The data further revealed that in general all herbicide application treatments exhibited superior performance in respect of growth and yield over control. (author)

Giemsa C-banded karyotypes of Hordeum taxa from North America

DEFF Research Database (Denmark)

Linde-Laursen, Ib; Bothmer, R. von; Jacobsen, N.

1986-01-01

submetacentrics than previously reported in Hordeum distinguished the genomes of H. arizonicum and H. brachyantherum (4x) from Newfoundland. A partial inactivation of the nucleolus organizers of one parental genome in interspecific hybrids is considered more common than generally appreciated....

Induction by chromium ions of chitinases and polyamines in barley (Hordeum vulgare L.) and rape (Brassica napus L. ssp. oleifera)

DEFF Research Database (Denmark)

Jacobsen, S.; Hauschild, M.Z.; Rasmussen, U.

1992-01-01

Barley and rape seedlings were grown in hydroponic culture with increasing concentrations of CrO3 (Cr(VI)) or CrCl3 (Cr(III)). The chitinase activity and the concentrations of putrescine, spennidine and spermine were determined in the third leaf of barley seed-lings and in the second leaf of rape...

Untangling nucleotide diversity and evolution of the H genome in polyploid Hordeum and Elymus species based on the single copy of nuclear gene DMC1.

Directory of Open Access Journals (Sweden)

Dongfa Sun

Full Text Available Numerous hybrid and polypoid species are found within the Triticeae. It has been suggested that the H subgenome of allopolyploid Elymus (wheatgrass species originated from diploid Hordeum (barley species, but the role of hybridization between polyploid Elymus and Hordeum has not been studied. It is not clear whether gene flow across polyploid Hordeum and Elymus species has occurred following polyploid speciation. Answering these questions will provide new insights into the formation of these polyploid species, and the potential role of gene flow among polyploid species during polyploid evolution. In order to address these questions, disrupted meiotic cDNA1 (DMC1 data from the allopolyploid StH Elymus are analyzed together with diploid and polyploid Hordeum species. Phylogenetic analysis revealed that the H copies of DMC1 sequence in some Elymus are very close to the H copies of DMC1 sequence in some polyploid Hordeum species, indicating either that the H genome in theses Elymus and polyploid Hordeum species originated from same diploid donor or that gene flow has occurred among them. Our analysis also suggested that the H genomes in Elymus species originated from limited gene pool, while H genomes in Hordeum polyploids have originated from broad gene pools. Nucleotide diversity (π of the DMC1 sequences on H genome from polyploid species (π = 0.02083 in Elymus, π = 0.01680 in polyploid Hordeum is higher than that in diploid Hordeum (π = 0.01488. The estimates of Tajima's D were significantly departure from the equilibrium neutral model at this locus in diploid Hordeum species (P<0.05, suggesting an excess of rare variants in diploid species which may not contribute to the origination of polyploids. Nucleotide diversity (π of the DMC1 sequences in Elymus polyploid species (π = 0.02083 is higher than that in polyploid Hordeum (π = 0.01680, suggesting that the degree of relationships between two parents of a polyploid might be a factor

Responses of growth and primary metabolism of water-stressed barley roots to rehydration

Science.gov (United States)

Barley seedlings [Hordeum vulgare L. Brant] were grown in pots in controlled environment chambers and drought treatments were imposed 11 days after sowing. Soil water content decreased from 92% to 10% after an additional 14 days of water stress. Shoot and root growth ceased after 4 and 9 days of wat...

Environmental impact from mountainous olive orchards under different soil-management systems (SE Spain)

NARCIS (Netherlands)

Francia-Martinez, J.R.; Duran Zuazo, V.H.; Martinez-Raya, A.

2006-01-01

Soil erosion, runoff and nutrient-loss patterns over a two-year period (1999¿2000) were monitored in erosion plots on a mountainside with olive (Olea europaea cv. Picual) trees under three different types of soil management: (1) non-tillage with barley (Hordeum vulgare) strips of 4 m width (BS); (2)

Biochemistry, Structure and Function of Non-Wheat Proteins: Case Study of Barley ß-Amylase

Science.gov (United States)

The importance of a protein is not always evident and may be due to its multifunctional nature. ß-Amylase in seeds of barley (Hordeum vulgare L.) constitutes approximately 2% of the total protein in mature seeds and is assumed to be important when storage proteins are mobilized to support protein s...

Multi-method research strategy for understanding changes in storage protein composition in developing barley grain to improve nutritional profile

DEFF Research Database (Denmark)

Kaczmarczyk, Agnieszka Ewa

Barley (Hordeum vulgare L.) is cultivated in a range of diverse environments and is widely utilised as feed for animal and as malt in brewing. Nitrogen (N) is a key macronutrient whch directly increases plant growth and is used as a fertiliser to meet the demands for higher yield. However...

Starch and Free Sugars during Kernel Development of Bomi Barley and its High-Lysine Mutant 1508

DEFF Research Database (Denmark)

Kreis, Michael

1978-01-01

At maturity the high-lysine barley (Hordeum vulgare L.) Ris0 mutants 1508, 527 and 29 kernels contained about 20% less starch and twice as much free sugars as the parent varieties Bomi and Carlsberg II. An enhanched effect on starch reduction and free sugar accumulation was observed during kernel...

Nitrate Leaching, Yields and Carbon Sequestration after Noninversion Tillage, Catch Crops, and Straw Retention

DEFF Research Database (Denmark)

Hansen, Elly Møller; Munkholm, Lars Juhl; Olesen, Jørgen E

2015-01-01

retention did not significantly increase yields, nor did it reduce leaching, while fodder radish (Raphanus sativus L.) as a catch crop was capable of reducing nitrate leaching to a low level. Thus, YSL of winter wheat (Triticum aestivum L.) was higher than for spring barley (Hordeum vulgare L.) grown after...

Aspectos anatômicos de plântulas Foeniculum vulgare Mill. Anatomical aspects of the Foeniculum vulgare Mill. seedling

Directory of Open Access Journals (Sweden)

C.F. Azevedo

2012-01-01

Full Text Available A erva-doce, Foeniculum vulgare Mill. (Apiaceae, é uma erva entouceirada, aromática que apresenta propriedades condimentares e medicinais; tem origem Européia e é amplamente cultivada em todo o Brasil. Devido à deficiência de informações relativas à organização estrutural de plântulas de espécies medicinais, o presente estudo teve como objetivo fornecer informações sobre a anatomia e o desenvolvimento de plântulas de F. vulgare. As sementes de erva-doce foram semeadas em areia e mantidas em casa de vegetação por 25 dias, sendo realizadas regas diárias. Foram selecionadas plântulas normais e de padrão uniforme, que tiveram raiz, zona de transição, caule, cotilédones e primeiras folhas seccionados à mão livre. Este material foi corado e montado em lâminas com glicerina para observação em microscópio. Em todos os órgãos da plântula de erva-doce a epiderme é unisseriada, cuticularizada e com estômatos; sendo que as duas últimas estruturas não são encontradas na raiz, porém esta apresenta pêlos unicelulares e cônicos. Os cotilédones e as folhas apresentam funções fotossintéticas e nutricionais, indicadas pela presença de grande quantidade de estômatos, cloroplastos e amido. A caracterização anatômica de plântulas de F. vulgare auxilia na identificação da espécie e no conhecimento da organização celular, fornecendo informações que auxiliam em estudos fisiológicos, taxonômicos e ecológicos.Fennel, Foeniculum vulgare Mill. (Apiaceae, is a forming clumps herb and presents aromatic, medicinal and condimental properties. It has European origin and is widely cultivated and used in Brazil. Due to lack of information concerning the structural organization of seedlings of medicinal species, this study aimed to provide information about the anatomy and development of F. vulgare seedlings. The seeds fennel was sowed in sand and maintained in greenhouse for 25 days, with daily waterings. Were selected

Chemical Composition of Essential Oil from Marrubium Vulgare L. Leaves

OpenAIRE

Bayir, Burcu; Gündüz, Hatice; Usta, Tuba; Şahin, Esma; Özdemir, Zeynep; Kayır, Ömer; Sen, Özkan; Akşit, Hüseyin; Elmastaş, Mahfuz; Erenler, Ramazan

2014-01-01

– The essential oils are significant for pharmaceutical, food and cosmetic industries. Marrubium vulgare L. has been used as a traditional medicine to treat the various illnesses. The chemical composition of the essential oil from leaves of Marrubium vulgare L.was obtained by steam distillation using the Clevenger apparatus. The oil was analyzed by gas chromatography and mass spectrometry (GC-MS). The main constituent of the oil was α-pinene (28.85%)

Efficacy of Essential Oils of Thymus vulgaris and Origanum vulgare on Echinococcus granulosus

Directory of Open Access Journals (Sweden)

P. E. Pensel

2014-01-01

Full Text Available The aim of the present work was to determine the in vitro effect of T. vulgaris and O. vulgare essential oils against E. granulosus protoscoleces and cysts. Essential oils were added to the medium resulting in thymol final concentrations of 10 μg/mL. The essential oils had a time-dependent effect provoking the complete loss of protoscolex viability after 72 days of postincubation. The results were confirmed at the ultrastructure level. Loss of infectivity in protoscoleces incubated with O. vulgare after 60 days was observed. On the other hand, the weight of cysts recorded in mice inoculated with T. vulgaris treated protoscoleces was significantly lower than that obtained in control group. Gamma-glutamyl-transpeptidase activity was readily detected in the culture supernatant of protoscoleces treated either with the essential oils or thymol. T. vulgaris and O. vulgare essential oils and thymol can induce cell apoptosis of protoscoleces after short incubation times. The efficacy of T. vulgaris and O. vulgare essential oils was also demonstrated in vitro on E. granulosus murine cysts. Our data suggest that essential oils of T. vulgaris and O. vulgare have anthelmintic effect against protoscoleces and cysts of E. granulosus.

Diterpene synthases of the biosynthetic system of medicinally active diterpenoids in Marrubium vulgare

DEFF Research Database (Denmark)

Zerbe, Philipp; Chiang, Angela; Dullat, Harpreet

2014-01-01

Marrubium vulgare (Lamiaceae) is a medicinal plant whose major bioactive compounds, marrubiin and other labdane-related furanoid diterpenoids, have potential applications as anti-diabetics, analgesics or vasorelaxants. Metabolite and transcriptome profiling of M. vulgare leaves identified five...... different candidate diterpene synthases (diTPSs) of the TPS-c and TPS-e/f clades. We describe the in vitro and in vivo functional characterization of the M. vulgare diTPS family. In addition to MvEKS ent-kaurene synthase of general metabolism, we identified three diTPSs of specialized metabolism: MvCPS3...

Chemical composition and antioxidant activity of Origanum vulgare subsp. vulgare essential oil from Iran

Directory of Open Access Journals (Sweden)

M. Vazirian

2015-12-01

Full Text Available Background and Objectives: Essential oils are very complex mixture of components and their composition may vary in different species or varieties or even within the same variety. Origanum vulgare L. subsp. vulgare is one of the most distributed subspecies within the genus Origanum and has been found to be a poor-oil, categorized in cymyl, bornane or sabinyl chemotypes with higher proportion of sesquiterpenes. In this experiment, the Iranian sample was studied for the chemical composition of the oil and evaluation of its antioxidant activity. Methods: Essential oil was obtained by hydro-distillation and analyzed by GC/MS for determination of components. Antioxidant activity was evaluated by radical scavenging ability (DPPH method and reducing power (FRAP assay. Results: The sample belonged to “thymol” chemotype with the main components as thymol (37.13%, gama-terpinene (9.67%, carvacrol (9.57%, carvacrol methyl ether (6.88, cis-alpha-bisabolene (6.80%, eucalyptol (3.82%, p-cymene (3.58% and elemol (2.04%. The oil of plant showed very strong antioxidant activity (IC50=2.5 µg/mL in DPPH method, which was stronger than the standard antioxidants (Vit E and BHA, p

MglA/SspA complex interactions are modulated by inorganic polyphosphate.

Science.gov (United States)

Wrench, Algevis P; Gardner, Christopher L; Siegel, Sara D; Pagliai, Fernando A; Malekiha, Mahsa; Gonzalez, Claudio F; Lorca, Graciela L

2013-01-01

The transcription factors MglA and SspA of Francisella tularensis form a heterodimer complex and interact with the RNA polymerase to regulate the expression of the Francisella pathogenicity island (FPI) genes. These genes are essential for this pathogen's virulence and survival within host cells. Our goal was to determine if an intracellular metabolite modulate these protein/protein interactions. In this study, we identified inorganic polyphosphate (polyP) as a signal molecule that promotes the interaction of MglA and SspA from F. tularensis SCHU S4. Analysis of the Mgla/SspA interaction was carried out using a two-hybrid system. The Escherichia coli reporter strain contained a deletion on the ppK-ppX operon, inhibiting polyP synthesis. The interaction between MglA and SspA was significantly impaired, as was the interaction between the MglA/SspA complex and the regulatory protein, FevR, indicating the stabilizing effect of polyP. In F. tularensis, chromatin immune precipitation studies revealed that in the absence of polyP, binding of the MglA/SspA complex to the promoter region of the pdpD, iglA, fevR and ppK genes is decreased. Isothermal titration calorimetry (ITC) indicated that polyP binds directly to the MglA/SspA complex with high affinity (KD = 0.3 µM). These observations directly correlated with results obtained from calorimetric scans (DSC), where a strong shift in the mid-transition temperature (Tm) of the MglA/SspA complex was observed in the presence of polyP.

MglA/SspA complex interactions are modulated by inorganic polyphosphate.

Directory of Open Access Journals (Sweden)

Algevis P Wrench

Full Text Available The transcription factors MglA and SspA of Francisella tularensis form a heterodimer complex and interact with the RNA polymerase to regulate the expression of the Francisella pathogenicity island (FPI genes. These genes are essential for this pathogen's virulence and survival within host cells. Our goal was to determine if an intracellular metabolite modulate these protein/protein interactions. In this study, we identified inorganic polyphosphate (polyP as a signal molecule that promotes the interaction of MglA and SspA from F. tularensis SCHU S4. Analysis of the Mgla/SspA interaction was carried out using a two-hybrid system. The Escherichia coli reporter strain contained a deletion on the ppK-ppX operon, inhibiting polyP synthesis. The interaction between MglA and SspA was significantly impaired, as was the interaction between the MglA/SspA complex and the regulatory protein, FevR, indicating the stabilizing effect of polyP. In F. tularensis, chromatin immune precipitation studies revealed that in the absence of polyP, binding of the MglA/SspA complex to the promoter region of the pdpD, iglA, fevR and ppK genes is decreased. Isothermal titration calorimetry (ITC indicated that polyP binds directly to the MglA/SspA complex with high affinity (KD = 0.3 µM. These observations directly correlated with results obtained from calorimetric scans (DSC, where a strong shift in the mid-transition temperature (Tm of the MglA/SspA complex was observed in the presence of polyP.

Anti-Inflammatory, Antioxidant, Antibiotic, and Cytotoxic Activities of Tanacetum vulgare L. Essential Oil and Its Constituents.

Science.gov (United States)

Coté, Héloïse; Boucher, Marie-Anne; Pichette, André; Legault, Jean

2017-05-25

Background: Tanacetum vulgare L. (Asteraceae) is a perennial herb that has been used to treat multiple ailments. Regional variability of the chemical composition of T. vulgare essential oils is well-known. Despite these regional chemotypes, most relevant studies did not analyze the complete chemical composition of the T. vulgare essential oil and its constituents in relation to their biological activities. Here, we assess the anti-inflammatory, antioxidant, antibacterial, and cytotoxic activities of T. vulgare collected from northern Quebec (Saguenay-Lac-St-Jean), Canada. Methods: Essential oil was extracted from plants by steam distillation and analyzed using GC-FID. Biological activities of essential oil and its main constituents were evaluated in vitro. Results: We identified the major compounds as camphor, borneol, and 1,8-cineole. The oil possesses anti-inflammatory activity inhibiting NO production. It also inhibits intracellular DCFH oxidation induced by tert-butylhydroperoxide. Anti-inflammatory activity of essential oil appears driven mainly by α-humulene while antioxidant activity is provided by α-pinene and caryophyllene oxide. Essential oil from T vulgare was active against both Escherichia coli and Staphylococcus aureus with camphor and caryophyllene oxide responsible for antibacterial activity. Finally, T. vulgare essential oil was slightly cytotoxic against the human healthy cell line WS1 while α-humulene and caryophyllene oxide were moderately cytotoxic against A-549, DLD-1, and WS1. Conclusion: We report, for the first time, links between the specific compounds found in T. vulgare essential oil and anti-inflammatory, antioxidant, antibacterial, and cytotoxic activities. T. vulgare essential oil possesses interesting biological properties.

Anti-Inflammatory, Antioxidant, Antibiotic, and Cytotoxic Activities of Tanacetum vulgare L. Essential Oil and Its Constituents

Directory of Open Access Journals (Sweden)

Héloïse Coté

2017-05-01

Full Text Available Background: Tanacetum vulgare L. (Asteraceae is a perennial herb that has been used to treat multiple ailments. Regional variability of the chemical composition of T. vulgare essential oils is well-known. Despite these regional chemotypes, most relevant studies did not analyze the complete chemical composition of the T. vulgare essential oil and its constituents in relation to their biological activities. Here, we assess the anti-inflammatory, antioxidant, antibacterial, and cytotoxic activities of T. vulgare collected from northern Quebec (Saguenay-Lac-St-Jean, Canada. Methods: Essential oil was extracted from plants by steam distillation and analyzed using GC-FID. Biological activities of essential oil and its main constituents were evaluated in vitro. Results: We identified the major compounds as camphor, borneol, and 1,8-cineole. The oil possesses anti-inflammatory activity inhibiting NO production. It also inhibits intracellular DCFH oxidation induced by tert-butylhydroperoxide. Anti-inflammatory activity of essential oil appears driven mainly by α-humulene while antioxidant activity is provided by α-pinene and caryophyllene oxide. Essential oil from T vulgare was active against both Escherichia coli and Staphylococcus aureus with camphor and caryophyllene oxide responsible for antibacterial activity. Finally, T. vulgare essential oil was slightly cytotoxic against the human healthy cell line WS1 while α-humulene and caryophyllene oxide were moderately cytotoxic against A-549, DLD-1, and WS1. Conclusion: We report, for the first time, links between the specific compounds found in T. vulgare essential oil and anti-inflammatory, antioxidant, antibacterial, and cytotoxic activities. T. vulgare essential oil possesses interesting biological properties.

AFLP genetic polymorphism in wild barley (Hordeum spontaneum) populations in Israel

NARCIS (Netherlands)

Turpeinen, T.; Vanhala, T.; Nevo, E.; Nissila, E.

2003-01-01

The genetic diversity produced by the amplified fragment length polymorphism (AFLP) method was studied in 94 genotypes of wild barley, Hordeum spontaneum (C. Koch) Thell., originating from ten ecologically and geographically different locations in Israel. Eight primer pairs produced 204 discernible

Origanum vulgare (Lamiaceae OVICIDAL POTENTIAL ON GASTROINTESTINAL NEMATODES OF CATTLE

Directory of Open Access Journals (Sweden)

Luciana Laitano Dias de Castro

2013-12-01

Full Text Available Due to anthelmintic resistance in nematodes, several research studies have been developed seeking control alternatives to these parasites. This study evaluated the in vitro action of Origanum vulgare on gastrointestinal nematode eggs of cattle. In order to evaluate the ability to inhibit egg hatch, different dried leaves extracts of this plant were tested, such as dye, hydroalcoholic and aqueous extracts at concentrations varying from 0.62 to 80 mg/mL. Each assay was accompanied by control containing levamisole hydrochloride (0.2 mg/mL, distilled water and 70 ºGL grain alcohol at the same concentration of the extracts. Test results showed that the different O. vulgare extracts inhibited egg hatch of cattle gastrointestinal nematodes at a percentage that varied from 8.8 to 100%; dye and hydroalcoholic extract were the most promising inhibitors. In view of this ovicidal property, O. vulgare may be an important source of viable antiparasitic compounds for nematodiosis control in ruminants.

Registration of ‘Kardia’, a Two-Rowed Spring Food Barley

Science.gov (United States)

‘Kardia’ (Reg. No. XXXX, XXXX), a two-rowed spring food barley (Hordeum vulgare L.) developed by the USDA-ARS, Aberdeen, ID, in cooperation with the University of Idaho Agricultural Experiment Station, was released in 2015. Kardia is derived from the cross of ‘03AH3054 / 98Ab12019’ and was advanced...

Effects of Net Blotch ( Pyrenophora teres ) on Malt Barley Yield and ...

African Journals Online (AJOL)

Barley (Hordeum vulgare L.) production is constrained by diseases such as net blotch caused by Pyrenophora teres Drechsl. The objectives of this study were to assess the effects of net blotch disease on malt barley yield and grain quality under natural infection. Four malt barley varieties (Beka, HB 120, HB 52 and Holker), ...

Antihypertensive effect of extracts from Crateva adansonii DC.ssp ...

African Journals Online (AJOL)

Crateva adansonii DC.ssp. adansonii (CA) is a medicinal plant used in traditional medicine to treat various diseases including hypertension. The main objective of ... All rights reserved. Keywords: Crateva adansonii DC.ssp. adansonii, medicinal plant, L-NAME, high blood pressure, Wistar rat, liquid-liquid chromatography ...

Phytochemical Analysis, Antibacterial Activity of Marrubium vulgare L against Staphylococcus aureus in vitro

Directory of Open Access Journals (Sweden)

Saeide Saeidi

2014-10-01

Full Text Available Background: Herbal medicines are the major remedy in traditional medical systems and made a great contribution in maintaining human health and in preventing many infectious diseases. The present study was carried out to determine the potential antibacterial effect of ethanol extracts and essential oil of Marrubium vulgare L. against Staphylococcus aureus which is antibiotic resistant. Materials and Methods: All 17 strains of S. aureus isolated from nose and throat sample from 160 healthy subjects, hospital staffs and inpatient in the city of Zabol (Amir Al-Momenin hospital, Zabol, south-eastern Iran were screened during years 2010-2011. In this study, the essential oil of Marrubium vulgare L. obtained by hydrodistillation was analyzed by gas chromatography coupled to mass spectrometry (GC-MS in order to determine their chemical composition. The minimum inhibitory concentrations were investigated to characterize the antimicrobial activities of this essential oil and extract. Results: Thirty-one components in the oil of Marrubium vulgare were identified. The results demonstrated that the major components of the essential oil were γ-Eudesmol (11%, Germacrene (10%, D-Citronelly formate (10%, β-Citronellol (8%, Geranyl tiglate (7.1%, Geranyl formate (6.02%. The least MIC value of extract M. vulgare was 2.5 mg/mL and the highest MIC value of essential oil M. vulgare was 2.5 mg/mL. Conclusion: This investigation showed that the M. vulgare essential oil and extract has a potent antimicrobial activity against S. aureus. The present studies confirm the use of this essential oil and extract as antibacterial agent. Further research is required to evaluate the practical values of therapeutic applications.

Primer registro de Conidiobolus coronatus (Zygomycetes: Entomophthorales en crías experimentales de dos especies plaga del maíz: Delphacodes kuscheli y D. haywardi (Hemiptera: Delphacidae en la Argentina First record of Conidiobolus coronatus (Zygomycetes: Entomophthorales in experimental breeding of two pest species of corn: Delphacodes kuscheli and D. haywardi Muir (Hemiptera: Delphacidae in Argentine

Directory of Open Access Journals (Sweden)

A. V. Toledo

Full Text Available Se investigó la ocurrencia natural del hongo entomopatógeno Conidiobolus coronatus (Costantin Batko (Zygomycetes: Entomophthorales en adultos de Delphacodes kuscheli Fennah y D. haywardi Muir (Hemiptera: Delphacidae, criados sobre Hordeum vulgare L. bajo condiciones de invernadero. Los insectos muertos, por una sospechada infección fúngica, fueron recolectados, esterilizados superficialmente, y examinados en el laboratorio. Conidiobolus coronatus fue aislado en cultivos puros, descrito morfológicamente y depositado en colecciones micológicas. Este trabajo presenta el primer registro de C. coronatus contra insectos perjudiciales en la Argentina.The natural occurrence of the entomopathogenic fungus Conidiobolus coronatus (Costantin Batko (Zygomycetes: Entomophthorales in adults of Delphacodes kuscheli Fennah and D. haywardi Muir (Hemiptera: Delphacidae, reared on Hordeum vulgare L. under greenhouse conditions, was investigated. Dead insects, suspected of fungal infection, were collected, surface sterilized, and examined in the laboratory. Conidiobolus coronatus was isolated in pure cultures, described morphologically, and deposited in mycological collections. This paper presents the first record of C. coronatus against harmful insects in Argentina.

Recovery of nitrogen by spring barley following incorporation of 15N-labelled straw and catch crop material

DEFF Research Database (Denmark)

Thomsen, I.K.; Jensen, E.S.

1994-01-01

The recovery by spring barley (Hordeum vulgare L.) of nitrogen mineralized from N-15-labelled straw and ryegrass material was followed for 3 years in the field. The effects of separate and combined applications of straw and ryegrass were studied using cross-labelling with N-15. Reference plots re...... mineral fertilizer was in the second and third barley crop similar to the recovery of N from incorporated plant residues.......The recovery by spring barley (Hordeum vulgare L.) of nitrogen mineralized from N-15-labelled straw and ryegrass material was followed for 3 years in the field. The effects of separate and combined applications of straw and ryegrass were studied using cross-labelling with N-15. Reference plots...... receiving (NH4NO3)-N-15-N-15 were included. Plant samples were taken every second week until maturity during the first growing season and at maturity in the two following years. Incorporation of plant material had no significant influence on the above-ground dry matter yield of the barley. The barley...

Implementation of biochemical screening to improve baking quality of barley

DEFF Research Database (Denmark)

Vincze, Éva; Dionisio, Giuseppe; Aaslo, Per

2011-01-01

Barley (Hordeum vulgare) has the potential to offer considerable human nutritional benefits, especially as supplement to wheat-based breads. Under current commercial baking conditions it is not possible to introduce more that 20% barley flour to the wheat bread without negative impact on the phys......Barley (Hordeum vulgare) has the potential to offer considerable human nutritional benefits, especially as supplement to wheat-based breads. Under current commercial baking conditions it is not possible to introduce more that 20% barley flour to the wheat bread without negative impact...... on the physical chemical properties of the bread products due to the poor baking properties of barley flour. As a consequence, the nutritional advantages of barley are not fully exploited. The inferior leavening and baking properties of barley can, in part, be attributed to the physical properties of the storage...... proteins. Changing the storage protein composition can lessen this problem. Our working hypothesis was that exploiting the substantial genetic variation within the gene pool for storage proteins could enable improving the baking qualities of barley flour. We characterised forty-nine barley cultivars...

Kvalitet, faglighed og legitime videnformer i SSP-samarbejdet under transformation

DEFF Research Database (Denmark)

Tamborg, Andreas Lindenskov

2016-01-01

Quality, professionalism and legitimate knowledge in a changing SSP-collaboration. This article explores the inter professional collaboration in a crime preventive initiative called SSP, which is a collaboration between school, social work and police. By drawing on interviews of actors from...... the collaboration and on historic sources that document the background of the establishment of SSP, the articles main focus is to explore and explain how the actors in the collaboration view legitimate and valuable knowledge. The article’s main conclusion is that the actors mainly view knowledge legitimate...... to the extent it can be linked to research based models. Consequently, this means that the conception of professional knowledge in SSP is at risk of being reduced to only include their information, which can be linked to these models....

Taxonomy, Variation, and Relationships in the Hordeum parodii Group (Poaceae)

DEFF Research Database (Denmark)

Von Bothmer, R.; Jacobsen, N.; Bagger Jørgensen, Rikke

1986-01-01

The Hordeum parodii group contains three species, viz. H. parodii Covas (6x), H. tetraploidum Covas (4x), and H. fuegianum Bothmer, Jacobsen, et Jorgensen, sp. nov. (4x). The former two species mainly occur in C and S Argentina, while H. fuegianum is native to Tierra del Fuego. All three species...

Chemical and Antibacterial Polymorphism of Juniperus oxycedrus ssp. oxycedrus and Juniperus oxycedrus ssp. macrocarpa (Cupressaceae Leaf Essential Oils from Tunisia

Directory of Open Access Journals (Sweden)

Hnène Medini

2013-01-01

Full Text Available Essential oils from Juniperus oxycedrus L. have been used since antiquity for fragrance, flavoring, medicinal, antimicrobial, insecticidal, and cosmetic purposes. Several works studied the chemical composition of the essential oils of Juniperus oxycedrus leaves. The aim of this study is to investigate the chemotaxonomic relationships and antibacterial activity of two Tunisian subspecies: Juniperus oxycedrus ssp. oxycedrus (L. K. Deb. and Juniperus oxycedrus ssp. macrocarpa (S. & m. Ball. In addition, and for the first time, we reported the antibacterial activities of Tunisian J. oxycedrus ssp. macrocarpa and J. oxycedrus ssp. oxycedrus against four bacteria. Essential oils obtained by hydrodistillation were analysed by GC and GC/MS. Fifty-five constituents were identified. Thirty four major compounds were retained for the study of the chemical variability, and α-pinene, sylvestrene, p-cymene, and 13-epi-manoyl oxide were the main ones. The chemical principal components analysis (PCA identified three chemotypes. The study of the antibacterial activity showed that Escherichia coli was found to be extremely resistant (zone diameter 0 mm to all the oils tested, while Staphylococcus aureus was the most sensitive strain (zone diameter 13.5 mm and MIC ranged from 600 to 650 μg/mL.

Physiological effects and transport of 24-epibrassinolide in heat-stressed barley

Czech Academy of Sciences Publication Activity Database

Janeczko, A.; Oklešťková, Jana; Pociecha, E.; Koscielniak, J.; Mirek, M.

2011-01-01

Roč. 33, č. 4 (2011), s. 1249-1259 ISSN 0137-5881 R&D Projects: GA AV ČR IAA400550801; GA ČR GA301/08/1649 Institutional research plan: CEZ:AV0Z50380511 Keywords : Brassinosteroid transport * Dark respiration * Hordeum vulgare L * PSII efficiency * Metabolic activity Subject RIV: EF - Botanics Impact factor: 1.639, year: 2011

Effects of slurry pre-treatment and application technique on short-term N₂O emmissions as determind by a new non-linear approach

DEFF Research Database (Denmark)

Thomsen, Ingrid K; Pedersen, Asger R; Nyord, Tavs

2010-01-01

, and losses via N2O. Two field experiments were carried out on a loamy sand. Pig slurry was applied to established crops, i.e., to spring barley (Hordeum vulgare L.) in May 2007, and to winter wheat (Triticum aestivum L.) in April 2008. In 2007 the slurry was applied by direct injection using either winged...

Ridging in autumn as an alternative to mouldboard ploughing in a humid-temperate region

DEFF Research Database (Denmark)

Henriksen, Jens Christian Martin Bugge; Rasmussen, Jesper; Søgaard, Carsten

2006-01-01

and ploughing. Residue treatments were stubble, stubble + straw and stubble + liquid manure in order to create a gradient of C/N ratios. From the time of harvest until planting of a subsequent barley crop (Hordeum vulgare L.), inorganic N was determined 11 times in 1998–1999 and 10 times in 1999–2000 in the 0...

Comparison of fast neutrons and X-rays in respect to genetic effects accompanying induced chromosome aberrations, in relation to the evaluation of the BARN-reactor

International Nuclear Information System (INIS)

Ramulu, K.S.

1980-01-01

The M 2 and M 3 plants derived from both fast neutron and X-ray treatments have been studied to detect and analyse reciprocal translocations in Arabidopsis thaliana (L.) Heynh. cv. Landsberg erecta (2n=10), Hordeum vulgare L. cv. Aramir (2n=14) and Secale cereale L., summer inbred line ZF9 (2n=14). (Auth.)

Effects of 24-epibrassinolide and green light on plastid gene transcription and cytokinin content of barley leaves

Czech Academy of Sciences Publication Activity Database

Efimova, N.V.; Vaňková, Radomíra; Kusnetsov, V.; Litvinovskaya, R. P.; Zlobin, Y.L.; Dobrev, Petre; Vedenicheva, N.P.; Savchuk, A. L.; Karnachuk, R. A.; Kudryakova, N.V.; Kuznetsov, V. D.

2017-01-01

Roč. 120, APR (2017), s. 32-40 ISSN 0039-128X Institutional support: RVO:61389030 Keywords : lupinus-luteus cotyledons * arabidopsis-thaliana * de-etiolation * abscisic-acid * brassinosteroid biosynthesis * plant development * hormonal balance * mutant * expression * growth * Brassinosteroids * Cytokinin * Gene expression * Green light * Hordeum vulgare * Transcription Subject RIV: EF - Botanics OBOR OECD: Plant sciences, botany Impact factor: 2.282, year: 2016

PENGEMBANGAN SSP TEMATIK INTEGRATIF UNTUK MEMBANGUN KARAKTER KEJUJURAN DAN KEPEDULIAN SISWA SD KELAS II

Directory of Open Access Journals (Sweden)

Sri Hariyati Qodriyah

2015-07-01

Full Text Available Penelitian ini bertujuan untuk menghasilkan perangkat pembelajaran berupa SSP Tematik yang dapat mengembangkan karakter siswa kelas 2 sekolah dasar, meliputi karakter kejujuran dan kepedulian. Penelitian ini merupakan penelitian dan pengembangan yang terdiri dari tujuh tahap, yaitu studi pendahuluan, perencanaan, mengembangkan produk awal, uji coba awal, revisi produk utama, uji coba lapangan, dan revisi terhadap produk operasional. SSP yang dikembangkan dievaluasi oleh seorang ahli materi dan media untuk mengetahui validitasnya. Subjek uji coba berjumlah 90 siswa terdiri dari 23 siswa SD Sonosewu, Kasihan, Bantul, DIY sebagai subjek uji coba terbatas dan 33 siswa untuk kelas control dan 34 siswa untuk kelas eksperimen SD 1 Kadipiro, Kasihan, Bantul, DIY. Hasil penelitian ini berupa SSP yang meliputi: silabus, RPP, LKS, dan lembar penilaian. Hasil evaluasi dari ahli materi dan ahli media untuk menguji tingkat kevalidan SSP menyatakan bahwa SSP yang dikembangkan adalah valid dan berkategori “baik”. Hasil uji coba menunjukkan bahwa SSP yang dikembangkan dinyatakan layak serta memenuhi kriteria praktis dan efektif dalam mengembangkan karakter siswa. Pembelajaran dengan SSP yang dikembangkan mampu mengembangkan karakter kejujuran dan kepedulian. Kata Kunci: SSP, karakter jujur dan peduli   DEVELOPING THEMATIC INTEGRATIVE SSP FOR BUILDING THE CHARACTERS OF HONESTY AND CARE GRADE II STUDENT OF ELEMENTARY SCHOOL Abstract This study aims to produce integrated learning sets in the form of thematic SSP that can develop the characters of honesty and care of grade II students of elementary school. This was a research and development study consisting of seven steps, i.e. preliminary study, planning, preliminary product development, preliminary tryout, main product revision, field tryout, revision of operational product, operational product revision, and revision of the final product. The developed SSP was evaluated by a science subject expert to assess

Foeniculum vulgare: A comprehensive review of its traditional use, phytochemistry, pharmacology, and safety

Directory of Open Access Journals (Sweden)

Manzoor A. Rather

2016-11-01

Full Text Available Foeniculum vulgare (Apiaceae commonly known as fennel is a well known and important medicinal and aromatic plant widely used as carminative, digestive, lactogogue and diuretic and in treating respiratory and gastrointestinal disorders. Its seeds are used as flavourings in baked goods, meat and fish dishes, ice cream, alcoholic beverages and herb mixtures. Phenols, phenolic glycosides and volatile aroma compounds such as trans-anethole, estragole and fenchone have been reported as the major phytoconstituents of this species. Different pharmacological experiments in a number of in vitro and in vivo models have convincingly demonstrated the ability of F. vulgare to exhibit antifungal, antibacterial, antioxidant, antithrombotic and hepatoprotective activities, lending support to the rationale behind several of its therapeutic uses. Phenolic compounds isolated from F. vulgare are considered to be responsible for its antioxidant activity while the volatile aroma compounds make it an excellent flavouring agent. The present review is an up-to-date and comprehensive analysis of the chemistry, pharmacology, traditional uses and safety of F. vulgare.

Molecular phylogeography of domesticated barley traces expansion of agriculture in the Old World.

Science.gov (United States)

Saisho, Daisuke; Purugganan, Michael D

2007-11-01

Barley (Hordeum vulgare ssp. vulgare) was first cultivated 10,500 years ago in the Fertile Crescent and is one of the founder crops of Eurasian agriculture. Phylogeographic analysis of five nuclear loci and morphological assessment of two traits in >250 domesticated barley accessions reveal that landraces found in South and East Asia are genetically distinct from those in Europe and North Africa. A Bayesian population structure assessment method indicates that barley accessions are subdivided into six clusters and that barley landraces from 10 different geographical regions of Eurasia and North Africa show distinct patterns of distribution across these clusters. Using haplotype frequency data, it appears that the Europe/North Africa landraces are most similar to the Near East population (F ST = 0.15) as well as to wild barley (F ST = 0.11) and are strongly differentiated from all other Asian populations (F ST = 0.34-0.74). A neighbor-joining analysis using these F ST estimates also supports a division between European, North African, and Near East barley types from more easterly Asian accessions. There is also differentiation in the presence of a naked caryopsis and spikelet row number between eastern and western barley accessions. The data support the differential migration of barley from two domestication events that led to the origin of barley--one in the Fertile Crescent and another farther east, possibly at the eastern edge of the Iranian Plateau--with European and North African barley largely originating from the former and much of Asian barley arising from the latter. This suggests that cultural diffusion or independent innovation is responsible for the expansion of agriculture to areas of South and East Asia during the Neolithic revolution.

Relationships in the barley genus (Hordeum): An electrophoretic examination of proteins

DEFF Research Database (Denmark)

Bagger Jørgensen, Rikke

1986-01-01

The relationships between all known Hordeum species except H. guatemalense were inferred from the electrophoresis of the six enzyme systems Got, 6-Pgd, Mdh, Idh, .alpha.- and.beta.- amylases. A total of eleven loci were scored for in these systems. Maximum likelihood clusters and Wagner networks...

The genetics and mechanism of avoidance of rust infection in Hordeum chilense

NARCIS (Netherlands)

Vaz Patto, M.C.

2001-01-01

Hordeum chilense is a perennial species occurring in Chile and Argentina. This wild barley species shows a very wide range of variation of morphological and agronomic characters and crosses easily with other members of the Triticeae

Environmental adaptibility of tansy ( Tanacetum vulgare L ...

African Journals Online (AJOL)

Ecological role of essential oils is reflected in the interaction of plants with environmental factors. Environmental adaptability of the plants can be assumed from essential oil contents. Essential oils are agents, which communicate with the plant environment. Tansy (Tanacetum vulgare L.) was selected for laboratory research ...

Environmental adaptibility of tansy (Tanacetum vulgare L.)

African Journals Online (AJOL)

STORAGESEVER

2009-11-16

Nov 16, 2009 ... Ecological role of essential oils is reflected in the interaction of plants with environmental factors. Environmental adaptability of the plants can be assumed from essential oil contents. Essential oils are agents, which communicate with the plant environment. Tansy (Tanacetum vulgare L.) was selected for.

Antibacterial and antioxidant activities of essential oils isolated from Thymbra capitata L. (Cav.) andOriganum vulgare L.

Science.gov (United States)

Faleiro, Leonor; Miguel, Graça; Gomes, Sónia; Costa, Ludmila; Venâncio, Florencia; Teixeira, Adriano; Figueiredo, A Cristina; Barroso, José G; Pedro, Luis G

2005-10-19

Antilisterial activities of Thymbra capitata and Origanum vulgare essential oils were tested against 41 strains of Listeria monocytogenes. The oil of T. capitata was mainly constituted by one component, carvacrol (79%), whereas for O. vulgare three components constituted 70% of the oil, namely, thymol (33%), gamma-terpinene (26%), and p-cymene (11%). T. capitata essential oil had a significantly higher antilisterial activity in comparison to O. vulgare oil and chloramphenicol. No significant differences in L. monocytogenes susceptibilities to the essential oils tested were registered. The minimum inhibitory concentration values of T. capitata essential oil and of carvacrol were quite similar, ranging between 0.05 and 0.2 microL/mL. Antioxidant activity was also tested, the essential oil of T. capitata showing significantly higher antioxidant activity than that of O. vulgare. Use of T. capitata and O. vulgare essential oils can constitute a powerful tool in the control of L. monocytogenes in food and other industries.

DNA replication after mutagenic treatment in Hordeum vulgare.

Science.gov (United States)

Kwasniewska, Jolanta; Kus, Arita; Swoboda, Monika; Braszewska-Zalewska, Agnieszka

2016-12-01

The temporal and spatial properties of DNA replication in plants related to DNA damage and mutagenesis is poorly understood. Experiments were carried out to explore the relationships between DNA replication, chromatin structure and DNA damage in nuclei from barley root tips. We quantitavely analysed the topological organisation of replication foci using pulse EdU labelling during the S phase and its relationship with the DNA damage induced by mutagenic treatment with maleic hydrazide (MH), nitroso-N-methyl-urea (MNU) and gamma ray. Treatment with mutagens did not change the characteristic S-phase patterns in the nuclei; however, the frequencies of the S-phase-labelled cells after treatment differed from those observed in the control cells. The analyses of DNA replication in barley nuclei were extended to the micronuclei induced by mutagens. Replication in the chromatin of the micronuclei was rare. The results of simultanous TUNEL reaction to identify cells with DNA strand breaks and the labelling of the S-phase cells with EdU revealed the possibility of DNA replication occurring in damaged nuclei. For the first time, the intensity of EdU fluorescence to study the rate of DNA replication was analysed. Copyright © 2016 Elsevier B.V. All rights reserved.

Diversity in Indian barley (Hordeum vulgare) cultivars and ...

Indian Academy of Sciences (India)

tinguish varieties of crop plants and establish their purity as a prerequisite for any ... of genetic material in germplasm collection and as a general guide for the choice ... Sixty-nine barley cultivars were grown under field condi- tions in three ...

Coupling amplified DNA from flow-sorted chromosomes to high-density SNP mapping in barley

Czech Academy of Sciences Publication Activity Database

Šimková, Hana; Svensson, J.T.; Condamine, P.; Hřibová, Eva; Suchánková, Pavla; Bhat, P.R.; Bartoš, Jan; Šafář, Jan; Close, T.J.; Doležel, Jaroslav

2008-01-01

Roč. 9, č. 294 (2008), s. 1-9 ISSN 1471-2164 R&D Projects: GA ČR GD521/05/H013; GA MŠk ME 884; GA MŠk(CZ) LC06004 Institutional research plan: CEZ:AV0Z50380511 Keywords : Flow cytometry * DNA amplification * Hordeum vulgare L. Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 3.926, year: 2008

INFLUENCE OF SPATIAL AND TEMPORAL VARIATIONS IN THE HYPERSENSITIVE RESPONSE ON THE ACCUMULATION OF DEFENSE-RELATED TRANSCRIPTS IN POWDERY MILDEW-INFECTED BARLEY

Czech Academy of Sciences Publication Activity Database

Rayapuram, C.; Hemzalová, Vendula; Lyngkjaer, M. E.

2011-01-01

Roč. 93, č. 3 (2011), s. 613-625 ISSN 1125-4653 R&D Projects: GA MZe QH72117 Institutional research plan: CEZ:AV0Z50380511 Keywords : Blumeria graminis f. sp hordei * Hordeum vulgare * hypersensitive response Subject RIV: GF - Plant Pathology, Vermin, Weed, Plant Protection Impact factor: 0.912, year: 2011 http://sipav.org/main/jpp/index.php/jpp/article/view/1229

Radiation induced early maturing mutants in barley

International Nuclear Information System (INIS)

Kumar, R.; Chauhan, S.V.S.; Sharma, R.P.

1978-01-01

In M 2 generation, two early maturing plants were screened from a single spike progeny of a plant obtained from 20 kR of gamma-ray irradiation of a six-rowed barley (Hordeum vulgare L. var. Jyoti). Their true breeding nature was confirmed in M 3 generation. These mutants flower and mature 38 and 22 days earlier than those of control. (auth.)

Pengaruh SSP tematik terhadap peningkatkan karakter kejujuran dan disiplin peserta didik kelas I SD

Directory of Open Access Journals (Sweden)

Masnur Masnur

2017-01-01

Full Text Available Tujuan penelitian ini untuk mengetahui, pengaruh Subject Specific Pedagogy (SSP tematik dan pembelajaran tematik yang tidak menggunakan SSP tematik terhadap peningkatan karakter kejujuran dan disiplin peserta didik pada tema peristiwa alam semester genap kelas I SDN di Kecamatan Ujung kota Parepare tahun ajaran 2013/2014. Penelitian eksperimen semu dengan nonequivalent groups pretest-posttest design ini mengandung satu variabel bebas dan dua variabel terikat. Variabel bebas adalah Subject Specific Pedagogy (SSP tematik sedangkan variabel terikat adalah karakter kejujuran dan disiplin. Populasi penelitian ini adalah seluruh peserta didik kelas I SDN di Kecamatan Ujung Kota Parepare. Sampel dipilih dengan tekhnik purposive sampling, sehingga didapat tiga kelas sebagai sampel penelitian. Kelompok eksperimen 1 dan kelompok eksperimen 2 diberi perlakuan menggunakan SSP tematik, dan kelompok kontrol diberi perlakuan menggunakan pembelajaran tematik yang tidak menggunakan SSP tematik. Teknik pengumpulan data yang digunakan adalah teknik angket dan teknik observasi. Teknik angket digunakan untuk mengetahui nilai karakter kejujuran dan disiplin peserta didik. Teknik observasi digunakan untuk mengungkap perilaku karakter kejujuran dan disiplin peserta didik. Teknik analisis data digunakan adalah Analisys of Variance (ANOVA dengan taraf signifikansi 0.05. Hasil penelitian ini adalah SSP tematik secara signifkan berpengaruh positif terhadap peningkatan karakter kejujuran peserta didik dibandingkan dengan pembelajaran tematik yang tidak menggunakan SSP tematik diperoleh p < α yaitu p = 0,000 < α = 0,05 dengan F = 27,890; dan karakter disiplin peserta didik dibandingkan dengan pembelajaran tematik diperoleh p < α yaitu p = 0,000 < α = 0,05 dengan F= 9,294. Kata kunci: Subject Specific Pedagogy tematik, kejujuran, disiplin The effect of SSP thematic on the increase of characters honesty and discipline of grade 1 elementary school students Abstract The

JST Thesaurus Headwords and Synonyms: Sorghum vulgare [MeCab user dictionary for science technology term[Archive

Lifescience Database Archive (English)

Full Text Available MeCab user dictionary for science technology term Sorghum vulgare 名詞 一般 * * * * モロコ...シ モロコシ モロコシ Thesaurus2015 200906063836088318 C LS06/LS72 UNKNOWN_2 Sorghum vulgare

Susceptibility of wild carrot (Daucus carota ssp. carota) to Sclerotinia sclerotiorum

DEFF Research Database (Denmark)

Jensen, Brita Dahl; Finckh, M.R.; Munk, Lisa

2008-01-01

Sclerotinia soft rot, caused by Sclerotinia sclerotiorum, is a severe disease of cultivated carrots (Daucus carota ssp. sativus) in storage. It is not known whether Sclerotinia soft rot also affects wild carrots (D. carota ssp. carota), which hybridise and exchange genes, among them resistance...

Omslaget - hvid okseøje (Leucanthemum vulgare)

DEFF Research Database (Denmark)

Friis, Ib

2010-01-01

Artiklen redergør for den historiske baggrund for den illustration (tavle 994 fra Flora Danica, udgivet i 1790) af hvid okseøje (Leucanthemum vulgare), der er anvendt som illustration på festskriftets omslag. De illustratorer, der blev anvendt af Martin Vahl, udgiver af Flora Danica da tavle 994...

Natural killer cell activities of synbiotic Lactobacillus casei ssp. casei in conjunction with dextran.

Science.gov (United States)

Ogawa, T; Asai, Y; Tamai, R; Makimura, Y; Sakamoto, H; Hashikawa, S; Yasuda, K

2006-01-01

We have reported previously that Lactobacillus casei ssp. casei, together with specific substrate dextran, exhibited an adjuvant effect of stimulating humoral immune responses against bovine serum albumin (BSA) as a model antigen in BALB/c mice. In the present study, among the Lactobacillus species tested, L. casei ssp. casei with dextran significantly elevated the natural killer (NK) cell activities in spleen mononuclear cells from BALB/c mice in comparison to L. casei ssp. casei alone or other Lactobacillus species with or without dextran. Oral administration of L. casei ssp. casei together with dextran also resulted in a significant increase of NK cell activities in healthy human volunteers. Further, L. casei ssp. casei induced significant production of interleukin (IL)-12 in human peripheral blood mononuclear cells and IL-15 mRNA expression in the human intestinal epithelial cell line Caco-2. L. casei ssp. casei with dextran in food also significantly elevated the survival rate of BALB/c mice bearing Meth-A cells. Taken together, these results demonstrate that dietary synbiotic supplementation which is a combination of the L. casei ssp. casei used as a probiotic together with the dextran, a specific substrate as a prebiotic, efficiently elicits murine and human NK cell activities.

SSP Plus at 36 Months: Effects of Adding Employment Services to Financial Work Incentives.

Science.gov (United States)

Lei, Ying; Michalopoulos, Charles

A study examined effects of the Self-Sufficiency Project (SSP) Plus program. A small group of long-term income assistance (IA) recipients in New Brunswick was offered an earnings supplement and employment services (SSP Plus); a second group was offered the regular SSP earnings supplement only; and a third group was offered neither supplement nor…

Foderstater för ökad konsumtion av vallfoder

DEFF Research Database (Denmark)

Hetta, M.; Lund, Peter; Tahir, M.N.

2011-01-01

nedbrytningen från våmmen till tunntarmen. Nedbrytning av stärkelse i tunntarmen leder till högre energieffektivitet i ämnesomsättningen. Stärkelse hos korn (Hordeum Vulgare, L) anses i litteraturen ha en snabb omsättning i våmmen och stärkelse hos majs (Zea Mays, L) anses ha en långsam nedbrytning (Mills et al...

Toxicities of TNT and RDX to Terrestrial Plants in Five Soils with Contrasting Characteristics

Science.gov (United States)

2013-07-01

lettuce ( Lactuca sativa (L.)) and barley (Hordeum vulgare (L.)), respectively, at analytically determined soil concentrations up to and including 3320... sativa L.), Japanese millet (J. millet; Echinochloa crus-galli L. [Beauv.]), and perennial ryegrass (Lolium perenne L.) in five natural soils that...of the test. The test species in these studies were Medicago sativa (L.) var. Canada no. 1 (alfalfa), Echinochloa crus-galli (L.) P. Beauv. var

The Phytotoxicity of Designated Pollutants on Plant Species

Science.gov (United States)

1984-03-01

Only seeds collected from those flowers exposed during pollin 20. DISTRIBUTION/AVAILABILITY OF ABSTRACT 21. ABSTRACT SECURITY CLASSIFICATION...acid exposure during pollination lowered the germination rate of mature seeds. Plant injury was chiefly a function of acid concentration, but amount...TESTS Species Name Variety Barley Hordeum vulgare L. CM67 Bean Phaseolus vulgaris L. Pinto Citrus Citrus limon (L.) Lupe Lemon Lettuce Lactuca sativa

The fungi communities of the soil environment of Triticum aestivum and its forecrops: Hordeum vulgare, Vicia faba ssp. minor and Trifolium pratense

OpenAIRE

Elżbieta Pląskowska

2014-01-01

The species spectrum and abundance of the fungi communities were affected by the soil environment developed by wheat and its forecrops, and by atmospheric conditions. The fungi of the genus Fusarium were the greatest threat to winter wheat regardless of the forecrop. The field bean was the best forecrop to the wheat whereas spring barley was the worst.

An abstract class loader for the SSP and its implementation in TL.

Energy Technology Data Exchange (ETDEWEB)

Wickstrom, Gregory Lloyd; Winter, Victor Lono (University of Nebraska at Omaha, Omaha, NE); Fraij, Fares (University of Texas at El Paso, El Paso, TX); Roach, Steve (University of Texas at El Paso, El Paso, TX); Beranek, Jason (University of Nebraska at Omaha, Omaha, NE)

2004-08-01

The SSP is a hardware implementation of a subset of the JVM for use in high consequence embedded applications. In this context, a majority of the activities belonging to class loading, as it is defined in the specification of the JVM, can be performed statically. Static class loading has the net result of dramatically simplifying the design of the SSP as well as increasing its performance. Due to the high consequence nature of its applications, strong evidence must be provided that all aspects of the SSP have been implemented correctly. This includes the class loader. This article explores the possibility of formally verifying a class loader for the SSP implemented in the strategic programming language TL. Specifically, an implementation of the core activities of an abstract class loader is presented and its verification in ACL2 is considered.

Comparative pathogenicity of Vibrio spp., Photobacterium damselae ssp. damselae and five isolates of Aeromonas salmonicida ssp. achromogenes in juvenile Atlantic halibut (Hippoglossus hippoglossus).

Science.gov (United States)

Bowden, T J; Bricknell, I R; Preziosi, B M

2018-01-01

Juvenile Atlantic halibut (~100 mg, Hippoglossus hippoglossus) were exposed to Vibrio proteolyticus, a Vibrio spp. isolate, Photobacterium damselae ssp. damselae and five different isolates of Aeromonas salmonicida ssp. achromogenes via an hour-long bath immersion to ascertain their variation in pathogenicity to this fish species. Results were analysed using Kaplan-Meier survival analysis. Analysis of the data from challenges using A. salmonicida ssp. achromogenes revealed three survival values of zero and a spread of values from 0 to 28.43. Challenges using a Vibrio spp isolate, V. proteolyticus and P. damselae resulted in Kaplan-Meier survival estimates of 31.21, 50.41 and 57.21, respectively. As all bacterial species tested could induce juvenile halibut mortalities, they must all be considered as potential pathogens. However, the degree of pathogenicity of A. salmonicida is isolate dependent. © 2017 John Wiley & Sons Ltd.

Searching for moving objects in HSC-SSP: Pipeline and preliminary results

Science.gov (United States)

Chen, Ying-Tung; Lin, Hsing-Wen; Alexandersen, Mike; Lehner, Matthew J.; Wang, Shiang-Yu; Wang, Jen-Hung; Yoshida, Fumi; Komiyama, Yutaka; Miyazaki, Satoshi

2018-01-01

The Hyper Suprime-Cam Subaru Strategic Program (HSC-SSP) is currently the deepest wide-field survey in progress. The 8.2 m aperture of the Subaru telescope is very powerful in detecting faint/small moving objects, including near-Earth objects, asteroids, centaurs and Tran-Neptunian objects (TNOs). However, the cadence and dithering pattern of the HSC-SSP are not designed for detecting moving objects, making it difficult to do so systematically. In this paper, we introduce a new pipeline for detecting moving objects (specifically TNOs) in a non-dedicated survey. The HSC-SSP catalogs are sliced into HEALPix partitions. Then, the stationary detections and false positives are removed with a machine-learning algorithm to produce a list of moving object candidates. An orbit linking algorithm and visual inspections are executed to generate the final list of detected TNOs. The preliminary results of a search for TNOs using this new pipeline on data from the first HSC-SSP data release (2014 March to 2015 November) present 231 TNO/Centaurs candidates. The bright candidates with Hr 5 show that the best-fitting slope of a single power law to absolute magnitude distribution is 0.77. The g - r color distribution of hot HSC-SSP TNOs indicates a bluer peak at g - r = 0.9, which is consistent with the bluer peak of the bimodal color distribution in literature.

Progenitor-derivative relationships of Hordeum polyploids (Poaceae, Triticeae inferred from sequences of TOPO6, a nuclear low-copy gene region.

Directory of Open Access Journals (Sweden)

Jonathan Brassac

Full Text Available Polyploidization is a major mechanism of speciation in plants. Within the barley genus Hordeum, approximately half of the taxa are polyploids. While for diploid species a good hypothesis of phylogenetic relationships exists, there is little information available for the polyploids (4×, 6× of Hordeum. Relationships among all 33 diploid and polyploid Hordeum species were analyzed with the low-copy nuclear marker region TOPO6 for 341 Hordeum individuals and eight outgroup species. PCR products were either directly sequenced or cloned and on average 12 clones per individual were included in phylogenetic analyses. In most diploid Hordeum species TOPO6 is probably a single-copy locus. Most sequences found in polyploid individuals phylogenetically cluster together with sequences derived from diploid species and thus allow the identification of parental taxa of polyploids. Four groups of sequences occurring only in polyploid taxa are interpreted as footprints of extinct diploid taxa, which contributed to allopolyploid evolution. Our analysis identifies three key species involved in the evolution of the American polyploids of the genus. (i All but one of the American tetraploids have a TOPO6 copy originating from the Central Asian diploid H. roshevitzii, the second copy clustering with different American diploid species. (ii All hexaploid species from the New World have a copy of an extinct close relative of H. californicum and (iii possess the TOPO6 sequence pattern of tetraploid H. jubatum, each with an additional copy derived from different American diploids. Tetraploid H. bulbosum is an autopolyploid, while the assumed autopolyploid H. brevisubulatum (4×, 6× was identified as allopolyploid throughout most of its distribution area. The use of a proof-reading DNA polymerase in PCR reduced the proportion of chimerical sequences in polyploids in comparison to Taq polymerase.

Antibacterial activity of whole plant extract of Marrubium vulgare

African Journals Online (AJOL)

SERVER

2007-11-26

Nov 26, 2007 ... Key words: Disc diffusion, antibacterial activity, Marrubium vulgare. INTRODUCTION .... Glossary of Indian Medicinal. Plants, CSIR, V ed. ... 22. E. coli MTCC 443. 0. 0. 0. 10. 15. 400. 25. P. vulgaris MTCC 426. 0. 0. 0. 11. 16.

Comparison between MRI and 3D-SSP in olivopontocerebellar atrophy and cortical cerebellar atrophy

International Nuclear Information System (INIS)

Hamaguchi, Hirotoshi; Kanda, Fumio; Hosaka, Kayo; Fujii, Masahiko; Chihara, Kazuo

2004-01-01

We compared images of three-dimensional stereotactic surface projections (3D-SSP) of SPECT with MRI images in spinocerebellar degeneration patients (13 olivopontocerebellar atrophy (OPCA) and 7 cortical cerebellar atrophy (CCA)). We analyzed a brain blood flow pattern with an image of statistics by 123 I-IMP SPECT. In OPCA patients, a blood flow reduction was more remarkable in 3D-SSP than a degree of cerebellar atrophy in MRI. In patients with CCA, the cerebellum showed little blood flow reduction in 3D-SSP despite of apparent atrophy in MRI. Simultaneous examination both MRI and 3D-SSP might be useful for differential diagnosis of spinocerebellar degenerations. (author)

Foeniculum vulgare Mill: A Review of Its Botany, Phytochemistry, Pharmacology, Contemporary Application, and Toxicology

Directory of Open Access Journals (Sweden)

Shamkant B. Badgujar

2014-01-01

Full Text Available Foeniculum vulgare Mill commonly called fennel has been used in traditional medicine for a wide range of ailments related to digestive, endocrine, reproductive, and respiratory systems. Additionally, it is also used as a galactagogue agent for lactating mothers. The review aims to gather the fragmented information available in the literature regarding morphology, ethnomedicinal applications, phytochemistry, pharmacology, and toxicology of Foeniculum vulgare. It also compiles available scientific evidence for the ethnobotanical claims and to identify gaps required to be filled by future research. Findings based on their traditional uses and scientific evaluation indicates that Foeniculum vulgare remains to be the most widely used herbal plant. It has been used for more than forty types of disorders. Phytochemical studies have shown the presence of numerous valuable compounds, such as volatile compounds, flavonoids, phenolic compounds, fatty acids, and amino acids. Compiled data indicate their efficacy in several in vitro and in vivo pharmacological properties such as antimicrobial, antiviral, anti-inflammatory, antimutagenic, antinociceptive, antipyretic, antispasmodic, antithrombotic, apoptotic, cardiovascular, chemomodulatory, antitumor, hepatoprotective, hypoglycemic, hypolipidemic, and memory enhancing property. Foeniculum vulgare has emerged as a good source of traditional medicine and it provides a noteworthy basis in pharmaceutical biology for the development/formulation of new drugs and future clinical uses.

Effect of dietary oregano ( Origanum vulgare L.) essential oil on ...

African Journals Online (AJOL)

Effect of dietary oregano ( Origanum vulgare L.) essential oil on growth performance, cecal microflora and serum antioxidant activity of broiler chickens. ... promoting effects and also displayed potent antibacterial effects against cecal E. coli.

Staphylococcus saprophyticus surface-associated protein (Ssp) is associated with lifespan reduction in Caenorhabditis elegans.

Science.gov (United States)

Szabados, Florian; Mohner, Amelie; Kleine, Britta; Gatermann, Sören G

2013-10-01

Staphylococcal lipases have been proposed as pathogenicity factors. In Staphylococcus saprophyticus the surface-associated protein (Ssp) has been previously characterized as a cell wall-associated true lipase. A S. saprophyticus Δssp::ermB mutant has been described as less virulent in an in vivo model of urinary tract infection compared with its wild-type. This is the first report showing that S. saprophyticus induced a lifespan reduction in Caenorhabditis elegans similar to that of S. aureus RN4220. In two S. saprophyticus Δssp::ermB mutants lifespan reduction in C. elegans was partly abolished. In order to attribute virulence to the lipase activity itself and distinguish this phenomenon from the presence of the Ssp-protein, the conserved active site of the lipase was modified by site-directed ligase-independent mutagenesis and lipase activity-deficient mutants were constructed. These results indicate that the Ssp is associated with pathogenicity in C. elegans and one could speculate that the lipase activity itself is responsible for this virulence.

Protective effect of UV-A radiation during acclimation of the photosynthetic apparatus to UV-B treatment

Czech Academy of Sciences Publication Activity Database

Štroch, Michal; Materová, Z.; Vrábl, D.; Karlický, Václav; Šigut, Ladislav; Nezval, J.; Špunda, Vladimír

2015-01-01

Roč. 96, nov (2015), s. 90-96 ISSN 0981-9428 R&D Projects: GA MŠk(CZ) LO1415; GA MŠk(CZ) LM2010007 Grant - others:EHP(CZ) EHP-CZ02-OV-1-014-2014 Program:CZ02 Institutional support: RVO:67179843 Keywords : barley (Hordeum vulgare L.) * chlorophyll fluorescence * photosynthesis * photosynthetic pigments * UV-A radiation * UV-B radiation Subject RIV: BO - Biophysics Impact factor: 2.928, year: 2015

The Effects of Designated Pollutants on Plants

Science.gov (United States)

1978-11-01

Persea americana Mill. Haas and Bacon Barley Hordeum vulgare L. CM 67 Bean Phaseolus vulgaris L. Pinto, U.I. III Briza Briza maxima L. Ornamental...Tagetes patula L. French dwarf double goldie Marigold Tagetes erecta L. American ,Senator Dirksen Petunia Petunia hybrida Vilm. White cascade Radish...Probit analysis of five plant species: citrus seedlings, lemon, orange,, grape, French marigold, American marigold. Probit scale is the probability that a

Variability of barley aleurone layer induced by X-rays

Directory of Open Access Journals (Sweden)

Romuald Kosina

2015-05-01

Full Text Available A series of Hordeum vulgare cultivars was irradiated by X-rays to induce mutations in endosperm. Many structural defects of endosperm were revealed in plants irradiated 8 DAF. Change of a cell cycle was especially frequent and this was visible in the form of clones of small or large cells in the aleurone layer. X-irradiation appeared as a successful tool in the study of development.

Green Fodder Production and Water Use Efficiency of Some Forage Crops under Hydroponic Conditions

OpenAIRE

Ghazi N. Al-Karaki; M. Al-Hashimi

2012-01-01

The objectives of this study were to evaluate five forage crops (alfalfa (Medicago sativa), barley (Hordeum vulgare), cowpea (Vigna unguiculata), sorghum (Sorghum bicolor), and wheat (Triticum aestivum)) for green fodder production and water use efficiency under hydroponic conditions. The experiment has been conducted under temperature-controlled conditions (24 ± 1°C) and natural window illumination at growth room of Soilless Culture Laboratory, Arabian Gulf University, Manama, Bahrain. The r...

Composition and antiproliferative effect of essential oil of Origanum vulgare against tumor cell lines.

Science.gov (United States)

Begnini, Karine Rech; Nedel, Fernanda; Lund, Rafael Guerra; Carvalho, Pedro Henrique de Azambuja; Rodrigues, Maria Regina Alves; Beira, Fátima Tereza Alves; Del-Pino, Francisco Augusto Burkert

2014-10-01

Cancer is a leading cause of death and is responsible for one in eight deaths worldwide. The use of herbs as complementary medicine for cancer, especially advanced cancer, has recently increased. The aim of this study was to evaluate in vitro, the antiproliferative effect of Origanum vulgare against human breast adenocarcinoma (MCF-7), and human colon adenocarcinoma (HT-29). The essential oil (EO) was extracted from a bought amount of O. vulgare dried leaves and analyzed in a gas chromatograph interfaced with a mass selective detector. The cytotoxicity test was performed by sulforhodamine B assay. The results show that the EO is composed mostly of 4-terpineol and induces a high cytotoxicity effect in HT-29. In the MCF-7 cell line the EO was less effective. In conclusion, this study showed that O. vulgare main component is 4-terpineol and was effective in inducing cancer cell growth inhibition.

Streptococcal adhesin SspA/B analogue peptide inhibits adherence and impacts biofilm formation of Streptococcus mutans.

Directory of Open Access Journals (Sweden)

Tatsuro Ito

Full Text Available Streptococcus mutans, the major causative agent of dental caries, adheres to tooth surfaces via the host salivary glycoprotein-340 (gp340. This adherence can be competitively inhibited by peptides derived from the SspA/B adhesins of Streptococcus gordonii, a human commensal microbe that competes for the same binding sites. Ssp(A4K-A11K, a double-lysine substituted SspA/B peptide analogue, has been shown to exhibit superior in vitro binding affinity for a gp340-derived peptide (SRCRP2, suggesting that Ssp(A4K-A11K may be of clinical interest. In the present work, we tested the inhibitory effects of Ssp(A4K-A11K on adherence and biofilm formation of S. mutans by reconstructing an artificial oral environment using saliva-coated polystyrene plates and hydroxyapatite disks. Bacterial adherence (adherence period: 1 h was assessed by an enzyme-linked immunosorbent assay using biotinylated bacterial cells. Biofilm formation (periods: 8, 11, or 14 h was assessed by staining and imaging of the sessile cells, or by recovering biofilm cells and plating for cell counts. The pH values of the culture media were measured as a biofilm acidogenicity indicator. Bactericidality was measured by loss of optical density during culturing in the presence of the peptide. We observed that 650 μM Ssp(A4K-A11K significantly inhibited adherence of S. mutans to saliva-coated polystyrene; a similar effect was seen on bacterial affinity for SRCRP2. Ssp(A4K-A11K had lesser effects on the adherence of commensal streptococci. Pretreatment of polystyrene and hydroxyapatite with 650 μM Ssp(A4K-A11K significantly attenuated biofilm formation, whether tested with glucose- or sucrose-containing media. The SspA/B peptide's activity did not reflect bactericidality. Strikingly, pH in Ssp-treated 8-h (6.8 ± 0.06 and 11-h (5.5 ± 0.06 biofilms showed higher values than the critical pH. Thus, Ssp(A4K-A11K acts by inhibiting bacterial adherence and cariogrnic biofilm formation. We further

Effect of Mo-Doped Mesoporous Al-SSP Catalysts for the Catalytic Dehydration of Ethanol to Ethylene

Directory of Open Access Journals (Sweden)

Titinan Chanchuey

2016-01-01

Full Text Available The catalytic dehydration of ethanol to ethylene over the mesoporous Al-SSP and Mo-doped Al-SSP catalysts was investigated. The Al-SSP catalyst was first synthesized by the modified sol-gel method and then doped with Mo by impregnation to obtain 1% Mo/Al-SSP and 5% Mo/Al-SSP catalysts (1 and 5 wt% of Mo. The final catalysts were characterized using various techniques such as XRD, N2 physisorption, SEM/EDX, TEM, and NH3-TPD. The catalytic activity for all catalysts in gas-phase ethanol dehydration reaction was determined at temperature range of 200°C to 400°C. It was found that the most crucial factor influencing the catalytic activities appears to be the acidity. The acid property of catalysts depended on the amount of Mo loading. Increased Mo loading in Al-SSP resulted in increased weak acid sites, which enhanced the catalytic activity. Besides acidity, the high concentration of Al at surface of catalyst is also essential to obtain high activity. Based on the results, the most suitable catalyst in this study is 1% Mo/Al-SSP catalyst, which can produce ethylene yield of ca. 90% at 300°C with slight amounts of diethyl ether (DEE and acetaldehyde.

Energy consumption in barley and turnip rape cultivation for bioethanol and biodiesel (RME) production

Energy Technology Data Exchange (ETDEWEB)

Mikkola, Hannu; Ahokas, Jukka [University of Helsinki, Faculty of Agriculture and Forestry, Department of Agricultural Sciences, FIN-00014 Helsingin yliopisto (Finland); Pahkala, Katri [MTT, Agrifood Research Finland, Crop Science and Technology, FIN-31600 Jokioinen (Finland)

2011-01-15

The energy consumption for six spring barley (Hordeum vulgare L.) production chains and five spring turnip rape (Brassica rapa ssp. oleifera (DC) Metsg.) production chains were compared with each other and in relation to the energy content of the seed yield. Two cultivation intensities, standard and intensive production, were used for barley. Fertiliser production and grain drying were the most energy consuming phases of the chains. The production of nitrogen fertiliser alone accounted for 1/3-1/2 of the total energy consumption of the production chains. If barley were direct drilled and the yield stored in airtight silos, instead of drying, the energy consumption would decrease by 30-34%. Use of wood-chips instead of oil for grain drying would decrease the use of fossil fuel to the same extent. The input-output ratios for the intensive barley production chains were 0.18-0.25. They were somewhat lower than the ratios for the standard production intensity. The intensive production was more energy efficient despite higher input rates. The input-output ratios for turnip rape production were 0.32-0.34. The energy consumption for manufacturing, repair and maintenance of machines and buildings requires more research because it is a significant factor but the data available are largely old and few studies have been conducted. (author)

Sensitivity of spoiling and pathogen food-related bacteria to Origanum vulgare L. (Lamiaceae) essential oil

OpenAIRE

Souza,Evandro Leite de; Stamford,Tânia Lúcia Montenegro; Lima,Edeltrudes de Oliveira

2006-01-01

Origanum vulgare L. (oregano), Lamiaceae, has been known as plant specie with prominent biological properties for a long time. This study aimed to evaluate the antibacterial activity of Origanum vulgare essential oil on various Gram-positive and Gram-negative spoiling and/or pathogen food-related bacteria, as well as to observe its antimicrobial effectiveness in a food conservation micromodel. The results showed a strong antibacterial activity of the assayed essential oil noted by large growt...

108-110 Registration of Guta Barley (Hordeium vulgare L.)

African Journals Online (AJOL)

adoption potential by the local farmers. Keywords: Guta; Barley (Hordeium vulgare L); Yield ... evaluated along with Aruso and Shage as the local and standard variety, respectively at altitudinal range of 2400- ... 6. Farmers Evaluation of the Variety. To evaluate the perception and preferences of the local farmers, farmers' ...

Identification of functional candidates amongst hypothetical proteins of Treponema pallidum ssp. pallidum.

Science.gov (United States)

Naqvi, Ahmad Abu Turab; Shahbaaz, Mohd; Ahmad, Faizan; Hassan, Md Imtaiyaz

2015-01-01

Syphilis is a globally occurring venereal disease, and its infection is propagated through sexual contact. The causative agent of syphilis, Treponema pallidum ssp. pallidum, a Gram-negative sphirochaete, is an obligate human parasite. Genome of T. pallidum ssp. pallidum SS14 strain (RefSeq NC_010741.1) encodes 1,027 proteins, of which 444 proteins are known as hypothetical proteins (HPs), i.e., proteins of unknown functions. Here, we performed functional annotation of HPs of T. pallidum ssp. pallidum using various database, domain architecture predictors, protein function annotators and clustering tools. We have analyzed the sequences of 444 HPs of T. pallidum ssp. pallidum and subsequently predicted the function of 207 HPs with a high level of confidence. However, functions of 237 HPs are predicted with less accuracy. We found various enzymes, transporters, binding proteins in the annotated group of HPs that may be possible molecular targets, facilitating for the survival of pathogen. Our comprehensive analysis helps to understand the mechanism of pathogenesis to provide many novel potential therapeutic interventions.

Genetic diversity in barley landraces (Hordeum vulgare L. subsp ...

Indian Academy of Sciences (India)

SDS-PAGE was performed to separate the extracted pro- teins by using 12% separating and 5% stacking gels with a. Mini Protean System from Bio-Rad according to Laemmli modified method (Laemmli 1970). In this study, we adopted constant current electrophoresis instead of constant voltage. The loading of sample was ...

Genetic Variability in Barley (Hordeum vulgare l.) Landraces from ...

African Journals Online (AJOL)

segregating progenies with maximum genetic variability for selection. .... cultivar Clipper applied in slots of the first two, the tenth, and the last ... solution (50 ml glacial acetic acid, 200 ml methanol and 250 ml distilled water) ...... Adelaide, South.

Radiosensitivities of cultured barley of different type (Hordeum vulgare)

International Nuclear Information System (INIS)

Wang Cailian; Shen Mei; Xu Gang; Zhao Kongnan

1990-01-01

The dormant seeds (with 13% moisture) of 47 barley varieties were irradiated with various doses (0-40 krad) of 137 Cs γ-rays. The radiosensitivities of naked barley was significantly higher than that of hulled barley. The sensitive coefficients of seedling height were 0.04945 and 0.03667 for naked barley and hulled barley, respectively. The radiosensitivity of four-row naked barley was significantly higher than that of two-row hulled barley and six-row hulled barley. 47 varieties studied could be divided into five types with different radiosensitivities, i.e. extreme resistant, resistant, intermediate, sensitive and extreme sensitive. It was also found that the dose-effect curves of cell nucleus volume had a peal at 30 krad

Lysine-Rich Proteins in High-Lysine Hordeum Vulgare Grain

DEFF Research Database (Denmark)

Ingversen, J.; Køie, B.

1973-01-01

The salt-soluble proteins in barley grain selected for high-lysine content (Hiproly, CI 7115 and the mutants 29 and 86) and of a control (Carlsberg II) with normal lysine content, contain identical major proteins as determined by MW and electrophoretic mobility. The concentration of a protein gro...

Genetic diversity in barley landraces (Hordeum vulgare L. subsp ...

Indian Academy of Sciences (India)

its nutritional value and low glycemic index (Ullrich 2011). Lebanon belongs to the ... Rim Mzid and Farhat Chibani contributed equally to this work. biochemical accomplished ..... environment interaction of hordein content. J. Cereal Sci. 34,.

Latent manganese deficiency increases transpiration in barley (Hordeum vulgare).

Science.gov (United States)

Hebbern, Christopher A; Laursen, Kristian Holst; Ladegaard, Anne H; Schmidt, Sidsel B; Pedas, Pai; Bruhn, Dan; Schjoerring, Jan K; Wulfsohn, Dvoralai; Husted, Søren

2009-03-01

To investigate if latent manganese (Mn) deficiency leads to increased transpiration, barley plants were grown for 10 weeks in hydroponics with daily additions of Mn in the low nM range. The Mn-starved plants did not exhibit visual leaf symptoms of Mn deficiency, but Chl a fluorescence measurements revealed that the quantum yield efficiency of PSII (F(v)/F(m)) was reduced from 0.83 in Mn-sufficient control plants to below 0.5 in Mn-starved plants. Leaf Mn concentrations declined from 30 to 7 microg Mn g(-1) dry weight in control and Mn-starved plants, respectively. Mn-starved plants had up to four-fold higher transpiration than control plants. Stomatal closure and opening upon light/dark transitions took place at the same rate in both Mn treatments, but the nocturnal leaf conductance for water vapour was still twice as high in Mn-starved plants compared with the control. The observed increase in transpiration was substantiated by (13)C-isotope discrimination analysis and gravimetric measurement of the water consumption, showing significantly lower water use efficiency in Mn-starved plants. The extractable wax content of leaves of Mn-starved plants was approximately 40% lower than that in control plants, and it is concluded that the increased leaf conductance and higher transpirational water loss are correlated with a reduction in the epicuticular wax layer under Mn deficiency.

Incorporation of tritiated thymidine and uridine in normal and endopolyploid nuclei of differentiated tissue

International Nuclear Information System (INIS)

Bansal, Y.K.; Sen, Sumitra

1987-01-01

Rate of replication and transcription between normal and giant endopolyploid nuclei of differentiated tissue of Hordeum vulgare L. (2n=14) roots and Phlox drummondii Hook. (2n=14) and Zea mays L. (2n=20) endosperms were studied by labelling experiments with tritiated thymidine and uridine. The incorporation of thymidine and uridine was identical in both diploid and giant endopolyploid nuclei of the roots of H. vulgare. The endosperm cells of P. drummondii and Z. mays, however, exhibit markedly different labelling pattern in normal (i.e. triploid) and endopolyploid nuclei where both replication and transcription were rather high. The nutritive function of the endosperm is probably responsible for this high degree of activity. (author). 14 refs., 10 figs., 3 tables

Scirpus lacustrus L. ssp. flevensis Bakker

NARCIS (Netherlands)

Bakker, D.

1957-01-01

De ssp. flavensis was tot voor kort alleen bekend van de IJselmeerkust ter hoogte van het Kampereiland en van Schokkerhaven in de Noordoostpolder. In de zomer van 1956 ontdekte ik de plant tevens op een eilandje in het Kadoelermeer hij Vollenhove en aan de rand van een matig voedselrijk veen tussen

Multiple plasmid-borne virulence genes of Clavibacter michiganensis ssp. capsici critical for disease development in pepper.

Science.gov (United States)

Hwang, In Sun; Oh, Eom-Ji; Kim, Donghyuk; Oh, Chang-Sik

2018-02-01

Clavibacter michiganensis ssp. capsici is a Gram-positive plant-pathogenic bacterium causing bacterial canker disease in pepper. Virulence genes and mechanisms of C. michiganensis ssp. capsici in pepper have not yet been studied. To identify virulence genes of C. michiganensis ssp. capsici, comparative genome analyses with C. michiganensis ssp. capsici and its related C. michiganensis subspecies, and functional analysis of its putative virulence genes during infection were performed. The C. michiganensis ssp. capsici type strain PF008 carries one chromosome (3.056 Mb) and two plasmids (39 kb pCM1 Cmc and 145 kb pCM2 Cmc ). The genome analyses showed that this bacterium lacks a chromosomal pathogenicity island and celA gene that are important for disease development by C. michiganensis ssp. michiganensis in tomato, but carries most putative virulence genes in both plasmids. Virulence of pCM1 Cmc -cured C. michiganensis ssp. capsici was greatly reduced compared with the wild-type strain in pepper. The complementation analysis with pCM1 Cmc -located putative virulence genes showed that at least five genes, chpE, chpG, ppaA1, ppaB1 and pelA1, encoding serine proteases or pectate lyase contribute to disease development in pepper. In conclusion, C. michiganensis ssp. capsici has a unique genome structure, and its multiple plasmid-borne genes play critical roles in virulence in pepper, either separately or together. © 2017 The Authors. New Phytologist © 2017 New Phytologist Trust.

Spasmogenic and spasmolytic activities of Agastache mexicana ssp. mexicana and A. mexicana ssp. xolocotziana methanolic extracts on the guinea pig ileum.

Science.gov (United States)

Ventura-Martínez, Rosa; Rodríguez, Rodolfo; González-Trujano, María Eva; Ángeles-López, Guadalupe E; Déciga-Campos, Myrna; Gómez, Claudia

2017-01-20

Agastache mexicana has been used in traditional medicine for relief of abdominal pain and treatment of other diseases. Two subspecies have been identified: A. mexicana ssp. mexicana (AMM) and A. mexicana ssp. xolocotziana (AMX) and both are used traditionally without distinction or in combination. To determine the effect of methanol extracts of A. mexicana ssp. mexicana and A. mexicana ssp. xolocotziana on gut motility and their possible mechanism of action. The effect of AMM and AMX methanol extracts were tested on the spontaneous activity in the isolated guinea pig ileum and on tissues pre-contracted with KCl, electrical field stimulation (EFS) or ACh. In addition, the possible mechanism of action of each subspecies on gut motility was analyzed in the presence of hexametonium, indomethacin, L-NAME, verapamil, atropine or pyrylamine. A comparative chromatographic profile of these extracts was also done to indicate the most abundant flavonoids presents in methanol extracts of both subspecies. AMM, but not AMX, induced a contractile effect in the guinea pig ileum. This spasmogenic effect was partially inhibited by atropine, antagonist of muscarinic receptors; and pyrilamine, antagonist of H 1 receptors. In contrast, AMX, but not AMM, diminished the contractions induced by KCl, EFS or ACh. The spasmolytic activity of AMX was partially inhibited by hexamethonium, ganglionic blocker; and indomethacin, inhibitor of the synthesis of prostaglandins; but not by L-NAME, inhibitor of nitric oxide synthase. In addition, AMX diminished the maximal contraction induced by CaCl 2 in a calcium-free medium. Chromatographic analyses of these methanol extracts showed the presence of acacetin and tilanin in both. These results suggest that in folk medicine only AMX should be used as spasmolytic, and not in combination with AMM as traditionally occurs, due to the spasmogenic effects of the latter. In addition, activation of nicotinic receptors, prostaglandins and calcium channels, but

Synthesis of Salt Soluble Proteins in Barley. Pulse-Labeling Study of Grain Filling in Liquid-Cultured Detached Spikes

DEFF Research Database (Denmark)

Giese, Nanna Henriette; Hejgaard, Jørn

1984-01-01

The accumulation of salt-soluble proteins in the endosperm of developing barley (Hordeum vulgare L.) grains was examined. Detached spikes of barley were cultured at different levels of nitrogen nutrition and pulse-labeled with [14C] sucrose at specific times after anthesis. Proteins were extracted...... to increased nitrogen nutrition. Two major components, β-amylase and protein Z in particular, had a synthesis profile almost identical to that of the endosperm storage protein, hordein....

Vulgarization of popular music tradition in Serbia

OpenAIRE

Božilović, Nikola

2011-01-01

The vulgarization of tradition in this paper implies the alteration, false representation, and adaptation of tradition in line with the interests of certain individuals or groups in power. The author observes popular music in Serbia (jazz, pop, rock) under a sociological magnifying glass, attempting to explain and motivate the thesis which proposes a valid historical foundation of popular culture and music in the social life of Serbia. In his opinion, this kind of tradition is being 'swept un...

Cytogenetic Diversity of Simple Sequences Repeats in Morphotypes of Brassica rapa ssp. chinensis.

Science.gov (United States)

Zheng, Jin-Shuang; Sun, Cheng-Zhen; Zhang, Shu-Ning; Hou, Xi-Lin; Bonnema, Guusje

2016-01-01

A significant fraction of the nuclear DNA of all eukaryotes is comprised of simple sequence repeats (SSRs). Although these sequences are widely used for studying genetic variation, linkage mapping and evolution, little attention had been paid to the chromosomal distribution and cytogenetic diversity of these sequences. In this paper, we report the distribution characterization of mono-, di-, and tri-nucleotide SSRs in Brassica rapa ssp. chinensis. Fluorescence in situ hybridization was used to characterize the cytogenetic diversity of SSRs among morphotypes of B. rapa ssp. chinensis. The proportion of different SSR motifs varied among morphotypes of B. rapa ssp. chinensis, with tri-nucleotide SSRs being more prevalent in the genome of B. rapa ssp. chinensis. We determined the chromosomal locations of mono-, di-, and tri-nucleotide repeat loci. The results showed that the chromosomal distribution of SSRs in the different morphotypes is non-random and motif-dependent, and allowed us to characterize the relative variability in terms of SSR numbers and similar chromosomal distributions in centromeric/peri-centromeric heterochromatin. The differences between SSR repeats with respect to abundance and distribution indicate that SSRs are a driving force in the genomic evolution of B. rapa species. Our results provide a comprehensive view of the SSR sequence distribution and evolution for comparison among morphotypes B. rapa ssp. chinensis.

Micropropagation of Origanum sipyleum L., an endemic medicinal ...

African Journals Online (AJOL)

PRECIOUS

2009-11-02

Nov 2, 2009 ... the shoots rooted in a culture medium with 0.5 mg/L indolebutyric acid (IBA) after 3 weeks. The plantlets were acclimatized into ... of tissue cultures for propagation and multiplication of. Origanum sipyleum. There are reports on .... Geographic variation of Greek oregano (Origanum vulgare ssp. hirtum) ...

Space Shuttle Program (SSP) Dual Docked Operations (DDO)

Science.gov (United States)

Sills, Joel W., Jr.; Bruno, Erica E.

2016-01-01

This document describes the concept definition, studies, and analysis results generated by the Space Shuttle Program (SSP), International Space Station (ISS) Program (ISSP), and Mission Operations Directorate for implementing Dual Docked Operations (DDO) during mated Orbiter/ISS missions. This work was performed over a number of years. Due to the ever increasing visiting vehicle traffic to and from the ISS, it became apparent to both the ISSP and the SSP that there would arise occasions where conflicts between a visiting vehicle docking and/or undocking could overlap with a planned Space Shuttle launch and/or during docked operations. This potential conflict provided the genesis for evaluating risk mitigations to gain maximum flexibility for managing potential visiting vehicle traffic to and from the ISS and to maximize launch and landing opportunities for all visiting vehicles.

The effect of abandoned mining ponds on trace elements dynamics in the soil-plant system

Science.gov (United States)

Gabarrón, María; Faz, Ángel; Zornoza, Raúl; Acosta, Jose A.

2017-04-01

In semiarid climate regions lack of vegetation and dryer climate contribute to erosion of abandoned mining surface areas making them up important potential sources of metal pollution into the environment. The objectives of this study were to determine the influence of mine ponds in agriculture and forest soils, and identify the dynamic of metals in the soil-plant system for native plant species (Ballota hirsuta) and crop species (Hordeum vulgare) in two ancient mining districts: La Unión and Mazarrón. To achieve these objectives, wastes samples from mine ponds and soil samples (rhizosphere and non-rhizosphere soils) from natural and agricultural lands were collected. In addition, six plants (Ballota hirsuta) from natural area and 3 plants (Hordeum vulgare) from crops were collected. Physicochemical properties and total, water soluble and bioavailable metals (Cd, Co, Cr, Cu, Fe, Mn, Ni, Pb, and Zn) and arsenic were measured in waste/soil samples. The chemical speciation of metals in soil was estimated by a sequential extraction procedure. For plants analyses, each plant were divided in roots, stem and leaves and metal content measured by ICP-MS. Results indicated that mine, natural and agricultural soils were contaminated by As, Cd, Cu, Pb, and Zn. Chemical partitioning revealed higher mobility of metals in mine ponds than natural and agriculture soils while only Fe and As are completely bound to the soil matrix due to the mineralogical compositions of soils. The accumulation of metals in Ballota hirsuta in La Union decrease as Fe>As>Cr>Ni>Cu>Zn>Cd>Mn>Co>Pb while in Mazarrón did as As>Fe>Cr>Pb>Cu>Ni>Co>Mn>Zn>Cd. Ballota hirsuta showed high ability to bio-accumulate Cu, Cr, Fe, Ni, and As, transferring a large amount to edible parts without exceeding the toxicity limits for animals. Results for barley plants (Hordeum vulgare) showed the ability to absorb and accumulate As, Fe, Mn, Pb and Zn, although the transfer ability of As, Cd and Pb was lower. Although the

Importance of diet in the growth, survivorship and reproduction of the no-tillage pest Armadillidium vulgare (Crustacea: Isopoda Importancia de la dieta en el crecimiento, la supervivencia y la reproducción de Armadillidium vulgare (Crustacea: Isopoda plaga en siembra directa

Directory of Open Access Journals (Sweden)

ARIEL J FABERI

2011-09-01

Full Text Available The studies of Armadillidium vulgare as pest are virtually null worldwide. However under no-tillage systems this species has found an adequate environment for its development and it has become an important pest in some crops in Argentina. It has been shown that the composition of vegetables affects the isopods biology. Our hypothesis was that soybean leaf litter has high nutritive value which allows A. vulgare to grow faster, survive longer, and have higher fecundity favoring the population increase and turning it into a crop pest. Growth and survivorship of juveniles and adults, egg incubation period, offspring number per female and offspring mean body weight were determined in individuals fed with leaf litter of soybean, sunflower, wheat and pasture. The growth rate coefficient, k, in juveniles was higher for soybean, intermediate for pasture and lower for sunflower. Adult growth was faster under the soybean diet. Survivorship under soybean and pasture was longer than under sunflower and wheat in both juveniles and adults. The reproductive parameters were similar in all diets, food did not generate any change in the reproductive aspects of A. vulgare. Results of the present study represent a source of information about the A. vulgare biology under different diets of agricultural origin to establish the basis for Integrated Management of this species as pest. Under soybean litter provision A. vulgare found the best conditions for faster growth, longer survival and relatively higher fecundity. In fields with soybean as preceding crop or in systems with high frequency of soybean in the crop rotation a more abundant population of A. vulgare would be found as well as with larger individuals which could cause more damage to the following crop in the rotation.Los estudios sobre Armadillidium vulgare como plaga son virtualmente nulos a nivel mundial. Sin embargo, en los sistemas bajo siembra directa esta especie ha encontrado un ambiente adecuado para

Strip Tillage and Early-Season Broadleaf Weed Control in Seeded Onion (Allium cepa)

OpenAIRE

Sarah Gegner-Kazmierczak; Harlene Hatterman-Valenti

2016-01-01

Field experiments were conducted in 2007 and 2008 near Oakes, North Dakota (ND), USA, to evaluate if strip tillage could be incorporated into a production system of seeded onion (Allium cepa) to eliminate the standard use of a barley (Hordeum vulgare) companion crop with conventional, full width tillage, yet support common early-season weed control programs. A split-factor design was used with tillage (conventional and strip tillage) as the main plot and herbicide treatments (bromoxynil, DCPA...

Comparing the performance of 11 crop simulation models in predicting yield response to nitrogen fertilization

OpenAIRE

Salo , Tapio J.; Palosuo , Taru; Kersebaum , Kurt Christian; Nendel , Claas; Angulo , Carlos; Ewert , Frank; Bindi , Marco; Calanca , Pierluigi; Klein , Tommy; Moriondo , Marco; Ferrise , Roberto; Olesen , Jørgen Eivind; Patil , Rasmi H.; Ruget , Francoise; Takac , Jozef

2016-01-01

Eleven widely used crop simulation models (APSIM, CERES, CROPSYST, COUP, DAISY, EPIC, FASSET, HERMES, MONICA, STICS and WOFOST) were tested using spring barley (Hordeum vulgare L.) data set under varying nitrogen (N) fertilizer rates from three experimental years in the boreal climate of Jokioinen, Finland. This is the largest standardized crop model inter-comparison under different levels of N supply to date. The models were calibrated using data from 2002 and 2008, of which 2008 included si...

Isozyme differences in barley mutants

International Nuclear Information System (INIS)

AI-Jibouri, A.A.M.; Dham, K.M.

1990-01-01

Full text: Thirty mutants (M 11 ) of barley (Hordeum vulgare L.) induced by physical and chemical mutagens were analysed for isozyme composition using polyacrylamide gel electrophoresis. Results show that these mutants were different in the isozymes leucine aminopeptidase, esterase and peroxidase. The differences included the number of forms of each enzyme, relative mobility value and their intensity on the gel. Glutamate oxaloacetate transaminase isozyme was found in six molecular forms and these forms were similar in all mutants. (author)

Interspecific competition changes photosynthetic and oxidative stress response of barley and barnyard grass to elevated CO2 and temperature

OpenAIRE

Irena Januskaitiene; Jūratė Žaltauskaitė; Austra Dikšaitytė; Gintarė Sujetovienė; Diana Miškelytė; Giedrė Kacienė; Sandra Sakalauskienė; Jurga Miliauskienė; Romualdas Juknys

2018-01-01

This work focuses on the investigation of competition interaction between C3 crop barley (Hordeum vulgare L.) and C4 weed barnyard grass (Echinochloa crus-galli L.) at 2 times higher than ambient [CO2] and +4 0C higher ambient temperature climate conditions. It was hypothesized that interspecific competition will change the response of the investigated plants to increased [CO2] and temperature. The obtained results showed that in the current climate conditions, a higher biomass and photosynth...

Comparison of the results of climate change impact assessment between RCP8.5 and SSP2 scenarios

Science.gov (United States)

Lee, D. K.; Park, J. H.; Park, C.; Kim, S.

2017-12-01

Climate change scenarios are mainly published by the Intergovernmental Panel on Climate Change (IPCC), and include SRES (Special Report on Emission Scenario) scenarios (IPCC Third Report), RCP (Representative Concentration Pathways) scenarios (IPCC 5th Report), and SSP (Shared Socioeconomic Pathways) scenarios. Currently widely used RCP scenarios are based on how future greenhouse gas concentrations will change. In contrast, SSP scenarios are that predict how climate change will change in response to socio-economic indicators such as population, economy, land use, and energy change. In this study, based on RCP 8.5 climate data, we developed a new Korean scenario using the future social and economic scenarios of SSP2. In the development of the scenario, not only Korea's emissions but also China and Japan's emissions were considered in terms of space. In addition, GHG emissions and air pollutant emissions were taken into consideration. Using the newly developed scenarios, the impacts assessments of the forest were evaluated and the impacts were evaluated using the RCP scenarios. The average precipitation is similar to the SSP2 scenario and the RCP8.5 scenario, but the SSP2 scenario shows the maximum value is lower than RCP8.5 scenario. This is because the SSP2 scenario simulates the summer precipitation weakly. The temperature distribution is similar for both scenarios, and it can be seen that the average temperature in the 2090s is higher than that in the 2050s. At present, forest net primary productivity of Korea is 693 tC/km2, and it is 679 tC/km2 when SSP2 scenario is applied. Also, the damage of forest by ozone is about 4.1-5.1%. On the other hand, when SSP2 scenario is applied, the forest net primary productivity of Korea is 607 tC/km2 and the forest net primary productivity of RCP8.5 scenario is 657 tC/km2. The analysis shows that the damage caused by climate change is reduced by 14.2% for the SSP2 scenario and 6.9% for the RCP8.5 scenario. The damage caused

Lactobacillus delbrueckii ssp. bulgaricus thermotolerance

OpenAIRE

Gouesbet , Gwenola; Jan , Gwenaël; Boyaval , Patrick

2001-01-01

International audience; Lactobacillus delbrueckii ssp. bulgaricus is a lactic acid bacterium widely used in the dairy food industry. Since the industrial processes are a succession of constraints, it is essential to understand the behaviour of L. bulgaricus when facing usual stresses. The influence of heat stress was investigated on the viability of L. bulgaricus cells grown in a chemically defined medium. The susceptibility of cells to heat-shock was obvious only above 55 $^{\\circ}$C. We inv...

Effect of the aqueous extract of Foeniculum vulgare (fennel on the kidney in experimental PCOS female rats

Directory of Open Access Journals (Sweden)

Somayyeh Sadrefozalayi

2014-02-01

Full Text Available Objective: Foeniculum vulgare seed (F. vulgare is a herbal plant which is used with phytoestrogene compounds for polycystic ovary syndrome (PCOS treatment. In this research, renoprotective effect of the aqueous extract of Foeniculum vulgare (AEF in experimental PCOS female rats is studied. Materials and Methods: Forty female rats were randomly divided into five groups. The first group served as control,was injected with an equivalent volume (0.2 ml of normal saline, and received normal diet. Animals in the second group were non poly cystic ovary syndrome (PCOS rats which were treated with intragastric administration of aqueous extract of F. vulgare (150 mg/kg b.w.. In the third group, the rats were treated with intraperitoneal injection of estradiolvalerate (EV (4 mg in 0.2 ml of sesame oil. The fourth groups were treated with EV and AEF (150mg/kg bw with the same route.  The fifth groups were treated with EV and AEF (100mg/kg bw. After 4 weeks of study, all of the rats were sacrificed, their kidneys tissues were processed for light microscopy, and some biochemical parameters of serum were measured. Results: The mean values of blood urea nitrogen in PCOS rats treated with low dose of AEF and EV and non-treated, was significantly (p

Oreganum vulgare Linn. leaf: An Extensive Pharmacognostical and Phytochemical Quality Assessment

Directory of Open Access Journals (Sweden)

Veni Bharti

2013-08-01

Full Text Available Purpose: Standardization and detailed pharmacognostical studies of Oreganum vulgare Linn. leaf for authentication and commercial utilization. Methods: Oreganum vulgare Linn. leaf was with standardization according to standard procedures described in WHO, 2011 and I.P. 1996. Results: The physicochemical parameters total ash, acid insoluble ash, water soluble ash and sulphated ash were found to be 11.5%, 11%, 5, 10.5% w/w respectively. Foaming index was found be <100. The trace elements were found to be copper, lead, cadmium, zinc, cobalt, manganese, nickel and copper in ethanol extract and phytochemical screening of aqueous and ethanol extract showed the presence of carbohydrates, flavonoids, anthocyanins, phenolic compounds etc. Conclusion: The standardization parameters viz. physico-chemical parameters, macroscopy, microscopy, taxonomy, anatomy and preliminary phytochemical screening, microbial and aflatoxin count, HPTLC profile is being reported to help in authentication and development of monograph of this plant.

VizieR Online Data Catalog: SSP in NIR. II. Synthesis models (Meneses-Goytia+, 2015)

NARCIS (Netherlands)

Meneses-Goytia, S.; Peletier, R. F.; Trager, S. C.; Vazdekis, A.

2015-01-01

The present Single Stellar Populations (SSP) models are derived from my Ph.D.'s thesis and this paper. The following nomenclature is used throughout the paper and the website (http://smg.astro-research.net/ssp-models/the-models/) to describe the models, e.g. MarS models use the M08 isochrones (Mar)

Lactococcus lactis ssp. lactis as Potential Functional Starter Culture

Directory of Open Access Journals (Sweden)

Jelena Cvrtila

2014-01-01

Full Text Available The aim of this study is to identify and characterise potential autochthonous functional starter cultures in homemade horsemeat sausage. The dominant microflora in the samples of horsemeat sausage were lactic acid bacteria (LAB, followed by micrococci. Among the LAB, Lactococcus lactis ssp. lactis and Lactobacillus plantarum were the dominant species, and since the first is not common in fermented sausages, we characterised it as a potential functional starter culture. Lactococcus lactis ssp. lactis produced a significant amount of lactic acid, displayed good growth capability at 12, 18 and 22 °C, growth in the presence of 5 % NaCl, good viability after lyophilisation and in simulated gastric and small intestinal juice, antimicrobial activity against test pathogens, and good adhesive properties in vitro.

Atividade in vitro do óleo essencial de Origanum vulgare frente à Sporothrix Schenckii In vitro activity of the essential oil of Origanum vulgare against Sporothrix schenckii

Directory of Open Access Journals (Sweden)

M.B. Cleff

2008-04-01

Full Text Available In vitro activity of the essential oil Origanum vulgare against Sporothrix schenckii was determined by the MIC (Minimum Inhibitory Concentration. For this, seven samples of S. schenckii were studied, two isolated from two cases of human sporotrichosis and five isolated from cats. Analysis of the essential oil was carried out in a gas chromatograph (GC/FID for the identification and quantification of thymol and carvacrol (antifungal agents. MIC was obtained based on the microdilution method according to the adapted document NCCLS-M 27A2 for fitopharmacy. All the isolates presented sensibility to the essential oil. S. schenckii was inhibited in a concentration of 0.25% (250m l/ml. Chromatographic analysis showed that thymol concentration was bigger than carvacrol. The antifungal activity demonstrated by the essential oil of O. vulgare against S. Schenckii stimulates the accomplishment of more studies, including in vivo studies.

Submergence tolerance in Hordeum marinum

DEFF Research Database (Denmark)

Pedersen, Ole; Malik, Al I.; Colmer, Timothy D.

2010-01-01

Floodwaters differ markedly in dissolved CO(2), yet the effects of CO(2) on submergence responses of terrestrial plants have rarely been examined. The influence of dissolved CO(2) on underwater photosynthesis and growth was evaluated for three accessions of the wetland plant Hordeum marinum Huds....... All three accessions tolerated complete submergence, but only when in CO(2) enriched floodwater. Plants submerged for 7 days in water at air equilibrium (18 mM CO(2)) suffered loss of biomass, whereas those with 200 mM CO(2) continued to grow. Higher underwater net photosynthesis at 200 mM CO(2......) increased by 2.7- to 3.2-fold sugar concentrations in roots of submerged plants, compared with at air equilibrium CO(2). Leaf gas films enhancing gas exchange with floodwater, lack of a shoot elongation response conserving tissue sugars and high tissue porosity (24-31% in roots) facilitating internal O(2...

Some aspects of cultivation and utilization of waxy maize (Zea mays L. ssp. ceratina

Directory of Open Access Journals (Sweden)

Agnieszka Klimek-Kopyra

2012-10-01

Full Text Available This paper is a review of available literature on Zea mays L.ssp.ceratina. It contains information on the origin, cul- tivation and utilization of waxy maize in the world and can be a contribution to the development of new research on maize cultivation and starch processing technology. Maize, as an old and economically important cereal, played an enormous role in the ancient civilisations of the New World. Among the maize subspecies compared, Z. mays ssp. indurata and Z. mays ssp. indentata are now the most important in Poland. The subspecies Z. mays ssp. saccharata has a marginal role, while Z. mays ssp. ceratina has not been hitherto cultivated. Decisions to introduce the subspecies Z. mays ssp. ceratina into cultivation are based on different grounds, taking into account both agro-climatic conditions and industrial uses of grain processing products. The growing demand for maize grain, stimulated by the increased demand for maize starch and oil in the global market as raw materials that are important in food production, is an impulse for the development of agrobiological research. The development of the starch industry, associated with the demand for industrial starch, will probably contribute to increased interest in this subspecies in Central Europe, also including Poland. Waxy maize grain can be a major ingredient of high-energy feeds for livestock, replacing in this role the type of maize that has been grown for this purpose until now. A great advantage of waxy maize is its specific structure of starch, due to its unique and high amylopectin content (95-98%, which creates unlimited possibilities of industrial use. Currently, waxy maize acreage in Europe does not exceed 2% of the maize crop area in this continent.

Determination of chromosomal ploidy in Agave ssp. | Lingling ...

African Journals Online (AJOL)

Chromosome observation is necessary to elucidate the structure, function and organization of Agave plants' genes and genomes. However, few researches about chromosome observation of Agave ssp. were done, not only because their chromosome numbers are large, but also because their ploidies are complicated.

Morphology and AFLP markers suggest three Hordeum chilense ecotypes that differ in avoidance to rust fungi

NARCIS (Netherlands)

Vaz Patto, M.C.; Aardse, A.; Buntjer, J.; Rubiales, D.; Martin, A.; Niks, R.E.

2001-01-01

In Hordeum chilense Roem. & Schult., a high variation in the level of avoidance to infection of barley leaf rust (Puccinia hordei Otth) occurs. Probably resulting from the properties of the stomata, the rust germ tube overgrows stomata, and the infection process fails in an early stage. In the

Choleretic activity of Gentiana lutea ssp. symphyandra in rats.

Science.gov (United States)

Oztürk, N; Herekman-Demir, T; Oztürk, Y; Bozan, B; Başer, K H

1998-08-01

Effects of an ethanolic extract prepared from G. lutea ssp. symphyandra roots on the bile production and liver in rats were investigated. Bile flows of rats which were treated by a single i.p. dose of CCl(4) 24 h prior to experiments were measured after the cannulation of bile duct under urethane anaesthesia. After an equilibration period of 1 h, the lyophilized extract were administered intraduodenally (500 mg/kg i.p.), while control animals received physiological saline only. To monitor the effect of multiple dose therapy, rats received the same dose of G. lutea ssp. symphyandra extract for 3 days (2 days prior to CCl(4) administration) and their bile flows were measured after the cannulation. In all groups, bile samples were collected for 3 h with 15 min intervals. After the completion of bile flow experiment, rat livers were removed and put in neutral formaldehyde solution (10%) for the histological examination. According to results obtained, multiple dose treatment of rats with the plant extract normalized the decreased bile flow due CCl(4), whereas single dose therapy was ineffective on the impaired bile flow. These data indicate that the extract prepared from Gentiana lutea ssp. symphyandra roots has a hepatoprotective activity. Copyright © 1998 Gustav Fischer Verlag. Published by Elsevier GmbH.. All rights reserved.

PENGEMBANGAN SSP TEMATIK-INTEGRATIF UNTUK MEMBANGUN KARAKTER DISIPLIN DAN KREATIF SISWA KELAS I SD

Directory of Open Access Journals (Sweden)

Wawan Wahyu Setyawan

2015-01-01

DEVELOPING THEMATIC-INTEGRATED SSP FOR BUILDING THE CHARACTERS OF DISCIPLINE AND CREATIVE OF GRADE I STUDENT ELEMENTARY SCHOOL ABSTRACT This study aims to produce integrated learning sets in the form of thematic SSP that can develop the characters of discipline and creative of grade I students of elementary school.This was a research and development study consisting of seven steps, namely: preliminary study and data collection, planning, product draft development, preliminary field tryout, revision of the tryout result, field tryout, product finalization based the field tryout result, field implementation testing, final product finalization, and dissemination. The developed SSP was evaluated by a science subject expert to assess the validity. The tryout subjects comprised 82 students consisting of 26 students of SD Baran, Pundong, Bantul, DIY in the small-scale tryout, 25 students in the control class of SD Manding Tengah, Bantul, DIY and 31 students in the experimental class of SD 1 Tulung, Bantul, DIY. The results of this study are in the form of SSP consisting of: a syllabus, lesson plans, course sheets, student worksheets, and evaluation sheets. The results of the evaluation show that the developed syllabus is good score of 47. The developed lesson plans score of 67, student course sheets score of 65, student worksheets score of 47, and assessment instruments, are very good , while the developed learning media are good score of 66. The results of the tryout show that the developed SSP otherwise meet the criteria for the practical views of teacher assessment score of 281 and a score of 730 student responses. In field trials the results obtained for the control class average pretest score of 70.8 and an average posttest score of 80.8. While the experimental class scored an average of 74.1 pretest and posttest score of 90.9. Improved control class scores of 10 and an increase of 16.8 experimental class. Teaching using developed SSP is capable of developing

Comparative study of anatomical normalization errors in SPM and 3D-SSP using digital brain phantom.

Science.gov (United States)

Onishi, Hideo; Matsutake, Yuki; Kawashima, Hiroki; Matsutomo, Norikazu; Amijima, Hizuru

2011-01-01

In single photon emission computed tomography (SPECT) cerebral blood flow studies, two major algorithms are widely used statistical parametric mapping (SPM) and three-dimensional stereotactic surface projections (3D-SSP). The aim of this study is to compare an SPM algorithm-based easy Z score imaging system (eZIS) and a 3D-SSP system in the errors of anatomical standardization using 3D-digital brain phantom images. We developed a 3D-brain digital phantom based on MR images to simulate the effects of head tilt, perfusion defective region size, and count value reduction rate on the SPECT images. This digital phantom was used to compare the errors of anatomical standardization by the eZIS and the 3D-SSP algorithms. While the eZIS allowed accurate standardization of the images of the phantom simulating a head in rotation, lateroflexion, anteflexion, or retroflexion without angle dependency, the standardization by 3D-SSP was not accurate enough at approximately 25° or more head tilt. When the simulated head contained perfusion defective regions, one of the 3D-SSP images showed an error of 6.9% from the true value. Meanwhile, one of the eZIS images showed an error as large as 63.4%, revealing a significant underestimation. When required to evaluate regions with decreased perfusion due to such causes as hemodynamic cerebral ischemia, the 3D-SSP is desirable. In a statistical image analysis, we must reconfirm the image after anatomical standardization by all means.

SSP: an interval integer linear programming for de novo transcriptome assembly and isoform discovery of RNA-seq reads.

Science.gov (United States)

Safikhani, Zhaleh; Sadeghi, Mehdi; Pezeshk, Hamid; Eslahchi, Changiz

2013-01-01

Recent advances in the sequencing technologies have provided a handful of RNA-seq datasets for transcriptome analysis. However, reconstruction of full-length isoforms and estimation of the expression level of transcripts with a low cost are challenging tasks. We propose a novel de novo method named SSP that incorporates interval integer linear programming to resolve alternatively spliced isoforms and reconstruct the whole transcriptome from short reads. Experimental results show that SSP is fast and precise in determining different alternatively spliced isoforms along with the estimation of reconstructed transcript abundances. The SSP software package is available at http://www.bioinf.cs.ipm.ir/software/ssp. © 2013.

A 16 deg2 survey of emission-line galaxies at z SSP Public Data Release 1

Science.gov (United States)

Hayashi, Masao; Tanaka, Masayuki; Shimakawa, Rhythm; Furusawa, Hisanori; Momose, Rieko; Koyama, Yusei; Silverman, John D.; Kodama, Tadayuki; Komiyama, Yutaka; Leauthaud, Alexie; Lin, Yen-Ting; Miyazaki, Satoshi; Nagao, Tohru; Nishizawa, Atsushi J.; Ouchi, Masami; Shibuya, Takatoshi; Tadaki, Ken-ichi; Yabe, Kiyoto

2018-01-01

We present initial results from the Subaru Strategic Program (SSP) with Hyper Suprime-Cam (HSC) on a comprehensive survey of emission-line galaxies at z SSP fields suggests that a survey volume of >5 × 105 Mpc3 is essential to overcome cosmic variance. Since the current data have not reached the full depth expected for the HSC-SSP, the color cut in i - NB816 or z - NB921 induces a bias towards star-forming galaxies with large equivalent widths, primarily seen in the stellar mass functions for the H α emitters at z ≈ 0.25-0.40. Even so, the emission-line galaxies clearly cover a wide range of luminosity, stellar mass, and environment, thus demonstrating the usefulness of the narrowband data from the HSC-SSP for investigating star-forming galaxies at z < 1.5.

Isozyme differences in barley mutants

Energy Technology Data Exchange (ETDEWEB)

AI-Jibouri, A A.M.; Dham, K M [Department of Botany, Nuclear Research Centre, Baghdad (Iraq)

1990-01-01

Full text: Thirty mutants (M{sub 11}) of barley (Hordeum vulgare L.) induced by physical and chemical mutagens were analysed for isozyme composition using polyacrylamide gel electrophoresis. Results show that these mutants were different in the isozymes leucine aminopeptidase, esterase and peroxidase. The differences included the number of forms of each enzyme, relative mobility value and their intensity on the gel. Glutamate oxaloacetate transaminase isozyme was found in six molecular forms and these forms were similar in all mutants. (author)

Host genotype is an important determinant of the cereal phyllosphere mycobiome

DEFF Research Database (Denmark)

Sapkota, Rumakanta; Knorr, Kamilla; Jørgensen, Lise Nistrup

2015-01-01

The phyllosphere mycobiome in cereals is an important determinant of crop health. However, an understanding of the factors shaping this community is lacking. Fungal diversity in leaves from a range of cultivars of winter wheat (Triticum aestivum), winter and spring barley (Hordeum vulgare...... and location have minor effects. We found many host-specific fungal pathogens, but also a large diversity of fungi that were relatively insensitive to host genetic background, indicating that host-specific pathogens live in a 'sea' of nonspecific fungi....

DOES JASMONIC ACID PREVENT THE GERMINATION

OpenAIRE

ÇAVUŞOĞLU, Kürşat

2009-01-01

Abstract: Effect of jasmonic acid on seed germination and seedling growth of barley (Hordeum vulgare L. cv. Bülbül 89) was investigated in the present study. Jasmonic acid concentrations less than 1500 µM have not inhibited the seed germination, while 1500 and 2000 µM jasmonic acid levels caused atypical germination. The germination was completely inhibited at 3000 µM level of jasmonic acid. However, the seedling growth clearly slowed down with increasing concentrations of jasmonic acid. Furt...

Integrated transcriptomics and proteomics analysis of storage protein composition in developing barley grain to improve nutritional profile

DEFF Research Database (Denmark)

Kaczmarczyk, Agnieszka Ewa; Dionisio, Giuseppe; Renaut, Jenny

2012-01-01

The aim of the study was to understand the molecular and biochemical mechanisms underpinning the effect of nitrogen (N) on barley (Hordeum vulgare) storage protein production (hordeins) during grain filling. Using a combination of advanced biochemistry methods, we could comprehensively describe......-regimes caused significant differences in both quantity and quality of the storage proteins transcripts. Principal Component Analysis of the amino acid (AA) profiles also indicated dissimilarity in individual AA percentages, correlated to hordein content. The abundance values of proteins of interest confirmed...

Aplicación de modelos en los sistemas agrícolas de secano de la meseta central : Simulación de rotaciones y modelado de la arquitectura de la planta en leguminosas

OpenAIRE

Hernández Díaz-Ambrona, Carlos Gregorio

1999-01-01

Este trabajo profundiza en el estudio de los sistemas agrícolas de secano de la Meseta Central. Sobre la base de la alternativa tradicional ce^eal^arbecho, se han estudiado durante tres años de cultivo 1995/96, 1996/97 y 1997/98 seis rotaciones diferentes: monocultivo de cebada (Hordeum vulgare L.), cebada/barbecho, cebada/habas (Viciafaba L.), cebada/guisantes {Pisum sativum L.), cebada/habas/barbecho y cebada/guisantes/barbecho. Entre las rotaciones, se ha comparado la biomasa, el rendimien...

Resistance to Barley Leaf Stripe

DEFF Research Database (Denmark)

Nørgaard Knudsen, J. C.

1986-01-01

in well adapted Northwest European spring cultivars. Virulence matching two hitherto not overcome resistances was demonstrated. Differences in apparent race nonspecific or partial resistance were also present, changing the percentage of infected plants of susceptible genotypes from about 20 to 44 per cent.......Ten barley [Hordeum vulgare] genotypes were inoculated with twelve isolates of Pyrenophora graminea of diverse European and North African origin. Race specific resistance occurred. Four, possibly five, genetically different sources of race-specific resistance were found, three of them occurring...

Genome Sequence of Bacillus endophyticus and Analysis of Its Companion Mechanism in the Ketogulonigenium vulgare-Bacillus Strain Consortium.

Directory of Open Access Journals (Sweden)

Nan Jia

Full Text Available Bacillus strains have been widely used as the companion strain of Ketogulonigenium vulgare in the process of vitamin C fermentation. Different Bacillus strains generate different effects on the growth of K. vulgare and ultimately influence the productivity. First, we identified that Bacillus endophyticus Hbe603 was an appropriate strain to cooperate with K. vulgare and the product conversion rate exceeded 90% in industrial vitamin C fermentation. Here, we report the genome sequencing of the B. endophyticus Hbe603 industrial companion strain and speculate its possible advantage in the consortium. The circular chromosome of B. endophyticus Hbe603 has a size of 4.87 Mb with GC content of 36.64% and has the highest similarity with that of Bacillus megaterium among all the bacteria with complete genomes. By comparing the distribution of COGs with that of Bacillus thuringiensis, Bacillus cereus and B. megaterium, B. endophyticus has less genes related to cell envelope biogenesis and signal transduction mechanisms, and more genes related to carbohydrate transport and metabolism, energy production and conversion, as well as lipid transport and metabolism. Genome-based functional studies revealed the specific capability of B. endophyticus in sporulation, transcription regulation, environmental resistance, membrane transportation, extracellular proteins and nutrients synthesis, which would be beneficial for K. vulgare. In particular, B. endophyticus lacks the Rap-Phr signal cascade system and, in part, spore coat related proteins. In addition, it has specific pathways for vitamin B12 synthesis and sorbitol metabolism. The genome analysis of the industrial B. endophyticus will help us understand its cooperative mechanism in the K. vulgare-Bacillus strain consortium to improve the fermentation of vitamin C.

First detection of Rickettsia conorii ssp. caspia in Rhipicephalus sanguineus in Zambia.

Science.gov (United States)

Chitimia-Dobler, Lidia; Dobler, Gerhard; Schaper, Sabine; Küpper, Thomas; Kattner, Simone; Wölfel, Silke

2017-11-01

Ticks are important vectors for Rickettsia spp. of the spotted fever group all around the world. Rickettsia conorii is the etiological agent of boutonneuse fever in the Mediterranean region and Africa. Tick identification was based on morphological features and further characterized using the 16S rRNA gene. The ticks were individually tested using pan-Rickettsia real-time-PCR for screening, and 23S-5S intergenic spacer region, 16S rDNA, gltA, sca4, ompB, and ompA genes were used to analyze the Rickettsia positive samples. Rickettsia conorii ssp. caspia was detected in tick collected in Zambia for the first time, thus demonstrating the possibility of the occurrence of human disease, namely Astrakhan fever, due to this Rickettsia ssp. in this region of Africa. The prevalence of R. conorii ssp. caspia was 0.06% (one positive tick out of 1465 tested ticks) and 0.07% (one positive tick out of 1254 tested Rh. sanguineus).

Streptococcus mutans SpaP binds to RadD of Fusobacterium nucleatum ssp. polymorphum.

Science.gov (United States)

Guo, Lihong; Shokeen, Bhumika; He, Xuesong; Shi, Wenyuan; Lux, Renate

2017-10-01

Adhesin-mediated bacterial interspecies interactions are important elements in oral biofilm formation. They often occur on a species-specific level, which could determine health or disease association of a biofilm community. Among the key players involved in these processes are the ubiquitous fusobacteria that have been recognized for their ability to interact with numerous different binding partners. Fusobacterial interactions with Streptococcus mutans, an important oral cariogenic pathogen, have previously been described but most studies focused on binding to non-mutans streptococci and specific cognate adhesin pairs remain to be identified. Here, we demonstrated differential binding of oral fusobacteria to S. mutans. Screening of existing mutant derivatives indicated SpaP as the major S. mutans adhesin specific for binding to Fusobacterium nucleatum ssp. polymorphum but none of the other oral fusobacteria tested. We inactivated RadD, a known adhesin of F. nucleatum ssp. nucleatum for interaction with a number of gram-positive species, in F. nucleatum ssp. polymorphum and used a Lactococcus lactis heterologous SpaP expression system to demonstrate SpaP interaction with RadD of F. nucleatum ssp. polymorphum. This is a novel function for SpaP, which has mainly been characterized as an adhesin for binding to host proteins including salivary glycoproteins. In conclusion, we describe an additional role for SpaP as adhesin in interspecies adherence with RadD-SpaP as the interacting adhesin pair for binding between S. mutans and F. nucleatum ssp. polymorphum. Furthermore, S. mutans attachment to oral fusobacteria appears to involve species- and subspecies-dependent adhesin interactions. © 2016 John Wiley & Sons A/S. Published by John Wiley & Sons Ltd.

RASS sound speed profile (SSP) measurements for use in outdoor sound propagation models

Energy Technology Data Exchange (ETDEWEB)

Bradley, S G [Physics Department, University of Auckland (New Zealand); Huenerbein, S v; Waddington, D [Research Institute for the Built and Human Environment, University of Salford (United Kingdom)], E-mail: s.vonhunerbein@salford.ac.uk

2008-05-01

The performance of outdoor sound propagation models depends to a great extent on meteorological input parameters. In an effort to improve speed and accuracy, model output synthetic sound speed profiles (SSP) are commonly used depending on meteorological classification schemes. In order to use SSP measured by RASS in outdoor sound propagation models, the complex profiles need to be simplified. In this paper we extend an investigation on the spatial and temporal characteristics of the meteorological data set required to yield adequate comparisons between models and field measurements, so that the models can be fairly judged. Vertical SSP from RASS, SODAR wind profiles as well as mast wind and temperature data from a flat terrain site and measured over a period of several months are used to evaluate applicability of the logarithmic approximation for a stability classification scheme proposed by the HARMONOISE working group.

RASS sound speed profile (SSP) measurements for use in outdoor sound propagation models

International Nuclear Information System (INIS)

Bradley, S G; Huenerbein, S v; Waddington, D

2008-01-01

The performance of outdoor sound propagation models depends to a great extent on meteorological input parameters. In an effort to improve speed and accuracy, model output synthetic sound speed profiles (SSP) are commonly used depending on meteorological classification schemes. In order to use SSP measured by RASS in outdoor sound propagation models, the complex profiles need to be simplified. In this paper we extend an investigation on the spatial and temporal characteristics of the meteorological data set required to yield adequate comparisons between models and field measurements, so that the models can be fairly judged. Vertical SSP from RASS, SODAR wind profiles as well as mast wind and temperature data from a flat terrain site and measured over a period of several months are used to evaluate applicability of the logarithmic approximation for a stability classification scheme proposed by the HARMONOISE working group

Sensitivity of spoiling and pathogen food-related bacteria to Origanum vulgare L. (Lamiaceae essential oil Sensibilidade de bactérias deteriorantes e patogênicas de interesse em alimentos ao óleo essencial de Origanum vulgare L. (Lamiaceae

Directory of Open Access Journals (Sweden)

Evandro Leite de Souza

2006-12-01

Full Text Available Origanum vulgare L. (oregano, Lamiaceae, has been known as plant specie with prominent biological properties for a long time. This study aimed to evaluate the antibacterial activity of Origanum vulgare essential oil on various Gram-positive and Gram-negative spoiling and/or pathogen food-related bacteria, as well as to observe its antimicrobial effectiveness in a food conservation micromodel. The results showed a strong antibacterial activity of the assayed essential oil noted by large growth inhibition zones (30-37 mm. MIC values were between 20-40 µL/mL for the most bacteria strains. Essential oil was able to cause significant (POriganum vulgare L. (orégano, Lamiaceae, tem sido reconhecida como uma espécie vegetal com destacáveis propriedades biológicas por um longo tempo. Este estudo objetivou avaliar a atividade antibacteriana do óleo essencial de Origanum vulgare L. sobre várias bactérias Gram positivas e Gram negativas deteriorantes e/ou patogênicas de interesse em alimentos, bem como observar sua efetividade antimicrobiana em um micromodelo de conservação de alimentos. Os resultados mostraram uma considerável atividade antibacteriana do óleo essencial ensaiado notada por grandes zonas de inibição do crescimento bacteriano (30-37 mm. Os valores de CIM encontrados oscilaram entre 20-40 µL/mL para a maioria das bactérias. A CIM do óleo essencial causou um significante (P<0.05 efeito inibitório sobre a viabilidade bacteriana, sendo caracterizado uma propriedade bacteriostática após 24 horas de exposição. Ainda, a CIM causou uma diminuição significante (P<0.05 da contagem da flora bacteriana autóctone em carne moída armazenada sob refrigeração. Estes dados suportam a possibilidade do uso do óleo essencial de Origanum vulgare L. como composto antimicrobiano alternativo em sistemas de conservação de alimentos.

The Salmonella type III effector SspH2 specifically exploits the NLR co-chaperone activity of SGT1 to subvert immunity.

Directory of Open Access Journals (Sweden)

Amit P Bhavsar

Full Text Available To further its pathogenesis, S. Typhimurium delivers effector proteins into host cells, including the novel E3 ubiquitin ligase (NEL effector SspH2. Using model systems in a cross-kingdom approach we gained further insight into the molecular function of this effector. Here, we show that SspH2 modulates innate immunity in both mammalian and plant cells. In mammalian cell culture, SspH2 significantly enhanced Nod1-mediated IL-8 secretion when transiently expressed or bacterially delivered. In addition, SspH2 also enhanced an Rx-dependent hypersensitive response in planta. In both of these nucleotide-binding leucine rich repeat receptor (NLR model systems, SspH2-mediated phenotypes required its catalytic E3 ubiquitin ligase activity and interaction with the conserved host protein SGT1. SGT1 has an essential cell cycle function and an additional function as an NLR co-chaperone in animal and plant cells. Interaction between SspH2 and SGT1 was restricted to SGT1 proteins that have NLR co-chaperone function and accordingly, SspH2 did not affect SGT1 cell cycle functions. Mechanistic studies revealed that SspH2 interacted with, and ubiquitinated Nod1 and could induce Nod1 activity in an agonist-independent manner if catalytically active. Interestingly, SspH2 in vitro ubiquitination activity and protein stability were enhanced by SGT1. Overall, this work adds to our understanding of the sophisticated mechanisms used by bacterial effectors to co-opt host pathways by demonstrating that SspH2 can subvert immune responses by selectively exploiting the functions of a conserved host co-chaperone.

Space Solar Power Technical Interchange Meeting 2: SSP TIM 2

Science.gov (United States)

Sanders, Jim; Hawk, Clark W.

1998-01-01

The 2nd Space Solar Power Technical Interchange Meeting (SSP TIM 2) was conducted September 21st through 24th with the first part consisting of a Plenary session. The summary results of this Plenary session are contained in part one of this report. The attendees were then organized into Working Breakout Sessions and Integrated Product Team (IPT) Sessions for the purpose of conducting in-depth discussions in specific topic areas and developing a consensus as to appropriate study plans and actions to be taken. The Second part covers the Plenary Summary Session, which contains the summary results of the Working Breakout Sessions and IPT Sessions. The appendix contains the list of attendees. The ob'jective was to provide an update for the study teams and develop plans for subsequent study activities. This SSP TIM 2 was initiated and the results reported electronically over the Internet. The International Space Station (ISS) could provide the following opportunities for conducting research and technology (R&T) which are applicable to SSP: (1) Automation and Robotics, (2) Advanced Power Generation, (3) Advanced Power Management & Distribution (PMAD), (4) Communications Systems and Networks, (5) Energy Storage, (6) In Space Propulsion (ISP), (7) Structural Dynamics and Control, and Assembly and (8) Wireless Power Transmission.

A weed suppressive index for spring barley (Hordeum vulgare) varieties

DEFF Research Database (Denmark)

Hansen, P K; Kristensen, K; Willas, J

2008-01-01

A screening programme for crop variety competitiveness would ideally be based on only a few, non-destructive measurements of key growth traits. In this study we measured the weed suppressive ability of 79 varieties of spring barley in two ways: (i) directly, by weed coverage assessments under wee...

Isolating Barley ( Hordeum vulgare L.) B1 Hordein Gene Promoter ...

African Journals Online (AJOL)

Promoters play the most important role in determining the temporal and spatial expression pattern and transcript level of a gene. Some strong constitutive promoters, such as cauliflower mosaic virus 35s promoter, are widely used in plant genetic engineering research. However, the expression levels of the foreign genes in ...

Isolating Barley (Hordeum vulgare L.) B1 Hordein Gene Promoter ...

African Journals Online (AJOL)

Yomi

2012-04-10

Apr 10, 2012 ... proline and glutamine (Piston et al., 2004). The four main groups of ... account for approximately 50% of the total protein in the. *Corresponding author. ..... inheritance, chromosomal location, and population dynamics. PNAS,.

Identification of a Phytase Gene in Barley (Hordeum vulgare L.)

Science.gov (United States)

Dai, Fei; Qiu, Long; Ye, Lingzhen; Wu, Dezhi; Zhou, Meixue; Zhang, Guoping

2011-01-01

Background Endogenous phytase plays a crucial role in phytate degradation and is thus closely related to nutrient efficiency in barley products. The understanding of genetic information of phytase in barley can provide a useful tool for breeding new barley varieties with high phytase activity. Methodology/Principal Findings Quantitative trait loci (QTL) analysis for phytase activity was conducted using a doubled haploid population. Phytase protein was purified and identified by the LC-ESI MS/MS Shotgun method. Purple acid phosphatase (PAP) gene was sequenced and the position was compared with the QTL controlling phytase activity. A major QTL for phytase activity was mapped to chromosome 5 H in barley. The gene controlling phytase activity in the region was named as mqPhy. The gene HvPAP a was mapped to the same position as mqPhy, supporting the colinearity between HvPAP a and mqPhy. Conclusions/Significance It is the first report on QTLs for phytase activity and the results showed that HvPAP a, which shares a same position with the QTL, is a major phytase gene in barley grains. PMID:21533044

Identification of a phytase gene in barley (Hordeum vulgare L..

Directory of Open Access Journals (Sweden)

Fei Dai

Full Text Available BACKGROUND: Endogenous phytase plays a crucial role in phytate degradation and is thus closely related to nutrient efficiency in barley products. The understanding of genetic information of phytase in barley can provide a useful tool for breeding new barley varieties with high phytase activity. METHODOLOGY/PRINCIPAL FINDINGS: Quantitative trait loci (QTL analysis for phytase activity was conducted using a doubled haploid population. Phytase protein was purified and identified by the LC-ESI MS/MS Shotgun method. Purple acid phosphatase (PAP gene was sequenced and the position was compared with the QTL controlling phytase activity. A major QTL for phytase activity was mapped to chromosome 5 H in barley. The gene controlling phytase activity in the region was named as mqPhy. The gene HvPAP a was mapped to the same position as mqPhy, supporting the colinearity between HvPAP a and mqPhy. CONCLUSIONS/SIGNIFICANCE: It is the first report on QTLs for phytase activity and the results showed that HvPAP a, which shares a same position with the QTL, is a major phytase gene in barley grains.

Comparison of stability statistics for yield in barley (Hordeum vulgare ...

African Journals Online (AJOL)

STORAGESEVER

2010-03-15

Mar 15, 2010 ... statistics and yield indicated that only TOP method would be useful for simultaneously selecting for high yield and ... metric stability methods; i) they reduce the bias caused by outliers, ii) ...... Biometrics, 43: 45-53. Sabaghnia N ...

Registration of Food Barley (Hordeum vulgare L.) Variety HB 1307 ...

African Journals Online (AJOL)

Six-rowed food type barley, HB 1307, was developed by Holetta Agricultural Research Center (HARC) from a cross between a landrace line and exotic germplasm (Awra gebs-1 x IBON93/91) and released in 2006 for mid and high altitude areas. The three consecutive years\\' (2002-2004) tests proved its superiority in grain ...

Comparative study of anatomical normalization errors in SPM and 3D-SSP using digital brain phantom

International Nuclear Information System (INIS)

Onishi, Hideo; Matsutomo, Norikazu; Matsutake, Yuki; Kawashima, Hiroki; Amijima, Hizuru

2011-01-01

In single photon emission computed tomography (SPECT) cerebral blood flow studies, two major algorithms are widely used statistical parametric mapping (SPM) and three-dimensional stereotactic surface projections (3D-SSP). The aim of this study is to compare an SPM algorithm-based easy Z score imaging system (eZIS) and a 3D-SSP system in the errors of anatomical standardization using 3D-digital brain phantom images. We developed a 3D-brain digital phantom based on MR images to simulate the effects of head tilt, perfusion defective region size, and count value reduction rate on the SPECT images. This digital phantom was used to compare the errors of anatomical standardization by the eZIS and the 3D-SSP algorithms. While the eZIS allowed accurate standardization of the images of the phantom simulating a head in rotation, lateroflexion, anteflexion, or retroflexion without angle dependency, the standardization by 3D-SSP was not accurate enough at approximately 25 deg or more head tilt. When the simulated head contained perfusion defective regions, one of the 3D-SSP images showed an error of 6.9% from the true value. Meanwhile, one of the eZIS images showed an error as large as 63.4%, revealing a significant underestimation. When required to evaluate regions with decreased perfusion due to such causes as hemodynamic cerebral ischemia, the 3D-SSP is desirable. In a statistical image analysis, we must reconfirm the image after anatomical standardization by all means. (author)

Action de I'AlA sur la teneur en azote total et protéinique des graines de céréales cultivées à different niveau de la capacité capillaire en eau

Directory of Open Access Journals (Sweden)

Wiesław Nowakowski

2015-06-01

Full Text Available L'action de I'AIA sur la teneur en azote total et en azote protéinique des graines du Triticum vulgare, d'Hordeum vulgare et d'Avena sativa cultivés a 30%, 60% et 90% de la capacité capillaire en eau du sable a tété étudiée au cours de trois ans (1969, 1970, 1971. La teneur en g-protéines totales liée au rendement des graines de céréales examinees a été plus élevée dans les conditions de sécheresse (30% de la capacite capillaire en eau à la suite d'un traitement auxinique. La teneur (% en azote total et proteinique ne semble pas etre tellement modifiee dans les graines de cereales à la suite d'un traitement auxinique.

Campylobacter fetus ssp jejuni en patología humana

Directory of Open Access Journals (Sweden)

Luz Echeverri

1982-06-01

Full Text Available Algunos microorganismos, como los Rotovirus y el Compylobocter fetus ssp jejuni reconocidos y estudiados recientemente, han llegado a ocupar un lugar preponderante en el grupo de enteropatógenos considerados como problema en salud pública.

Positioning Space Solar Power (SSP) as the Next Logical Step after the International Space Station (ISS)

Science.gov (United States)

Charania, A.

2002-01-01

At the end of the first decade of the 21st century, the International Space Station (ISS) will stand as a testament of the engineering capabilities of the international community. The choices for the next logical step for this community remain vast and conflicting: a Mars mission, moon colonization, Space Solar Power (SSP), etc. This examination focuses on positioning SSP as one such candidate for consideration. A marketing roadmap is presented that reveals the potential benefits of SSP to both the space community and the global populace at large. Recognizing that scientific efficiency itself has no constituency large enough to persuade entities to outlay funds for such projects, a holistic approach is taken to positioning SSP. This includes the scientific, engineering, exploratory, economic, political, and development capabilities of the system. SSP can be seen as both space exploration related and a resource project for undeveloped nations. Coupling these two non-traditional areas yields a broader constituency for the project that each one alone could generate. Space exploration is many times seen as irrelevant to the condition of the populace of the planet from which the money comes for such projects. When in this new century, billions of people on the planet still have never made a phone call or even have access to clean water, the origins of this skepticism can be understandable. An area of concern is the problem of not living up to the claims of overeager program marketers. Just as the ISS may never live up to the claims of its advocates in terms of space research, any SSP program must be careful in not promising utopian global solutions to any future energy starved world. Technically, SSP is a very difficult problem, even harder than creating the ISS, yet the promise it can hold for both space exploration and Earth development can lead to a renaissance of the relevance of space to the lives of the citizens of the world.

Summary of Recent Results from NASA's Space Solar Power (SSP) Programs and the Current Capabilities of Microwave WPT Technology

Science.gov (United States)

McSpadden, James; Mankins, John C.; Howell, Joe T. (Technical Monitor)

2002-01-01

The concept of placing enormous solar power satellite (SPS) systems in space represents one of a handful of new technological options that might provide large-scale, environmentally clean base load power into terrestrial markets. In the US, the SPS concept was examined extensively during the late 1970s by the U.S. Department of Energy (DOE) and the National Aeronautics and Space Administration (NASA). More recently, the subject of space solar power (SSP) was reexamined by NASA from 1995-1997 in the "fresh look" study, and during 1998 in an SSP "concept definition study". As a result of these efforts, in 1999-2000, NASA undertook the SSP Exploratory Research and Technology (SERT) program which pursued preliminary strategic technology research and development to enable large, multi-megawatt SSP systems and wireless power transmission (WPT) for government missions and commercial markets (in-space and terrestrial). During 2001-2002, NASA has been pursuing an SSP Concept and Technology Maturation (SCTM) program follow-on to the SERT, with special emphasis on identifying new, high-leverage technologies that might advanced the feasibility of future SSP systems. In addition, in 2001, the U.S. National Research Council (NRC) released a major report providing the results of a peer review of NASA's SSP strategic research and technology (R&T) road maps. One of the key technologies needed to enable the future feasibility of SSP/SPS is that of wireless power transmission. Advances in phased array antennas and rectennas have provided the building blocks for a realizable WPT system. These key components include the dc-RF converters in the transmitter, the retrodirective beam control system, and the receiving rectenna. Each subject is briefly covered, and results from the SERT program that studied a 5.8 GHz SPS system are presented. This paper presents a summary results from NASA's SSP efforts, along with a summary of the status of microwave WPT technology development.

Foeniculum vulgare essential oils: chemical composition, antioxidant and antimicrobial activities.

Science.gov (United States)

Miguel, Maria Graça; Cruz, Cláudia; Faleiro, Leonor; Simões, Mariana T F; Figueiredo, Ana Cristina; Barroso, José G; Pedro, Luis G

2010-02-01

The essential oils from Foeniculum vulgare commercial aerial parts and fruits were isolated by hydrodistillation, with different distillation times (30 min, 1 h, 2 h and 3 h), and analyzed by GC and GC-MS. The antioxidant ability was estimated using four distinct methods. Antibacterial activity was determined by the agar diffusion method. Remarkable differences, and worrying from the quality and safety point of view, were detected in the essential oils. trans-Anethole (31-36%), alpha-pinene (14-20%) and limonene (11-13%) were the main components of the essentials oil isolated from F. vulgare dried aerial parts, whereas methyl chavicol (= estragole) (79-88%) was dominant in the fruit oils. With the DPPH method the plant oils showed better antioxidant activity than the fruits oils. With the TBARS method and at higher concentrations, fennel essential oils showed a pro-oxidant activity. None of the oils showed a hydroxyl radical scavenging capacity > 50%, but they showed an ability to inhibit 5-lipoxygenase. The essential oils showed a very low antimicrobial activity. In general, the essential oils isolated during 2 h were as effective, from the biological activity point of view, as those isolated during 3 h.

Roles of Hydroxynitrile Glucosides in Barley

DEFF Research Database (Denmark)

Roelsgaard, Pernille Sølvhøj

on barley (Hordeum vulgare). Barley accumulates five hydroxynitrile glucosides, including one cyanogenic glucoside, in the epidermal cell layer. Cyanogenic glucosides are classically known as hydrogen cyanide-releasing defense compounds which act against generalist insects and herbivores. However...... is proposed. The results obtained in this Ph.D. study provide a unique insight demonstrating that hydroxynitrile glucosides play a far more complex role in barley defense against and susceptibility to Bgh than previously described. Future studies can build on the platforms established in this study to provide...

Studies on /sup 32/P transport and yellow rust resistance in barley

Energy Technology Data Exchange (ETDEWEB)

Schubert, J. (Akademie der Landwirtschaftswissenschaften der DDR, Aschersleben. Inst. fuer Phytopathologie)

1982-01-01

Several cultivars of barley (Hordeum vulgare L.) differing in their resistance to yellow rust were used to study the influence of the infection with Puccinia striiformis West. (strain 24) on /sup 32/P transport in intact plants and isolated leaves. Close correlations exist between transport processes and resistance. For example, resistant plants seem to have a more intensive matter transport than susceptible ones. The importance of the rate of transport to the effectiveness of hypothetic inducers of resistance reactions and defence substances is discussed.

Inter-simple sequence repeat (ISSR) loci mapping in the genome of perennial ryegrass

DEFF Research Database (Denmark)

Pivorienė, O; Pašakinskienė, I; Brazauskas, G

2008-01-01

The aim of this study was to identify and characterize new ISSR markers and their loci in the genome of perennial ryegrass. A subsample of the VrnA F2 mapping family of perennial ryegrass comprising 92 individuals was used to develop a linkage map including inter-simple sequence repeat markers...... demonstrated a 70% similarity to the Hordeum vulgare germin gene GerA. Inter-SSR mapping will provide useful information for gene targeting, quantitative trait loci mapping and marker-assisted selection in perennial ryegrass....

In vitro activity of Origanum vulgare essential oil against Candida species

Directory of Open Access Journals (Sweden)

Marlete Brum Cleff

2010-03-01

Full Text Available The aim of this study was to evaluate the in vitro activity of the essential oil extracted from Origanum vulgare against sixteen Candida species isolates. Standard strains tested comprised C. albicans (ATCC strains 44858, 4053, 18804 and 3691, C. parapsilosis (ATCC 22019, C. krusei (ATCC 34135, C. lusitaniae (ATCC 34449 and C. dubliniensis (ATCC MY646. Six Candida albicans isolates from the vaginal mucous membrane of female dogs, one isolate from the cutaneous tegument of a dog and one isolate of a capuchin monkey were tested in parallel. A broth microdilution technique (CLSI was used, and the inoculum concentration was adjusted to 5 x 10(6 CFU mL-1. The essential oil was obtained by hydrodistillation in a Clevenger apparatus and analyzed by gas chromatography. Susceptibility was expressed as Minimal Inhibitory Concentration (MIC and Minimal Fungicidal Concentration (MFC. All isolates tested in vitro were sensitive to O. vulgare essential oil. The chromatographic analysis revealed that the main compounds present in the essential oil were 4-terpineol (47.95%, carvacrol (9.42%, thymol (8.42% and □-terpineol (7.57%. C. albicans isolates obtained from animal mucous membranes exhibited MIC and MFC values of 2.72 µL mL-1 and 5 µL mL-1, respectively. MIC and MFC values for C. albicans standard strains were 2.97 µL mL-1 and 3.54 µL mL-1, respectively. The MIC and MFC for non-albicans species were 2.10 µL mL-1 and 2.97 µL mL-1, respectively. The antifungal activity of O. vulgare essential oil against Candida spp. observed in vitro suggests its administration may represent an alternative treatment for candidiasis.

Feminizing Wolbachia: a transcriptomics approach with insights on the immune response genes in Armadillidium vulgare

Directory of Open Access Journals (Sweden)

Chevalier Frédéric

2012-01-01

Full Text Available Abstract Background Wolbachia are vertically transmitted bacteria known to be the most widespread endosymbiont in arthropods. They induce various alterations of the reproduction of their host, including feminization of genetic males in isopod crustaceans. In the pill bug Armadillidium vulgare, the presence of Wolbachia is also associated with detrimental effects on host fertility and lifespan. Deleterious effects have been demonstrated on hemocyte density, phenoloxidase activity, and natural hemolymph septicemia, suggesting that infected individuals could have defective immune capacities. Since nothing is known about the molecular mechanisms involved in Wolbachia-A. vulgare interactions and its secondary immunocompetence modulation, we developed a transcriptomics strategy and compared A. vulgare gene expression between Wolbachia-infected animals (i.e., “symbiotic” animals and uninfected ones (i.e., “asymbiotic” animals as well as between animals challenged or not challenged by a pathogenic bacteria. Results Since very little genetic data is available on A. vulgare, we produced several EST libraries and generated a total of 28 606 ESTs. Analyses of these ESTs revealed that immune processes were over-represented in most experimental conditions (responses to a symbiont and to a pathogen. Considering canonical crustacean immune pathways, these genes encode antimicrobial peptides or are involved in pathogen recognition, detoxification, and autophagy. By RT-qPCR, we demonstrated a general trend towards gene under-expression in symbiotic whole animals and ovaries whereas the same gene set tends to be over-expressed in symbiotic immune tissues. Conclusion This study allowed us to generate the first reference transcriptome ever obtained in the Isopoda group and to identify genes involved in the major known crustacean immune pathways encompassing cellular and humoral responses. Expression of immune-related genes revealed a modulation of host

PENGEMBANGAN SSP FISIKA BERBASIS PENDEKATAN CTL UNTUK MENINGKATKAN KETERAMPILAN PROSES SAINS DAN MOTIVASI BELAJAR

Directory of Open Access Journals (Sweden)

Faiq Makhdum Noor

2015-04-01

Full Text Available This research aims to develop a learning device as Subject-Specific Pedagogy (SSP of physics, and to improve science process skills and learning motivation of the students. This research used the 4D model. The subjects of this research were the XI grade students of Muhammadiyah High School 2 Yogyakarta. The data collecting instruments were expert validation sheets, science process skill observation sheets, questionnaire of students’ response to the student books and worksheets, question-naire of students’ response to teaching process, students’ motivation learning sheets, and science process skill paper test. The research data were collected through observation, questionnaire, and paper test, and analyzed quantitatively. The results show as follows. (1 The development of physics SSP is carried out in accordance with the procedures of 4D model product development. (2 The results of expert’s validation show the physics SSP is in the very good criteria. (3 The readability of the student books and worksheets is in the good criteria. (4 The increasing of the score of science process skills and students’ learning motivation in the experimental class is higher than that in the control class. This shows that the physics SSP is fit for use in physics teaching.

An Optimally Stable and Accurate Second-Order SSP Runge-Kutta IMEX Scheme for Atmospheric Applications

Science.gov (United States)

Rokhzadi, Arman; Mohammadian, Abdolmajid; Charron, Martin

2018-01-01

The objective of this paper is to develop an optimized implicit-explicit (IMEX) Runge-Kutta scheme for atmospheric applications focusing on stability and accuracy. Following the common terminology, the proposed method is called IMEX-SSP2(2,3,2), as it has second-order accuracy and is composed of diagonally implicit two-stage and explicit three-stage parts. This scheme enjoys the Strong Stability Preserving (SSP) property for both parts. This new scheme is applied to nonhydrostatic compressible Boussinesq equations in two different arrangements, including (i) semiimplicit and (ii) Horizontally Explicit-Vertically Implicit (HEVI) forms. The new scheme preserves the SSP property for larger regions of absolute monotonicity compared to the well-studied scheme in the same class. In addition, numerical tests confirm that the IMEX-SSP2(2,3,2) improves the maximum stable time step as well as the level of accuracy and computational cost compared to other schemes in the same class. It is demonstrated that the A-stability property as well as satisfying "second-stage order" and stiffly accurate conditions lead the proposed scheme to better performance than existing schemes for the applications examined herein.

Tanacetum vulgare as a bioindicator of trace-metal contamination: a study of a naturally colonized open-pit lignite mine.

Science.gov (United States)

Jasion, Mateusz; Samecka-Cymerman, Aleksandra; Kolon, Krzysztof; Kempers, Alexander J

2013-10-01

We investigated the possibility of use of Tanacetum vulgare (tansy) as an ecological indicator of metal concentration in a naturally colonized open-pit lignite mine in Bełchatów (Poland). Tanacetum vulgare is the only species growing abundantly and spontaneously in the lignite mine waste dumps. Metal concentrations in roots, stems, leaves, flowers, and soil were measured in dump sites differing in type and time of reclamation and therefore differing in pollution levels. Tanacetum vulgare appeared to be an accumulator of chromium and iron in roots, whereas highest concentrations of manganese and zinc were found in leaves. A high bioaccumulation factor for cadmium (Cd) was observed in dumps and control sites, indicating that even small amounts of Cd in the environment may result in significant uptake by the plant. The lowest concentrations of metals were found in plants from sites situated on dumps reclaimed with argillaceous limestone.

Comparative Evaluation of Antifungal Activity of Piper Betel Leaf Oil, Origanum vulgare Essential Oil and Fluconazole Suspension on Candida albicans − An In Vitro Study

Directory of Open Access Journals (Sweden)

Nisha Makkar

2017-01-01

Full Text Available Introduction: Oropharyngeal candidiasis is an opportunistic mucosal infection caused by Candida albicans. It usually responds to topical treatments such as clotrimazole troches, topical fluconazole, chlorhexidine mouthwash and nystatin suspension. Piper betel leaf oil and Origanum vulgare essential oil have shown some topical antifungal activity. Aim: To determine and compare the antifungal efficacy of piper betel leaf oil, O. vulgare essential oil and fluconazole suspension against C. albicans. Materials and Methods: The zone of inhibition was measured by the cup–plate diffusion method using 100 μl volume of piper betel leaf oil, O. vulgare essential oil and fluconazole suspension, which were pipetted into the wells of the inoculated Sabouraud’s dextrose agar plates. The zone of inhibition was measured in millimetres using Vernier calliper. Minimum inhibitory concentration (MIC was determined by the broth macro-dilution test by pouring 1 ml of the respective concentrations of the test material to the individual test tubes along with 10 μl of the diluted test organism inoculum. Finally, MIC was calculated using a reflective viewer. Results: The zone of inhibition for O. vulgare essential oil (>40 mm was more than fluconazole suspension (>35 mm. MIC of O. vulgare essential oil, piper betel leaf oil and fluconazole suspension was 1.6%, 0.4% and 0.8%, respectively. Conclusion: O. vulgare essential oil was found to be a more effective antifungal agent than piper betel leaf oil and fluconazole suspension.

Morphological differentiation of non-glandular and glandular trichomes on Marrubium vulgare L.

Directory of Open Access Journals (Sweden)

Marta Dmitruk

2014-04-01

Full Text Available Marrubium vulgare L., commonly known as a white horehound or common horehound, belongs to the plant family Lamiaceae. It is a perennial aromatic herb which grows naturally in Europe, Asia, and America. Since ancient Egypt, this species has been known as a remedy for upper respiratory tract ailments. Nowadays, horehound is used in herbal medicine for treatment of liver diseases, biliary tract disorders, and for increasing the appetite and supporting the function of the stomach. The main biologically active substances in M. vulgare organs are: marrubiin, tannins, essential oils, and ursolic acid. The paper presents micromorphological analyses of non-glandular and glandular trichomes of M. vulgare. The research material was sampled from the plant collection in the Botanical Garden of the Maria Curie-Sklodowska University in Lublin (51°14′ N, 22°34′ E. The above-ground parts of horehound were collected during the flowering period in July 2013. Using light microscopy (LM and scanning electron microscopy (SEM, the types and sizes of trichomes from the stem, leaf, calyx, and corolla were investigated. The results of the microscopic observations show that the surfaces of M. vulgare vegetative and reproductive organs are densely clothed with glandular and non-glandular trichomes. The glandular trichomes are of two main types: peltate and capitate. Peltate trichomes consist of a short stalk cell and a large head with secretory cells arranged in a circle. The height of a mature trichome is about 31.33 μm and the diameter of the head is 31.47 μm. The substance produced by secretory cells passes through the apical walls and accumulates within a space between the cuticle and the cell wall layer. Capitate long trichomes with a basal cell, long stalk, neck cell, and a unicellular head are 36.65 μm long and the diameter of the head is about 15.6 μm. There are two types of short capitate trichomes: with a bicellular head and a unicellular stalk and with

Immunoreactive proteins of Bifidobacterium longum ssp. longum CCM 7952 and Bifidobacterium longum ssp. longum CCDM 372 identified by gnotobiotic mono-colonized mice sera, immune rabbit sera and nonimmune human sera.

Directory of Open Access Journals (Sweden)

Sabina Górska

2016-09-01

Full Text Available The Bifidobacteria show great diversity in the cell surface architecture which may influence the physicochemical properties of the bacterial cell and strain specific properties. The immunomodulatory role of bifidobacteria has been extensively studied, however studies on the immunoreactivity of their protein molecules are very limited. Here, we compared six different methods of protein isolation and purification and we report identification of immunogenic and immunoreactive protein of two human Bifidobacterium longum ssp. longum strains. We evaluated potential immunoreactive properties of proteins employing polyclonal sera obtained from germ free mouse, rabbit and human. The protein yield was isolation method-dependent and the reactivity of proteins detected by SDS-PAGE and Western blotting was heterogeneous and varied between different serum samples. The proteins with the highest immunoreactivity were isolated, purified and have them sequenced. Among the immunoreactive proteins we identified enolase, aspartokinase, pyruvate kinase, DnaK (B. longum ssp. longum CCM 7952 and sugar ABC transporter ATP-binding protein, phosphoglycerate kinase, peptidoglycan synthethase penicillin-binding protein 3, transaldolase, ribosomal proteins and glyceraldehyde 3-phosphate dehydrogenase (B. longum ssp. longum CCDM 372.

Optimal Control Strategy for Marine Ssp Podded Propulsion Motor Based on Strong Tracking-Epf

Directory of Open Access Journals (Sweden)

Yao Wenlong

2015-09-01

Full Text Available Aiming at the non-linearity of state equation and observation equation of SSP (Siemen Schottel Propulsor propulsion motor, an improved particle filter algorithm based on strong tracking extent Kalman filter (ST-EKF was presented, and it was imported into the marine SSP propulsion motor control system. The strong tracking filter was used to update particles in the new algorithm and produce importance densities. As a result, the problems of particle degeneracy and sample impoverishment were ameliorated, the propulsion motor states and the rotor resistance were estimated simultaneously using strong track filter (STF, and the tracking ability of marine SSP propulsion motor control system was improved. Simulation result shown that the improved EPF algorithm was not only improving the prediction accuracy of the motor states and the rotor resistance, but also it can satisfy the requirement of navigation in harbor. It had the better accuracy than EPF algorithm.

The chemical defoliation of Ligitstrum vulgare L. and Spiraea x arguta Zab. shrubs in nursery

Directory of Open Access Journals (Sweden)

Szczepan Marczyński

2015-06-01

Full Text Available To defoliate Ligustrum vulgare and Spiraea x arguta – ethephon, KJ, Mg(ClO32•6H2O, CuSO4•5H2O and (NH42SO4 in various concentrations were used alone or in mixtures. Treating plants with potassium iodide gave the best results. KJ concentrations of 0.05-0,1% and 0.1-0.% were sufficient to defoliate Spiraea and Ligusturm respectively. Magnesium chlorate at concentration of 0.24 and 2% CuSO4 were also effective, the latter however, proved slight harmful to the plants. Spraying with defoliants on Sept. 26 gave better results than treating plants on Sept. 16. Chemical defoliation decreased negligibly the frost resistance of Ligusturm vulgare shrubs.

Aspectos ecológicos y distribución de Tropaeolum tuberosum ssp. silvestre (Tropaeolaceae en Argentina

Directory of Open Access Journals (Sweden)

Eva Bulacio

2012-06-01

Full Text Available Tropaeolum tuberosum Ruiz et Pav. ssp. silvestre Sparre es una hierba rizomatosa trepadora que en Argentina fue encontrada en las Sierras de Calilegua (Jujuy y en áreas montanas de Catamarca, aunque de esta última localidad sólo se conoce un único e incompleto ejemplar. Habita quebradas húmedas, entre los 2.100 y 2.650 m s.n.m., en el límite superior del bosque montano. El tallo es grácil de hasta 3 m de largo y la porción subterránea está constituida por rizomas alargados y de hasta 1 cm de diámetro. Estas son las principales diferencias con la ssp. tuberosum, en la cual el tallo es más corto, erguido y desarrolla tubérculos bien definidos.Ecological features and distribution of Tropaeolum tuberosum ssp. silvestre (Tropaeolaceae in Argentina. Tropaeolum tuberosum Ruiz et Pav. ssp. silvestre Sparre is a rhizomatous climbing herb that in Argentina was found in the Sierras of Calilegua (Jujuy and Catamarca mountains, yet of this last locality only is known an one and incomplete specimen. It inhabits humid gorges, between 2100-2650 masl, in the upper limit of the montane forest. The slender stem reaches 3 meters in lenght and the underground portion shows elongated rhizomes up to 1 cm in diameter. These are the main differences with the ssp. tuberosum, in which the stem is shorter, erect and develop well-defned tubers.

AKTIVITAS ANTIBAKTERI EKSTRAK BUAH ADAS (Foeniculum vulgare, Mill PADA Vibrio harveyi DAN Vibrio alginolyticus Antibacterial Activity of Fennel (Foeniculum vulgare Mill Extract on Vibrio alginolyticus and Vibrio harveyi

Directory of Open Access Journals (Sweden)

Budianto Budianto

2015-10-01

Pada penelitian ini menggunakan ekstrak air dari buah adas untuk mengetahui aktivitas antibakteri terhadap Vibrio harveyi dan Vibrio alginolyticus dengan menggunakan metode uji Minimum Inhibitory Concentration (MIC dan difusi cakram kertas. Hasil yang diperoleh pada uji MIC, konsentrasi terkecil untuk menghambat pertumbuhan adalah 0,060 g/ml, untuk kedua spesies bakteri. Variasi perlakuan pada uji cakram kertas yaitu konsentrasi A (0,065 g/ml, B (0,070 g/ml, C (0,075 g/ml, D (0,080 g/ml, E (0,085 g/ml, F (0,090 g/ml dan kontrol (0,000 g/ml, hasil yang diperoleh adalah konsentrasi 0,090 g/ml memiliki diameter zona hambat tertinggi sebesar 11,17 ± 0,5 mm (V. harveyi dan 12,53 ± 1,14 mm (V. alginolyticus, sehingga dapat disimpulkan bahwa buah adas (F. vulgare Mill memiliki peranan ekologi yang sangat penting sebagai bahan pengobatan alternatif dalam pengendalian penyebaran penyakit Vibriosis yang disebabkan oleh V. harveyi dan V. alginolyticus. Kata kunci: Foeniculum vulgare Mill, Vibrio harveyi, Vibrio alginolyticus, uji MIC dan difusi cakram kertas

The 'Big bang' in the Early Iron Age

Directory of Open Access Journals (Sweden)

Medović Aleksandar

2010-01-01

Full Text Available The Early Iron Age granaries of Tell Gradina upon Bosut exploded in a fire inferno in the 8th century B.C. The result of this catastrophe is 2-5 cm thick layer with mixed carbonized seeds and fruits. Recently, eight samples were taken from Gradina's profile for archaeobotanical analysis. The goal was to obtain basic information on land use and on major crops and weeds of that period. The most abundant were cereals, followed by millets, pulses and oil/fibre plants. The dominant cereals were einkorn (Triticum monococcum and hulled barley (Hordeum vulgare vulgare. Broomcorn millet (Panicum miliaceum was also very important. Pulses were represented with six and oil/fibre plants with three species. Among weeds and ruderals, most common are rye brome (Bromus secalinus, fat hen (Chenopodium album, darnel ryegrass (Lolium temulentum, hairy crabgrass (Digitaria sanguinalis and corncockle (Agrostemma githago.

Identification of barley and rye varieties using matrix- assisted laser desorption/ionisation time-of-flight mass spectrometry with neural networks

DEFF Research Database (Denmark)

Bloch, H.A.; Petersen, Marianne Kjerstine; Sperotto, Maria Maddalena

2001-01-01

developed, which combines analysis of alcohol-soluble wheat proteins (gliadins) using matrix-assisted laser desorption/ionisation time-of-flight mass spectrometry with neural networks. Here we have applied the same method for the identification of both barley (Hordeum vulgare L.) and rye (Secale cereale L.......) varieties. For barley, 95% of the mass spectra were correctly classified. This is an encouraging result, since in earlier experiments only a grouping into subsets of varieties was possible. However, the method was not useful in the classification of rye, due to the strong similarity between mass spectra...

Assessment of a relaxed eddy accumulation for measurements of fluxes of biogenic volatile organic compounds: Study over arable crops and a mature beech forest

DEFF Research Database (Denmark)

Gallagher, M.W.; Clayborough, R.; Beswick, K.M.

2000-01-01

A relaxed eddy accumulation (REA) system, based on the design by Beverland et al. (Journal of Geophysics Research 101 (D17) 22, 807-22, 815), for the measurement of biogenic VOC species was evaluated by intercomparison with an eddy correlation CO2 flux system over a mature deciduous beech canopy...... (Fagus Sylvatica) during the FOREXNOX program. Measurements from a site where winter wheat and barley (Hordeum Vulgare ann Triticum Aestivum) were being harvested are also presented. The system was inter-compared with two different eddy correlation systems for measuring CO2 fluxes. Good results were...

UCE: A uracil excision (USER^TM)-based toolbox for transformation of cereals

DEFF Research Database (Denmark)

Hebelstrup, Kim H; Christiansen, Michael W; Carciofi, Massimiliano

2010-01-01

Background Cloning of gene casettes and other DNA sequences into the conventional vectors for biolistic or Agrobacterium-mediated transformation is hampered by a limited amount of unique restriction sites and by the difficulties often encountered when ligating small single strand DNA overhangs...... (USER cereal), ready for use in cloning of complex constructs into the T-DNA. A series of the vectors were tested and shown to perform successfully in Agrobacterium-mediated transformation of barley (Hordeum vulgare L.) as well as in biolistic transformation of endosperm cells conferring transient...

Effect of sterilization on mineralization of straw and black carbon

OpenAIRE

Bobul'ská, Lenka; Bruun, Sander; Fazekašová, Danica

2013-01-01

The study was aimed at investigating the role of microorganisms in the degradation of BC (black carbon). CO evolution was measured under sterilized and non-sterilized soil using BC and straw amendments. Black carbon and straw were produced from homogenously C labelled roots of barley (Hordeum vulgare) with a specific activity 2.9 MBq g C. Production of BC was implemented at 300 °C for 24 h in a muffle oven, incubated in soil and C in the evolved CO was measured after 0.5, 1, 2, 4, 8, 16, 26 a...

High-level expression of the native barley alpha-amylase/subtilisin inhibitor in Pichia pastoris

DEFF Research Database (Denmark)

Micheelsen, Pernille Ollendorff; Ostergaard, Peter Rahbek; Lange, Lene

2008-01-01

An expression system for high-level expression of the native Hordeum vulgare alpha-amylase/subtilisin inhibitor (BASI) has been developed in Pichia pastoris, using the methanol inducible alcohol oxidase 1 (AOX1) promoter. To optimize expression, two codon-optimized coding regions have been designed...... and expressed alongside the wild-type coding region. To ensure secretion of the native mature protein, a truncated version of the alpha mating factor secretion signal from Saccharomyces cerevisiae was used. In order to be able to compare expression levels from different clones, single insertion transformants...

Starch bioengineering in Brachypodium distachyon

DEFF Research Database (Denmark)

Tanackovic, Vanja; Svensson, Jan Tommy; Buleon, A

2011-01-01

Brachypodium distachyon was recently introduced as a model plant for temperate cereals (Opanowicz et al., 2008). We aim to establish Brachypodium as a model for cereal starch metabolism. Grain starch from two lines: Bd21 and Bd21-3 are being characterized. Microscopic, chemical and structural data...... including amylopectin chain length distribution, phosphate content and amylose content provided further evidence for the close relationship to temperate cereals even though starch content and starch granule size were considerably lower than that for barley (Hordeum vulgare). Bioinformatics analyses...... in temperate cereals....

GeneCAT--novel webtools that combine BLAST and co-expression analyses

DEFF Research Database (Denmark)

Mutwil, Marek; Obro, Jens; Willats, William G T

2008-01-01

The gene co-expression analysis toolbox (GeneCAT) introduces several novel microarray data analyzing tools. First, the multigene co-expression analysis, combined with co-expressed gene networks, provides a more powerful data mining technique than standard, single-gene co-expression analysis. Second...... orthologs in the plant model organisms Arabidopsis thaliana and Hordeum vulgare (Barley). GeneCAT is equipped with expression data for the model plant A. thaliana, and first to introduce co-expression mining tools for the monocot Barley. GeneCAT is available at http://genecat.mpg.de....

Identification and characterization of barley RNA-directed RNA polymerases

DEFF Research Database (Denmark)

Madsen, Christian Toft; Stephens, Jennifer; Hornyik, Csaba

2009-01-01

in dicot species. In this report, we identi!ed and characterized HvRDR1, HvRDR2 and HvRDR6 genes in the monocot plant barley (Hordeum vulgare). We analysed their expression under various biotic and abiotic stresses including fungal and viral infections, salicylic acid treatment as well as during plant...... development. The different classes and subclasses of barley RDRs displayed contrasting expression patterns during pathogen challenge and development suggesting their involvement in speci!c regulatory pathways. Their response to heat and salicylic acid treatment suggests a conserved pattern of expression...

Estimating legume N-2 fixation in grass-clover mixtures of a grazed organic cropping system using two N-15 methods

DEFF Research Database (Denmark)

Vinther, F.P.; Jensen, E.S.

2000-01-01

The input of Nitrogen (N) through symbiotic N-2 fixation (SNF) in grass-clover mixtures was determined in an organic cropping. system for grazing during 3 years. The mixture of perennial ryegrass (Lolium perenne L.) and white clover (Trifolium repens L.) was established by undersowing in spring...... barley (Hordeum vulgare L.) and maintained subsequently for two production years. Dinitrogen fixation was determined using the N-15 isotope dilution techniques and two labelling procedures. Using either pre-labelling of the soil with immobilisation of the N-15 by addition of a carbon source before...

Chemical characteristic of salt fermented meat inoculated with Pediococcus ssp

Science.gov (United States)

Pramono, Y. B.; Rahayu, E. S.; Suparmo; Utami, T.; Nurwantoro; Yunianto, V. D.

2018-01-01

The research goal is knowing of the characteristict of salt fermented meat by Pediococcus ssp. There were microbiological, chemical, and off-flavor compound during fermentation. This study was conducted on research of influence of salt-meat fermentation inoculated used starter. They were included microbiological characteristics, and chemical characteristics. Microbiological characteristics observed were total bacteria, number of coliform groups, bacteria producing bioamine, and total lactic acid bacteria. The result showed that decreasing of coliform and bioamine producer bacteria, and total lactic acid bacteria decreased 3 log cycle. While the soluble protein increased of 7-8% and bioamine increased of 5-6 mg/100 g. And then Off-flavour compound, TVN and TMA increased of 36-20 mg/100g and 16-30 mg/100g, respectively. Conclusion of the research that Pedioccoccus ssp. influenced salt fermented meat.

SSP Technology Investigation of a High-Voltage DC-DC Converter

Science.gov (United States)

Pappas, J. A.; Grady, W. M.; George, Patrick J. (Technical Monitor)

2002-01-01

The goal of this project was to establish the feasibility of a high-voltage DC-DC converter based on a rod-array triggered vacuum switch (RATVS) for the Space Solar Power system. The RATVS has many advantages over silicon and silicon-carbide devices. The RATVS is attractive for this application because it is a high-voltage device that has already been demonstrated at currents in excess of the requirement for an SSP device and at much higher per-device voltages than existing or near-term solid state switching devices. The RATVS packs a much higher specific power rating than any solid-state device and it is likely to be more tolerant of its surroundings in space. In addition, pursuit of an RATVS-based system would provide NASA with a nearer-term and less expensive power converter option for the SSP.

Honey Antibacterial Effect Boosting Using Origanum vulgare L. Essential Oil

OpenAIRE

Imtara, Hamada; Elamine, Youssef; Lyoussi, Badiâa

2018-01-01

The appearance of new bacterial strains which cause pathogenic diseases and which are resistant to the most used antibiotics requires probing new antibacterial agents sources. Therefore, the main aim of the present work was to follow the antibacterial activity of honey samples from Palestine and Morocco, after the combination with Origanum vulgare L. essential oil, and figure out whether the honey physicochemical parameters and geographic origin influence the final activity. The results of th...

Proteomic analysis of bronchoalveolar lavage fluid proteins from mice infected with Francisella tularensis ssp novicida

Energy Technology Data Exchange (ETDEWEB)

Varnum, Susan M.; Webb-Robertson, Bobbie-Jo M.; Pounds, Joel G.; Moore, Ronald J.; Smith, Richard D.; Frevert, Charles; Skerret, Shawn J.; Wunschel, David S.

2012-07-06

Francisella tularensis causes the zoonosis tularemia in humans and is one of the most virulent bacterial pathogens. We utilized a global proteomic approach to characterize protein changes in bronchoalveolar lavage fluid from mice exposed to one of three organisms, F. tularensis ssp. novicida, an avirulent mutant of F. tularensis ssp. novicida (F.t. novicida-ΔmglA); and Pseudomonas aeruginosa. The composition of BALF proteins was altered following infection, including proteins involved in neutrophil activation, oxidative stress and inflammatory responses. Components of the innate immune response were induced including the acute phase response and the complement system, however the timing of their induction varied. Francisella tularensis ssp. novicida infected mice do not appear to have an effective innate immune response in the first hours of infection, however within 24 hours they show an upregulation of innate immune response proteins. This delayed response is in contrast to P. aeruginosa infected animals which show an early innate immune response. Likewise, F.t. novicida-ΔmglA infection initiates an early innate immune response, however this response is dimished by 24 hours. Finally, this study identifies several candidate biomarkers, including Chitinase 3-like-1 (CHI3L1 or YKL-40) and peroxiredoxin 1, that are associated with F. tularensis ssp. novicida but not P. aeruginosa infection.

In vitro antimicrobial activity and chemical composition of the essential oil of Foeniculum vulgare Mill.

Science.gov (United States)

Aprotosoaie, Ana Clara; Hăncianu, Monica; Poiată, Antonia; Tuchiluş, Cristina; Spac, A; Cioană, Oana; Gille, Elvira; Stănescu, Ursula

2008-01-01

In our study, four samples of volatile oil from Foeniculum vulgare, cultivated in different pedoclimatic conditions, were investigated for their antimicrobial activity and chemical composition. Organisms. Staphylococcus aureus ATCC 25923, Bacillus cereus, Pseudomonas aeruginosa, Escherichia coli ATCC 25922, Candida albicans were included in the report. Antimicrobial susceptibility tests. The comparative inhibitory activity of volatile oil samples with other antimicrobial agents was quantitative determined by minimum inhibitory concentration (MIC). Oil samples are the volatile oils extracted by steam distillation, from two ecological vegetative populations of Foeniculum vulgare. Gas chromatography coupled to mass spectrometry (GC-MS) was used to determine the chemical composition of the essential oils. All oil samples have a good activity against E. coli and S. aureus at low concentrations. Against B. cereus and P. aeruginosa these oil samples are less active. The oil samples were generally bactericidal at a concentration up to twofold or fourfold higher than the MIC value. Significantly synergic activity with amoxicillin or tetracycline showed all fennel samples against E. coli, Sarcina lutea and B. subtilis strains. Fennel oil samples have shown high activity against Candida albicans. No significant antimicrobial activity variations were observed for Foeniculum vulgare volatile oil samples obtained after two or three years cultivation period. The most important identified compounds in all samples of fennel volatile oils were trans-anethole, estragole, fenchone, limonene, alpha-pinene and gamma-terpinene.

Immunoreactive Proteins of Bifidobacterium longum ssp. longum CCM 7952 and Bifidobacterium longum ssp. longum CCDM 372 Identified by Gnotobiotic Mono-Colonized Mice Sera, Immune Rabbit Sera and Non-immune Human Sera.

Science.gov (United States)

Górska, Sabina; Dylus, Ewa; Rudawska, Angelika; Brzozowska, Ewa; Srutkova, Dagmar; Schwarzer, Martin; Razim, Agnieszka; Kozakova, Hana; Gamian, Andrzej

2016-01-01

The Bifidobacteria show great diversity in the cell surface architecture which may influence the physicochemical properties of the bacterial cell and strain specific properties. The immunomodulatory role of bifidobacteria has been extensively studied, however studies on the immunoreactivity of their protein molecules are very limited. Here, we compared six different methods of protein isolation and purification and we report identification of immunogenic and immunoreactive protein of two human Bifidobacterium longum ssp. longum strains. We evaluated potential immunoreactive properties of proteins employing polyclonal sera obtained from germ free mouse, rabbit and human. The protein yield was isolation method-dependent and the reactivity of proteins detected by SDS-PAGE and Western blotting was heterogeneous and varied between different serum samples. The proteins with the highest immunoreactivity were isolated, purified and have them sequenced. Among the immunoreactive proteins we identified enolase, aspartokinase, pyruvate kinase, DnaK ( B. longum ssp. longum CCM 7952) and sugar ABC transporter ATP-binding protein, phosphoglycerate kinase, peptidoglycan synthethase penicillin-binding protein 3, transaldolase, ribosomal proteins and glyceraldehyde 3-phosphate dehydrogenase ( B. longum ssp. longum CCDM 372).

Biorestauration of soil polluted by waste motor oil by biostimulation with vermicompost and phytoremediation with Sorghum vulgare inoculated by Bacillus cereus and Rhizobium etli

Directory of Open Access Journals (Sweden)

Juárez-Cisneros Gladys

2014-11-01

Full Text Available Soil pollution by waste motor oil (WMO caused soil´s lost fertility. The aims of this research where a bioremediation of soil polluted by 10000 ppm of WMO for biostimulation with vermicompost (VC at 3 and 6 % (w/w follow by b phytoremediation (PR of the same soil to eliminate remaining WMO with Sorghum vulgare inoculated with Bacillus cereus and/or Rhizobium etli or Promoting Growth Plant Bacteria (PGPB. At the first step of assay WMO concentration was measured before and after bioremediation. At the second step the same soil phytoremediation was applied for remaining WHO sowing S. vulgare inoculated with PGPB, then at flowering stage its biomass and WHO final concentration was determined. Results showed that soil impacted by WMO biostimulated with VC at 3% was eliminated 8630 ppm of WMO. At the second phase in the same soil PR applied for remaining WMO which was reduced until 210 ppm. Soil polluted by remaining WMO applied PR using S. vulgare plus R. etli WMO was decreased at 260 ppm. While S. vulgare´s biomass inoculated with PGPB was higher compared to S. vulgare grown in soil not polluted by WMO according by ANOVA - Tukey (p > 0.05. These results suggested that soil polluted by WMO could be recovering by applying integrated BR and PR better than just using one type.

Does SSP Plus Increase Employment? The Effect of Adding Services to the Self-Sufficiency Project's Financial Incentives.

Science.gov (United States)

Quets, Gail; Robins, Philip K.; Pan, Elsie C.; Michalopoulos, Charles; Card, David

In 1992, Human Resources Development Canada launched the Self-Sufficiency Project (SSP), which was a research and demonstration effort involving long-term, single-parent Income Assistance (IA) recipients in New Brunswick and British Columbia. Under SSP, IA recipients who left IA and worked at least 30 hours per week were offered a generous but…

Introgression of genetic material from Zea mays ssp. Mexicana into cultivated maize was facilitated by tissue culture

International Nuclear Information System (INIS)

Wang, L.; Gu, X.; Qu, M.; Luan, J.; Zhang, J.

2012-01-01

Zea mays ssp. mexicana, a wild relative of cultivated maize (Z. mays ssp. mays), is a useful gene resource for maize breeding. In this study, two populations were generated by conventional breeding scheme (population I) or tissue culture regime (population II), respectively, to introgress genetic material of Z. mays ssp. mexicana into maize. Karyotype analysis showed that the arm ratios of 10 pairs of chromosomes in parent maize Ye515 and derivative lines from 2 different populations with 26% and 38% chromosome variation frequencies, respectively. Alien chromatin was detected in the root tip cells of progeny plants through genomic in situ hybridization (GISH). There were 3.3 chromosomes carrying alien chromatin on average in population I and 6.5 in population II. The hybridization signals were located mainly at the terminal or sub terminal regions of the chromosomes and the sizes were notably variant among lines. Based on those results, it is concluded that the introgression of genetic material from Z. mays ssp. mexicana into cultivated maize was facilitated by tissue culture, and subsequently some excellent materials for maize breeding were created. (author)

Assessing the effects of exposure to environmental stress on some functional properties of Bifidobacterium animalis ssp. lactis.

Science.gov (United States)

Amund, O D; Ouoba, L I I; Sutherland, J P; Ghoddusi, H B

2014-12-01

This study assessed the effects of exposing a strain of Bifidobacterium animalis ssp. lactis to acid, bile and osmotic stresses on antagonistic properties, biofilm formation and antibiotic susceptibility/resistance profile. Exposure to each stress factor appeared to have no significant effect on the antagonism against Escherichia coli NCTC 12900 and Salmonella enterica serovar Enteritidis PT4. No suppression in biofilm formation due to exposure to stress was observed. Bile and osmotic stresses resulted in significantly higher biofilm formation. Expression of an exopolysaccharide synthesis gene, gtf 01207, was significantly higher when the B. animalis ssp. lactis strain was exposed to osmotic stress. Susceptibility of the B. animalis ssp. lactis strain to chloramphenicol, erythromycin, ampicillin and vancomycin, and resistance to tetracycline remained unchanged when exposed to each stress. The expression of a tetracycline resistance gene, tet(W), was significantly higher when exposed to each stress. These results may suggest that the potential for the B. animalis ssp. lactis strain to provide probiotic benefit, after exposure to the stressful conditions of the gastrointestinal tract, remains intact.

Lineages of Streptococcus equi ssp. equi in the Irish equine industry.

Science.gov (United States)

Moloney, Emma; Kavanagh, Kerrie S; Buckley, Tom C; Cooney, Jakki C

2013-01-01

Streptococcus equi ssp. equi is the causative agent of 'Strangles' in horses. This is a debilitating condition leading to economic loss, yard closures and cancellation of equestrian events. There are multiple genotypes of S. equi ssp. equi which can cause disease, but to date there has been no systematic study of strains which are prevalent in Ireland. This study identified and classified Streptococcus equi ssp. equi strains isolated from within the Irish equine industry. Two hundred veterinary isolates were subjected to SLST (single locus sequence typing) based on an internal sequence from the seM gene of Streptococcus equi ssp equi. Of the 171 samples which successfully gave an amplicon, 162 samples (137 Irish and 24 UK strains) gave robust DNA sequence information. Analysis of the sequences allowed division of the isolates into 19 groups, 13 of which contain at least 2 isolates and 6 groups containing single isolates. There were 19 positions where a DNA SNP (single nucleotide polymorphism) occurs, and one 3 bp insertion. All groups had multiple (2-8) SNPs. Of the SNPs 17 would result in an amino acid change in the encoded protein. Interestingly, the single isolate EI8, which has 6 SNPs, has the three base pair insertion which is not seen in any other isolate, this would result in the insertion of an Ile residue at position 62 in that protein sequence. Comparison of the relevant region in the determined sequences with the UK Streptococcus equi seM MLST database showed that Group B (15 isolates) and Group I (2 isolates), as well as the individual isolates EI3 and EI8, are unique to Ireland, and some groups are most likely of UK origin (Groups F and M), but many more probably passed back and forth between the two countries. The strains occurring in Ireland are not clonal and there is a considerable degree of sequence variation seen in the seM gene. There are two major clades causing infection in Ireland and these strains are also common in the UK.

'Galega Vulgar' - yield indices and quality of elementary olive oil

International Nuclear Information System (INIS)

Almeida, F.; Vitorino, M.C.; Henriques, L.R.; Peres, M.F.

1998-01-01

This paper shows the evolution of two olive yield indexes (humidity and fat) and three olive oil quality parameters (acidity, peroxid value and UV absorbances) for cv. Galega vulgar from the olive grove Quinta Senhora de Mercules, Castelo Branco, during the 1995/96 harvest. It shows also the evolution of fatty acid composition of the same olive oil [pt

The in-vitro evaluation of antibacterial, antifungal and cytotoxic properties of Marrubium vulgare L. essential oil grown in Tunisia

Directory of Open Access Journals (Sweden)

Mejdoub Hafedh

2011-09-01

Full Text Available Abstract Background In order to validate its antiseptic and anticancer properties with respect to traditional uses, we have screened for the first time the antimicrobial activity of aerial parts of M. vulgare L. essential oil against different pathogenic microorganisms and the cytotoxic activity against HeLa cell lines. Methods The agar disk diffusion method was used to study the antibacterial activity of M. vulgare essential oil against 12 bacterial and 4 fungi strains. The disc diameters of zone of inhibition (DD, the minimum inhibitory concentrations (MIC and the concentration inhibiting 50% (IC50 were investigated to characterize the antimicrobial activities of this essential oil. The in vitro cytotoxicity of M. vulgare essential oil was examined using a modified MTT assay; the viability and the IC50 were used to evaluate this test. Results The antimicrobial activity of the essential oil was investigated in order to evaluate its efficacy against the different tested microorganisms. The present results results showed a significant activity against microorganisms especially Gram (+ bacteria with inhibition zones and minimal inhibitory concentration values in the range of 6.6-25.2 mm and 1120-2600 μg/ml, respectively, whereas Gram (- bacteria exhibited a higher resistance. As far as the antifungal activity, among four strains tested, Botrytis cinerea exhibited the strongest activity with inhibition zones of 12.6 mm. However, Fusarium solani, Penicillium digitatum and Aspergillus niger were less sensitive to M. vulgare essential oil. About the citotoxicity assay, this finding indicate the capability of this essential oil to inhibited the proliferation of HeLa cell lines under some conditions with IC50 value of 0.258 μg/ml. Conclusion This investigation showed that the M. vulgare essential oil has a potent antimicrobial activity against some Gram (+ pathogenic bacteria and Botrytis cinerea fungi. The present studies confirm the use of this

Bibliography of Selected SCSD, URBS, SSP, SEF, and RAS Publications.

Science.gov (United States)

Stanford Univ., CA. School Planning Lab.

The annotated bibliography contains publications and report listings of the following sources--(1) School Construction Systems Development (SCSD), (2) University Residential Building Systems (URBS), (3) Florida Schoolhouse Systems Project (SSP), (4) Study of Educational Facilities (SEF), and (5) Recherches en Amenagements Scolaires (RAS) Building…

Bovine glycomacropeptide promotes the growth of Bifidobacterium longum ssp. infantis and modulates its gene expression.

Science.gov (United States)

O'Riordan, N; O'Callaghan, J; Buttò, L F; Kilcoyne, M; Joshi, L; Hickey, R M

2018-05-23

Bovine milk glycomacropeptide (GMP) is derived from κ-casein, with exclusively o-linked glycosylation. Glycomacropeptide promoted the growth of Bifidobacterium longum ssp. infantis in a concentration-dependent manner, and this activity was lost following periodate treatment of the GMP (GMP-P), which disables biological recognition of the conjugated oligosaccharides. Transcriptional analysis of B. longum ssp. infantis following exposure to GMP revealed a substantial response to GMP relative to bacteria treated with GMP-P, with a greater number of differentially expressed transcripts and larger fold changes versus the control. Therefore, stimulation of B. longum ssp. infantis growth by GMP is intrinsically linked to the peptide's O-linked glycosylation. The pool of differentially expressed transcripts included 2 glycoside hydrolase (family 25) genes, which were substantially upregulated following exposure to GMP, but not GMP-P. These GH25 genes were present in duplicated genomic islands that also contained genes encoding fibronectin type III binding domain proteins and numerous phage-related proteins, all of which were also upregulated. Homologs of this genomic arrangement were present in other Bifidobacterium species, which suggest it may be a conserved domain for the utilization of glycosylated peptides. This study provides insights into the molecular basis for the prebiotic effect of bovine milk GMP on B. longum ssp. infantis. Copyright © 2018 American Dairy Science Association. Published by Elsevier Inc. All rights reserved.

Foeniculum vulgare essential oil ameliorates acetic acid-induced colitis in rats through the inhibition of NF-kB pathway.

Science.gov (United States)

Rezayat, Seyed Mahdi; Dehpour, Ahmad-Reza; Motamed, Saeed Mohammadi; Yazdanparast, Maryam; Chamanara, Mohsen; Sahebgharani, Mousa; Rashidian, Amir

2017-10-24

The aim of the present study is to investigate the protective effects of Foeniculum vulgare essential oil on intestinal inflammation through the inhibition of NF-kB pathway in acetic acid-induced rat colitis. Acute colitis was induced by intra-rectal administration of 2 mL of diluted acetic acid (4%) solution. Two hours after the induction of colitis, 0.2% tween 80 in normal saline, dexamethasone (2 mg/kg) and F. vulgare essential oil (100, 200, 400 mg/kg) were administered to the animals by oral gavage and continued for 5 consecutive days. Assessment of macroscopic and microscopic lesions was done. MPO activity was evaluated by biochemical method. Furthermore, TNF-α activity was detected by immunohistochemistry (IHC) and the expression level of p-NF-kB p65 protein was measured by western blot analysis. Dexamethasone and F. vulgare essential oil (200, 400 mg/kg) reduced the macroscopic and microscopic lesions compared to the acetic acid group (p kB p65 protein (p kB pathway.

The effect of pre-nutrition of hydroalcoholic extractof Origanum vulgare on brain edema and neurologic deficits in a rat stroke model

Directory of Open Access Journals (Sweden)

Meysam Foroozandeh

2015-10-01

Full Text Available Background and Aim: Stroke is one of the most important factors of mortality and disability in the world. Free radicals are produced following ischemic stroke and they play a central role in breaking the blood-brain barrier and  causing brain edema formation. The aim of the current study was to evaluate the effect of hydro- alcoholic extract of Origanum vulgare on brain edema and neurologic deficit in a rat stroke model. Materials and Methods: In thisexperimental study, 35 male Wistar rats were randomly divided into 5 equal groups.  The first  two groups (control and Sham received distilled water, while three treatment groups received oral Origanum vulgare extract for 30days (50,75and 100 mg/kgdaily, respectively.  Two hours after the last dose of Origanum vulgare extract,each main group underwent  a 60 min middle cerebral artery occlusion.  Then, the assessment of blood brain edema, and neurologic deficits analysis were done . Brain edema (brain water content was analyzed by One-Way ANOVA using LSD method and neurologic deficits analysis by means of Mann-Whitney U, and P<0.05 was taken as the significant level. Results: Origanum vulgare extract reduced brain edema in the experimental groups of 50 (82.49±0.47, 75 (80.89±0.63 and 100 mg/kg/day (80.80±0.66 compared to the control group (84.46±0.67. The neurologic deficit scores in the experimental groups of 75and 100mg/kg/day, compared with control group, but neurologic deficit scores did not affect the group receiving the dose 50 mg/kg. Conclusion:  The obtained data indicate that Origanum vulgar extract via reduction of brain edema and neurologic deficits scorescan have a protective effect on the stroke model.

QTL mapping provides evidence for lack of association of the avoidance of leaf rust in Hordeum chilense with stomata density

NARCIS (Netherlands)

Vaz Patto, M.C.; Rubiales, D.; Martin, A.; Hernandez, P.; Lindhout, W.H.; Niks, R.E.; Stam, P.

2003-01-01

In cereals, rust fungi are among the most harmful pathogens. Breeders usually rely on short-lived hypersensitivity resistance. As an alternative, "avoidance" may be a more durable defence mechanism to protect plants to rust fungi. In Hordeum chilense avoidance is based on extensive wax covering of

Malt quality of 4 barley (Hordeum vulgare L.) grain varieties grown ...

African Journals Online (AJOL)

user

2011-01-31

Jan 31, 2011 ... Grain flour starch pasting and malt qualities were analyzed. .... bags and stored in a cool place (ca. ... Pasting properties of four malting barely varieties grain flour starches and the effect of three fungicide (propiconazole) spray.

Barley (Hordeum vulgare L.) cysteine proteases: heterologous expression, purification and characterization

DEFF Research Database (Denmark)

Rosenkilde, Anne Lind; Dionisio, Giuseppe; Holm, Preben Bach

2011-01-01

During germination of barley seeds, mobilization of protein is essential and cysteine proteases accounts for more than 90 % of the total proteolytic activity in the degradation of barley seed storage proteins. Cysteine proteases exist as pro-enzyme and is activated through reduction of the active...... site cysteines and by removal of the pro-domain. The complement of cysteine proteases is comprehensive and for detailed studies of the individual components of this complement, a fast and efficient eukaryotic expression platform is highly desirable. A cDNA clone of the barley key cysteine endoprotease...

Latent manganese deficiency increases transpiration in barley (Hordeum vulgare)

DEFF Research Database (Denmark)

Hebbern, Christopher Alan; Laursen, Kristian Holst; Ladegaard, Anne Hald

2009-01-01

To investigate if latent manganese (Mn) deficiency leads to increased transpiration, barley plants were grown for 10 weeks in hydroponics with daily additions of Mn in the low nM range. The Mn-starved plants did not exhibit visual leaf symptoms of Mn deficiency, but Chl a fluorescence measurements...

Frequency of Aneuploids in Progenies of Autotriploid Barley, Hordeum Vulgare L

DEFF Research Database (Denmark)

Sandfær, J.

1979-01-01

Chromosome counts of 863 progeny plants originating from 68 autotriploid barley plants revealed a considerable variation in chromosome numbers ranging from the diploid number (2n= 14) to 2n= 39. The most frequent groups were plants with 15 and 16 chromosomes each constituting about 27% of all pro...

Malt quality of 4 barley (Hordeum vulgare L.) grain varieties grown ...

African Journals Online (AJOL)

user

2011-01-31

Jan 31, 2011 ... 76.6 to 79.7%). The varieties had a pasting- time and -temperature (Ti) of 4.7 to 5.0 min and 64.7 to .... 16°C) (Termaks chamber KBP 6395F, Bergen, Norway). Each .... varieties in the peak viscosity is in part attributed to the.

Characterization of Gene Candidates for Vacuolar Sodium Transport from Hordeum Vulgare

KAUST Repository

Scheu, Arne Hagen August

2017-01-01

Various potential causes are discussed, including inaccuracies in the genome resource used as reference for primer design and issues inherent to the model system. Finally, I make suggestions on how to proceed to further characterize the candidate genes and hopefully identify novel sodium transporters from barley.

Phosphorus acquisition by barley (Hordeum vulgare L. at suboptimal soil temperature

Directory of Open Access Journals (Sweden)

Kari Ylivainio

2012-12-01

Full Text Available We studied the effects of soil temperature (8 ºC and 15 ºC on barley growth, barley phosphorus (P uptake and soil P solubility. Barley was grown in a pot experiment in two soils with different P fertilization histories for 22 years. The availability of P was estimated by using 33P-labeled fertilizer and calculating L-values. After cultivation for 22 years at ambient soil temperature without P fertilization (-P, soil L-value had decreased compared to soil that received annual P fertilization (P+. Low soil temperature further reduced the L-values, more in the -P soil than in the +P soil. Our results demonstrated that P fertilization can only partially ameliorate poor growth at low soil temperatures. Thus, applying ample fertilization to compensate for poor growth at low soil temperatures would increase the P content and solubility in the soil, but plant uptake would remain inhibited by cold.

Malt quality of 4 barley ( Hordeum vulgare L.) grain varieties grown ...

African Journals Online (AJOL)

propiconazole) spray intervals (7, 14, 21 day) and no spray control were arranged in a RCBD in 4 replications to assess net blotch (Pyrenophora teres) effect on malt quality. The varieties were grown at Holetta agricultural research center in 2005, ...

BIOCHEMICAL COMPOSITION AND NUTRITIONAL EVALUATION OF BARLEY RIHANE (HORDEUM VULGARE L.).

Science.gov (United States)

Lahouar, Lamia; Ghrairi, Fatma; El Arem, Amira; Medimagh, Sana; El Felah, Mouledi; Salem, Hichem Ben; Achour, Lotfi

2017-01-01

Many experimental studies have suggested an important role for barley Rihane(BR)in the prevention of colon cancer and cardiovascular diseases. The objective of this study was to evaluate the physico-chemical properties and nutritional characterizations of BR compared to other varieties grown in Tunisia (Manel, Roho and Tej). Total, insoluble and soluble dietary fiber(β-glucan), total protein, ash and some minerals of BR and Tunisian barley varieties were determined. The results revealed that BR is good source of dietary fiber mainly β-glucan compared to the other varieties. This variety is a relatively rich source of phosphorous and potassium and it contains many important unsaturated fatty acids. BR has higher nutritional value than other varieties. Barley Rihane has significant nutritional characterizations compared to others Tunisian barleys varieties. Abbreviations: BR, Barley Rihane; LDL, low density lipoprotein; HDL, high density lipoprotein; AOM, azoxymethane; TBV, Tunisian barley varieties; TGW, thousand grain weight; SW, weight specific; TDF, total dietary fiber; IDF, insoluble dietary fiber; SDF, soluble dietary fiber; DM, Dry Matter.

Growth and yield of barley (Hordeum vulgare L.) as affected by ...

African Journals Online (AJOL)

Bheema

(2003) reported that about 65% of grain yield variability in barley was attributed to ... of those of the respective non-stressed environments (Cantero-Martínez et ... production stability of barley (Fekadu and Skjelvåg, 2002) and nitrogen and phosphorus are .... of SAS version 9.1 for analysis of variance of non-orthogonal data.

A putative serine protease, SpSsp1, from Saprolegnia parasitica is recognised by sera of rainbow trout, Oncorhynchus mykiss

Science.gov (United States)

Minor, Kirsty L.; Anderson, Victoria L.; Davis, Katie S.; Van Den Berg, Albert H.; Christie, James S.; Löbach, Lars; Faruk, Ali Reza; Wawra, Stephan; Secombes, Chris J.; Van West, Pieter

2014-01-01

Saprolegniosis, the disease caused by Saprolegnia sp., results in considerable economic losses in aquaculture. Current control methods are inadequate, as they are either largely ineffective or present environmental and fish health concerns. Vaccination of fish presents an attractive alternative to these control methods. Therefore we set out to identify suitable antigens that could help generate a fish vaccine against Saprolegnia parasitica. Unexpectedly, antibodies against S. parasitica were found in serum from healthy rainbow trout, Oncorhynchus mykiss. The antibodies detected a single band in secreted proteins that were run on a one-dimensional SDS-polyacrylamide gel, which corresponded to two protein spots on a two-dimensional gel. The proteins were analysed by liquid chromatography tandem mass spectrometry. Mascot and bioinformatic analysis resulted in the identification of a single secreted protein, SpSsp1, of 481 amino acid residues, containing a subtilisin domain. Expression analysis demonstrated that SpSsp1 is highly expressed in all tested mycelial stages of S. parasitica. Investigation of other non-infected trout from several fish farms in the United Kingdom showed similar activity in their sera towards SpSsp1. Several fish that had no visible saprolegniosis showed an antibody response towards SpSsp1 suggesting that SpSsp1 might be a useful candidate for future vaccination trial experiments. PMID:25088077

In silico characterization of boron transporter (BOR1 protein sequences in Poaceae species

Directory of Open Access Journals (Sweden)

Ertuğrul Filiz

2013-01-01

Full Text Available Boron (B is essential for the plant growth and development, and its primary function is connected with formation of the cell wall. Moreover, boron toxicity is a shared problem in semiarid and arid regions. In this study, boron transporter protein (BOR1 sequences from some Poaceae species (Hordeum vulgare subsp. vulgare, Zea mays, Brachypodium distachyon, Oryza sativa subsp. japonica, Oryza sativa subsp. indica, Sorghum bicolor, Triticum aestivum were evaluated by bioinformatics tools. Physicochemical analyses revealed that most of BOR1 proteins were basic character and had generally aliphatic amino acids. Analysis of the domains showed that transmembrane domains were identified constantly and three motifs were detected with 50 amino acids length. Also, the motif SPNPWEPGSYDHWTVAKDMFNVPPAYIFGAFIPATMVAGLYYFDHSVASQ was found most frequently with 25 repeats. The phylogenetic tree showed divergence into two main clusters. B. distachyon species were clustered separately. Finally, this study contributes to the new BOR1 protein characterization in grasses and create scientific base for in silico analysis in future.

Sensibilidade de bactérias deteriorantes e patogênicas de interesse em alimentos ao óleo essencial de Origanum vulgare L. (Lamiaceae)

OpenAIRE

Souza, Evandro Leite de; Stamford, Tânia Lúcia Montenegro; Lima, Edeltrudes de Oliveira

2006-01-01

Origanum vulgare L. (oregano), Lamiaceae, has been known as plant specie with prominent biological properties for a long time. This study aimed to evaluate the antibacterial activity of Origanum vulgare essential oil on various Gram-positive and Gram-negative spoiling and/or pathogen food-related bacteria, as well as to observe its antimicrobial effectiveness in a food conservation micromodel. The results showed a strong antibacterial activity of the assayed essential oil noted by large growt...

RNA-seq Analysis of Cold and Drought Responsive Transcriptomes of Zea mays ssp. mexicana L.

OpenAIRE

Lu, Xiang; Zhou, Xuan; Cao, Yu; Zhou, Meixue; McNeil, David; Liang, Shan; Yang, Chengwei

2017-01-01

The annual Zea mays ssp. mexicana L. is a member of teosinte, a wild relative of the Zea mays spp. mays L. This subspecies has strong growth and regeneration ability, high tiller numbers, high protein and lysine content as well as resistance to many fungal diseases, and it can be effectively used in maize improvement. In this study, we reported a Zea mays ssp. mexicana L. transcriptome by merging data from untreated control (CK), cold (4?C) and drought (PEG2000, 20%) treated plant samples. A ...

Chemical composition and bioactivity of different oregano (Origanum vulgare) extracts and essential oil.

Science.gov (United States)

Teixeira, Bárbara; Marques, António; Ramos, Cristina; Serrano, Carmo; Matos, Olívia; Neng, Nuno R; Nogueira, José M F; Saraiva, Jorge Alexandre; Nunes, Maria Leonor

2013-08-30

There is a growing interest in industry to replace synthetic chemicals by natural products with bioactive properties. Aromatic plants are excellent sources of bioactive compounds that can be extracted using several processes. As far as oregano is concerned, studies are lacking addressing the effect of extraction processes in bioactivity of extracts. This study aimed to characterise the in vitro antioxidant and antibacterial properties of oregano (Origanum vulgare) essential oil and extracts (in hot and cold water, and ethanol), and the chemical composition of its essential oil. The major components of oregano essential oil were carvacrol, β-fenchyl alcohol, thymol, and γ-terpinene. Hot water extract had the strongest antioxidant properties and the highest phenolic content. All extracts were ineffective in inhibiting the growth of the seven tested bacteria. In contrast, the essential oil inhibited the growth of all bacteria, causing greater reductions on both Listeria strains (L. monocytogenes and L. innocua). O. vulgare extracts and essential oil from Portuguese origin are strong candidates to replace synthetic chemicals used by the industry. © 2013 Society of Chemical Industry.

Brain SPECT analysis by 3D-SSP and clinical features of Parkinson's disease

International Nuclear Information System (INIS)

Mito, Yasunori; Yoshida, Kazuto; Makino, Kenichi; Yabe, Ichiro; Kikuchi, Seiji; Sasaki, Hidenao; Tashiro, Kunio

2006-01-01

The aim of the present study is to investigate the association of symptoms in Parkinson's disease (PD) with cerebral perfusion on single photon emission computed tomography (SPECT). The clinical features of PD were compared with SPECT images of the brain obtained by three-dimensional stereotactic surface projection (3D-SSP) analysis. Thirty-eight patients who had PD without dementia (17 men and 21 women with a mean age of 68.6±4.7 years) were enrolled in this study. Their symptoms were rated using the unified parkinson's disease rating scale (UPDRS). Within a week, all patients were examined by SPECT with I-123, and reconstructed images were analyzed with 3D-SSP using an image-analysis software, iSSP ver. 3.5. Data on brain surface perfusion extracted by 3D-SSP analysis were compared between the PD patients and the normal control group. The same comparisons were made for subgroups of PD patients with severe symptoms, such as tremor, gait disturbance, bradykinesia, and the UPDRS motor score. Cerebral perfusion was decreased at the anterior cingulate cortex and occipital lobe of the PD patients compared with the normal controls. In the subgroups with severe gait disturbance and severe bradykinesia, additional hypoperfusion was seen at the lateral frontal association and lateral temporal association and the medial frontal gyrus, and by the pixel-by-pixel comparison, perfusion was significantly decreased (p<0.05) at the medial frontal gyrus and anterior cingulate cortex compared with the normal control group. In PD patients, severe gait disturbance and bradykinesia may be correlated with hypoperfusion of the medial aspect of the frontal lobe. This suggests that functional disturbance of the supplementary motor area and other parts of the frontal lobe are involved in the development of gait disturbance and bradykinesia in PD. (author)

The Non-universality of the Low-mass End of the IMF is Robust against the Choice of SSP Model

NARCIS (Netherlands)

Spiniello, C.; Trager, S. C.; Koopmans, L. V. E.

We perform a direct comparison of two state-of-the art single stellar population (SSP) models that have been used to demonstrate the non-universality of the low-mass end of the initial mass function (IMF) slope. The two public versions of the SSP models are restricted to either solar abundance

Effects of Gentiana lutea ssp. symphyandra on the central nervous system in mice.

Science.gov (United States)

Oztürk, Nilgün; Başer, K Hüsnü Can; Aydin, Süleyman; Oztürk, Yusuf; Caliş, Ihsan

2002-11-01

A methanolic extact of Gentiana lutea ssp. symphyandra roots has been investigated for its possible effects on the central nervous system of mice. At doses of 250 and 500 mg/kg (i.p.), the methanol extract of Gentiana roots caused a significant increase in the swimming endurance test and exhibited slight analgesic activity, but no lethality in mice suggesting some activity on the central nervous system. However, there was no indication of sedation or muscular fatigue at the doses employed. HPLC analysis showed that three secoiridoid compounds, gentiopicroside, swertiamarine and sweroside were present and may have been responsible for the CNS effects of the methanol extract of Gentiana lutea ssp. symphyandra roots. Copyright 2002 John Wiley & Sons, Ltd.

PENGEMBANGAN SUBJECT SPECIFIC PEDAGOGY (SSP IPA TERPADU UNTUK MENINGKATKAN HASIL BELAJAR SISWA

Directory of Open Access Journals (Sweden)

Fitri Yuliawati

2016-05-01

Full Text Available Background of this research is the analysis of the results of interviews some junior secondary schools in Yogyakarta and the conclusion that teachers do not use an integrated science teaching and teachers still find difficulties in the application of learning science in an integrated manner. It can be influenced by several factors, such as the lack of reference used by teachers in presenting the material Integrated Science relevantly, most of science teachers are from educational background of chemistry, physics, and biology instead of science education, so that teachers find difficulties to create an integrated learning of science. In addition, teachers feel difficulty in determining the depth of the material, limits of integration in integrated science teaching, and did not know the concept of integrated science teaching. This research is a development research. Learning tools developed included : student books, lesson plans, student activity sheets and evaluation tools. The development of the learning which is done in this study use the models of 4D development which includes the step of Define (definition which at this stage conducted a needs analysis. Design : it is the stage of Subject Specific Pedagogy (SSP software design. Development, it is the stage of development after the draft was made followed by a learning device validation by experts. This stage is also conducted to seek input from all the responses, reactions and comments from teachers, students, and observers so that it can be used for further improvement of science teaching later. The Disseminate, it is the stage of field tests are widely but not done. Data collection instruments used in this study include : test items and questionnaire. The conclusion of this development research are as follows : the results of the validation SSP integrated science by learning tools expert, material experts and media experts indicate the category of Very Good (SB so that SSP integrated

Mercury in mercury(II)-spiked soils is highly susceptible to plant bioaccumulation.

Science.gov (United States)

Hlodák, Michal; Urík, Martin; Matúš, Peter; Kořenková, Lucia

2016-01-01

Heavy metal phytotoxicity assessments usually use soluble metal compounds in spiked soils to evaluate metal bioaccumulation, growth inhibition and adverse effects on physiological parameters. However, exampling mercury phytotoxicity for barley (Hordeum vulgare) this paper highlights unsuitability of this experimental approach. Mercury(II) in spiked soils is extremely bioavailable, and there experimentally determined bioaccumulation is significantly higher compared to reported mercury bioaccumulation efficiency from soils collected from mercury-polluted areas. Our results indicate this is not affected by soil sorption capacity, thus soil ageing and formation of more stable mercuric complexes with soil fractions is necessary for reasonable metal phytotoxicity assessments.

Does heavy traffic have long term implications for crop yields?

DEFF Research Database (Denmark)

Nielsen, J. Aa.; Munkholm, Lars Juhl; Schjønning, Per

Danish soils are subject to increasingly heavier traffic. Today, wheel loads of 6-12 tons are common on e.g. slurry tankers, combines and sugar beet harvesters. Field trials were started in Denmark in spring 2010 to answer the question: "does heavy traffic have long term implications for crop...... by the contractors delivering the machinery for the experimentation. Each year, spring barley (Hordeum vulgare L.) was established after the compaction treatments. s.ince 2013, investigations on biological tillage (root growth by pioneering crops) have been added to the trials. Significant yield losses up to 12.5 dt...

Interference of heating on the antimicrobial activity and chemical composition of Origanum vulgare L. (Lamiaceae essential oil Interferência do aquecimento sobre a atividade antimicrobiana e composição química do óleo essencial de Origanum vulgare L. (Lamiaceae

Directory of Open Access Journals (Sweden)

Evandro Leite de Souza

2008-06-01

Full Text Available Origanum vulgare L. (oregano, Lamiaceae, essential oil has a variety of biological properties and its antimicrobial activity has received a renewed interest for use in food conservation. The aim of this study was to evaluate the interference of heating on the antimicrobial activity and chemical composition of O. vulgare essential oil. The antimicrobial activity of the essential oil kept at room temperature and exposed to different heating temperatures (60, 80, 100 and 120 °C during 1 hour was evaluated by observing antimicrobial effectiveness at absolute concentration and determining MIC values by the solid medium diffusion procedure. The essential oil chemical composition analysis was performed by GC-MS. O. vulgare essential oil showed interesting antimicrobial activity on all assayed microbial strains (Candida albicans, C.krusei, C. tropicalis, Bacillus cereus, Escherichia coli, Staphylococcus aureus, Yersinia enterocolitica, Salmonella enterica, Serratia marcencens, noted by large growth inhibition zones (30-42 mm. Heating treatment showed no significant interference (p O óleo essencial de Origanum vulgare L. Lamiaceae (orégano apresenta variadas propriedades biológicas, de modo que seu potencial antimicrobiano tem despertado interesse para uso na conservação de alimentos. Este estudo objetivou avaliar a interferência de diferentes tratamentos térmicos (60, 80, 100 e 120 °C/1 hora sobre a efetividade antimicrobiana e composição química do óleo essencial de O. vulgare. A efetividade antimicrobiana do óleo essencial exposto aos diferentes tratamentos térmicos foi avaliada através da observação de sua atividade antimicrobiana em concentração absoluta e através da determinação da sua CIM utilizando-se a técnica de difusão em meio sólido. O estudo da composição do óleo essencial foi realizado através de GC-MS. O óleo essencial apresentou intensa atividade antimicrobiana sobre todas as amostras microbianas ensaiadas

Consumption of Dairy Yogurt Containing Lactobacillus paracasei ssp. paracasei, Bifidobacterium animalis ssp. lactis and Heat-Treated Lactobacillus plantarum Improves Immune Function Including Natural Killer Cell Activity

Science.gov (United States)

Lee, Ayoung; Lee, Young Ju; Yoo, Hye Jin; Kim, Minkyung; Chang, Yeeun; Lee, Dong Seog; Lee, Jong Ho

2017-01-01

The aim of this study was to investigate the impact of consuming dairy yogurt containing Lactobacillus paracasei ssp. paracasei (L. paracasei), Bifidobacterium animalis ssp. lactis (B. lactis) and heat-treated Lactobacillus plantarum (L. plantarum) on immune function. A randomized, open-label, placebo-controlled study was conducted on 200 nondiabetic subjects. Over a twelve-week period, the test group consumed dairy yogurt containing probiotics each day, whereas the placebo group consumed milk. Natural killer (NK) cell activity, interleukin (IL)-12 and immunoglobulin (Ig) G1 levels were significantly increased in the test group at twelve weeks compared to baseline. Additionally, the test group had significantly greater increases in serum NK cell activity and interferon (IFN)-γ and IgG1 than placebo group. Daily consumption of dairy yogurt containing L. paracasei, B. lactis and heat-treated L. plantarum could be an effective option to improve immune function by enhancing NK cell function and IFN-γ concentration (ClinicalTrials.gov: NCT03051425). PMID:28561762

Consumption of Dairy Yogurt Containing Lactobacillus paracasei ssp. paracasei, Bifidobacterium animalis ssp. lactis and Heat-Treated Lactobacillus plantarum Improves Immune Function Including Natural Killer Cell Activity

Directory of Open Access Journals (Sweden)

Ayoung Lee

2017-05-01

Full Text Available The aim of this study was to investigate the impact of consuming dairy yogurt containing Lactobacillus paracasei ssp. paracasei (L. paracasei, Bifidobacterium animalis ssp. lactis (B. lactis and heat-treated Lactobacillus plantarum (L. plantarum on immune function. A randomized, open-label, placebo-controlled study was conducted on 200 nondiabetic subjects. Over a twelve-week period, the test group consumed dairy yogurt containing probiotics each day, whereas the placebo group consumed milk. Natural killer (NK cell activity, interleukin (IL-12 and immunoglobulin (Ig G1 levels were significantly increased in the test group at twelve weeks compared to baseline. Additionally, the test group had significantly greater increases in serum NK cell activity and interferon (IFN-γ and IgG1 than placebo group. Daily consumption of dairy yogurt containing L. paracasei, B. lactis and heat-treated L. plantarum could be an effective option to improve immune function by enhancing NK cell function and IFN-γ concentration (ClinicalTrials.gov: NCT03051425.

Consumption of Dairy Yogurt Containing Lactobacillus paracasei ssp. paracasei, Bifidobacterium animalis ssp. lactis and Heat-Treated Lactobacillus plantarum Improves Immune Function Including Natural Killer Cell Activity.

Science.gov (United States)

Lee, Ayoung; Lee, Young Ju; Yoo, Hye Jin; Kim, Minkyung; Chang, Yeeun; Lee, Dong Seog; Lee, Jong Ho

2017-05-31

The aim of this study was to investigate the impact of consuming dairy yogurt containing Lactobacillus paracasei ssp. paracasei ( L. paracasei ), Bifidobacterium animalis ssp. lactis ( B. lactis ) and heat-treated Lactobacillus plantarum ( L. plantarum ) on immune function. A randomized, open-label, placebo-controlled study was conducted on 200 nondiabetic subjects. Over a twelve-week period, the test group consumed dairy yogurt containing probiotics each day, whereas the placebo group consumed milk. Natural killer (NK) cell activity, interleukin (IL)-12 and immunoglobulin (Ig) G1 levels were significantly increased in the test group at twelve weeks compared to baseline. Additionally, the test group had significantly greater increases in serum NK cell activity and interferon (IFN)-γ and IgG1 than placebo group. Daily consumption of dairy yogurt containing L. paracasei , B. lactis and heat-treated L. plantarum could be an effective option to improve immune function by enhancing NK cell function and IFN-γ concentration (ClinicalTrials.gov: NCT03051425).

Over-expression of miR158 causes pollen abortion in Brassica campestris ssp. chinensis.

Science.gov (United States)

Ma, Zhiming; Jiang, Jianxia; Hu, Ziwei; Lyu, Tianqi; Yang, Yang; Jiang, Jingjing; Cao, Jiashu

2017-02-01

We identified and cloned the two precursors of miR158 and its target gene in Brassica campestris ssp. chinensis, which both had high relative expression in the inflorescences. Further study revealed that over-expression of miR158 caused reduced pollen varbility, which was caused by the degradation of pollen contents from the binucleate microspore stage. These results first suggest the role of miR158 in pollen development of Brassica campestris ssp. chinensis. MicroRNAs (miRNAs) play crucial roles in many important growth and development processes both in plants and animals by regulating the expression of their target genes via mRNA cleavage or translational repression. In this study, miR158, a Brassicaceae specific miRNA, was functionally characterized with regard to its role in pollen development of non-heading Chinese cabbage (Brassica campestris ssp. chinensis). Two family members of miR158 in B. campestris, namely bra-miR158a1 and bra-miR158a2, and their target gene bra027656, which encodes a pentatricopeptide repeat (PPR) containing protein, were identified. Then, qRT-PCR analysis and GUS-reporter system revealed that both bra-miR158 and its target gene had relatively high expression levels in the inflorescences. Further study revealed that over-expression of miR158 caused reduced pollen varbility and pollen germination ratio, and the degradation of pollen contents from the binucleate microspore stage was also found in those deformed pollen grains, which led to pollen shrinking and collapse in later pollen development stage. These results first shed light on the importance of miR158 in pollen development of Brassica campestris ssp. chinensis.

Intrascrotal Abscess, Propionibacterium acnes and Staphylococcus cohnii ssp. cohnii: A Case Report and Review of the Literature.

Science.gov (United States)

Stefano, Masciovecchio; Del Rosso, Alessandro; Saldutto, Pietro; Paradiso Galatioto, Giuseppe; Vicentini, Carlo

2012-01-01

Introduction. The Propionibacterium acnes and the Staphylococcus cohnii ssp. cohnii are occasional pathogenic bacteria. The intrascrotal localization of the Propionibacterium acnes is exceptional. The Staphylococcus cohnii ssp. cohnii is not able to colonize the urogenital apparatus but it is the most frequently responsible for blood culture contamination even if it can sustain, in particular conditions, systemic infections. Case Presentation. We report the case of a 72-year-old man who is under observation for pain and swelling of the left hemiscrotum associated to high fever. The scrotal ultrasound shows the presence of a left intra-scrotal abscess with didymus, epididymis, and intact didymus-epididymis tunicae. The blood culture executed for evening fever during antibiotic therapy has underlined an infection with Propionibacterium acnes. A following blood culture has shown an increase in Staphylococcus cohnii ssp. cohnii. Due to fever the patient has undergone left orchifunicolectomy with inguino-scrotal toilet. The anatomical pathological examination has also shown the presence of nonspecific granulomatous inflammation compatible with Propionibacterium acnes infection. Conclusion. The onset of an intrascrotal abscess likely sustained by Propionibacterium acnes complicated by a possible systemic Staphylococcus cohnii ssp. cohnii suprainfection is an exceptional event that, in our case, has been resolved with surgical toilet.

Intrascrotal Abscess, Propionibacterium acnes and Staphylococcus cohnii ssp. cohnii: A Case Report and Review of the Literature

Directory of Open Access Journals (Sweden)

Masciovecchio Stefano

2012-01-01

Full Text Available Introduction. The Propionibacterium acnes and the Staphylococcus cohnii ssp. cohnii are occasional pathogenic bacteria. The intrascrotal localization of the Propionibacterium acnes is exceptional. The Staphylococcus cohnii ssp. cohnii is not able to colonize the urogenital apparatus but it is the most frequently responsible for blood culture contamination even if it can sustain, in particular conditions, systemic infections. Case Presentation. We report the case of a 72-year-old man who is under observation for pain and swelling of the left hemiscrotum associated to high fever. The scrotal ultrasound shows the presence of a left intra-scrotal abscess with didymus, epididymis, and intact didymus-epididymis tunicae. The blood culture executed for evening fever during antibiotic therapy has underlined an infection with Propionibacterium acnes. A following blood culture has shown an increase in Staphylococcus cohnii ssp. cohnii. Due to fever the patient has undergone left orchifunicolectomy with inguino-scrotal toilet. The anatomical pathological examination has also shown the presence of nonspecific granulomatous inflammation compatible with Propionibacterium acnes infection. Conclusion. The onset of an intrascrotal abscess likely sustained by Propionibacterium acnes complicated by a possible systemic Staphylococcus cohnii ssp. cohnii suprainfection is an exceptional event that, in our case, has been resolved with surgical toilet.

Effect of lixiviated sediments affected with treated water on Selenastrum capricornutum, Printz and Origanum vulgare L.

Science.gov (United States)

Ramos, Guadalupe E; Lopez, Martin H; Flores, Antonio M; Figueroa, Guadalupe T; De Leon, Fernando G

2010-01-01

Xochimilco is an area of Mexico City fulfilling important ecological functions. However, the water of the canal network in the lacustrine zone of Xochimilco is supplied by the water treatment plants of the city, implying a risk of accumulated contaminants in the sediments. This study reports the effect of lixiviates obtained from sediments collected in the canals of Xochimilco on the growth of the alga Selenastrum capricornutum and the angiosperm Origanum vulgare. Three factors were tested: (a) water source in terms of the effluent from the two water treatment plants (urban waste-water, located at Cerro de la Estrella (CE) and urban-rural waters at San Luis Tlaxialtemalco (SLT); (b) sampling season (January, dry season; May and September, rainy season; and (c) distances from the water discharge point in the Xochimilco's main canal (5200 and 1000 m for CE, and 0, 200 m for SLT). The chemical water properties analyzed were: pH, electrical conductivity, N-NO(3), N-NH(3), N(Total), P-PO(4) and P(Total). The alga was more sensitive to the contaminants than O. vulgare, showing growth inhibition of 93-100%. The effect of sampling season on the inhibition of algal growth was ordered as follows: September > May > January. Lixiviates obtained from sediment samples 200 and 1000 m from the main point of water discharge caused a higher algal growth inhibition than the samples obtained at the source point. Lixiviate promoted the growth of seedlings of O. vulgare.

Using elevated CO2 to increase the biomass of a Sorghum vulgare x Sorghum vulgare var. sudanense hybrid and Trifolium pratense L. and to trigger hyperaccumulation of cesium

International Nuclear Information System (INIS)

Wu Huibin; Tang Shirong; Zhang Ximei; Guo Junkang; Song, Zhengguo; Tian Shuai; Smith, Donald L.

2009-01-01

The most important challenge to use phytoremediation is how to improve its efficiency by increasing the accumulation of metals in plants, or by improving key plant biological traits that should enhance metal uptake. In this paper, we used open-top chambers to investigate the effects of elevated CO 2 (860 μL L -1 ) on biomass and Cs uptake by a Sorghum vulgare x Sorghum vulgare var. sudanense hybrid and Trifolium pratense L. growing on soils spiked with various levels of cesium (0, 300, 1500 and 3000 mg Cs kg -1 ). The results showed that elevated CO 2 not only increased aboveground biomass of the Sorghum and Trifolium species by 32-111%, and by 8-11%, respectively, compared to the ambient CO 2 treatment, but also caused more accumulation of Cs by Sorghum species (up to 73%) than Trifolium species (up to 43%). It was speculated that the increase in biomass and the improvement in Cs accumulation ability at elevated CO 2 could be related to lowered soil pH values, and changes in number and kind of microorganisms in the rhizospheres of the two tested species. This is the first report of a link among elevated CO 2 , increased biomass and hyperaccumulation of Cs by Sorghum and Trifolium species.

Species-Level Phylogeny and Polyploid Relationships in Hordeum (Poaceae) Inferred by Next-Generation Sequencing and In Silico Cloning of Multiple Nuclear Loci.

Science.gov (United States)

Brassac, Jonathan; Blattner, Frank R

2015-09-01

Polyploidization is an important speciation mechanism in the barley genus Hordeum. To analyze evolutionary changes after allopolyploidization, knowledge of parental relationships is essential. One chloroplast and 12 nuclear single-copy loci were amplified by polymerase chain reaction (PCR) in all Hordeum plus six out-group species. Amplicons from each of 96 individuals were pooled, sheared, labeled with individual-specific barcodes and sequenced in a single run on a 454 platform. Reference sequences were obtained by cloning and Sanger sequencing of all loci for nine supplementary individuals. The 454 reads were assembled into contigs representing the 13 loci and, for polyploids, also homoeologues. Phylogenetic analyses were conducted for all loci separately and for a concatenated data matrix of all loci. For diploid taxa, a Bayesian concordance analysis and a coalescent-based dated species tree was inferred from all gene trees. Chloroplast matK was used to determine the maternal parent in allopolyploid taxa. The relative performance of different multilocus analyses in the presence of incomplete lineage sorting and hybridization was also assessed. The resulting multilocus phylogeny reveals for the first time species phylogeny and progenitor-derivative relationships of all di- and polyploid Hordeum taxa within a single analysis. Our study proves that it is possible to obtain a multilocus species-level phylogeny for di- and polyploid taxa by combining PCR with next-generation sequencing, without cloning and without creating a heavy load of sequence data. © The Author(s) 2015. Published by Oxford University Press, on behalf of the Society of Systematic Biologists.

Environmental Restoration and Waste Management Site-Specific Plan (SSP) for fiscal year 1992 (FY92)

International Nuclear Information System (INIS)

1991-09-01

The FY-92 Site-Specific Plan (FY-92 SSP) for environmental restoration and waste management at the Idaho National Engineering Laboratory (INEL) is designed to provide the reader with easy access to the status of environmental restoration and waste management activities at INEL. The first chapter provides background on INIEL's physical environment, site history and mission, and general information about the site and its facilities. In addition, this chapter discusses the inter-relationships between the Site Specific Plan, the Environmental Restoration and Waste Management Five-Year Plan, the environmental restoration and waste management prioritization systems, and the Activity Data Sheets (ADSs) for environmental restoration and waste management. This discussion should help readers understand what the SSP is and how it fits into the environmental restoration and waste management process at INEL. This understanding should provide the reader with a better context for understanding the discussions in the SSP as well as a better feel for how and what to comment on during the public comment period that will be held from the first of September through the end of October 1991

Intrascrotal Abscess, Propionibacterium acnes and Staphylococcus cohnii ssp. cohnii: A Case Report and Review of the Literature

OpenAIRE

Stefano, Masciovecchio; Del Rosso, Alessandro; Saldutto, Pietro; Paradiso Galatioto, Giuseppe; Vicentini, Carlo

2012-01-01

Introduction. The Propionibacterium acnes and the Staphylococcus cohnii ssp. cohnii are occasional pathogenic bacteria. The intrascrotal localization of the Propionibacterium acnes is exceptional. The Staphylococcus cohnii ssp. cohnii is not able to colonize the urogenital apparatus but it is the most frequently responsible for blood culture contamination even if it can sustain, in particular conditions, systemic infections. Case Presentation. We report the case of a 72-year-old man who is un...

Formulaciones con combinación de ingredientes activos para el control de Armadillidium vulgare (Crustacea: Isopoda, plaga en el cultivo de colza

Directory of Open Access Journals (Sweden)

LÓPEZ, A.N.

2012-04-01

Full Text Available ResumenLa colza (Brassica napus, B. campestris en siembra directa (SD representa una alternativa en los sistemas de rotación actuales. Armadillidium vulgare es una de las plagas principales de los cultivos en SD. El objetivo de este trabajo fue evaluar cebos de acción combinada como estrategia alternativa de control de dicha especie.Se realizaron ensayos de laboratorio y de campo con los siguientes tratamientos: testigo sin tratamiento químico; testigo químico (4 kg/ha de Carbaryl 8%, MataBiBos Acay; 3, 4 y 5 kg/ha de cebo de acción combinada (Carbaryl 8% + Metaldehído 4%, Dual Acay. Se evaluó el número de individuos de A. vulgare muertos, de plantas dañadas y de plantas sanas. En el laboratorio, a los 2, 3, 7 y 9 días después de la aplicación de los cebos, los tratamientos químicos se diferenciaron del testigo y no mostraron diferencias significativas entre ellos. Los tratamientos con aplicaciones de cebos presentaron un número de plantas sanas y totales mayorcon respecto al testigo. En el campo, se detectaron diferencias en el número de individuos muertos entre los tratamientos químicos y el testigo. No se observaron diferencias en la proporción de individuos muertos ni de plantas dañadas entre los tratamiento químicos, sí respecto al testigo. La presencia del molusquicida en el cebo de acción combinada no interfirió en el control de A. vulgare. Se concluye que el cebo de acción combinada representa una alternativa de control de A. vulgare eficaz, que permite la protección del cultivo de colza. AbstractOilseed rape (Brassica napus, B. campestris under No-Tillage (NT represents an alternative in the current crop rotation systems. Armadillidium vulgare is a principal pest in crops under NT. The aim of this study was to evaluate combined action baits as alternative strategy in the control of that species. Laboratory and fields traits were carried out with five treatments: control treatment without chemicals, positive

Identification of small secreted peptides (SSPs) in maize and expression analysis of partial SSP genes in reproductive tissues.

Science.gov (United States)

Li, Ye Long; Dai, Xin Ren; Yue, Xun; Gao, Xin-Qi; Zhang, Xian Sheng

2014-10-01

Maize 1,491 small secreted peptides were identified, which were classified according to the character of peptide sequences. Partial SSP gene expressions in reproductive tissues were determined by qRT-PCR. Small secreted peptides (SSPs) are important cell-cell communication messengers in plants. Most information on plant SSPs come from Arabidopsis thaliana and Oryza sativa, while little is known about the SSPs of other grass species such as maize (Zea mays). In this study, we identified 1,491 SSP genes from maize genomic sequences. These putative SSP genes were distributed throughout the ten maize chromosomes. Among them, 611 SSPs were classified into 198 superfamilies according to their conserved domains, and 725 SSPs with four or more cysteines at their C-termini shared similar cysteine arrangements with their counterparts in other plant species. Moreover, the SSPs requiring post-translational modification, as well as defensin-like (DEFL) proteins, were identified. Further, the expression levels of 110 SSP genes were analyzed in reproductive tissues, including male flower, pollen, silk, and ovary. Most of the genes encoding basal-layer antifungal peptide-like, small coat proteins-like, thioredoxin-like proteins, γ-thionins-like, and DEFL proteins showed high expression levels in the ovary and male flower compared with their levels in silk and mature pollen. The rapid alkalinization factor-like genes were highly expressed only in the mature ovary and mature pollen, and pollen Ole e 1-like genes showed low expression in silk. The results of this study provide basic information for further analysis of SSP functions in the reproductive process of maize.

Composición química y efecto antibacteriano in vitro de extractos de larrea tridentata, origanum vulgare, artemisa ludoviciana y ruta graveolens

Directory of Open Access Journals (Sweden)

Lucía Delgadillo Ruíz

2017-01-01

Full Text Available Introducción . Los extractos de algunas plantas han demostrado tener propiedades antimicr o bianas relacionadas a ciertos compuestos químicos como son el timol, carvacrol, limoneno, linalol y terpineno. El objetivo del presente trabajo fue determinar la concentración de estos compue s tos en los extractos de Larrea tridentata , Origanum vulgare , Artemisa ludoviciana y Ruta graveolens ; así como evaluar su efecto antimicrobiano en Escherichia coli , Acinetoba c ter baumanii , Pseudomona sp y Staphyloc o ccus aureus . Método . Los extractos se obtuvieron por destilación simple empleando alcohol etílico como solvente, la composición química se evaluó mediante cromatografía de gases. La actividad antimicrobia na de cada uno de los extractos de plantas se realizó por los métodos difusión en pozo y difusión en disco. Resultados . Las bacterias mostraron diferentes grados de sensibilidad a los extractos, prese n tando inhibición de crecimiento S. aureus con el extra cto de O. vulgare y R. graveolens , mientras que la bacteria Pseudomona sp. , con los extracto s de A. ludoviciana, L. tridentata y O. vulgare . Discusión . La mayor concentración de timol y carvacrol se encontró en los extractos de O. vulgare y L. tridentata . El compuesto linalol se encontró en una proporción mayor en O. vulgare y en menor proporción en A. ludoviciana . Limoneno se encontró en los extractos de O. vulgare y R. graveolens . De las cuatro plantas evaluadas, el extracto de L. tridentata fue mejor , de bido a que presenta la mayor inhibición en comparación con los otros extractos; y con un efecto similar a los aceites empleados como control. La técnica de dif u sión en disco, permitió observar mejor los efectos inhibitorios de los extra c tos y los aceites s obre cada una de las bacterias empleadas en comparación con el método de difusión en pozo.

A modified method of 3D-SSP analysis for amyloid PET imaging using [¹¹C]BF-227.

Science.gov (United States)

Kaneta, Tomohiro; Okamura, Nobuyuki; Minoshima, Satoshi; Furukawa, Katsutoshi; Tashiro, Manabu; Furumoto, Shozo; Iwata, Ren; Fukuda, Hiroshi; Takahashi, Shoki; Yanai, Kazuhiko; Kudo, Yukitsuka; Arai, Hiroyuki

2011-12-01

Three-dimensional stereotactic surface projection (3D-SSP) analyses have been widely used in dementia imaging studies. However, 3D-SSP sometimes shows paradoxical results on amyloid positron emission tomography (PET) analyses. This is thought to be caused by errors in anatomical standardization (AS) based on an (18)F-fluorodeoxyglucose (FDG) template. We developed a new method of 3D-SSP analysis for amyloid PET imaging, and used it to analyze (11)C-labeled 2-(2-[2-dimethylaminothiazol-5-yl]ethenyl)-6-(2-[fluoro]ethoxy)benzoxazole (BF-227) PET images of subjects with mild cognitive impairment (MCI) and Alzheimer's disease (AD). The subjects were 20 with MCI, 19 patients with AD, and 17 healthy controls. Twelve subjects with MCI were followed up for 3 years or more, and conversion to AD was seen in 6 cases. All subjects underwent PET with both FDG and BF-227. For AS and 3D-SSP analyses of PET data, Neurostat (University of Washington, WA, USA) was used. Method 1 involves AS for BF-227 images using an FDG template. In this study, we developed a new method (Method 2) for AS: First, an FDG image was subjected to AS using an FDG template. Then, the BF-227 image of the same patient was registered to the FDG image, and AS was performed using the transformation parameters calculated for AS of the corresponding FDG images. Regional values were normalized by the average value obtained at the cerebellum and values were calculated for the frontal, parietal, temporal, and occipital lobes. For statistical comparison of the 3 groups, we applied one-way analysis of variance followed by the Bonferroni post hoc test. For statistical comparison between converters and non-converters, the t test was applied. Statistical significance was defined as p SSP analysis of amyloid PET imaging possible. This new method of 3D-SSP analysis for BF-227 PET could prove useful for detecting differences between normal groups and AD and MCI groups, and between converters and non-converters.

Failure of PCR to Detect Treponema pallidum ssp. pertenue DNA in Blood in Latent Yaws.

Directory of Open Access Journals (Sweden)

Michael Marks

Full Text Available Yaws, caused by Treponema pallidum ssp. pertenue, is a neglected tropical disease closely related to venereal syphilis and is targeted for eradication by 2020. Latent yaws represents a diagnostic challenge, and current tools cannot adequately distinguish between individuals with true latent infection and individuals who are serofast following successful treatment. PCR on blood has previously been shown to detect T. pallidum DNA in patients with syphilis, suggesting that this approach may be of value in yaws. We performed real-time PCR for Treponema pallidum ssp. pertenue on blood samples from 140 children with positive T. pallidum Particle Agglutination (TPPA and Rapid Plasma Reagin (RPR tests and 7 controls (negative serology, all collected as part of a prospective study of yaws in the Solomon Islands. All samples were also tested by a nested PCR for T. pallidum. 12 patients had clinical evidence of active yaws whilst 128 were considered to have latent yaws. 43 children had high titre rapid plasma reagins (RPRs of ≥1:32. PCR testing with both assays gave negative results in all cases. It is possible that the failure to detect T. pallidum ssp. pertenue in blood reflects lower loads of organism in latent yaws compared to those in latent infection with T. pallidum ssp. pertenue, and/or a lower propensity for haematogenous dissemination in yaws than in syphilis. As the goal of the yaws control programme is eradication, a tool that can differentiate true latent infection from individuals who are serofast would be of value; however, PCR of blood is not that tool.

Failure of PCR to Detect Treponema pallidum ssp. pertenue DNA in Blood in Latent Yaws.

Science.gov (United States)

Marks, Michael; Katz, Samantha; Chi, Kai-Hua; Vahi, Ventis; Sun, Yongcheng; Mabey, David C; Solomon, Anthony W; Chen, Cheng Y; Pillay, Allan

2015-01-01

Yaws, caused by Treponema pallidum ssp. pertenue, is a neglected tropical disease closely related to venereal syphilis and is targeted for eradication by 2020. Latent yaws represents a diagnostic challenge, and current tools cannot adequately distinguish between individuals with true latent infection and individuals who are serofast following successful treatment. PCR on blood has previously been shown to detect T. pallidum DNA in patients with syphilis, suggesting that this approach may be of value in yaws. We performed real-time PCR for Treponema pallidum ssp. pertenue on blood samples from 140 children with positive T. pallidum Particle Agglutination (TPPA) and Rapid Plasma Reagin (RPR) tests and 7 controls (negative serology), all collected as part of a prospective study of yaws in the Solomon Islands. All samples were also tested by a nested PCR for T. pallidum. 12 patients had clinical evidence of active yaws whilst 128 were considered to have latent yaws. 43 children had high titre rapid plasma reagins (RPRs) of ≥1:32. PCR testing with both assays gave negative results in all cases. It is possible that the failure to detect T. pallidum ssp. pertenue in blood reflects lower loads of organism in latent yaws compared to those in latent infection with T. pallidum ssp. pertenue, and/or a lower propensity for haematogenous dissemination in yaws than in syphilis. As the goal of the yaws control programme is eradication, a tool that can differentiate true latent infection from individuals who are serofast would be of value; however, PCR of blood is not that tool.

Isolation, identification and activity of natural antioxidants from horehound (Marrubium vulgare L.) cultivated in Lithuania

NARCIS (Netherlands)

Pukalskas, A.; Venskutonis, P.R.; Salido, S.; Waard, de P.; Beek, van T.A.

2012-01-01

In an earlier screening of Lithuanian plants, horehound (Marrubium vulgare) showed good antioxidant activity and as this species is used in herbal teas and cough pastilles it was selected for further investigation. Some fractions of the aerial parts were strong scavengers of the model free radicals

Pyrrolizidine Alkaloids from Echium vulgare in Honey Originate Primarily from Floral Nectar.

Science.gov (United States)

Lucchetti, Matteo A; Glauser, Gaetan; Kilchenmann, Verena; Dübecke, Arne; Beckh, Gudrun; Praz, Christophe; Kast, Christina

2016-06-29

Pyrrolizidine alkaloids (PAs) in honey can be a potential human health risk. So far, it has remained unclear whether PAs in honey originate from pollen or floral nectar. We obtained honey, nectar, and plant pollen from two observation sites where Echium vulgare L. was naturally abundant. The PA concentration of honey was determined by targeted analysis using a high pressure liquid chromatography-mass spectrometry system (HPLC-MS/MS), allowing the quantification of six different PAs and PA-N-oxides present in E. vulgare. Echium-type PAs were detected up to 0.153 μg/g in honey. Nectar and plant pollen were analyzed by nontargeted analysis using ultrahigh pressure liquid chromatography-high resolution-mass spectrometry (UHPLC-HR-MS), allowing the detection of 10 alkaloids in small size samples. Echium-type PAs were detected between 0.3-95.1 μg/g in nectar and 500-35000 μg/g in plant pollen. The PA composition in nectar and plant pollen was compared to the composition in honey. Echimidine (+N-oxide) was the main alkaloid detected in honey and nectar samples, while echivulgarine (+N-oxide) was the main PA found in plant pollen. These results suggest that nectar contributes more significantly to PA contamination in honey than plant pollen.

STABILITAS OKSIDATIF MINYAK BIJI KENARI (Canarium indicum DAN Canarium vulgare SELAMA PENYIMPANAN PADA SUHU 30 DAN 40°C [Oxidative Stability of Canarium Nut (Canarium indicum and Canarium vulgare Oil during Storage at 30 and 40°C

Directory of Open Access Journals (Sweden)

Suhartati Djarkasi1

2008-12-01

Full Text Available The aims of this research were to study the effect of temperature and storage on the oxidative stability of crude and refined canarium nut oil extracted from the seeds of Canarium indicum and Canarium vulgare. The experiment was designed to include storage of two type of canarium nut oil at two different temperatures for up to 35 days. The oils (crude and refined used had the similar condition. Parameter used for oxidative deterioration indicators were two peroxide value, TBARS (thiobarbituric acid reactive substances, and free fatty acid value. The result showed that refining oil can decrease component natural antioxidant of canarium oil cause more sensitive to the oxidation. Increased storage temperature can raise oxidation of crude and refined oils from both species Canarium. The peroxide values of crude and refined oils both Canarium indicum and Canarium vulgare stored at 30 °C were 2.17, 4.35, 3.36 and 3.77 meq O2/kg oil, respectively. When they were stored at 4C the similar results were 6.21, 19.09, 8.12 and 17.23 meq O2/kg oil. Furthermore, TBARS value of crude and refined oils both for Canarium indicum and Canarium vulgare stored 30C were 4.55, 7.78, 5.70 and 6.58 µmol MDA/kg oil. When they were stored at 40 °C the similar results were 9.99, 55.46, 12.46 and 43.62 µmol MDA/kg oil.

Establishing Artemisia tridentata ssp wyomingensis on mined lands: Science and economics

Energy Technology Data Exchange (ETDEWEB)

Schuman, G.E.; Vicklund, L.E.; Belden, S.E. [ARS, Cheyenne, WY (United States). High Plains Grasslands Research Station

2005-12-01

In 1996, the Wyoming Department of Environmental Quality enacted regulations governing the reestablishment of woody shrubs on mined lands. The regulation required that an average density of one shrub m{sup -2} be reestablished on at least 20% of the disturbed land area and that the shrub composition must include dominant premine species. In Wyoming, and much of the Northern Great Plains, that meant that Artemisia tridentata Nutt. ssp. wyomingensis (Beetle and Young) (Wyoming big sagebrush) had to be reestablished on mined lands. Artemisia tridentata Nutt. ssp. wyomingensis had proven difficult to reestablish on mined lands because of poor quality seed, seed dormancy and a poor understanding of the seedbed ecology of this species. Research in the last two decades has produced significant knowledge in the area of direct-seed establishment of Artemisia tridentata Nutt. ssp. wyomingensis on mined lands. Our research has shown that reducing grass seeding rates will reduce competition and result in larger sagebrush plants that are more likely to survive and provide greater structural diversity to the plant community. Economic analyses demonstrated that big sagebrush can be established at a cost of $0.01-0.05 per seedling using direct seeding methods compared to transplanting nursery grown seedlings, estimated to cost $0.72-$1.65 per seedling (depending on size) to grow and from $1.30-$2.40 to plant (flat land to 2:1 slopes). An adequate level of precipitation will be necessary to ensure successful establishment of this species no matter what method of propagation is selected and direct seeding gives greater opportunity for success because of the demonstrated longevity of the seed to germinate 3-5 years after the initial seeding.

Pengembangan Subject Specific Pedagogy (SSP Tematik Berbasis Local Wisdom Untuk Membangun Karakter Hormat dan Kepedulian Siswa SD

Directory of Open Access Journals (Sweden)

Amaliyah Ulfah

2018-01-01

Full Text Available This study aims at generating possible thematic Subject Specific Pedagogy (SSP based on local wisdom and examining the results teachers and students perception on the pedagogical approach developed in the preliminary field testing. Drawing upon the notion of research and development by Borg & Gall, this research was conducted through different stages involving information gathering, planning, developing preliminary product, preliminary field testing, and revising. The subjects were a small group of second grade students of SD Muhammadiyah Bodon and SD Muhammadiyah Sidoarum Yogyakarta. Each consists of 10 students. The data gathering instrument consists of product validation, character observation sheets, and teacher assessment sheets. The data gathering instrument consists of product validation tool, character observation sheets, and teachers’ assessment sheets. The SSP product generated in this study consists of lesson plans, teaching materials, worksheets, and expert perception. According to the experts of media, materials, and evaluation, the SSP product is in good categories. First grade teachers result a good score to the syllabus and lesson plans, while the worksheets and evaluation are in very good category. The results from the students responses to the textbooks is 78, which is in very good category, while the students worksheets score 71 which includes in excellent category. Therefore, the developed thematic SSP based on local wisdom can be declared appropriate for use in learning.

Evaluation of Origanum vulgare essential oil as antimicrobial agent in sausage Avaliação da atividade antimicrobiana de óleo essencial de Origanum vulgare em linguiça

OpenAIRE

Cassiano Busatta; Altemir José Mossi; Maria Regina Alves Rodrigues; Rogério Luis Cansian; José Vladimir de Oliveira

2007-01-01

This work reports antimicrobial activity of oregano (Origanum vulgare) essential oil against several bacteria in sausage. The in vitro minimum inhibitory concentration (MIC) was determined for 9 selected aerobic heterotrofic bacteria. The antimicrobial activity of distinct concentrations of the essential oil on the basis of the highest MIC found was tested in a food system comprised of fresh sausage. Batch food samples were also inoculated with Escherichia coli with a fixed concentration and ...

Essential oil composition of Valeriana officinalis ssp collina cultivated in Bulgaria

NARCIS (Netherlands)

Bos, R; Hendriks, H; Pras, N; St Stojanova, A; Georgiev, EV

2000-01-01

The essential oils obtained from air-dried subterranean parts of Valeriana officinalis ssp. collina (Wallr.) Nyman (Valerianaceae), 'Shipka,' was analyzed by GC and GC/MS, and 62 components were identified. The oil yield, collected in plants grown in 1995 and 1938, was 0.42% (v/m) and 0.40% (v/m)

Anthelmintic Activity of Crude Extract and Essential Oil of Tanacetum vulgare (Asteraceae against Adult Worms of Schistosoma mansoni

Directory of Open Access Journals (Sweden)

Loyana Silva Godinho

2014-01-01

Full Text Available Schistosomiasis, a parasitic disease caused by trematode flatworms of the genus Schistosoma, affects more than 200 million people worldwide, and its control is dependent on a single drug, praziquantel. Tanacetum vulgare (Asteraceae is used in folk medicine as a vermifuge. This study aimed to investigate the in vitro schistosomicidal activity of the crude extract (TV and the essential oil (TV-EO from the aerial parts of T. vulgare. TV-EO was obtained by hydrodistillation and analyzed by GC/MS, which allowed the identification of β-thujone (84.13% as the major constituent. TV and TV-EO, at 200 μg/mL, decreased motor activity and caused 100% mortality of all adult worms. At 100 and 50 μg/mL, only TV caused death of all adult worms, while TV-EO was inactive. TV (200 μg/mL was also able to reduce viability and decrease production of developed eggs. Confocal laser scanning microscopy showed morphological alterations in the tegument of the S. mansoni surface after incubation with TV (50 and 100 μg/mL. Quantitative analysis on the schistosomes tegument showed that TV caused changes in the numbers of tubercles of S. mansoni male worms in a dose-dependent manner. The findings suggest that T. vulgare is a potential source of schistosomicidal compounds.

COMPOSITION AND BACTERICIDAL ACTIVITY AGAINST BENEFICIAL AND PATHOGENIC BACTERIA OF OREGANO ESSENTIAL OILS FROM FOUR CHEMOTYPES OF Origanum AND Lippia GENUS

Directory of Open Access Journals (Sweden)

L. Betancourt

2012-01-01

Full Text Available Diversos estudios demuestran la actividad antibacterial de distintos quimiotipos de aceites esenciales de orégano (OEO, carvacrol y timol, contra bacterias patógenas Gram positivas y Gram negativas, pero muy poca información está disponible sobre el efecto de los OEO en bacterias benéficas. El objetivo de este estudio fue comparar la composición y concentración mínima bactericida (CMB de OEO de quimiotipos del género Origanum: O. vulgare L. ssp. hirtum (OH, O. majorana (OM y O. vulgare L. (OL cultivados en Colombia, frente Lippia origanoides Kunth (LO nativo del Alto Pa-tía en Colombia y O. vulgare L. ssp. hirtum cultivado en Grecia (OG. Los OEO se ob-tuvieron por arrastre de vapor, la composición se determinó por cromatografía de gases acoplada a espectrometría de masas y la actividad antibacteriana mediante el método de dilución en caldo y cultivo en agar. Se evaluaron tres quimiotipos de OEO: OH y OG tipo-carvacrol, LO y OL tipo-timol y OM rico en compuestos sabinilo. Las variedades de orégano producidas bajo condiciones de invernadero a alta altitud mostraron un alto contenido de precursores. Un valor similar de concentración mínima bactericida contra Salmonella enteritidis (0.098 mg/mL fue observada para carvacrol, OH y LO. La más baja actividad bactericida contra las bacterias benéficas Lactobacillusacidophilusy Bifidobacterium breve fue observada para OM (6.25 mg/mL y LO (50 mg/mL, respectivamente. Estos resultados mostraron que LO, nativo de Colombia presentó un efecto antibacteriano comparable a OH y carvacrol contra enterobacterias patógenas y una baja actividad bactericida contra las bacterias benéficas. Estos resultados mostraron un efecto bactericida selectivo contra bacterias benéficas y patógenas de los quimiotiposOriganum ssp. y L. origanoides. Se comprobó un buen potencial de L. origanoides para uso como aditivo antimicrobiano para la salud humana y animal.

Applying the global RCP-SSP-SPA scenario framework at sub-national scale: A multi-scale and participatory scenario approach.

Science.gov (United States)

Kebede, Abiy S; Nicholls, Robert J; Allan, Andrew; Arto, Iñaki; Cazcarro, Ignacio; Fernandes, Jose A; Hill, Chris T; Hutton, Craig W; Kay, Susan; Lázár, Attila N; Macadam, Ian; Palmer, Matthew; Suckall, Natalie; Tompkins, Emma L; Vincent, Katharine; Whitehead, Paul W

2018-09-01

To better anticipate potential impacts of climate change, diverse information about the future is required, including climate, society and economy, and adaptation and mitigation. To address this need, a global RCP (Representative Concentration Pathways), SSP (Shared Socio-economic Pathways), and SPA (Shared climate Policy Assumptions) (RCP-SSP-SPA) scenario framework has been developed by the Intergovernmental Panel on Climate Change Fifth Assessment Report (IPCC-AR5). Application of this full global framework at sub-national scales introduces two key challenges: added complexity in capturing the multiple dimensions of change, and issues of scale. Perhaps for this reason, there are few such applications of this new framework. Here, we present an integrated multi-scale hybrid scenario approach that combines both expert-based and participatory methods. The framework has been developed and applied within the DECCMA 1 project with the purpose of exploring migration and adaptation in three deltas across West Africa and South Asia: (i) the Volta delta (Ghana), (ii) the Mahanadi delta (India), and (iii) the Ganges-Brahmaputra-Meghna (GBM) delta (Bangladesh/India). Using a climate scenario that encompasses a wide range of impacts (RCP8.5) combined with three SSP-based socio-economic scenarios (SSP2, SSP3, SSP5), we generate highly divergent and challenging scenario contexts across multiple scales against which robustness of the human and natural systems within the deltas are tested. In addition, we consider four distinct adaptation policy trajectories: Minimum intervention, Economic capacity expansion, System efficiency enhancement, and System restructuring, which describe alternative future bundles of adaptation actions/measures under different socio-economic trajectories. The paper highlights the importance of multi-scale (combined top-down and bottom-up) and participatory (joint expert-stakeholder) scenario methods for addressing uncertainty in adaptation decision

Regional cerebral blood flow in pure dysarthria. A 3D-SSP study

International Nuclear Information System (INIS)

Okamoto, Kensho; Kamogawa, Kenji; Okuda, Bungo; Kawabata, Keita; Tachibana, Hisao

2007-01-01

Pure dysarthria from brain infarction is a rare condition, and its pathophysiology remains unclear. To clarify the underlying mechanism of pure dysarthria, we investigated the lesion sites and regional cerebral blood flow in patients with pure dysarthria. We examined 18 consecutive patients with pure dysarthria (9 men and 9 women; mean age, 71 years) who underwent MRI and cerebral blood flow studies. To visualize the regional cerebral blood flow, we generated Z score images using the three-dimensional stereotactic surface projection (3D-SSP) method with single-photon emission computed tomography (SPECT) and N-isopropyl-p [ 123 I]iodoamphetamine. Data on the brain surface perfusion extracted by the 3D-SSP analysis were compared between the pure dysarthria (PD) patients and 9 control subjects. MRI revealed multiple lacunar infarctions involving the internal capsule and/or corona radiata in 11 patients, left internal capsule-corona radiata infarction in 4 patients, and pontine infarction in 3 patients. SPECT with 3D-SSP demonstrated bilateral frontal cortical hypoperfusion in all patients, particularly in the anterior opercular region. Based on intergroup comparisons, the PD group exhibited pronounced cortical hypoperfusion in the opercular and medial frontal regions, left more than right. In conclusion, pure dysarthria is considered to originate from frontal cortical hypoperfusion, mainly in the anterior opercular and medial frontal regions, which is probably due to interruption of the corticosubcortical neural networks relevant to speech expression and articulation. In addition, it is suggested that left hemispheric lesions may make a greater contribution to the development of pure dysarthria than do right ones. (author)

Relationship between line spread function (LSF), or slice sensitivity profile (SSP), and point spread function (PSF) in CT image system

International Nuclear Information System (INIS)

Ohkubo, Masaki; Wada, Shinichi; Kobayashi, Teiji; Lee, Yongbum; Tsai, Du-Yih

2004-01-01

In the CT image system, we revealed the relationship between line spread function (LSF), or slice sensitivity profile (SSP), and point spread function (PSF). In the system, the following equation has been reported; I(x,y)=O(x,y) ** PSF(x,y), in which I(x,y) and O(x,y) are CT image and object function, respectively, and ** is 2-dimensional convolution. In the same way, the following 3-dimensional expression applies; I'(x,y,z)=O'(x,y,z) *** PSF'(x,y,z), in which z-axis is the direction perpendicular to the x/y-scan plane. We defined that the CT image system was separable, when the above two equations could be transformed into following equations; I(x,y)=[O(x,y) * LSF x (x)] * LSF y (y) and I'(x,y,z) =[O'(x,y,z) * SSP(z)] ** PSF(x,y), respectively, in which LSF x (x) and LSF y (y) are LSFs in x- and y-direction, respectively. Previous reports for the LSF and SSP are considered to assume the separable-system. Under the condition of separable-system, we derived following equations; PSF(x,y)=LSF x (x) ·LSF y (y) and PSF'(x,y,z)=PSF(x,y)·SSP(z). They were validated by the computer-simulations. When the study based on 1-dimensional functions of LSF and SSP are expanded to that based on 2- or 3-dimensional functions of PSF, derived equations must be required. (author)

Phytochemical Analysis, Antioxidant and Antibacterial Activities of Four Lamiaceae Species Cultivated in Barnyard Manure

OpenAIRE

YALDIZ, Gülsüm; KAŞKO ARICI, Yeliz; YILMAZ, Gülşah

2017-01-01

The present study was conducted to determine essential oil yields, essential oil compositions, total phenolics, antioxidantand antibacterial activities of organic manure-treated medicinal plants of Salvia officinalis L. (sage), Lavandulaangustifolia L. (lavender), Melissa officinalis L. (lemon balm) and Origanum vulgare ssp. hirtum (origano). Essentialoil yields of investigated medicinal plants varied between 0.06±0.01%-3.43±0.06%. The 1,8-cineol (15.285±0.003%),viridiflorol (12.095±0.003%) a...

A biomimetic synthesis of stable gold nanoparticles derived from aqueous extract of Foeniculum vulgare seeds and evaluation of their catalytic activity

Science.gov (United States)

Choudhary, Manoj Kumar; Kataria, Jyoti; Sharma, Shweta

2017-10-01

A facile biomimetic approach for the synthesis of gold nanoparticles (AuNPs) using aqueous extract of fennel ( Foeniculum vulgare) seeds have been reported in this article. The seeds of F. vulgare are rich in various plant secondary metabolites (phytochemicals) such as polyphenolic acids, flavonoids, and saponins. The phytochemicals of F. vulgare seeds play dual role of reducing and stabilizing agents. The formation of gold nanoparticles was evidenced from the appearance of intense purple color at room temperature with λ max around 550 nm in the UV-Vis absorption spectra. The stable AuNPs were further characterized by X-ray diffraction (XRD), Fourier transform infrared (FT-IR) spectroscopy and transmission electron microscopy (TEM) analysis. The synthesized nanoparticles were observed to be polydispersed, spherical and ranged from 10 to 30 nm with an average size of 20 ± 2 nm, as obtained from TEM images. The catalytic activity of gold nanoparticles was investigated by studying the reduction of anthropogenic dyes such as methylene blue (MB) and rhodamine B (Rh-B) with sodium borohydride. Results showed the possible applications of biogenic AuNPs in environment related problems.

Flavonoids from Ulex airensis and Ulex europaeus ssp. europaeus.

Science.gov (United States)

Máximo, Patrícia; Lourenço, Ana; Feio, Sónia Savluchinske; Roseiro, José Carlos

2002-02-01

From the dichloromethane extract of Ulex airensis three new isoflavonoids, ulexin C (1), ulexin D (2), and 7-O-methylisolupalbigenin (3), were isolated and characterized by spectroscopic methods. Ulexin D (2) was also identified from the dichloromethane extract of Ulex europaeus ssp. europaeus. Together with these new metabolites, 18 compounds of previously known structures were isolated and identified from both species. The antifungal activity of these compounds was tested against Cladosporium cucumerinum by a bioautographic TLC assay.

Cell size and cell number in dwarf mutants of barley (Hordeum vulgare)

International Nuclear Information System (INIS)

Blonstein, A.D.; Gale, M.D.

1984-01-01

Sixteen height mutants, induced by sodium azide treatment of the two-rowed barley variety Proctor, have been used to investigate the relationship between the extent and nature of stem shortening with alterations in cell size and cell number, and the pleiotropic effects of dwarfing genes on vegetative development and agronomic performance. The studies on epidermal cell number and cell length in the developmentally earliest and latest elongated vegetative tissues - the coleoptile and peduncle resprectively - suggest that cell number may be the primary determinant of plant height. One semi-prostrate and one erectoides mutant are used to illustrate different cell number/cell size strategies and their relationships with gibberellin sensitivity, growth rate and lodging resistance are discussed. (author)

Effects of aerial pollutants on cereal growth. [Hordeum vulgare var. Maris Otter

Energy Technology Data Exchange (ETDEWEB)

1975-01-01

Winter barley, var. Maris Otter, was grown at Woburn Experimental Farm in three closed plastic chambers with either filtered, ambient or sulfur dioxide-polluted air. The mean sulfur dioxide levels were 7.2 ..mu..g m/sup -3/, 37 ..mu..g m/sup -3/ for the filtered and ambient chambers respectively. In the field the mean value was 51.5 ..mu..g m/sup -3/ . Temperature and relative humidity in these closed houses differed from the outside. No visible damage occurred on any of the plants grown in the filtered or ambient air. In the fumigated chamber a high dose of sulfur dioxide was given for one week (19-25 April 1975), producing a mean concentration of 951 ..mu..g m/sup -3/, at the four-leaf stage. It caused severe necrosis of the leaves. The plants subsequently recovered and no further fumigations were given. At final harvest these plants were not significantly lower in total dry weight and grain weight from the ambient plants. The dry matter yield of the plants grown in filtered air was higher than that of plants in ambient air.

Analysis of chlorophyll mutations induced by γ-rays in barley (hordeum vulgare)

International Nuclear Information System (INIS)

Wang Cailian; Shen Mei; Xu Gang; Zhao Kongnan; Chen Qiufang

1991-06-01

Thirty varieties of dormant barley seeds were irradiated with 137 Cs γ-rays. Dose-effect relations of chlorophyll mutation frequency in M 2 seedling and differences resulting from cultured types or radiosensitive types were investigated. Experimental results show that the relations between chlorophyll mutation frequency and doses can be fitted by a linear regression equation Y = A + BX. According to analysis of covariance, there is no considerable difference in various cultured types, but the difference of five different radiosensitive types is remarkable. The sensitive and intermediate types need much lower doses than other types to induce maximum chlorophyll mutation

Diversity in boron toxicity tolerance of Australian barley (Hordeum vulgare L.) genotypes.

Science.gov (United States)

Hayes, Julie E; Pallotta, Margaret; Garcia, Melissa; Öz, Mehmet Tufan; Rongala, Jay; Sutton, Tim

2015-09-26

Boron (B) is an important micronutrient for plant growth, but is toxic when levels are too high. This commonly occurs in environments with alkaline soils and relatively low rainfall, including many of the cereal growing regions of southern Australia. Four major genetic loci controlling tolerance to high soil B have been identified in the landrace barley, Sahara 3771. Genes underlying two of the loci encode the B transporters HvBot1 and HvNIP2;1. We investigated sequence and expression level diversity in HvBot1 and HvNIP2;1 across barley germplasm, and identified five novel coding sequence alleles for HvBot1. Lines were identified containing either single or multiple copies of the Sahara HvBot1 allele. We established that only the tandemly duplicated Sahara allele conferred B tolerance, and this duplicated allele was found only in a set of nine lines accessioned in Australian collections as Sahara 3763-3771. HvNIP2;1 coding sequences were highly conserved across barley germplasm. We identified the likely causative SNP in the 5'UTR of Sahara HvNIP2;1, and propose that the creation of a small upstream open reading frame interferes with HvNIP2;1 translation in Sahara 3771. Similar to HvBot1, the tolerant HvNIP2;1 allele was unique to the Sahara barley accessions. We identified a new source of the 2H B tolerance allele controlling leaf symptom development, in the landrace Ethiopia 756. Ethiopia 756, as well as the cultivar Sloop Vic which carries both the 2H and HvBot1 B tolerance alleles derived from Sahara 3771, may be valuable as alternative parents in breeding programs targeted to high soil B environments. There is significant diversity in B toxicity tolerance among contemporary Australian barley varieties but this is not related to variation at any of the four known B tolerance loci, indicating that novel, as yet undiscovered, sources of tolerance exist.

Cell wall polysaccharides hydrolysis of malting barley (Hordeum vulgare L.: a review

Directory of Open Access Journals (Sweden)

Jamar, C.

2011-01-01

Full Text Available Malting quality results from the different steps of the malting process. Malting uses internal changes of the seed occurring during germination, such as enzymes synthesis, to obtain a good hydrolysis process and the components required. Among the three main hydrolytic events observed, that are namely starch degradation, cell wall breakdown and protein hydrolysis, an efficient cell wall polysaccharides hydrolysis is an essential condition for a final product of quality. Indeed, because of the physical barrier of the cell wall, cell wall polysaccharides hydrolysis is one of the first steps expected from the process to gain access to the cell components. Moreover, viscosity problem and haze formation in malting industry are related to their presence during the process when inefficient degradation occurs, leading to increased production time and cost. Understanding the key elements in cell wall degradation is important for a better control. (1-3,1-4-β-glucans and arabinoxylans are the main constituents of cell wall. (1-3,1-4-β-glucans are unbranched chains of β-D-glucopyranose residues with β-(1,3 linkages and β-(1,4 linkages. Arabinoxylan consists in a backbone of D-xylanopyranosyl units linked by β-(1-4 bonds connected to single L-arabinofuranose by α-(1→2 or α-(1→3-linkages. Degradation of (1-3,1-4-β-glucans is processed by the (1-3,1-4-β-glucanases, the β-glucosidases and the β-glucane exohydrolases. It seems that the (1-3-β-glucanases are also involved. Arabinoxylans are mainly decomposed by (1-4-β-xylan endohydrolase, arabinofuranosidase and β-xylosidase.

Hordein gene dose effects in triploid endosperm of barley (Hordeum vulgare L.

Directory of Open Access Journals (Sweden)

Perović Dragan

2009-01-01

Full Text Available The presence of two maternal chromosome sets in triploid barley endosperm allows the distinction of maternal and paternal hordein bands in an electrophoregram: the maternal bands are stronger due to the higher gene dose. In the F1 generation there are differences between reciprocal crosses and in the F2 generation all 16 classes that are theoretically possible for a pair of polymorphic loci can be distinguished. This full classification is rarely possible in genetic studies, and allows more accurate estimates of recombination rates. Two hordein gene clusters (Hor1 and Hor2, corresponding to hordein C and hordein B respectively were analyzed in hybrids obtained by crossing two winter barley cultivars Partizan and HWV-247. Hordein separation was performed by acid-polyacrylamide gel electrophoresis at pH 3.2 (A-PAGE. A set of most informative bands of B and C hordeins was selected in each cross by two criteria: (1 presence or absence of bands in the parents and (2 signal strength to allow doses scoring. The average genetic distance between Hor1 and Hor2 loci was 11 cM. Distances in male and female maps were not significantly different, suggesting a similar recombination rate in male and female meiosis.

Influence of yellow rust infection on /sup 32/P transport in detached barley leaves

Energy Technology Data Exchange (ETDEWEB)

Schubert, J. (Akademie der Landwirtschaftswissenschaften der DDR, Aschersleben. Inst. fuer Phytopathologie)

1982-01-01

Several barley cultivars (Hordeum vulgare L.) differing in their resistance to yellow rust (Puccinia striiformis West.) were tested for relationships between changes of /sup 32/P transport in detached leaves and resistance to yellow rust disease. Investigation carried out with detached second leaves from plants infected at their first leaf revealed a matter transport in these leaves changed by the infection. Transport was also influenced by inoculation with yellow rust uredospores. In that case rust infection influenced the basipetal transport less strongly in resistent plants than in susceptible ones. Connected with the findings the influence of fungal substances on transport processes is discussed in general.

Purification, enzymatic characterization, and nucleotide sequence of a high-isoelectric-point alpha-glucosidase from barley malt

DEFF Research Database (Denmark)

Frandsen, T P; Lok, F; Mirgorodskaya, E

2000-01-01

in the transition state complex. Mass spectrometry of tryptic fragments assigned the 92-kD protein to a barley cDNA (GenBank accession no. U22450) that appears to encode an alpha-glucosidase. A corresponding sequence (HvAgl97; GenBank accession no. AF118226) was isolated from a genomic phage library using a c......High-isoelectric-point (pI) alpha-glucosidase was purified 7, 300-fold from an extract of barley (Hordeum vulgare) malt by ammonium sulfate fractionation, ion-exchange, and butyl-Sepharose chromatography. The enzyme had high activity toward maltose (k(cat) = 25 s(-1)), with an optimum at pH 4...

Influence of yellow rust infextion on 32P transport in detached barley leaves

International Nuclear Information System (INIS)

Schubert, J.

1982-01-01

Several barley cultivars (Hordeum vulgare L.) differing in their resistance to yellow rust (Puccinia striiformis West.) were tested for relationships between changes of 32 P transport in detached leaves and resistance to yellow rust disease. Investigation carried out with detached second leaves from plants infected at their first leaf revealed a matter transport in these leaves changed by the infection. Transport was also influenced by inoculation with yellow rust uredospores. In that case rust infection influenced the basipetal transport less strongly in resistent plants than in susceptible ones. Connected with the findings the influence of fungal substances on transport processes is discussed in general. (author)

Nitrogen acquisition by pea and barley and the effect of their crop residues on available nitrogen for subsequent crops

DEFF Research Database (Denmark)

Jensen, E.S.

1996-01-01

Nitrogen acquisition by field pea (Pisum sativum L.) and spring barley (Hordeum vulgare L.) grown on a sandy loam soil and availability of N in three subsequent sequences of a cropping system were studied in an outdoor pot experiment. The effect of crop residues on the N availability was evaluated....... The dry matter production and total N uptake of a spring barley crop following pea or barley, with a period of unplanted soil in the autumn/winter, were significantly higher after pea than after barley. The barley crop following pea and barley recovered 11% of the pea and 8% of the barley residue N...

Variability in mesophyll conductance between barley genotypes, and effects on transpiration efficiency and carbon isotope discrimination.

Science.gov (United States)

Barbour, Margaret M; Warren, Charles R; Farquhar, Graham D; Forrester, Guy; Brown, Hamish

2010-07-01

Leaf internal, or mesophyll, conductance to CO(2) (g(m)) is a significant and variable limitation of photosynthesis that also affects leaf transpiration efficiency (TE). Genotypic variation in g(m) and the effect of g(m) on TE were assessed in six barley genotypes (four Hordeum vulgare and two H. bulbosum). Significant variation in g(m) was found between genotypes, and was correlated with photosynthetic rate. The genotype with the highest g(m) also had the highest TE and the lowest carbon isotope discrimination as recorded in leaf tissue (Delta(p)). These results suggest g(m) has unexplored potential to provide TE improvement within crop breeding programmes.

Using elevated CO{sub 2} to increase the biomass of a Sorghum vulgare x Sorghum vulgare var. sudanense hybrid and Trifolium pratense L. and to trigger hyperaccumulation of cesium

Energy Technology Data Exchange (ETDEWEB)

Wu Huibin [Centre for Research in Ecotoxicology and Environmental Remediation, Institute of Agro-Environmental Protection, Ministry of Agriculture, Tianjin 300191 (China); Open Key Laboratory of Agro-environment and Agro-product Safety of the Ministry of Agriculture, Tianjin (China); College of Resources and Environment, Huazhong Agricultural University, 430070 Wuhan, Hubei Province (China); Tang Shirong, E-mail: tangshir@hotmail.com [Centre for Research in Ecotoxicology and Environmental Remediation, Institute of Agro-Environmental Protection, The Ministry of Agriculture, Tianjin 300191 (China); Open Key Laboratory of Agro-environment and Agro-product Safety of the Ministry of Agriculture, Tianjin (China); Zhang Ximei; Guo Junkang; Song, Zhengguo; Tian Shuai [Centre for Research in Ecotoxicology and Environmental Remediation, Institute of Agro-Environmental Protection, Ministry of Agriculture, Tianjin 300191 (China); Open Key Laboratory of Agro-environment and Agro-product Safety of the Ministry of Agriculture, Tianjin (China); Smith, Donald L. [Plant Science Department, McGill University, Macdonald Campus, 21111 Lakeshore Road, Ste. Anne de Bellevue, Quebec, H9X 3V9 (Canada)

2009-10-30

The most important challenge to use phytoremediation is how to improve its efficiency by increasing the accumulation of metals in plants, or by improving key plant biological traits that should enhance metal uptake. In this paper, we used open-top chambers to investigate the effects of elevated CO{sub 2} (860 {mu}L L{sup -1}) on biomass and Cs uptake by a Sorghum vulgare x Sorghum vulgare var. sudanense hybrid and Trifolium pratense L. growing on soils spiked with various levels of cesium (0, 300, 1500 and 3000 mg Cs kg{sup -1}). The results showed that elevated CO{sub 2} not only increased aboveground biomass of the Sorghum and Trifolium species by 32-111%, and by 8-11%, respectively, compared to the ambient CO{sub 2} treatment, but also caused more accumulation of Cs by Sorghum species (up to 73%) than Trifolium species (up to 43%). It was speculated that the increase in biomass and the improvement in Cs accumulation ability at elevated CO{sub 2} could be related to lowered soil pH values, and changes in number and kind of microorganisms in the rhizospheres of the two tested species. This is the first report of a link among elevated CO{sub 2}, increased biomass and hyperaccumulation of Cs by Sorghum and Trifolium species.

Biological Evaluation, Overpressured Layer Chromatography (OPLC) separation and Isolation of a New Acetylenic Derivative Compound from Prangos platychlaena ssp. platychlaena Fruit Essential Oils

Science.gov (United States)

In the present work, fruits of Prangos platychlaena Boiss. ex Tchihat. ssp. platychlaena (Apiaceae) collected from eastern (Sample A) and central (Sample B) parts of Turkey were subjected to hydrodistillation to yield essential oils (EOs). The chemical composition of P. platychlaena ssp. platychlaen...

In vitro storage characteristics of platelet concentrates suspended in 70% SSP+(TM) additive solution versus plasma over a 14-day storage period.

Science.gov (United States)

Saunders, C; Rowe, G; Wilkins, K; Holme, S; Collins, P

2011-08-01

The non-paired two-arm study compared the in vitro storage characteristics of platelets suspended as concentrates in either 100% plasma or a mixture of additive solution (SSP+™, MacoPharma, Mouveaux, France) and autologous plasma in a 70:30 ratio over a 14-day storage period. The buffy coat-derived pooled platelet concentrates were sampled on days 1, 2, 3, 6, 8, 10 and 14 and tests performed to determine platelet morphology, function, metabolism, activation and apoptosis-like activity. Swirling remained strong (score=3) in SSP+™, whilst scores of 1 and 0 were noted for plasma units by end of storage. In contrast to units in plasma, pH levels remained above seven in SSP+™ units, increasing after day 10. Percent positive expression of CD62P was similar in both groups on day 1 (median of 54% and 56% for plasma (n=13) and SSP+™ (n=12), respectively), with SSP+™ units showing a more moderate increase in activation after day 10. A progressive decrease in mitochondrial membrane potential was evident in both groups from day 1, whilst annexin V binding was relatively stable from days 1 to 3, with median values remaining below 6%. Subsequent to this, the percentage of platelets binding annexin V increased to approximately 30% by day 14. Platelets suspended in a medium of 70:30 SSP+™ to plasma ratio performed at least as well as platelets in 100% autologous plasma for up to 10 days of storage. Further, results are suggestive of an apoptosis-like process being involved in the platelet storage lesion. © 2011 The Author(s). Vox Sanguinis © 2011 International Society of Blood Transfusion.

Development of a typing system for epidemiological studies of porcine toxin-producing Pasteurella multocida ssp. multocida in Denmark

DEFF Research Database (Denmark)

Fussing, V.; Nielsen, Jens; Bisgaard, M.

1999-01-01

The aim of the present study was to evaluate capsular-typing, plasmid-profiling, phage-typing and ribotyping for epidemiological studies of toxin-producing Pasteurella multocida ssp. multocida in Denmark. The evaluation of methods was based on 68 strains from nasal swabs and 14 strains from...... by HindIII ribotyping, as 85% of isolates from all herds were assigned to one ribotype. In conclusion, HindIII ribotyping seems to represent a useful tool for epidemiological studies of toxigenic P. multocida ssp. multocida....

Samenstelling van de vluchtige olie van Origanum vulgare L. ssp. vulgare gedurende de ontwikkeling van de plant

NARCIS (Netherlands)

Maarse, Henk

1971-01-01

INLEIDING EN DOEL VAN HET ONDERZOEK Vele onderzoekers hebben de laatste jaren de vorming van de verbindingen in vluchtige olien van planten bestudeerd door het bepalen van de verandering in de samenstelling van de vluchtige olie tijdens de groei van de plant. Lemli (68) wees als eerste op de

Second generation bioethanol production from Saccharum spontaneum L. ssp. aegyptiacum (Willd.) Hack.

Science.gov (United States)

Danilo Scordia; Salvatore L. Consentino; Thomas W. Jeffries

2010-01-01

Saccharum (Saccharum spontaneum L. ssp. aegyptiacum (Willd.) Hack.), is a rapidly growing, wide ranging high-yield perennial, suitable for second generation bioethanol production. This study evaluated oxalic acid as a pretreatment for bioconversion. Overall sugar yields, sugar degradation products, enzymatic glucan hydrolysis and ethanol production were studied as...

Composición química y actividad antibacteriana del aceite esencial del Origanum vulgare (orégano

Directory of Open Access Journals (Sweden)

Emilia Albado Plaus

2001-01-01

Full Text Available Objetivo: Determinar la actividad antimicrobiano en el aceite esencial (Carvacrol del Origanum vulgare. Material y métodos: El aceite esencial se obtuvo por destilación por arrastre con vapor de agua, a partir de las hojas y flores desecadas de O. vulgare; se determinó la gravedad especifica con un pinnómetro y el índice de refracción con refractómetro de Abbc; la composición química se evaluó mediante cromatografía de gas con detector de masa (GL-SM. La actividad antimicrobiana del aceite de O. vulgare se realizó por el método semicuantitativo de incorporación y de disco difusión en agar. Resultados: La densidad especifica del producto resultó 0.9234 a 20°C y el índice de refracción 1.4774; el cromatograma mostró un contenido de 9% de Carvacrol, 12.19% de Terpineol, 6.86% de P-cimeno y la presencia de otros compuesto relacionados metabolicamente con los tres antes citados. Las bacterias gram-negativas: Escherichia coli, Pseudomona aeruginosa, Salmonella tiphymurium, Salmonella cholerae suis y Vibrio cholerae y las bacterias gram-positivas: Staphylococcus aureus y Bacillus cereus, mostraron diferentes grados de sensibilidad. De los microorganismos evaluados solo pseudomonas aeruginosa mostró resistencia. Conclusión: El aceite esencial posee actividad microbiana contra todas las bacterias evaluadas, excepto antes para P. aeruginosa.(Rev Med Hered 2001; 12: 16-19 .

Antibacterial Effects of Origanum vulgare Essence Against Multidrug-Resistant Acinetobacter baumannii Isolated From Selected Hospitals of Tehran, Iran

Directory of Open Access Journals (Sweden)

Saghi

2015-02-01

Full Text Available Background Infection due to Acinetobacter baumannii has become a significant challenge to modern healthcare systems. The rapid emergence and global dissemination of A. baumannii as a major nosocomial pathogen is remarkable and it demonstrates its successful adaptation to the 21st century hospital environment. Recent studies have discussed about essential oil of Origanum vulgare against a range of bacteria, including various species of Staphylococcus, Pseudomonas, Bacillus and Escherichia coli. Objectives The present study aimed to investigate the inhibitory effects O. vulgare essence against multidrug-resistant (MDR strains of A. baumannii from selected hospitals in Tehran, Iran. Materials and Methods This oil was obtained using the hydrodistillation method and analyzed by gas chromatography mass spectrography (GC/MS. The antimicrobial activity against MDR isolates was achieved using disc diffusion method and macro-broth dilution assay. Results Analysis of the essential oil revealed the presence of pulegone (68.59% piperitone (7.8%, piperitenone (7.8%, 1, 8-cineole (1.3%, and carvacrol (1.6% as the major components. The results showed a significant activity against MDR A. baumannii with inhibition zones and minimal inhibitory concentration values in the ranges of 7-15 mm and 20-35 µL/mL respectively. Conclusions This investigation showed that the essence oil of O. vulgare had a potent antimicrobial activity against MDR A. baumannii. Further research is required to evaluate the practical values of therapeutic applications.

Establishment and characterization of a new cell line (SSP-9) derived from Atlantic salmon Salmo salar that expresses type I ifn.

Science.gov (United States)

Rodriguez Saint-Jean, S; González, C; Monrás, M; Romero, A; Ballesteros, N; Enríquez, R; Perez-Prieto, S

2014-11-01

In the present work, the establishment and biological characterization of a new cell line, SSP-9, derived from the pronephros of the Atlantic salmon Salmo salar, are reported. These cells grew well in Leibovitz's (L15) medium supplemented with 10% foetal calf serum at temperatures from 15 to 25° C, and they have been sub-cultured over 100 passages to produce a continuous cell line with an epithelial-like morphology. The SSP-9 cells attached and spread efficiently at different plating densities, retaining 80% of cell viability after storage in liquid nitrogen. When karyotyped, the cells had 40-52 chromosomes, with a modal number of 48. Viral susceptibility tests showed that SSP-9 cells were susceptible to infectious pancreatic necrosis virus and infectious haematopoietic necrosis virus, producing infectious virus and regular cytopathic effects. Moreover, these cells could be stimulated by poly I:C, showing significant up-regulation in the expression of the genes that regulate immune responses, such as ifn and mx-1. SSP-9 cells constitutively express genes characteristic of macrophages, such as major histocompatibility complex (mhc-II) and interleukin 12b (il-12b), and flow cytometry assays confirmed that SSP-9 cells can be permanently transfected with plasmids expressing a reporter gene. Accordingly, this new cell line is apparently suitable for transgenic manipulation, and to study host cell-virus interactions and immune processes. © 2014 The Fisheries Society of the British Isles.

Extinction risk assessment for the species survival plan (SSP) population of the Bali mynah (Leucopsar rothschildi).

Science.gov (United States)

Earnhardt, Joanne M; Thompson, Steven D; Faust, Lisa J

2009-05-01

The Bali mynah Species Survival Plan (SSP), an Association of Zoos and Aquariums program, strives to maintain the genetic and demographic health of its population, avoid unplanned changes in size, and minimize the risk of population extinction. The SSP population meets current demographic and genetic objectives with a population size of 209 birds at 61 institutions and 96% genetic diversity (GD) retained from the source population. However, participating institutions have expressed concerns regarding space allocation, target population size (TPS), breeding restrictions, inbreeding depression, and harvest in relation to future population availability and viability. Based on these factors, we assess five questions with a quantitative risk assessment, specifically a population viability analysis (PVA) using ZooRisk software. Using an individual-based stochastic model, we project potential population changes under different conditions (e.g. changes in TPS and genetic management) to identify the most effective management actions. Our projections indicate that under current management conditions, population decline and extinction are unlikely and that although GD will decline over 100 years the projected loss does not exceed levels acceptable to population managers (less than 90% GD retained). Model simulations indicate that the combination of two genetic management strategies (i.e. priority breeding based on mean kinship and inbreeding avoidance) benefits the retention of GD and reduces the accumulation of inbreeding. The current TPS (250) is greater than necessary to minimize the risk of extinction for the SSP population but any reduction in TPS must be accompanied by continued application of genetic management. If carefully planned, birds can be harvested for transfer to Bali for a reintroduction program without jeopardizing the SSP population.

Applicability of Phytoextraction with Arabidopsis halleri ssp. gemmifera to Remediate Cd-contaminated Andisols

Science.gov (United States)

Kameyama, Koji; Tani, Shigeru; Sugawara, Reiko; Ishikawa, Yuichi

The objective of this study was to investigate the applicability of phytoextraction with a Cd-hyperaccumulator plant (Arabidopsis halleri ssp. gemmifera) to remediate Cd-contaminated Andisols. Cd absorption potentials of this plant for Andisols were examined in pot experiments. Sequentially, phytoextraction durations for remediation of Cd-contaminated Andisols were calculated from the experimental data. The results were as follows: (1) Cd concentrations in the plant shoots ranged from 170-750 mgṡkg-1. (2) Cd absorption of the plant for Andisols with ALC (Autoclaved Lightweight aerated Concrete) was less than for Andisols without ALC. However, the plants absorbed the same amount of soil Cd extracted by 0.01 M HCl with or without ALC. (3) Calculations suggest that the applicability of phytoextraction with this plant is high for slightly contaminated Andisols. Therefore, phytoextraction with Arabidopsis halleri ssp. gemmifera may be a viable option for the remediation of Cd-contaminated Andisols.

Reduced CBF recovery detected by longitudinal 3D-SSP SPECT analyses predicts outcome of postoperative patients after subarachnoid haemorrhage.

Science.gov (United States)

Mutoh, Tatsushi; Totsune, Tomoko; Takenaka, Shunsuke; Tatewaki, Yasuko; Nakagawa, Manabu; Suarez, Jose I; Taki, Yasuyuki; Ishikawa, Tatsuya

2018-02-01

The aim of this study was to evaluate the impact of cerebral blood flow (CBF) recovery obtained from brain single-photon emission computed tomography (SPECT) images on postoperative outcome after aneurysmal subarachnoid haemorrhage (SAH). Twenty-nine patients who had undergone surgical clipping for ruptured anterior communicating artery aneurysms were analyzed prospectively. Routine measurements of CBF were performed using technetium-99 m hexamethyl propyleneamine oxine SPECT on days 4 and 14 after SAH. Regional voxel data analyzed by three dimensional stereotactic surface projection (3D-SSP) were compared between patients and age-matched normal database (NDB). In 3D-SSP analysis of all patients, cortical hypoperfusion around the surgical site in bilateral frontal lobes was evident on day 4 (P SSP SPECT image analyses can be a potential predictor of poor prognosis in postoperative patients after SAH. © 2017 John Wiley & Sons Australia, Ltd.

Effectiveness of Origanum vulgare L. and Origanum majorana L. essential oils in inhibiting the growth of bacterial strains isolated from the patients with conjunctivitis

Directory of Open Access Journals (Sweden)

Jana Luíza Toscano Mendes de Oliveira

2009-02-01

Full Text Available This study aimed to evaluate the antibacterial activity of Origanum vulgare L. and O. majorana L. essential oils on Staphylococcus aureus, S. coagulase negative, Enterobacter spp., Proteus spp., Acinetobacter spp., Klebsiella spp. isolated from the patients with conjunctivitis. The results showed a prominent inhibitory effect of both the essential oils on all the bacterial strains, noted by the large bacterial growth inhibition zones (15-32mm. The Minimum Inhibitory Concentrations (MIC values were between 5-20µL/mL and 2.5-10 µL/mL for O. vulgare and O. majorana essential oil, respectively. The MIC were able to cause significant (PEste estudo objetivou analisar a atividade antibacteriana do óleo essencial de O. vulgare L. and O. majorana L. sobre cepas bacterianas (Staphylococcus aureus, S. coagulase negative, Enterobacter spp., Proteus spp., Acinetobacter spp., Klebsiella spp. isoladas de pacientes com conjuntivite. Os resultados mostraram um destacável efeito inibitório de ambos os óleos essenciais ensaiadossobre todas as cepas bacterianas, notado pela formação de amplas zonas de inibição do crescimento bacteriano (15-32 mm. Os valores de Concentração Inibitória Mínima - CIM encontradas estiveram entre 5-20µL/mL e 2.5-10 µL/mL para o óleo essencial de O. vulgare e O. majorana, respectivamente. Os valores de CIM foram capazes de causar significante efeito inibitório sobre a viabilidade celular de Klebisiella spp., Proteus spp. e S. aureus causando uma total eliminação do inóculo microbiano em um tempo máximo de 24 h de exposição. Estes resultados mostraram a efetividade antibacteriana dos óleos essenciais de O. vulgare e O. majorana, bem como suporta a possibilidade do uso de tais produtos como fontes de compostos antimicrobianos.

Understanding rhizosphere processes to enhance phytoextraction of germanium and rare earth elements

Science.gov (United States)

Wiche, Oliver

2017-04-01

Germanium (Ge) and rare earth elements (REEs) are economically valuable raw materials that are not actually rare in terms of concentrations in soils but they are hardly available for plant uptake due to interactions with organic matter (SOM), secondary soil constituents such as Fe/Mn oxides and P bearing soil fractions. Processes in the rhizosphere might influence availability of Ge and REEs in the soil-plant system, since lowering of the pH and presence of carboxylates and siderophores (small molecules that strongly chelate Fe and other elements) strongly influences the chemical speciation of Ge and REEs in soil and consequently this comprehensive knowledge helps us to improve phytomining. In a series of field and greenhouse experiments 16 plant species from the functional groups of grasses, herbs and legumes were tested with regard to their accumulation efficiency of Ge and REEs in shoots. Subsequently, we conducted mixed culture experiments in which inefficient species (e.g. cereals like Avena sativa, Hordeum vulgare, Panicum miliaceum) were cultivated in mixed cultures with efficient species (Lupinus albus, Lupinus angustifolius). Based on the plant concentrations a principal component analysis (PCA) was performed to identify significant factors that explain the accumulation behavior of different plant species with regard to Ge, REEs, Si, Fe and Mn. In this analysis Mn was used to identify plant species with efficient mechanisms to access sparingly available P-resources in soils. Particularly in nonmycorrhizal species concentrations of Mn in leaves often indicate a carboxylate based P-mobilising strategy. Herbaceous plant species accumulated significantly higher amounts of REEs while grasses accumulated significantly higher amounts of Ge. Concentrations of Ge in shoots of grasses correlated significantly positive with Si, but negatively with concentrations of Mn. Indeed, the results of the PCA clearly show that plants with high Mn concentrations tend to have

Luxury as the opposite of vulgarity:a trio of perspectives on luxury brands

OpenAIRE

Reyneke, Mignon

2011-01-01

This thesis, entitled “Luxury as the opposite of vulgarity: A trio of perspectives on luxury brands” considers luxury brands in a trio of contemporary contexts. Despite the academic research surrounding luxury brands being limited, the existent research most often studies luxury brands in a traditional retail context. That is, luxury is viewed from a perspective where the products are sold in luxury retail stores. However, the landscape that these brands function within has changed significan...

Phytochemical constituents, antioxidant activity, total phenolic and flavonoid contents of Arisarum vulgare seeds

OpenAIRE

Hadjer Kadri; Salah Eddine Djilani; Abdelouaheb Djilani

2013-01-01

Background.Arisarum vulgare is screened and its total phenolic compounds and total flavonoid contents were measured. In addition, the antioxidant capacity of the methanol-water (7:3) extract of this plant is evalu- ated by DPPH (2,2-diphenyl-1 picrylhydrazyl) and ABTS (2,2’-azino-bis(3-ethylbenzothiazoline-6-sulfon- ic)) tests expressed by Vitamin C Equivalent Antioxidant Capacity (VCEAC). HPLC analyses are carried out to identify some polyphenols. The aim of this study is to identify, ...

Acetylcholinesterase inhibitory activity of lycopodane-type alkaloids from the Icelandic Lycopodium annotinum ssp. alpestre

DEFF Research Database (Denmark)

Halldórsdóttir, Elsa Steinunn; Jaroszewski, Jerzy W; Olafsdottir, Elin Soffia

2010-01-01

The aim of this study was to investigate structures and acetylcholinesterase inhibitory activities of lycopodane-type alkaloids isolated from an Icelandic collection of Lycopodium annotinum ssp. alpestre. Ten alkaloids were isolated, including annotinine, annotine, lycodoline, lycoposerramine M...

SSP-002392, a new 5-HT4 receptor agonist, dose-dependently reverses scopolamine-induced learning and memory impairments in C57Bl/6 mice.

Science.gov (United States)

Lo, Adrian C; De Maeyer, Joris H; Vermaercke, Ben; Callaerts-Vegh, Zsuzsanna; Schuurkes, Jan A J; D'Hooge, Rudi

2014-10-01

5-HT4 receptors (5-HT4R) are suggested to affect learning and memory processes. Earlier studies have shown that animals treated with 5-HT4R agonists, often with limited selectivity, show improved learning and memory with retention memory often being assessed immediately after or within 24 h after the last training session. In this study, we characterized the effect of pre-training treatment with the selective 5-HT4R agonist SSP-002392 on memory acquisition and the associated long-term memory retrieval in animal models of impaired cognition. Pre-training treatment with SSP-002392 (0.3 mg/kg, 1.5 mg/kg and 7.5 mg/kg p.o.) dose-dependently inhibited the cognitive deficits induced by scopolamine (0.5 mg/kg s.c.) in two different behavioral tasks: passive avoidance and Morris water maze. In the Morris water maze, spatial learning was significantly improved after treatment with SSP-002392 translating in an accelerated and more efficient localization of the hidden platform compared to scopolamine-treated controls. Moreover, retention memory was assessed 24 h (passive avoidance) and 72 h (Morris water maze) after the last training session of cognitive-impaired animals and this was significantly improved in animals treated with SSP-002392 prior to the training sessions. Furthermore, the effects of SSP-002392 were comparable to galanthamine hydrobromide. We conclude that SSP-002392 has potential as a memory-enhancing compound. Copyright © 2014 Elsevier Ltd. All rights reserved.

Stem rust (Puccinia graminis ssp. graminicola Urban its hosts and harmfulness in grasses grown for seed

Directory of Open Access Journals (Sweden)

Maria Prończuk

2013-12-01

Full Text Available Stem rust development on four species of grasses was studied in field experiments conducted at Radzików in 1997-2001. Population of Puccinia graminis ssp. graminicola from different hosts was characterised and their harmfulness for grass grown for seed was estimated. The materials for study were ecotypes and strains of Lolium perenne, Festuca rubra, Poa pratensis and Deschampsia caespitosa collected in breeding nursery and cultivars and strains of L.perenne, F.rubra, P.pratensis cultivated for seed. It was found that the changes in environmental conditions during last years influenced earlier occurrence of stem rust on grasses in Poland. All examined species were the host of P.graminis ssp. graminicola, however the period of infection of particular hosts were different. L.perenne and D.caespitosa were infected in early summer but F.rubra and P.pratensis in late summer or in the autumn. Morphological analysis of spores of P.graminis ssp. graminicola have shoved significant differences between populations obtained from L.perenne and D.caespitosa. Some differences were found between populations from F.rubra and P.pratensis also, but they need more study. Every year occurrence of stem rust on L.perenne and D.caespitosa and its relation with spring temperature in Radzików indicated that populations of patogen could overwinter in local turf. Incidental appearance of stem rust on F.rubra and P.pratensis in centre of Poland allowed to suppose that spores of these forms might be transfer by wind from other regions. The investigation revealed that stem rust can be dangerous for L.perenne grown for seed when infection occurs at flowering time. It has been established that infection of F.rubra and P.pratensis in autumn should not be disregarded. Damages of leaves by P.graminis ssp. graminicola substantially limited plant heading in the next year.

Instrumental neutron activities analysis of Marrubium vulgare L., a valuable medicinal herb

Energy Technology Data Exchange (ETDEWEB)

Nedjimi, Bouzid [Djelfa Univ. (Algeria). Lab. of Exploration and Valorization of Steppe Ecosystem; Beladel, Brahim [Djelfa Univ. (Algeria). Dept. of Physics

2016-08-01

Twenty two chemical elements were identified by Instrumental neutron activation analysis in Marrubium vulgare (Lamiaceae) a traditional medicine plant, used indigenously in Mediterranean basin to cure several diseases. The precision of the results was assessed by analyzing the certified reference material GBW 07605 (GSV-4) Tea leaves. Results showed that K was the dominant chemical element in studied plant (4.40%). The Ca and Fe mass fractions were also relatively high. However potential toxic elements in this Lamiaceae plant were within the safety limits suggested by WHO/FAO.

Simultaneous genotyping of HPA-17w to -21w by PCR-SSP in Chinese Cantonese.

Science.gov (United States)

Zhou, Haojie; Ding, Haoqiang; Chen, Yangkai; Li, Xiaofan; Ye, Xin; Nie, Yongmei

2015-01-01

Studies have reported the polymorphism of human platelet antigen (HPA)-17w, -18w, -19w, -20w, and -21w. However, the distribution of these five antigens in Chinese Cantonese is still unknown. In this study, we designed new sequence-specific primers for HPA-19w to -21w and used published primers for HPA-17w and -18w to develop a polymerase chain reaction with the sequence-specific primers (PCR-SSP) method for simultaneously genotyping HPA-17w to -21w. A total of 820 unrelated Cantonese apheresis platelet donors in Guangzhou were involved in this study. Among the five HPAs, complete a/a homozygosity was observed for HPA-17w to -20w with an allele frequency of 1.0000. For HPA-21w, nine individuals (9/820, 1.10%) were found to be HPA-21a/bw heterozygous and the allele frequencies of HPA-21a and HPA-21bw were 0.9945 (1631/1640) and 0.0055 (9/1640), respectively. The reliability of the PCR-SSP method was determined by comparing with the genotyping results by DNA sequencing, and no inconsistencies were observed between the two methods. This study provides a reliable PCR-SSP method for simultaneously genotyping HPA-17w to -21w and could improve HPA-matched platelet transfusion in Chinese Cantonese.

CD4 T Cell Dependent Colitis Exacerbation Following Re-Exposure of Mycobacterium avium ssp. paratuberculosis.

Science.gov (United States)

Suwandi, Abdulhadi; Bargen, Imke; Pils, Marina C; Krey, Martina; Zur Lage, Susanne; Singh, Anurag K; Basler, Tina; Falk, Christine S; Seidler, Ursula; Hornef, Mathias W; Goethe, Ralph; Weiss, Siegfried

2017-01-01

Mycobacterium avium ssp. paratuberculosis (MAP) is the causative agent of Johne's disease (JD), a chronic inflammatory bowel disease of cattle characterized by intermittent to chronic diarrhea. In addition, MAP has been isolated from Crohn's disease (CD) patients. The impact of MAP on severity of clinical symptoms in JD as well as its role in CD are yet unknown. We have previously shown that MAP is able to colonize inflamed enteric tissue and to exacerbate the inflammatory tissue response (Suwandi et al., 2014). In the present study, we analyzed how repeated MAP administration influences the course of dextran sulfate sodium (DSS)-induced colitis. In comparison to mice exposed to DSS or MAP only, repeated exposure of DSS-treated mice to MAP (DSS/MAP) revealed a significantly enhanced clinical score, reduction of colon length as well as severe CD4 + T cell infiltration into the colonic lamina propria . Functional analysis identified a critical role of CD4 + T cells in the MAP-induced disease exacerbation. Additionally, altered immune responses were observed when closely related mycobacteria species such as M. avium ssp. avium and M. avium ssp. hominissuis were administered. These data reveal the specific ability of MAP to aggravate intestinal inflammation and clinical symptoms. Overall, this phenotype is compatible with similar disease promoting capabilites of MAP in JD and CD.

Cu,Cr and As determination in preserved woods (Eucalyptus ssp.) by X-ray fluorescence spectrometries

International Nuclear Information System (INIS)

Pereira Junior, Sergio Matias

2014-01-01

Brazil produces around 2.2 millions of cubic meters of treated wood to meet the annual demand of railway, electric, rural and construction sectors. The most used wood species are eucalyptus (Eucalyptus ssp.) and pine (Pinus ssp.).The treated woods used for poles, sleepers, fence posts and plywoods should be according to Brazilian norms requirements. The most usual wood preservative products used in Brazil are CCA (chromated copper arsenate) and CCB (copper chromium and boron salt). The analytical methods, such as flame atomic absorption spectrometry (FAAS), plasma inductively coupled optical emission spectrometry (ICPOES) and X-ray fluorescence spectrometry (XRFS) have been used for the analytical control of those treatment processes. In this work, the eucalyptus trees (Eucalyptus ssp) samples was obtained from Minas Gerais State, Brazil, cut plantation areas. Under pressure, eucalyptus wood samples were submitted to different concentration of CCA solution reaching 3.9, 6.7, 9.1, 12.4 and 14.0 kg of CCA by m-³ sapwood retentions. Samples in cylinders and sawdust forms were obtained from treated wood samples. Copper, chromium and arsenic determination was performed using the energy dispersive X-ray fluorescence spectrometry (EDXRFS), portable X-ray fluorescence spectrometry (PXRFS), flame atomic absorption spectrometry (FAAS) and instrumental neutron activation analysis. In this work, the method of analysis, sensitivity, precision and accuracy performances of the related techniques were outlined. (author)

Attempting to restore mountain big sagebrush (Artemisia tridentata ssp. vaseyana) four years after fire

Science.gov (United States)

Restoration of shrubs is increasingly needed throughout the world because of altered fire regimes, anthropogenic disturbance, and over-utilization. The native shrub mountain big sagebrush (Artemisia tridentata Nutt. ssp. vaseyana (Rydb.) Beetle) is a restoration priority in western North America be...

Antioxidant capacity and total phenolic contents of oregano (Origanum vulgare), lavender (Lavandula angustifolia) and lemon balm (Melissa officinalis) from Romania.

Science.gov (United States)

Spiridon, Iuliana; Colceru, Svetlana; Anghel, Narcis; Teaca, Carmen Alice; Bodirlau, Ruxanda; Armatu, Alice

2011-10-01

The study reported here presents a comparative screening of three medicinal plants including oregano (Origanum vulgare L.), lavender (Lavandula angustifolia) and lemon balm (Melissa officinalis) having the same geographical origin, the Southeast region of Romania, and growing in the same natural conditions. The contents of total phenolics and total flavonoids for the extracts of these were determined. Furthermore, the total antioxidant capacity was also evaluated. It was found that Origanum vulgare and Melissa officinalis extracts present the most effective antioxidant capacity in scavenging DPPH radicals, while Lavandula angustifolia is less active. High performance liquid chromatography-mass spectrometry analysis was used to identify the components of extracts. Major phenolic acids identified in the analysed species were ferulic, rosmarinic, p-coumaric and caffeic, while predominant flavonoids were quercetin, apigenin kaempherol, which were present as glucosides.

Bacillus amyloliquefaciens ssp. plantarum strains as potential protective starter cultures for the production of Bikalga, an alkaline fermented food

DEFF Research Database (Denmark)

Compaor, C.S.; Nielsen, D.S.; Sawadogo-Lingani, H.

2013-01-01

. Methods and Results: The strains were identified by gyrB gene sequencing and phenotypic tests as B. amyloliquefaciens ssp. plantarum. Their antimicrobial activity was determined by the agar spot and well assay, being inhibitory to a wide range of Gram-positive and Gram-negative pathogenic bacteria....... They produced several lipopeptide antibiotics and showed good potential for biological control of Bikalga. Significance and Impact of the Study: Pathogenic bacteria often occur in spontaneous food fermentations. This is the first report to identify indigenous B. amyloliquefaciens ssp. plantarum strains...

GENETIC DIVERSITY OF WINTER BREAD WHEAT (Triticum aestivum L. ssp. vulgare

Directory of Open Access Journals (Sweden)

Sonja Petrović

2011-06-01

Full Text Available Diversity was analyzed based on agronomic and morphologic traits and molecular data. The main objectives of this study were: 1. to estimate genetic diversity of wheat germplasm using agronomic and morphologic traits and molecular markers, 2. to investigate the existence of genetic erosion within tested wheat germplasm, 3. to explore potential utilization of combination of agronomic, morphologic and molecular markers in plant breeding. Forty winter bread wheat varieties were used originating from Croatia, Austria, France, Italy and Russia. Field trial was conducted during two vegetation years (2007/2008, 2008/2009 in three replications according to randomized block design. Ten traits were included in agronomic and morphologic analysis. Composition of high molecular weight glutenin subunits (HMW GS was evaluated for 16 varieties, whereas literature data are used for the rest. Starch composition analysis was based on amylose and amylopectin isolation, their quantity and ratio. For the SSR analysis 26 microsatellite primers were used, and for the AFLP analysis four primer combinations. Statistical analysis was performed using SAS Software 9.1.3, NTSYS ver.2.2., Arlequin ver2.0. and Powermarker ver.3.25. Analyzed varieties displayed highly significant differences (p<0,001 for all agronomic traits and for amylose/amylopectin ratio. High variability of HMW GS was found among varieties. Estimation of genetic diversity based on morphologic and molecular data were used to construct dendograms. AMOVA was used to evaluate variability based on molecular data. Genetic diversity was estimated among and within morphologic and molecular data. SSR and AFLP markers showed efficient discrimination power between highly related genotypes. Significant correlation was found out between two molecular methods which showed more accurate estimate of genetic diversity than by agronomic and morphologic data.

The Effect of Citrus Aurantium, Foeniculum Vulgare and Rosmarinus Officinalis Essential Oils on Peroxidase Activity

OpenAIRE

Maryam Mohajerani (PhD); Afsaneh Aghae i ( MSc )

2016-01-01

Background and objective: Peroxidases catalyze protein oxidation and lipid peroxidation. The activity of these enzymes in nerve cells is involved in causing disorders such as Alzheimer's and Parkinson's disease. This study investigated the effect of Citrus aurantium, Foeniculum vulgare and Rosmarinus officinalis essential oils on activity of peroxidase enzyme. Methods: All three medicinal plants were dried at room temperature. Their essential oil was extracted by steam distillation ...

ICLUS v2.1 land use projections for the Fourth National Climate Assessment (SSP2)

Data.gov (United States)

U.S. Environmental Protection Agency — SSP2 is a “middle-of-the-road” projection, where social, economic and technological trends do not shift markedly from historical patterns, resulting in a U.S....

Surveillance of Campylobacter ssp. in broiler flocks by PCR on boot sock samples

DEFF Research Database (Denmark)

Nordentoft, Steen; Lund, Marianne; Hald, Birthe

on sampling with one pair of boot sock was established. Samples were collected by the farmer app. 10 days before slaughter and send to laboratory for analysis. To detect Campylobacter ssp. in these fecal samples, a PCR based method was established and validated. The assay was developed as a genus specific...

Detection of alien genetic introgressions in bread wheat using dot-blot genomic hybridisation.

Science.gov (United States)

Rey, María-Dolores; Prieto, Pilar

2017-01-01

Simple, reliable methods for the identification of alien genetic introgressions are required in plant breeding programmes. The use of genomic dot-blot hybridisation allows the detection of small Hordeum chilense genomic introgressions in the descendants of genetic crosses between wheat and H. chilense addition or substitution lines in wheat when molecular markers are difficult to use. Based on genomic in situ hybridisation, DNA samples from wheat lines carrying putatively H. chilense introgressions were immobilised on a membrane, blocked with wheat genomic DNA and hybridised with biotin-labelled H. chilense genomic DNA as a probe. This dot-blot screening reduced the number of plants necessary to be analysed by molecular markers or in situ hybridisation, saving time and money. The technique was sensitive enough to detect a minimum of 5 ng of total genomic DNA immobilised on the membrane or about 1/420 dilution of H. chilense genomic DNA in the wheat background. The robustness of the technique was verified by in situ hybridisation. In addition, the detection of other wheat relative species such as Hordeum vulgare , Secale cereale and Agropyron cristatum in the wheat background was also reported .

Effects of combined action of γ-irradiation and sulfur dioxide or N-methyl-N'-nitro-N-nitrosoguanidin on bacteria and higher plants

International Nuclear Information System (INIS)

Kal'chenko, V.A.; Lotareva, O.V.; Spirin, D.A.; Karaban', R.T.; Mal'tseva, L.N.; Ignat'ev, A.A.

1988-01-01

Effect of combined action of of gamma-irradiation and sulfur dioxide or N-methyl-N-nitro-N-nitrosoguanidin on baceria (Bacillus subtilis) and higher plants (Hordeum vulgare L., Pinus sylvestris L.) have been studied. The number of barley germ root cells with chromosomal aberrations depends on the order of treatment with the studied agents. The coefficients of SO 2 and gamma-irradiation correlation fluctuate from 1,3 to 2,6 in the above experiments. In experiments with pine seedlings, these correlation coefficients were similar to additive ones. The data obtained suggest that the pattern of action of the agents is determined by the radiation sensitivity of objects and the order of action of the agents

Long-term rotation and tillage effects on soil structure and crop yield

DEFF Research Database (Denmark)

Munkholm, Lars Juhl; Heck, R; Deen, B

2013-01-01

long-term rotation and tillage treatment experiment on a Canadian silt loam soil. Topsoil measurements were carried out for three different rotations: R1, (C–C–C–C) continuous corn (Zea mays L.), R6, (C–C–O(RC), B(RC)) corn, corn, oats (Avena fatua L.) and spring barley (Hordeum vulgare L.) and R8, (C......–C–S–S) corn, corn, soybean (Glycine max L.), soybean. A red clover (Trifolium pretense L.) cover crop was under seeded in oats and spring barley in R6. In 2010, first year corn was grown in R6 and R8. The tillage treatments included no tillage, NT and mouldboard ploughing, MP. Topsoil structural quality...

Long-Term Effects of Rotational Tillage On Visual Evaluation of Soil Structure, Soil Quality and Crop Yield

DEFF Research Database (Denmark)

Munkholm, Lars Juhl; Heck, Richard; Deen, Bill

year old long-term rotation and tillage treatment experiment on a Canadian silt loam soil. Measurements were carried out in the topsoil for three different rotations: R1 (C-C-C-C) continuous corn (Zea mays L.), R6. (C-C-O(RC), B(RC)) corn, corn, oats (Avena fatua L.) and spring barley (Hordeum vulgare...... L.) and R8, (C-C-S-S) corn, corn, soybean (Glycine max L.), soybean. A red clover (Trifolium pretense L.) cover crop was under seeded in oats and spring barley in R6. In 2010, first year corn was grown in R6 and R8. The tillage treatments included no tillage, NT and mouldboard plowing, MP. Topsoil...

Biochemical and Molecular Characterization of a Barley Seed ß-Glucosidase

DEFF Research Database (Denmark)

Leah, R.; Kigel, J.; Svendsen, I.

1995-01-01

blot analysis with the cDNA as probe indicated that BGQ60 is encoded by a single gene, and that BGQ60 mRNA only accumulates in the starchy endosperm tissue of late developing seeds. The bgq60 structural gene of approximately 5 kilobases contains an open reading frame encoding 485 amino acids...... during barley seed development and germination are discussed.......A 60-kDa ß-glucosidase (BGQ60) was purified and characterized from seeds of barley (Hordeum vulgare L.). BGQ60 catalytic activity was restricted to the cleavage of short-chain oligosaccharides composed of(1, 2) -,(1, 2, 3) -, and/or(1, 2, 3, 4) -ß-linked glucose or mannose units...

Labeled Azospirillum brasilense wild type and excretion-ammonium strains in association with barley roots.

Science.gov (United States)

Santos, Adrian Richard Schenberger; Etto, Rafael Mazer; Furmam, Rafaela Wiegand; Freitas, Denis Leandro de; Santos, Karina Freire d'Eça Nogueira; Souza, Emanuel Maltempi de; Pedrosa, Fábio de Oliveira; Ayub, Ricardo Antônio; Steffens, Maria Berenice Reynaud; Galvão, Carolina Weigert

2017-09-01

Soil bacteria colonization in plants is a complex process, which involves interaction between many bacterial characters and plant responses. In this work, we labeled Azospirillum brasilense FP2 (wild type) and HM053 (excretion-ammonium) strains by insertion of the reporter gene gusA-kanamycin into the dinitrogenase reductase coding gene, nifH, and evaluated bacteria colonization in barley (Hordeum vulgare). In addition, we determined inoculation effect based on growth promotion parameters. We report an uncommon endophytic behavior of A. brasilense Sp7 derivative inside the root hair cells of barley and highlight the promising use of A. brasilense HM053 as plant growth-promoting bacterium. Copyright © 2017 Elsevier Masson SAS. All rights reserved.

The Possible Protective Role of Foeniculum vulgare Mill. Against Radiation-Induced Certain Biochemical Changes in Albino Rats

International Nuclear Information System (INIS)

Mohammed, M.M.A.

2010-01-01

This study was conducted to evaluate the modulating efficacy of prolonged oral administration of Foeniculum vulgare Mill. essential oil (FEO) against gamma irradiation-induced biochemical changes in male rats. Essential oil of Foeniculum vulgare Mill. was orally administrated at dose level of 250 mg/kg body wt/day for 21 days before irradiation and 7 days post exposure (6.5 Gy single dose). Rats exposed to ionizing radiation exhibited a potential elevation of serum aspartate aminotransferase (AST) and alkaline phosphatase (ALP) activities, bilirubin, urea and creatinine levels, lipid abnormalities, and an increase in tissue lipid peroxidation (LPO) and metallothioneins (MTs). On the other hand, noticeable drop in liver and kidney glutathione content and serum total protein, albumin and testosterone levels were recorded. Tissue organs displayed some changes in trace element concentrations, which may be due to the radiation ability to induce oxidative stress. The data obtained from rats treated with fennel oil before and after whole body gamma irradiation revealed significant modulation in the biochemical tested parameters and profound improvement in the activity of antioxidant status, glutathione and metallothioneins. The treatment of irradiated rats with fennel oil also appeared to be effective in minimizing the radiation-induced increase in lipid peroxidation as well as changes in essential trace elements in some tissue organs. In addition to its containing many chemical antioxidant constituents such as polyphenols, fennel was found to contain detectable concentrations of essential trace elements (Zn, Cu, Fe, Se, Mg, Mn and Ca) which may be involved in multiple biological processes as constituents of enzymes system including superoxide dismutase (Cu, Zn, Mn, SODs), oxide reductase, glutathione (GSP, GSH, GST), metallothionein MTs, etc. Overall, it could be concluded that Foeniculum vulgare Mill. essential oil exerts beneficial protective role against radiation

RNA-seq Analysis of Cold and Drought Responsive Transcriptomes of Zea mays ssp. mexicana L.

Science.gov (United States)

Lu, Xiang; Zhou, Xuan; Cao, Yu; Zhou, Meixue; McNeil, David; Liang, Shan; Yang, Chengwei

2017-01-01

The annual Zea mays ssp. mexicana L. is a member of teosinte, a wild relative of the Zea mays spp. mays L. This subspecies has strong growth and regeneration ability, high tiller numbers, high protein and lysine content as well as resistance to many fungal diseases, and it can be effectively used in maize improvement. In this study, we reported a Zea mays ssp. mexicana L. transcriptome by merging data from untreated control (CK), cold (4°C) and drought (PEG2000, 20%) treated plant samples. A total of 251,145 transcripts (N50 = 1,269 bp) and 184,280 unigenes (N50 = 923 bp) were predicted, which code for homologs of near 47% of the published maize proteome. Under cold conditions, 2,232 and 817 genes were up-regulated and down-regulated, respectively, while fewer genes were up-regulated (532) and down-regulated (82) under drought stress, indicating that Zea mays ssp. mexicana L. is more sensitive to the applied cold rather than to the applied drought stresses. Functional enrichment analyses identified many common or specific biological processes and gene sets in response to drought and cold stresses. The ABA dependent pathway, trehalose synthetic pathway and the ICE1-CBF pathway were up-regulated by both stresses. GA associated genes have been shown to differentially regulate the responses to cold in close subspecies in Zea mays . These findings and the identified functional genes can provide useful clues for improving abiotic stress tolerance of maize.

An Acylated Kaempferol Glycoside from Flowers of Foeniculum vulgare and F. Dulce

OpenAIRE

Soliman, Fathy M.; Shehata, Afaf H.; Khaleel, Amal E.; Ezzat, Shahera M.

2002-01-01

An acylated kaempferol glycoside, namely kaempferol-3-O-α-L-(2”,3”-di-E-pcoumaroyl)-rhamnoside (1) was isolated from the flowers of Foeniculum vulgare Mill. and F. dulce DC. It is thus isolated for the first time from family Apiaceae. In addition, the different organs of both plants afforded six flavonoid glycosides - namely afzelin (kaempferol-3-O-α-L-rhamnoside) (2), quercitrin (3), isorhamnetin-3-O-β-D-glucoside (4), isoquercitrin (5), rutin (6), and miquelianin (quercetin-3...

Purification and partial characterization of bacteriocin produced by Lactococcus lactis ssp. lactis LL171.

Science.gov (United States)

Kumari, Archana; Akkoç, Nefise; Akçelik, Mustafa

2012-04-01

Lactic acid bacteria (LAB) are possessing ability to synthesize antimicrobial compounds (like bacteriocin) during their growth. In this regard, novel bacteriocin compound secreting capability of LAB isolated from Tulum Cheese in Turkey was demonstrated. The synthesized bacteriocin was purified by ammonium sulphate precipitation, dialysis and gel filtration. The molecular weight (≈3.4 kDa) of obtained bacteriocin was confirmed by SDS-PAGE, which revealed single peptide band. Molecular identification of LAB strain isolated from Tulum Cheese was conducted using 16S rDNA gene sequencing as Lactococcus lactis ssp. lactis LL171. The amino acid sequences (KKIDTRTGKTMEKTEKKIELSLKNMKTAT) of the bacteriocin from Lactococcus lactis ssp. lactis LL171 was found unique and novel than reported bacteriocins. Further, the bacteriocin was possessed the thermostable property and active at wide range of pH values from 1 to 11. Thus, bacteriocin reported in this study has the potential applications property as food preservative agent.

Modernization vs. vulgarization in online fashion luxury : how is internet impacting luxury brand equity ?

OpenAIRE

Marrão, Ana Rita Galante de Abreu

2016-01-01

The Internet became an inherent part of people’s daily life and the major source of transformation in the relation between consumers and brands. However, in the luxury branding context, the introduction of prestige brands into a mass channel such as the Internet might bring the risk of vulgarization, loss of control over the brand, loss of the high-luxury appeal, jeopardizing brand equity. Hence, the present thesis paper proposes to answer the dilemma between the imperative of going online an...

Improving nitrogen use efficiency in barley (Hordeum vulgare L.) through the cisgenic approach

DEFF Research Database (Denmark)

Kichey, Thomas Michel René; Holme, Inger; Møller, Inge Skrumsager

2009-01-01

into the pGreenII binary vector. The genes have been inserted into barley by Agrobacterium-mediated transformation using the hygromycin phosphotransferase gene for selection of transformed lines on hygromycin. In this system, the resistance gene is placed on the helper plasmid pSoup allowing for separate...

Diversity for seedling vigor in wild barley (hordeum vulgare L. subs. simpatina) germplasm

International Nuclear Information System (INIS)

Tyagi, K.; Park, M.R.; Lee, H.J.; Lee, C.A.; Rehman, S.; Steffenson, B.; Lee, K.J.; Yun, S.J.

2011-01-01

Seedling vigor is important for improving stand establishment of barley crops, particularly in arid regions and areas where the soil temperature is low at sowing time. Three hundred and fifteen wild barley accessions from the Wild Barley Diversity Collection (WBDC) were evaluated for nine seedling vigor traits in a poly house and growth chamber under hydroponic conditions. The accessions exhibited significant differences for all traits investigated. Traits showing greatest phenotypic variation were seedling visual score, plant height, shoot fresh weight, shoot dry weight and shoot length. Seed weight exhibited the least variation. Seed weight was significantly correlated with visual seedling score and shoot and seedling fresh and dry weight. Correlation analysis showed that the visual seedling score was a reliable method for estimating seedling vigor in wild barley. The first three principal components (PC) explained 82.3% of the variation present in the WBDC with PC1(54.0%) associated with shoot fresh weight, shoot dry weight, seedling dry weight, seedling fresh weight, shoot length and seedling length. Accessions from the southwest portion of the Fertile Crescent, like WBDC020 (Turkey), WBDC238 (Jordan) and WBDC244 (Jordan) exhibited the highest positive values for most of the plant vigor traits investigated. These wild barley accessions likely carry alleles that will be useful for the improvement of plant vigor traits in cultivated barley. (author)

Construction of a map-based reference genome sequence for barley, Hordeum vulgare L.

Czech Academy of Sciences Publication Activity Database

Beier, S.; Himmelbach, A.; Colmsee, C.; Zhang, X. Q.; Barrero, R. A.; Hastie, A.; Šimková, Hana; Staňková, Helena; Vrána, Jan; Chan, S.; Zhou, G.; Poland, J.; Bellgard, M. I.; Houben, A.; Doležel, Jaroslav; Ayling, S.; Lonardi, S.; Scholz, U.; Stein, N.; Mascher, M.

2017-01-01

Roč. 4, APR 27 (2017), č. článku 170044. ISSN 2052-4463 R&D Projects: GA MŠk(CZ) LO1204 Institutional support: RVO:61389030 Keywords : BACTERIAL ARTIFICIAL CHROMOSOMES * PHYSICAL MAP * LIBRARIES Subject RIV: EB - Genetics ; Molecular Biology OBOR OECD: Plant sciences, botany Impact factor: 4.836, year: 2016

Impact of mineral fertilizers on common winter barley (Hordeum vulgare L. agrophytocenosis development

Directory of Open Access Journals (Sweden)

Я. М. Мукан

2014-04-01

Full Text Available In 2011 to 2013 a study was completed for the impact of varying rates of fertilizing onto the indices of productivity for barley agrophytocenosis of Helios and Commandor, in particular, such its components as a number of productive stems, number of seeds per ear, potential biological activity of ear and photosynthetic apparatus. It is found that the level of spring barley agrophytocenosis productivity is subject both to varietal peculiarities and the rate of mineral fertilizer application. When applying N 60P 60K 60 і N 90P 90K 90 the highest potential and biological productivity of Helios and Commandor was recorder as compared against the control. Impact of varying application rates for fertilizers onto the components of ear biological productivity has been scrutinized. The qualitative composition of ear is a clear expression of variety phenotype and identifies the level of biological yield for spring barley. Application of N 60 P 60 K 60 і N 90 P 90 K 90 mineral fertilizers fairly increased the average leaf surface, photosynthetic lead capacity of varieties in 2 to 2.5 times, as well as FAR efficiency coefficient in 1.5 to 2.0 times as against control that thus contributed to the development of highest biological yield of Helios variety phytomass at the level of 14.9 to 15.0, grain – 7.8 to 8.0 ton per ha and, respectively, 12.7 and 7.5 tons per ha for Comandor variety.

Effect of gamma irradiation (60CO) on quatitative characters of barley (Hordeum vulgare)

International Nuclear Information System (INIS)

Santana, T.C.; Gonzalez, F.C.

1984-01-01

Seeds od f a barley line were irradiated with doses ranging from O to 64 Kr of gamma radiation for three consecutive generations (R1,R2 and R3). From these, several mutant generations were obtained in the field, planting at a commercial density and without selection. (M.A.C.) [pt

AFLP marker linked to water-stress-tolerant bulks in barley (Hordeum vulgare L.

Directory of Open Access Journals (Sweden)

A. Altinkut

2003-01-01

Full Text Available The amplified fragment length polymorphism (AFLP assay is an efficient method for the identification of molecular markers, useful in the improvement of numerous crop species. Bulked Segregant Analysis (BSA was used to identify AFLP markers associated with water-stress tolerance in barley, as this would permit rapid selection of water-stress tolerant genotypes in breeding programs. AFLP markers linked to water-stress tolerance was identified in two DNA pools (tolerant and sensitive, which were established using selected F2 individuals resulting from a cross between water-stress-tolerant and sensitive barley parental genotypes, based on their paraquat (PQ tolerance, leaf size, and relative water content (RWC. All these three traits were previously shown to be associated with water-stress tolerance in segregating F2 progeny of the barley cross used in a previous study. AFLP analysis was then performed on these DNA pools, using 40 primer pairs to detect AFLP fragments that are present/absent, respectively, in the two pools and their parental lines. One separate AFLP fragment, which was present in the tolerant parent and in the tolerant bulk, but absent in the sensitive parent and in the sensitive bulk, was identified. Polymorphism of the AFLP marker was tested among tolerant and sensitive F2 individuals. The presence of this marker that is associated with water-stress tolerance will greatly enhance selection for paraquat and water-stress tolerant genotypes in future breeding programs.

Development and characterization of polymorphic EST based SSR markers in barley (Hordeum vulgare).

Science.gov (United States)

Jo, Won-Sam; Kim, Hye-Yeong; Kim, Kyung-Min

2017-08-01

In barley, breeding using good genetic characteristics can improve the quality or quantity of crop characters from one generation to the next generation. The development of effective molecular markers in barley is crucial for understanding and analyzing the diversity of useful alleles. In this study, we conducted genetic relationship analysis using expressed sequence tag-simple sequence repeat (EST-SSR) markers for barley identification and assessment of barley cultivar similarity. Seeds from 82 cultivars, including 31 each of naked and hulled barley from the Korea Seed and Variety Service and 20 of malting barley from the RDA-Genebank Information Center, were analyzed in this study. A cDNA library of the cultivar Gwanbori was constructed for use in analysis of genetic relationships, and 58 EST-SSR markers were developed and characterized. In total, 47 SSR markers were employed to analyze polymorphisms. A relationship dendrogram based on the polymorphism data was constructed to compare genetic diversity. We found that the polymorphism information content among the examined cultivars was 0.519, which indicates that there is low genetic diversity among Korean barley cultivars. The results obtained in this study may be useful in preventing redundant investment in new cultivars and in resolving disputes over seed patents. Our approach can be used by companies and government groups to develop different cultivars with distinguishable markers. In addition, the developed markers can be used for quantitative trait locus analysis to improve both the quantity and the quality of cultivated barley.

Global cost analysis on adaptation to sea level rise based on RCP/SSP scenarios

Science.gov (United States)

Kumano, N.; Tamura, M.; Yotsukuri, M.; Kuwahara, Y.; Yokoki, H.

2017-12-01

Low-lying areas are the most vulnerable to sea level rise (SLR) due to climate change in the future. In order to adapt to SLR, it is necessary to decide whether to retreat from vulnerable areas or to install dykes to protect them from inundation. Therefore, cost- analysis of adaptation using coastal dykes is one of the most essential issues in the context of climate change and its countermeasures. However, few studies have globally evaluated the future costs of adaptation in coastal areas. This study tries to globally analyze the cost of adaptation in coastal areas. First, global distributions of projected inundation impacts induced by SLR including astronomical high tide were assessed. Economic damage was estimated on the basis of the econometric relationship between past hydrological disasters, affected population, and per capita GDP using CRED's EM-DAT database. Second, the cost of adaptation was also determined using the cost database and future scenarios. The authors have built a cost database for installed coastal dykes worldwide and applied it to estimating the future cost of adaptation. The unit costs of dyke construction will increase with socio-economic scenario (SSP) such as per capita GDP. Length of vulnerable coastline is calculated by identifying inundation areas using ETOPO1. Future cost was obtained by multiplying the length of vulnerable coastline and the unit cost of dyke construction. Third, the effectiveness of dyke construction was estimated by comparing cases with and without adaptation.As a result, it was found that incremental adaptation cost is lower than economic damage in the cases of SSP1 and SSP3 under RCP scenario, while the cost of adaptation depends on the durability of the coastal dykes.

Population Growth of Rhopalosiphum padi L. (Homoptera: Aphididae on Different Cereal Crops from the Semiarid Pampas of Argentina under Laboratory Conditions Crecimiento Poblacional de Rhopalosiphum padi L. (Homoptera: Aphididae sobre Diferentes Cereales de la Pampas Semiárida de Argentina en Condiciones de Laboratorio

Directory of Open Access Journals (Sweden)

Lilian R Descamps

2011-09-01

Full Text Available The bird cherry-oat aphid Rhopalosiphum padi L. (Homoptera: Aphididae is one of the main pests in a number of crops in the semiarid Pampas of Argentina. In the present study, the effect of different host plants, including Triticum aestivum L., ×Triticosecale Wittm., Hordeum vulgare L., Hordeum distichum L., Avena sativa L., and Secale cereale L. on biological parameters of R. padi L. was studied in the laboratory at 24 ± 1 °C, 65 ± 10% RH and a 14:10 photoperiod. Longevity, intrinsic rate of natural increase (r m, net reproductive rate (R0, mean generation time (T, doubling time (DT, and finite rate of increase (λ of the bird cherry-oat aphid on the different cereal crops were estimated. Differences in fertility life table parameters of R. padi among host plants were analyzed using pseudo-values, which were produced by Jackknife re-sampling. Results indicated that beer barley might be the most suitable food for R. padi due to greater adult longevity (20.88 d, higher fecundity (41 nymphs female-1, higher intrinsic rate of natural increase (0.309 females female-1 d-1, lower doubling time (2.24, and lower nymphal mortality (22.2%. Therefore, it can be concluded from the present study that R. padi prefers beer barley for fast and healthy development over other cereal crops.El áfido Rhopalosiphum padi L. (Homoptera: Aphididae es una de las principales plagas de numerosos cultivos de la región semiárida pampeana de Argentina. En el presente trabajo se estudió el efecto de diferentes cereales incluidos Triticum aestivum L., ×Triticosecale Wittm., Hordeum vulgare L., Hordeum distichum L., Avena sativa L. and Secale cereale L. sobre los parámetros biológicos de R. padi en laboratorio. Se estimaron longevidad, tasa intrínseca de crecimiento natural (r m, tasa neta de reproducción (R0, tiempo generacional medio (T, tiempo de duplicación (TD, y tasa finita de incremento (λ del pulgón de la avena en diferentes cereales. Las diferencias de

Serological comparison of selected isolates of Aeromonas salmonicida ssp. Salmonicida

Science.gov (United States)

Hahnel, G.B.; Gould, R.W.; Boatman, E.S.

1983-01-01

Eight isolates of Acronionus salmonicida ssp. salmonicida were collected during furunculosis epizootics in North American Pacific coast states and provinces. Both virulent and avirulent forms of each isolate, confirmed by challenge and electron microscopy, were examined. Serological comparisons by cross-absorption agglutination tests revealed no serological differences between isolates. Using the double diffusion precipitin test, a single band was observed when antigen from a sonicated virulent strain was reacted with antiserum against a sonicated, virulent strain absorbed with homologous, avirulent strain. The presence of the single band was eliminated by excess sonication.

When GIS zooms in: spatio-genetic maps of multipaternity in Armadillidium vulgare.

Science.gov (United States)

Bech, Nicolas; Depeux, Charlotte; Durand, Sylvine; Debenest, Catherine; Lafitte, Alexandra; Beltran-Bech, Sophie

2017-12-01

Geographic information system (GIS) tools are designed to illustrate, analyse and integrate geographic or spatial data, usually on a macroscopic scale. By contrast, genetic tools focus on a microscopic scale. Because in reality, landscapes have no predefined scale, our original study aims to develop a new approach, combining both cartographic and genetic approaches to explore microscopic landscapes. For this, we focused on Armadillidium vulgare, a terrestrial isopod model in which evolutionary pressures imposed by terrestrial life have led to the development of internal fertilisation and, consequently, to associated physiological changes. Among these, the emergence of internal receptacles, found in many taxa ranging from mammals to arthropods, allowed females to store sperm from several partners, enabling multipaternity. Among arthropods, terrestrial isopods like the polygynandrous A. vulgare present a female structure, the marsupium, in which fertilised eggs migrate and develop into mancae (larval stage). To test our innovative combined approach, we proposed different males to four independent females, and at the end of incubation in the marsupium, we mapped (using GIS methods) and genotyped (using 12 microsatellite markers) all the incubated mancae. This methodology permitted to obtain spatio-genetic maps describing heterozygosity and spatial distribution of mancae and of multipaternity within the marsupial landscape. We discussed the interest of this kind of multidisciplinary approach which could improve in this case our understanding of sexual selection mechanisms in this terrestrial crustacean. Beyond the interesting model-focused insights, the main challenge of this study was the transfer of GIS techniques to a microscopic scale and our results appear so as pioneers rendering GIS tools available for studies involving imagery whatever their study scale.

Carlos Jansen and the literary vulgarization for the youth

Directory of Open Access Journals (Sweden)

Lia Araujo Miranda Lima

2015-12-01

Full Text Available In this article we study the translations of Carlos Jansen for the youth, age group corresponding approximately to the contemporary concepts of preadolescence and adolescence, made at the end of the 19th century. Jansen was a pioneer in translating into Brazilian Portuguese works for the youth among which novels by Swift, Defoe, and Cervantes. His widely adapted versions had a pedagogical goal, serving as a reading material for children and adolescents attending schools. For this reason he was called a "vulgarizer" by critics of that period. The research encompassed the analysis of newspapers published between 1880 and 1899, available at the National Library's Hemeroteca Digital Brasileira, which provide data on the advertising and reception of his works. We intend to enrich historical research on children's literature in Brazil and analyse to what degree Jansen's pedagogical project has governed his translation practice.

Biorremediation of soil polluted by 75000 ppm of waste motor oil applying biostimulation and phytoremediation with Sorghum vulgare and Bacillus cereus or Burkholderia cepacia

Directory of Open Access Journals (Sweden)

Balderas-León Iván

2015-02-01

Full Text Available Waste motor oil (WMO pollutes soil and causing lost soil fertility. An alternative to solve this problem its bioremediation (BR by double and following biostimulation (BS with mineral solution (MS and a legume as green manure (GM then using phytoremediation (PR with growth promoting vegetal bacteria (GPVB like Bacillus cereus and Burkholderia cepacia to minimize remaining WMO. The aims of this research were: a bioremediation of polluted soil by 75000 ppm of WMO by biostimulation and then b Its phytoremediation for remaining WMO by Sorghum vulgare inoculated with B. cereus and B. cepacia. Soil polluted by high concentration WMO was biostimulated with MS, and then Phaseolus vulgaris treated by GPVB was incorporated as GM, finally to apply PR to eliminate WMO with S. vulgare with GPVB. Results indicate that soil bioremediated by biostimulation with MS, WMO decreased at 32500 ppm/30 days, and then with GM, WMO was reduced at 10100 ppm after/90 days. Finally, to apply phytoremediation using S. vulgare and GPVB at flowering, WMO was reduced from 2500 ppm to 800 ppm. For recovering soil impacted by high concentration WMO to apply both techniques double and following BS and PR are the best option than each technique separately.

The extracellular phage-host interactions involved in the bacteriophage LL-H infection of Lactobacillus delbrueckii ssp. lactis ATCC 15808.

Science.gov (United States)

Munsch-Alatossava, Patricia; Alatossava, Tapani

2013-12-24

The complete genome sequence of Lactobacillus bacteriophage LL-H was determined in 1996. Accordingly, LL-H has been used as a model phage for the infection of dairy Lactobacillus, specifically for thermophilic Lactobacillus delbrueckii ssp. lactis host strains, such as ATCC 15808. One of the major goals of phage LL-H research consisted of the characterization of the first phage-host interactions at the level of phage adsorption and phage DNA injection steps to determine effective and practical methods to minimize the risks associated with the appearance and attack of phages in the manufacture of yogurt, and Swiss or Italian hard type cheeses, which typically use thermophilic lactic acid bacteria starter cultures containing L. delbrueckii strains among others. This mini review article summarizes the present data concerning (i) the special features, particle structure, and components of phage LL-H and (ii) the structure and properties of lipoteichoic acids (LTAs), which are the phage LL-H receptor components of L. delbrueckii ssp. lactis host strains. Moreover, a model of the first, extracellular, phage-host interactions for the infection of L. delbrueckii ssp. lactis ATCC 15808 by phage LL-H is presented and further discussed.

The extracellular phage-host interactions involved in the bacteriophage LL-H infection of Lactobacillus delbrueckii ssp. lactis ATCC 15808

Directory of Open Access Journals (Sweden)

Patricia eMunsch-Alatossava

2013-12-01

Full Text Available The complete genome sequence of Lactobacillus bacteriophage LL-H was determined in 1996. Accordingly, LL-H has been used as a model phage for the infection of dairy Lactobacillus, specifically for thermophilic Lb. delbrueckii ssp. lactis host strains, such as ATCC 15808. One of the major goals of phage LL-H research consisted of the characterization of the the first phage-host interactions at the level of phage adsorption and phage DNA injection steps to determine effective and practical methods to minimise the risks associated with the appearance and attack of phages in the manufacture of yoghurt, and Swiss or Italian type hard cheeses, which typically use thermophilic LAB starter cultures containing Lb. delbrueckii strains among others. This mini review article summarises the present data concerning (i the special features, particle structure and components of phage LL-H and (ii the structure and properties of lipoteichoic acids (LTAs, which are the phage LL-H receptor components of Lb. delbrueckii ssp. lactis host strains. Moreover, a model of the first, extracellular, phage-host interactions for the infection of Lb. delbrueckii ssp. lactis ATCC 15808 by phage LL-H is presented and further discussed.

Genetic (RAPD) diversity between Oleria onega agarista and Oleria onega ssp. (Ithomiinae, Nymphalidae, Lepidoptera) in north-eastern Peru.

Science.gov (United States)

Gallusser, S; Guadagnuolo, R; Rahier, M

2004-05-01

Oleria onega agarista Felder and Felder and Oleria onega ssp. nov. are two Ithomiinae subspecies from north-eastern Peru, that differ for some morphological and behavioural traits. Two contact zones are known near the town of Tarapoto: Ahuashiyacu, where both subspecies cohabit but do not seem to hybridise, and Estero (near the village of Shapaja), where they apparently hybridise. Genetic differences between the two subspecies and between populations were investigated with random amplified polymorphic DNA (RAPD) markers. Both Cluster and Principal Coordinates Analyses (CCoA and PCoA) performed using these data, provided a clear but weak discrimination between the two subspecies. Genetic diversity is much higher within the populations than between them. Moreover, the geographically more distant populations are grouped together by the genetic data. Morphological traits on the wing patterns of the hybrids are intermediary between the two butterflies subspecies, while RAPDs data place them closer to O. onega agarista than to O. onega ssp. The individuals of the Ahuashiyacu population are clearly separated into two groups, those of O. onega ssp. and O. onega agarista, by both morphology and RAPDs data. Moreover, none of those individuals show RAPD similarity with the hybrids, suggesting that hybridisation has not occurred in this population.

Efectividad de la crema de Aloe vera en pacientes con psoriasis vulgar de la Parroquia San Fernando

Directory of Open Access Journals (Sweden)

Yoisel Belen Ruiz

2014-10-01

Full Text Available Se realizó un estudio de intervención terapéutica en 20 pacientes con psoriasis vulgar, pertenecientes a la Parroquia San Fernando, en Montes, Estado Sucre (Venezuela, de mayo a diciembre del 2013, quienes fueron seleccionados aleatoriamente y asignados en 2 grupos de idéntica cantidad de integrantes: el de control, que utilizó medicación convencional con triamcinolona, y el de estudio, que recibió tratamiento tópico con crema de Aloe vera (sábila de base inerte; a fin de determinar la efectividad de esta última. Para establecer la comparación entre ambos grupos, se emplearon técnicas no paramétricas debido al número reducido de pacientes, y siempre se consideró un nivel de significación de 0,05. Se obtuvo que la modalidad terapéutica con crema de sábila fuera tan efectiva como la aplicación de la triamcinolona, pero a diferencia de esta última, no presentó reacciones adversas. Así, pudo concluirse que la terapia con Aloe vera es efectiva para tratar pacientes con psoriasis vulgar

Potential SSP Perfluorooctanoic Acid Related Fluoropolymer Materials Obsolescence

Science.gov (United States)

Segars, Matt G.

2006-01-01

The Shuttle Environmental Assurance Initiative (SEA) has identified a potential for the Space Shuttle Program (SSP) to incur materials obsolescence issues due to agreements between the fluoro-chemical industry and the United States Environmental Protection Agency (USEPA) to participate in a Global Stewardship Program for perfluorooctanoic acid (PFOA). This presentation will include discussions of the chemistry, regulatory drivers, affected types of fluoropolymer and fluoroelastomer products, timeline for reformulations, and methodology for addressing the issue. It will cover the coordination of assessment efforts with the International Space Station and Head Quarters Air Force Space Command, along with some examples of impacted materials. The presentation is directed at all members of the international aerospace community concerned with identifying potential environmentally driven materials obsolescence issues.

School Teams up for SSP Functional Models

Science.gov (United States)

Pignolet, G.; Lallemand, R.; Celeste, A.; von Muldau, H.

2002-01-01

Space Solar Power systems appear increasingly as one of the major solutions to the upcoming global energy crisis, by collecting solar energy in space where this is most easy, and sending it by microwave beam to the surface of the planet, where the need for controlled energy is located. While fully operational systems are still decades away, the need for major development efforts is with us now. Yet, for many decision-makers and for most of the public, SSP often still sounds like science fiction. Six functional demonstration systems, based on the Japanese SPS-2000 concept, have been built as a result of a cooperation between France and Japan, and they are currently used extensively, in Japan, in Europe and in North America, for executive presentations as well as for public exhibitions. There is demand for more models, both for science museums and for use by energy dedicated groups, and a senior high school in La Reunion, France, has picked up the challenge to make the production of such models an integrated practical school project for pre-college students. In December 2001, the administration and the teachers of the school have evaluated the feasibility of the project and eventually taken the go decision for the school year 2002- 2003, when for education purposes a temporary "school business company" will be incorporated with the goal to study and manufacture a limited series of professional quality SSP demonstration models, and to sell them world- wide to institutions and advocacy groups concerned with energy problems and with the environment. The different sections of the school will act as the different services of an integrated business : based on the current existing models, the electronic section will redesign the energy management system and the microwave projector module, while the mechanical section of the school will adapt and re-conceive the whole packaging of the demonstrator. The French and foreign language sections will write up a technical manual for

Essential Oil from Origanum vulgare Completely Inhibits the Growth of Multidrug-Resistant Cystic Fibrosis Pathogens.

Science.gov (United States)

Pesavento, Giovanna; Maggini, Valentina; Maida, Isabel; Lo Nostro, Antonella; Calonico, Carmela; Sassoli, Chiara; Perrin, Elena; Fondi, Marco; Mengoni, Alessio; Chiellini, Carolina; Vannacci, Alfredo; Gallo, Eugenia; Gori, Luigi; Bogani, Patrizia; Bilia, Anna Rita; Campana, Silvia; Ravenni, Novella; Dolce, Daniela; Firenzuoli, Fabio; Fani, Renato

2016-06-01

Essential oils (EOs) are known to inhibit the growth of a wide range of microorganisms. Particularly interesting is the possible use of EOs to treat multidrug-resistant cystic fibrosis (CF) pathogens. We tested the essential oil (EO) from Origanum vulgare for in vitro antimicrobial activity, against three of the major human opportunistic pathogens responsible for respiratory infections in CF patients; these are methicillin-resistant Staphylococcus aureus, Stenotrophomonas maltophilia and Achromobacter xylosoxidans. Antibiotic susceptibility of each strain was previously tested by the standard disk diffusion method. Most strains were resistant to multiple antibiotics and could be defined as multi-drug-resistant (MDR). The antibacterial activity of O. vulgare EO (OEO) against a panel of 59 bacterial strains was evaluated, with MIC and MBC determined at 24, 48 and 72 hours by a microdilution method. The OEO was effective against all tested strains, although to a different extent. The MBC and MIC of OEO for S. aureus strains were either lower or equal to 0.50%, v/v, for A. xylosoxidans strains were lower or equal to 1% and 0.50%, v/v, respectively; and for S. maltophilia strains were lower or equal to 0.25%, v/v. The results from this study suggest that OEO might exert a role as an antimicrobial in the treatment of CF infections.

Pólen 2n e mecanismos meióticos de formação em Solanum commersonii ssp 2n pollen and meiotic mechanisms of Formation in Solanum commersonii ssp

Directory of Open Access Journals (Sweden)

Lívia Gracielle Oliveira Tomé

2009-04-01

Full Text Available Solanum commersonii subsp. commersonii Dun. e Solanum commersonii subsp. malmeanum Bitt. (2n=2x=24 - 1EBN não podem ser diretamente cruzadas com a batata cultivada de S. tuberosum subsp. tuberosum L. (2n=4x=48 -4 EBN em razão da barreira da ploidia e do número de equilíbrio do endosperma (EBN. No entanto, a produção de pólen não reduzido por S. commersonii ssp. (2x=2n=24 - 1EBN, permite o cruzamento desta com dihaplóides de batata e com as espécies diplóides S. phureja Juz. & Bukasov. e S. chacoense Bitt., que possuem 2 EBN. Conduziu-se este trabalho, com o objetivo de determinar o mecanismo meiótico e a freqüência dos grãos de pólen não reduzidos em cinco clones de Solanum commersonii ssp. Foram avaliados três clones de S. commersonii subsp. commersonii (SCC e dois de S. commersonii subsp. malmeanum (SCM. Nas avaliações, duzentos grãos de pólen viáveis foram corados (carmim acético 2% e mensurados, sendo considerados não reduzidos aqueles com o diâmetro igual ou superior a 25 µm. O clone Solanum commersonii subsp. commersonii Dun. (SCC 100 produz 26.1% de polen não reduzido, por fusos fundidos e fusos paralelos, o qual pode ser utilizado em programas de melhoramento.Solanum commersonii subsp. commersonii Dun. and Solanum commersonii subsp. malmeanum Bitt. (2n=2x=24 -1EBN cannot be directly crossed with the cultivated Solanum tuberosum subsp. Tuberosum L. (2n=4x=48 - 4EBN species due to ploidy barriers and endosperm balance number (EBN. However, non-reduced pollen production by the wild species S. commersonii ssp. (2x=2n=24 -1EBN, allows the crossing of these species with dihaploids of potato and with the diploids species, S. phureja Juz. & Bukasov. and S. chacoense Bitt., all with 2EBN. The aim of this work was to determine the meiotic mechanism and frequency of non-reduced pollen production of five clones of S. commersonii ssp. Three different clones of S. commersonii subsp. commersonii Dun. (SCC and two of S

Machine-learning-based real-bogus system for the HSC-SSP moving object detection pipeline

Science.gov (United States)

Lin, Hsing-Wen; Chen, Ying-Tung; Wang, Jen-Hung; Wang, Shiang-Yu; Yoshida, Fumi; Ip, Wing-Huen; Miyazaki, Satoshi; Terai, Tsuyoshi

2018-01-01

Machine-learning techniques are widely applied in many modern optical sky surveys, e.g., Pan-STARRS1, PTF/iPTF, and the Subaru/Hyper Suprime-Cam survey, to reduce human intervention in data verification. In this study, we have established a machine-learning-based real-bogus system to reject false detections in the Subaru/Hyper-Suprime-Cam Strategic Survey Program (HSC-SSP) source catalog. Therefore, the HSC-SSP moving object detection pipeline can operate more effectively due to the reduction of false positives. To train the real-bogus system, we use stationary sources as the real training set and "flagged" data as the bogus set. The training set contains 47 features, most of which are photometric measurements and shape moments generated from the HSC image reduction pipeline (hscPipe). Our system can reach a true positive rate (tpr) ˜96% with a false positive rate (fpr) ˜1% or tpr ˜99% at fpr ˜5%. Therefore, we conclude that stationary sources are decent real training samples, and using photometry measurements and shape moments can reject false positives effectively.

Root plasma membrane transporters controlling K+/Na+ homeostasis in salt-stressed bBarley1[C][W

DEFF Research Database (Denmark)

Chen, Zhonghua; Pottosin, Igor I.; Cuin, Tracey A.

2007-01-01

are well combined to withstand saline conditions. These mechanisms include: (1) better control of membrane voltage so retaining a more negative membrane potential; (2) intrinsically higher H1 pump activity; (3) better ability of root cells to pump Na1 from the cytosol to the external medium; and (4) higher......Plant salinity tolerance is a polygenic trait with contributions from genetic, developmental, and physiological interactions, in addition to interactions between the plant and its environment. In this study, we show that in salt-tolerant genotypes of barley (Hordeum vulgare), multiple mechanisms...... of the cytosolic K1-to-Na1 ratio being a key determinant of plant salinity tolerance, and suggest multiple pathways of controlling that important feature in salt-tolerant plants....

Possible role for abscisic acid in regulation of photosynthetic and photorespiratory carbon metabolism in barley leaves

International Nuclear Information System (INIS)

Popova, L.P.; Tsonev, T.D.; Vaklinova, S.G.

1987-01-01

The influence of abscisic acid (ABA) on carbon metabolism, rate of photorespiration, and the activity of the photorespiratory enzymes ribulose bisphosphate oxygenase and glycolate oxidase in 7-day-old barley seedlings (Hordeum vulgare L. var. Alfa) was investigated. Plants treated with ABA had enhanced incorporation of labeled carbon from 14 CO 2 into glycolic acid, glycine, and serine, while 14 C incorporation into 3-phosphoglyceric acid and sugarphosphate esters was depressed. Parallel with this effect, treated plants showed a rise in activity of RuBP oxygenase and glycolic acid oxidase. The rate of photorespiration was increased twofold by ABA treatment at IO -6 molar while the CO 2 -compensation point increased 46% and stomatal resistance increased more than twofold over control plants

A laser ablation ICP-MS based method for multiplexed immunoblot analysis

DEFF Research Database (Denmark)

de Bang, Thomas Christian; Petersen, Jørgen; Pedas, Pai Rosager

2015-01-01

developed a multiplexed antibody-based assay and analysed selected PSII subunits in barley (Hordeum vulgare L.). A selection of antibodies were labelled with specific lanthanides and immunoreacted with thylakoids exposed to Mn deficiency after western blotting. Subsequently, western blot membranes were...... analysed by laser ablation inductively coupled plasma mass spectrometry (LA-ICP-MS), which allowed selective and relative quantitative analysis via the different lanthanides. The method was evaluated against established liquid chromatography electrospray ionization tandem mass spectrometry (LC...... by more than one technique. The developed method enables a higher number of proteins to be multiplexed in comparison to existing immunoassays. Furthermore, multiplexed protein analysis by LA-ICP-MS provides an analytical platform with high throughput appropriate for screening large collections of plants....

Evidence for adaptive evolution of low-temperature stress response genes in a Pooideae grass ancestor

DEFF Research Database (Denmark)

Vigeland, Magnus D; Spannagl, Manuel; Asp, Torben

2013-01-01

Adaptation to temperate environments is common in the grass subfamily Pooideae, suggesting an ancestral origin of cold climate adaptation. Here, we investigated substitution rates of genes involved in low-temperature-induced (LTI) stress responses to test the hypothesis that adaptive molecular...... evolution of LTI pathway genes was important for Pooideae evolution. Substitution rates and signatures of positive selection were analyzed using 4330 gene trees including three warm climate-adapted species (maize (Zea mays), sorghum (Sorghum bicolor), and rice (Oryza sativa)) and five temperate Pooideae...... species (Brachypodium distachyon, wheat (Triticum aestivum), barley (Hordeum vulgare), Lolium perenne and Festuca pratensis). Nonsynonymous substitution rate differences between Pooideae and warm habitat-adapted species were elevated in LTI trees compared with all trees. Furthermore, signatures...

Full Scale Test SSP 34m blade, Combined load. Data report

DEFF Research Database (Denmark)

Nielsen, Per Hørlyk; Nielsen, Magda; Jensen, Find Mølholt

This report is part of the research project entitled “Eksperimentel vingeforskning: Strukturelle mekanismer i nutidens og fremtidens store vinger under kombineret last” where a 34m wind turbine blade from SSP-Technology A/S was tested in combined flap and edgewise load. The applied load is 55...... of e.g. transverse shear distortion. The global and local deformation of the blade as well as the blades’ respond to repeated tests has been studied and the result from these investigations are presented, including the measurements performed....

To be or not to be a subspecies: description of Saperda populnea lapponica ssp. n. (Coleoptera, Cerambycidae) developing in downy willow (Salix lapponum L.)

Science.gov (United States)

Wallin, Henrik; Kvamme, Torstein; Bergsten, Johannes

2017-01-01

Abstract A new subspecies of the European cerambycid Saperda populnea (Linnaeus, 1758) is described: Saperda populnea lapponica ssp. n. based on specimens from Scandinavia. The male genitalia characters were examined and found to provide support for this separation, as well as differences in morphology, geographical distribution and bionomy. The preferred host tree for the nominate subspecies S. populnea populnea is Populus tremula L., whereas S. populnea lapponica ssp. n. is considered to be monophagous on Salix lapponum L. DNA sequence data of mitochondrial cytochrome oxidase subunit I (COI) was generated from Scandinavian specimens of S. populnea populnea and specimens representing S. populnea lapponica ssp. n. The two subspecies were not reciprocally monophyletic and genetic distances in COI were small. All synonyms of S. populnea populnea have been considered, and species similar to S. populnea populnea have been examined, and not found to be related to S. populnea lapponica ssp. n. A male lectotype has been designated for each of the two following synonyms: Cerambyx decempunctatus De Geer, 1775, and Saperda salicis Zetterstedt, 1818. The synonymised species from Asia, S. balsamifera (Motshulsky, 1860), is elevated to subspecies: S. populnea balsamifera stat. n. We end with a discussion on the definition of subspecies under the unified species concept. PMID:29187784

Chemical Composition of Different Botanical Origin Honeys Produced by Sicilian Black Honeybees (Apis mellifera ssp. sicula).

Science.gov (United States)

Mannina, Luisa; Sobolev, Anatoly P; Di Lorenzo, Arianna; Vista, Silvia; Tenore, Gian Carlo; Daglia, Maria

2015-07-01

In 2008 a Slow Food Presidium was launched in Sicily (Italy) for an early warning of the risk of extinction of the Sicilian native breed of black honeybee (Apis mellifera L. ssp sicula). Today, the honey produced by these honeybees is the only Sicilian honey produced entirely by the black honeybees. In view of few available data regarding the chemical composition of A. mellifera ssp. sicula honeys, in the present investigation the chemical compositions of sulla honey (Hedysarum coronarium L.) and dill honey (Anethum graveolens L.) were studied with a multimethodological approach, which consists of HPLC-PDA-ESI-MSn and NMR spectroscopy. Moreover, three unifloral honeys (lemon honey (obtained from Citrus limon (L.) Osbeck), orange honey (Citrus arantium L.), and medlar honey (Eriobotrya japonica (Thunb.) Lindl)), with known phenol and polyphenol compositions, were studied with NMR spectroscopy to deepen the knowledge about sugar and amino acid compositions.

Resistance of Hordeum chilense against loose smuts of wheat and barley (Ustilago tritici and U. nuda) and its expression in amphiploids with wheat

OpenAIRE

Rubiales, Diego; Moral, Ana

2011-01-01

Hordeum chilense is wild barley with high potential for cereal breeding purposes given its high crossability with other members of the Triticeae tribe. It is resistant to loose smuts of wheat (Ustilago tritici). The resistance is expressed in xTritordeum amphipoids, offering perspectives for its utilization both in tritordeum breeding and for its transfer to wheat. H. chilense and tritordeums are also resistant to barley loose smut (U. nuda). © 2010 Blackwell Verlag GmbH.

Comparison of virulence of Francisella tularensis ssp. holarctica genotypes B.12 and B.FTNF002-00.

Science.gov (United States)

Kreizinger, Zsuzsa; Erdélyi, Károly; Felde, Orsolya; Fabbi, Massimo; Sulyok, Kinga M; Magyar, Tibor; Gyuranecz, Miklós

2017-02-10

Two main genetic groups (B.12 and B.FTNF002-00) of Francisella tularensis ssp. holarctica are endemic in Europe. The B.FTNF002-00 group proved to be dominant in Western European countries, while strains of the B.12 group were isolated mainly in Northern, Central and Eastern Europe. The clinical course of tularemia in the European brown hare (Lepus europaeus) also shows distinct patterns according to the geographical area. Acute course of the disease is observed in hares in Western European countries, while signs of sub-acute or chronic infection are more frequently detected in the eastern part of the continent. The aim of the present study was to examine whether there is any difference in the virulence of the strains belonging to the B.FTNF002-00 and B.12 genetic clades. Experimental infection of Fischer 344 rats was performed by intra-peritoneal injection of three dilutions of a Hungarian (B.12 genotype) and an Italian (B.FTNF002-00 genotype) F. tularensis ssp. holarctica strain. Moderate difference was observed in the virulence of the two genotypes. Significant differences were observed in total weight loss values and scores of clinical signs between the two genotypes with more rats succumbing to tularemia in groups infected with the B.FTNF002-00 genotype. Results of the experimental infection are consistent with previous clinical observations and pathological studies suggesting that F. tularensis ssp. holarctica genotype B.FTNF002-00 has higher pathogenic potential than the B.12 genotype.

Evaluation of RO modules for the SSP ETC/LSS.

Science.gov (United States)

Jasionowski, W. J.; Bambenek, R. A.

1973-01-01

During the past eight years the NASA Manned Spacecraft Center has supported the development of an Integrated Water and Waste Management System for use in the Space Station Prototype (SSP) Environmental Thermal Control/Life-Support System (ETC/LSS). This system includes the reverse osmosis (RO) process for recycling wash water and the compression distillation process for recovering useable water from urine, urinal flush water, humidity condensate, commode flush water and the wash water concentrated by RO. This paper summarizes the experimental work performed during the past four years to select the best commercially available RO module for this system and to also define which surfactants and germicides are most compatible with the selected module.

Increases in both acute and chronic temperature potentiate tocotrienol concentrations in wild barley at 'Evolution Canyon'.

Science.gov (United States)

Shen, Yu; Lansky, Ephraim; Traber, Maret; Nevo, Eviatar

2013-09-01

Biosynthesis of tocols (vitamin E isoforms) is linked to response to temperature in plants. 'Evolution Canyon', an ecogeographical microcosm extending over an average of 200 meters (range 100-400) wide area in the Carmel Mountains of northern Israel, has been suggested as a model for studying global warming. Both domestic (Hordeum vulgare) and wild (Hordeum spontaneum) barley compared with wheat, oat, corn, rice, and rye show high tocotrienol/tocopherol ratios. Therefore, we hypothesized that tocol distribution might change in response to global warming. α-, β-, γ-, and δ-tocopherol, and α-, β-, γ-, and δ-tocotrienol concentrations were measured in wild barley (H. spontaneum) seeds harvested from the xeric (African) and mesic (European) slopes of Evolution Canyon over a six-year period from 2005-2011. Additionally, we examined seeds from areas contiguous to and distant from the part of the Canyon severely burned during the Carmel Fire of December 2010. Increased α-tocotrienol (pslope in contrast to the cooler 'European' slope, and 3) to propinquity to the fire. The study illustrates the role of α-tocotrienol in both chronic and acute temperature adaptation in wild barley and suggests future research into thermoregulatory mechanisms in plants. Copyright © 2013 Verlag Helvetica Chimica Acta AG, Zürich.

Interrelationships among light, photosynthesis and nitrogen in the crown of mature Pinus contorta ssp. latifolia

Science.gov (United States)

A. W. Schoettle; W. K. Smith

1999-01-01

Scaling leaf-level measurements to estimate carbon gain of entire leaf crowns or canopies requires an understanding of the distribution of photosynthetic capacity and corresponding light microenvironments within a crown. We have compared changes in the photosynthetic light response and nitrogen (N) content (per unit leaf area) of Pinus contorta Dougl. ssp. latifolia...