Saski, Christopher; Lee, Seung-Bum; Fjellheim, Siri; Guda, Chittibabu; Jansen, Robert K.; Luo, Hong; Tomkins, Jeffrey; Rognli, Odd Arne; Clarke, Jihong Liu
2009-01-01
Comparisons of complete chloroplast genome sequences of Hordeum vulgare, Sorghum bicolor and Agrostis stolonifera to six published grass chloroplast genomes reveal that gene content and order are similar but two microstructural changes have occurred. First, the expansion of the IR at the SSC/IRa boundary that duplicates a portion of the 5′ end of ndhH is restricted to the three genera of the subfamily Pooideae (Agrostis, Hordeum and Triticum). Second, a 6 bp deletion in ndhK is shared by Agrostis, Hordeum, Oryza and Triticum, and this event supports the sister relationship between the subfamilies Erhartoideae and Pooideae. Repeat analysis identified 19–37 direct and inverted repeats 30 bp or longer with a sequence identity of at least 90%. Seventeen of the 26 shared repeats are found in all the grass chloroplast genomes examined and are located in the same genes or intergenic spacer (IGS) regions. Examination of simple sequence repeats (SSRs) identified 16–21 potential polymorphic SSRs. Five IGS regions have 100% sequence identity among Zea mays, Saccharum officinarum and Sorghum bicolor, whereas no spacer regions were identical among Oryza sativa, Triticum aestivum, H. vulgare and A. stolonifera despite their close phylogenetic relationship. Alignment of EST sequences and DNA coding sequences identified six C–U conversions in both Sorghum bicolor and H. vulgare but only one in A. stolonifera. Phylogenetic trees based on DNA sequences of 61 protein-coding genes of 38 taxa using both maximum parsimony and likelihood methods provide moderate support for a sister relationship between the subfamilies Erhartoideae and Pooideae. PMID:17534593
Heterologous expression of Hordeum vulgare cysteine protease in yeast
DEFF Research Database (Denmark)
Rosenkilde, Anne Lind; Dionisio, Giuseppe; Holm, Preben B
Cysteine Proteases accounts for more than 90 % of the total proteolytic activity in the degradation of barley seed storage proteins during germination. Several Cysteine proteases have been identified in barley. One of the key enzymes, Hordeum vulgare endoprotease B2 (HvEPB2) was cloned with and w......Cysteine Proteases accounts for more than 90 % of the total proteolytic activity in the degradation of barley seed storage proteins during germination. Several Cysteine proteases have been identified in barley. One of the key enzymes, Hordeum vulgare endoprotease B2 (HvEPB2) was cloned...
Genetic diversity in barley landraces (Hordeum vulgare L. subsp.
Indian Academy of Sciences (India)
Genetic diversity in barley landraces (Hordeum vulgare L. subsp. vulgare) originated from Crescent Fertile region as detected by seed storage proteins. RIM MZID FARHAT CHIBANI RAYDA BEN AYED MOHSEN HANANA JOELLE BREIDI RABIH KABALAN SAMIH EL-HAJJ HASSAN MACHLAB AHMED REBAI LAMIS ...
Haploid Barley from the Intergeneric Cross Hordeum vulgare x Psathyrostachys fragilis
DEFF Research Database (Denmark)
Bothmer, Roland; Jacobsen, Niels; Bagger Jørgensen, Rikke
1984-01-01
The intergeneric hybrid Hordeum vulgare x Psathyrostachys fragilis was fairly easily obtained. During each growing season the intermediate, perennial hybrid yielded haploid tillers of H. vulgare. Late in one season few, hybrid tillers headed. The morphology, cytology and enzymatic patterns...
Triple Hybridization with Cultivated Barley (Hordeum vulgare L.)
DEFF Research Database (Denmark)
Bothmer, R. von; Claesson, L.; Flink, J.
1989-01-01
A crossing programme for trispecific hybridization including cultivated barely (Hordeum vulgare L.) as the third parent was carried out. The primary hybrids comprised 11 interspecific combinations, each of which had either H. jabatum or H. lechleri as one of the parents. The second parent...
Molecular characterization of barley ( Hordeum vulgare L.) genome ...
African Journals Online (AJOL)
The present work aimed to select drought tolerant barley (Hordeum vulgare L.) cultivars through identification of stress genes responsible for drought tolerance. Several barley genotypes were tested for drought resistance using specific molecular markers, nine out of all the genotypes were chosen for this study; five out of ...
DEFF Research Database (Denmark)
Bagger Jørgensen, Rikke; Jensen, C. J.; Andersen, B.
1986-01-01
Callus was induced from hybrids between cultivated barley (Hordeum vulgare L. ssp. vulgare) and ten species of wild barley (Hordeum L.) as well as from one backcross line ((H. lechleri .times. H. vulgare) .times. H. vulgare). Successful callus induction and regeneration of plants were achieved from...... explants of young spikes on the barley medium J 25-8. The capacity for plant regeneration was dependent on the wild parental species. In particular, combinations with four related wild species, viz. H. jubatum, H. roshevitzii, H. lechleri, and H. procerum, regenerated high numbers of plants from calli....
Hordeum vulgare cysteine protease heterologous expressed in yeast
DEFF Research Database (Denmark)
Rosenkilde, Anne Lind; Dionisio, Giuseppe; Holm, Preben Bach
, (Hordeum vulgare) endoprotease B2 (HvEPB2) was cloned with and without the 5 amino acid C-terminal sequence into the Pichia pastoris expression vector pPICZ Aα and electrotransformed into Pichia pastoris strain SDM1163. Heterologous protein production was induced with 2% MeOH and the protein expression...
Cytogenetisch en embryologisch onderzoek aan kruisingen tussen Hordeum vulgare en H. bulbosum
Lange, W.
1969-01-01
Crosses between barley (Hordeum vulgare) and bulbous barleygrass ( H.bulbosum) could be valuable for the transfer of such properties as resistance to cold or diseases from H. bulbosum to H. vulgare. From the literature it was known that difficulties arose in the cross: seed abortion necessitating
Evaluation of genetic diversity in barley (Hordeum vulgare L.) from ...
African Journals Online (AJOL)
User
2015-06-03
Jun 3, 2015 ... were kernel weight per spike and thousand seed weight. ...... Ser. Biol. 17:65-70. CSA (2010) Area and production of crops (private peasant holdings, ... (Hordeum vulgare L.) landraces in variable production system,. Ethiopia.
Evaluation of genetic diversity in barley ( Hordeum vulgare L.) from ...
African Journals Online (AJOL)
This study aimed to determine the genetic diversity and relationships among barley varieties (Hordeum vulgare L.) growing at Wollo Highland areas by using hordein and agro-morphological traits. Twenty (20) varieties were laid down in randomized complete block design (RCBD) design with three replications; they were ...
DEFF Research Database (Denmark)
Jensen, J.; Linde-Laursen, Ib
1984-01-01
In 38 squashed, somatic metaphases of four hybrids between diploid Hordeum vulgare and two tetra-and two hexaploid alien species, each of the H. vulgare chromosomes was identifed, and differentiated from the chromosomes of the other parental species, by its Giemsa C-banding pattern. The H. vulgare...
Development and Meiosis of Three Interspecific Hybrids with Cultivated Barley (Hordeum vulgare L.)
DEFF Research Database (Denmark)
Von Bothmer, R.; Flink, J.; Linde-Laursen, Ib
1986-01-01
The development and meiosis of three interspecific hybrids between cultivated barley (Hordeum vulgare L.) and H. secalinum Schreb., H. tetraploidum Covas, and H. parodii Covas, respectively, were studied. All three hybrid combinations developed very slowly vegetatively. Meiosis of the hybrids...
Lifescience Database Archive (English)
Full Text Available MeCab user dictionary for science technology term Sorghum vulgare 名詞 一般 * * * * モロコ...シ モロコシ モロコシ Thesaurus2015 200906063836088318 C LS06/LS72 UNKNOWN_2 Sorghum vulgare
Characterization of senscence-associated NAC transcription factors in Barley (Hordeum Vulgare L.)
DEFF Research Database (Denmark)
Podzimska, Dagmara Agata
, such as yield, biomass production and nutrient quality, and NAC (NAM, ATAF1/2 and CUC2) transcription factors are promising targets for the breeding. The aim of this thesis was thus to assess the role of NAC transcription factors in regulation of senescence in barley (Hordeum vulgare L.) and to contribute...
DEFF Research Database (Denmark)
Bothmer, R. von; Bengtsson, M.; Flink, J.
1988-01-01
Several complex hybrids were produced from the combination [(Hordeum lechleri, 6 .times. .times. H. procerum, 6 .times.) .times. H. vulgare, 2 .times.]. Crosses with six diploid barley lines resulted in triple hybrids, most of which had a full complement of barley chromosomes (no. 1-7), but were...
NAC Transcription Factors of Barley (Hordeum vulgare L.) and their Involvement in Leaf Senescence
DEFF Research Database (Denmark)
Wagner, Michael
parts of the senescence process. The specific aims of this study were therefore (1) to establish and characterise the NAC transcription factors of the model cereal crop barley (Hordeum vulgare L.) (2) to identify and study putative barley NAC transcription factors involved in the regulation of leaf...
Informed collecting, conservation, monitoring and utilization of genetic diversity require knowledge of the distribution and structure of genetic variation occurring in a species. Hordeum vulgare subsp. spontaneum (K. Koch) Thell., a primary wild relative of barley, is an important source of genetic...
Directory of Open Access Journals (Sweden)
Lucie Maršálová
2016-08-01
Full Text Available Response to a high salinity treatment of 300 mM NaCl was studied in a cultivated barley Hordeum vulgare Syrian cultivar Tadmor and in a halophytic wild barley Hordeum marinum. Differential salinity tolerance of H. marinum and H. vulgare is underlied by qualitative and quantitative differences in proteins involved in a variety of biological processes. The major aim was to identify proteins underlying differential salinity tolerance between the two barley species. Analyses of plant water content, osmotic potential and accumulation of proline and dehydrin proteins under high salinity revealed a relatively higher water saturation deficit in H. marinum than in H. vulgare while H. vulgare had lower osmotic potential corresponding with high levels of proline and dehydrins. Analysis of proteins soluble upon boiling isolated from control and salt-treated crown tissues revealed similarities as well as differences between H. marinum and H. vulgare. The similar salinity responses of both barley species lie in enhanced levels of stress-protective proteins such as defence-related proteins from late-embryogenesis abundant (LEA family, several chaperones from heat shock protein (HSP family, and others such as GrpE. However, there have also been found significant differences between H. marinum and H. vulgare salinity response indicating an active stress acclimation in H. marinum while stress damage in H. vulgare. An active acclimation to high salinity in H. marinum is underlined by enhanced levels of several stress-responsive transcription factors from basic leucine zipper (bZIP and nascent polypeptide-associated complex (NAC families. In salt-treated H. marinum, enhanced levels of proteins involved in energy metabolism such as glycolysis, ATP metabolism, and photosynthesis-related proteins indicate an active acclimation to enhanced energy requirements during an establishment of novel plant homeostasis. In contrast, changes at proteome level in salt-treated H
Physical and Mechanical Properties of Sorghum Grains (Sorghum Vulgare
Directory of Open Access Journals (Sweden)
2016-11-01
Full Text Available The physical and mechanical properties of sorghum grains (sorghum vulgare were studied at varying moisture contents of 13%, 20% and 30% (w.b. The four varieties of sorghum grains studied include; Dura, Guinea, Faterita and Kafir. Results indicate that the size ranges were 3.94mm - 4.83mm for Dura variety; 3.75mm - 4.54mm for Guinea variety; 3.21mm - 4.42mm for Kafir variety and 2.70mm - 4.14mm for Faterita variety. Irregularities in the shapes of the grains were observed but all approximated to a sphere. In the mechanical properties, at major diameter, Dura variety had highest rupture force of 1.16kN at 13% moisture content (w.b while the Guinea variety had the lowest rupture force of 0.955kN. In minor diameter, the Dura variety also recorded highest rupture force of 1.12kN at 13% moisture content (w.b while the Kafir variety had the lowest value of 0.952kN. Also at 20% moisture content, the Dura variety had highest rupture force of 1.025kN while the Guinea variety had the lowest rupture force of 0.965kN. The same trend applies in the varieties at 30% moisture content. This is because, increase in moisture content results to decrease in rupture force. And this implies that force beyond these points at these moisture contents may cause damage to the sorghum varieties.
DEFF Research Database (Denmark)
Kirkensgaard, Kristine Groth; Hägglund, Per; Finnie, Christine
2009-01-01
to the active form. Here, the first crystal structure of a cereal NTR, HvNTR2 from Hordeum vulgare (barley), is presented, which is also the first structure of a monocot plant NTR. The structure was determined at 2.6 A resolution and refined to an R (cryst) of 19.0% and an R (free) of 23.8%. The dimeric protein...
International Nuclear Information System (INIS)
Wu Huibin; Tang Shirong; Zhang Ximei; Guo Junkang; Song, Zhengguo; Tian Shuai; Smith, Donald L.
2009-01-01
The most important challenge to use phytoremediation is how to improve its efficiency by increasing the accumulation of metals in plants, or by improving key plant biological traits that should enhance metal uptake. In this paper, we used open-top chambers to investigate the effects of elevated CO 2 (860 μL L -1 ) on biomass and Cs uptake by a Sorghum vulgare x Sorghum vulgare var. sudanense hybrid and Trifolium pratense L. growing on soils spiked with various levels of cesium (0, 300, 1500 and 3000 mg Cs kg -1 ). The results showed that elevated CO 2 not only increased aboveground biomass of the Sorghum and Trifolium species by 32-111%, and by 8-11%, respectively, compared to the ambient CO 2 treatment, but also caused more accumulation of Cs by Sorghum species (up to 73%) than Trifolium species (up to 43%). It was speculated that the increase in biomass and the improvement in Cs accumulation ability at elevated CO 2 could be related to lowered soil pH values, and changes in number and kind of microorganisms in the rhizospheres of the two tested species. This is the first report of a link among elevated CO 2 , increased biomass and hyperaccumulation of Cs by Sorghum and Trifolium species.
DEFF Research Database (Denmark)
Knoch, Eva; Motawie, Mohammed Saddik; Olsen, Carl Erik
2016-01-01
Barley (Hordeum vulgare L.) produces five leucine-derived hydroxynitrile glucosides (HNGs), of which only epiheterodendrin is a cyanogenic glucoside. The four non-cyanogenic HNGs are the β-HNG epidermin and the γ-HNGs osmaronin, dihydroosmaronin and sutherlandin. By analyzing 247 spring barley...
Energy Technology Data Exchange (ETDEWEB)
Wu Huibin [Centre for Research in Ecotoxicology and Environmental Remediation, Institute of Agro-Environmental Protection, Ministry of Agriculture, Tianjin 300191 (China); Open Key Laboratory of Agro-environment and Agro-product Safety of the Ministry of Agriculture, Tianjin (China); College of Resources and Environment, Huazhong Agricultural University, 430070 Wuhan, Hubei Province (China); Tang Shirong, E-mail: tangshir@hotmail.com [Centre for Research in Ecotoxicology and Environmental Remediation, Institute of Agro-Environmental Protection, The Ministry of Agriculture, Tianjin 300191 (China); Open Key Laboratory of Agro-environment and Agro-product Safety of the Ministry of Agriculture, Tianjin (China); Zhang Ximei; Guo Junkang; Song, Zhengguo; Tian Shuai [Centre for Research in Ecotoxicology and Environmental Remediation, Institute of Agro-Environmental Protection, Ministry of Agriculture, Tianjin 300191 (China); Open Key Laboratory of Agro-environment and Agro-product Safety of the Ministry of Agriculture, Tianjin (China); Smith, Donald L. [Plant Science Department, McGill University, Macdonald Campus, 21111 Lakeshore Road, Ste. Anne de Bellevue, Quebec, H9X 3V9 (Canada)
2009-10-30
The most important challenge to use phytoremediation is how to improve its efficiency by increasing the accumulation of metals in plants, or by improving key plant biological traits that should enhance metal uptake. In this paper, we used open-top chambers to investigate the effects of elevated CO{sub 2} (860 {mu}L L{sup -1}) on biomass and Cs uptake by a Sorghum vulgare x Sorghum vulgare var. sudanense hybrid and Trifolium pratense L. growing on soils spiked with various levels of cesium (0, 300, 1500 and 3000 mg Cs kg{sup -1}). The results showed that elevated CO{sub 2} not only increased aboveground biomass of the Sorghum and Trifolium species by 32-111%, and by 8-11%, respectively, compared to the ambient CO{sub 2} treatment, but also caused more accumulation of Cs by Sorghum species (up to 73%) than Trifolium species (up to 43%). It was speculated that the increase in biomass and the improvement in Cs accumulation ability at elevated CO{sub 2} could be related to lowered soil pH values, and changes in number and kind of microorganisms in the rhizospheres of the two tested species. This is the first report of a link among elevated CO{sub 2}, increased biomass and hyperaccumulation of Cs by Sorghum and Trifolium species.
DEFF Research Database (Denmark)
Pedersen, L.H.; Jacobsen, S.; Hejgaard, J.
1993-01-01
The plasma membrane bound beta-1,3-D-glucan (callose) synthase. assumed to be involved in the resistance to the powdery mildew fungus (Erysiphe graminis f.sp. hordei), was partially purified from a microsomal fraction of green barley leaves (Hordeum vulgare L.). Plasma membranes were enriched...
Geography of Genetic Structure in Barley Wild Relative Hordeum vulgare subsp. spontaneum in Jordan.
Thormann, Imke; Reeves, Patrick; Reilley, Ann; Engels, Johannes M M; Lohwasser, Ulrike; Börner, Andreas; Pillen, Klaus; Richards, Christopher M
2016-01-01
Informed collecting, conservation, monitoring and utilization of genetic diversity requires knowledge of the distribution and structure of the variation occurring in a species. Hordeum vulgare subsp. spontaneum (K. Koch) Thell., a primary wild relative of barley, is an important source of genetic diversity for barley improvement and co-occurs with the domesticate within the center of origin. We studied the current distribution of genetic diversity and population structure in H. vulgare subsp. spontaneum in Jordan and investigated whether it is correlated with either spatial or climatic variation inferred from publically available climate layers commonly used in conservation and ecogeographical studies. The genetic structure of 32 populations collected in 2012 was analyzed with 37 SSRs. Three distinct genetic clusters were identified. Populations were characterized by admixture and high allelic richness, and genetic diversity was concentrated in the northern part of the study area. Genetic structure, spatial location and climate were not correlated. This may point out a limitation in using large scale climatic data layers to predict genetic diversity, especially as it is applied to regional genetic resources collections in H. vulgare subsp. spontaneum.
International Nuclear Information System (INIS)
Bornman, J.F.; Bjoern, L.O.; Bornman, C.H.
1982-01-01
Estimates of viability as measured by vital straining with fluorescein diacetate were carried out on freshly isolated and partially aged (16-hour-old) Beta vulgaris and Hordeum vulgare mesophyll protoplasts following irradiation with UV-B. Damage to the photosynthetic system by UV-B was determined by delayed light emission (DLE). In the case of freshly isolated Protoplasts Beta was approximately 30% more susceptible than Hordeum following 3h irradiation, with viability decreasing from 90% to 40%. After storage of protoplasts on ice for 16 h UV-B radiation markedly depressed viability in both species, but in the case of Hordeum there was a substantial initial loss of nearly 70% in viability over the first hour of irradiation. The first 10 min of UV-B radiation decreased the intensity of DLE by 40% without appreciably affecting the decay rate. Longer treatment times did not give a proportional effect so that even after 60 min of UV-B the inhibition did not exceed 60%. This suggested that although the enzyme system responsible for FDA hydrolysis may be partially inactivated (viability was 75-80% as compared with 90% in the control), the UV-B did not penetrate the innermost parts of the chloroplasts, but left some thylakoids undamaged. (orig.)
International Nuclear Information System (INIS)
Cowan, A.K.; Railton, I.D.
1987-01-01
Excised light-grown leaves and etiolated leaves of Hordeum vulgare L. cv Dyan catabolized applied (+/-)-[2- 14 C]abscisic acid ([+/-]-[2- 14 C]ABA) to phaseic acid (PA), dihydrophaseic acid (DPA), and 2'-hydroxymethyl ABA (2'-HMABA). Identification of these catabolites was made by microchemical methods and by combined capillary gas chromatography-mass spectrometry (GC-MS) following high dose feeds of nonlabeled substrate to leaves. Circular dichroism analysis revealed that 2'-HMABA was derived from the (-) enantiomer of ABA. Refeeding studies were used to confirm the catabolic route. The methyl ester of (+/-)-[2 14 C]-ABA was hydrolyzed efficiently by light-grown leaves of H. vulgare. Leaf age played a significant role in (+/-)-ABA catabolism, with younger leaves being less able than their older counterparts to catabolize this compound. The catabolism of (+/-)-ABA was inhibited markedly in water-stressed Hordeum leaves which was characterized by a decreased incorporation of label into 2'-HMABA, DPA, and conjugates. The specific, mixed function oxidase inhibitor, ancymidol, did not inhibit, dramatically (+/-)-ABA catabolism in light-grown leaves of Hordeum whereas the 80s ribosome, translational inhibitor, cycloheximide, inhibited this process markedly. The 70s ribosome translational inhibitors, lincomycin and chloramphenicol, were less effective than cycloheximide in inhibiting (+/-)-ABA catabolism, implying that cytoplasmic protein synthesis is necessary for the catabolism of (+/-)-ABA in Hordeum leaves whereas chloroplast protein synthesis plays only a minor role. This further suggests that the enzymes involved in (+/-)-ABA catabolism in this plant are cytoplasmically synthesized and are turned-over rapidly, although the enzyme responsible for glycosylating (+/-)-ABA itself appeared to be stable
Zhou, Hong; Liu, Shihang; Liu, Yujiao; Liu, Yaxi; You, Jing; Deng, Mei; Ma, Jian; Chen, Guangdeng; Wei, Yuming; Liu, Chunji; Zheng, Youliang
2016-09-13
Kernel length is an important target trait in barley (Hordeum vulgare L.) breeding programs. However, the number of known quantitative trait loci (QTLs) controlling kernel length is limited. In the present study, we aimed to identify major QTLs for kernel length, as well as putative candidate genes that might influence kernel length in wild barley. A recombinant inbred line (RIL) population derived from the barley cultivar Baudin (H. vulgare ssp. vulgare) and the long-kernel wild barley genotype Awcs276 (H.vulgare ssp. spontaneum) was evaluated at one location over three years. A high-density genetic linkage map was constructed using 1,832 genome-wide diversity array technology (DArT) markers, spanning a total of 927.07 cM with an average interval of approximately 0.49 cM. Two major QTLs for kernel length, LEN-3H and LEN-4H, were detected across environments and further validated in a second RIL population derived from Fleet (H. vulgare ssp. vulgare) and Awcs276. In addition, a systematic search of public databases identified four candidate genes and four categories of proteins related to LEN-3H and LEN-4H. This study establishes a fundamental research platform for genomic studies and marker-assisted selection, since LEN-3H and LEN-4H could be used for accelerating progress in barley breeding programs that aim to improve kernel length.
Rankl, Simone
2017-01-01
N-Acyl-D/L-homoserine lactones (AHLs) are produced as microbial signaling compounds during bacterial intra- and inter-specific communication in the rhizosphere. Thus, plants are naturally exposed to these compounds and respond with tissue-specific reactions. In the present study the impact of AHLs on the monocot barley (Hordeum vulgare L.) was investigated. The treatment with C8- and C12- homoserine lactones (HSL) resulted in root and shoot biomass gain as well as in the formation of lat...
DEFF Research Database (Denmark)
Backes, G.; Madsen, L.H.; Jaiser, H.
2003-01-01
The aims of this investigation have been to map new (quantitative) resistance genes against powdery mildew, caused by Blumeria graminis f.sp. hordei L., and leaf rust, caused by Puccinia hordei L., in a cross between the barley (Hordeum vulgare ssp. vulgare) cultivar "Vada" and the wild barley...... (Hordeum vulgare ssp. spontaneum) line "1B-87" originating from Israel. The population consisted of 121 recombinant inbred lines. Resistance against leaf rust and powdery mildew was tested on detached leaves. The leaf rust isolate "I-80" and the powdery mildew isolate "Va-4", respectively, were used...
Directory of Open Access Journals (Sweden)
Pavlova Violetta Aleksandrovna
2014-04-01
Full Text Available Plant productivity is the important indicator, which determines the amount of yield. The productivity of plants depends on the number of bruchids per plant and on the weight of 1000 bruchids. The article studies the influence of impulse pressure of various magnitudes on plant productivity of Don barley (Hordeum vulgare L.. It was found that the pressure of 17 MPa was the most effective for increasing the productivity. Impulse pressure of other magnitudes also had influence on the productivity of Don barley.
Phylogenetic analysis of the genus Hordeum using repetitive DNA sequences
DEFF Research Database (Denmark)
Svitashev, S.; Bryngelsson, T.; Vershinin, A.
1994-01-01
A set of six cloned barley (Hordeum vulgare) repetitive DNA sequences was used for the analysis of phylogenetic relationships among 31 species (46 taxa) of the genus Hordeum, using molecular hybridization techniques. In situ hybridization experiments showed dispersed organization of the sequences...
Zinc blotting assay for detection of zinc binding prolamin in barley (Hordeum vulgare) grain
DEFF Research Database (Denmark)
Uddin, Mohammad Nasir; Nielsen, Ane Langkilde-Lauesen; Vincze, Eva
2014-01-01
In plants, zinc is commonly found bound to proteins. In barley (Hordeum vulgare), major storage proteins are alcohol-soluble prolamins known as hordeins, and some of them have the potential to bind or store zinc. 65Zn overlay and blotting techniques have been widely used for detecting zinc......-binding protein. However, to our knowledge so far this zinc blotting assay has never been applied to detect a prolamin fraction in barley grains. A radioactive zinc (65ZnCl2) blotting technique was optimized to detect zinc-binding prolamins, followed by development of an easy-to-follow nonradioactive colorimetric...... zinc blotting method with a zinc-sensing dye, dithizone. Hordeins were extracted from mature barley grain, separated by SDS-PAGE, blotted on a membrane, renatured, overlaid, and probed with zinc; subsequently, zinc-binding specificity of certain proteins was detected either by autoradiography or color...
Directory of Open Access Journals (Sweden)
Z Amini
2013-08-01
Full Text Available Future climate changes are expected to increase risks of drought, which already represent the most common stress factor for stable barley (Hordeum vulgare L. production in Iran. Up to now, extensive research projects have been done to study effects of drought stress on the antioxidant enzyme activity. While there is a few works of such studies on the field condition. In order to study of water deficit effects on the antioxidant enzymes activities as a secondary stress, we evaluate the effects of mild and severe drought stress on activities of antioxidative enzymes including superoxide dismutases, ascorbate peroxidase, catalase and peroxidase, among four barley genotypes, differing in the capacity to maintain the grain yield under drought condition during beginning on anthesis, kernel watery ripe and late milk stages under field condition. Results showed that drought increased the activity of antioxidant enzymes in all genotypes. At beginning of anthesis, POX activity of Q22 was higher than it in other genotypes ( P
Powdery Mildew Resistance in 268 Entries of Hordeum vulgare
DEFF Research Database (Denmark)
Jiang, W.M.; Jørgensen, Jørgen Helms; Torp, J
1984-01-01
A collection of 24 'Spontaneum' barley [H. vulgare ssp. spontaneum] entries and one comprising 244 Ethiopian barleys [H. vulgare ssp. vulgare] were tested for resistance to 4 powdery mildew [used by Erysiphe graminis f. sp. hordei] cultures that carried genes for virulence corresponding to most...
Bengtsson, Therése; Åhman, Inger; Manninen, Outi; Reitan, Lars; Christerson, Therese; Due Jensen, Jens; Krusell, Lene; Jahoor, Ahmed; Orabi, Jihad
2017-01-01
The powdery mildew fungus, Blumeria graminis f. sp. hordei is a worldwide threat to barley ( Hordeum vulgare L. ssp. vulgare ) production. One way to control the disease is by the development and deployment of resistant cultivars. A genome-wide association study was performed in a Nordic spring barley panel consisting of 169 genotypes, to identify marker-trait associations significant for powdery mildew. Powdery mildew was scored during three years (2012-2014) in four different locations within the Nordic region. There were strong correlations between data from all locations and years. In total four QTLs were identified, one located on chromosome 4H in the same region as the previously identified mlo locus and three on chromosome 6H. Out of these three QTLs identified on chromosome 6H, two are in the same region as previously reported QTLs for powdery mildew resistance, whereas one QTL appears to be novel. The top NCBI BLASTn hit of the SNP markers within the novel QTL predicted the responsible gene to be the 26S proteasome regulatory subunit, RPN1, which is required for innate immunity and powdery mildew-induced cell death in Arabidopsis . The results from this study have revealed SNP marker candidates that can be exploited for use in marker-assisted selection and stacking of genes for powdery mildew resistance in barley.
Lipid and sugar profiles of various barley cultivars (Hordeum vulgare
Directory of Open Access Journals (Sweden)
Pastor Kristian A.
2015-01-01
Full Text Available The lipid components and soluble sugars in flour samples of different cultivars of barley (Hordeum vulgare, involving winter malting barley, winter forage barley, spring barley, and hulless barley, were identified. Fatty acids were extracted from flour samples with n-hexane, and derivatized into volatile methyl esters, using TMSH (trimethylsulfonium hydroxide in methanol. Soluble sugars were extracted from defatted and dried samples of barley flour with 96% ethanol, and further derivatized into the corresponding trimethylsilyl (TMS oximes, using hydroxylamine hydrochloride solution and BSTFA (N,O-bis-(trimethylsilyl-trifluoroacetamide. The hexane and alcoholic extracts of barley cultivars were analyzed by GC-MS system. Lipid and sugar compositions were very similar in all barley cultivars. Therefore, multivariate analysis was applied to numerical values of automatically integrated areas of the identified fatty acid methyl esters and TMS oximes of soluble sugars. The application of hierarchical cluster analysis showed a great similarity between the investigated flour samples of barley cultivars, according to their fatty acid content (0.96. Also, significant, but somewhat less similarity was observed regarding the content of soluble sugars (0.70. These preliminary results indicate the possibility of distinguishing flour made of barley, regardless of the variety, from flours made of other cereal species, just by the analysis of the contents of fatty acids and soluble sugars.[Projekat Ministarstva nauke Republike Srbije, br. TR 31066
Resistance genes in barley (Hordeum vulgare L.) and their identification with molecular markers.
Chełkowski, Jerzy; Tyrka, Mirosław; Sobkiewicz, Andrzej
2003-01-01
Current information on barley resistance genes available from scientific papers and on-line databases is summarised. The recent literature contains information on 107 major resistance genes (R genes) against fungal pathogens (excluding powdery mildew), pathogenic viruses and aphids identified in Hordeum vulgare accessions. The highest number of resistance genes was identified against Puccinia hordei, Rhynchosporium secalis, and the viruses BaYMV and BaMMV, with 17, 14 and 13 genes respectively. There is still a lot of confusion regarding symbols for R genes against powdery mildew. Among the 23 loci described to date, two regions Mla and Mlo comprise approximately 31 and 25 alleles. Over 50 R genes have already been localised and over 30 mapped on 7 barley chromosomes. Four barley R genes have been cloned recently: Mlo, Rpg1, Mla1 and Mla6, and their structures (sequences) are available. The paper presents a catalogue of barley resistance gene symbols, their chromosomalocation and the list of available DNA markers useful in characterising cultivars and breeding accessions.
Piacentini, Karim Cristina
2015-01-01
Dissertação (mestrado) - Universidade Federal de Santa Catarina, Centro de Ciências Agrárias, Programa de Pós-Graduação em Ciência dos Alimentos, Florianópolis, 2015. A cevada (Hordeum vulgare L sp. vulgare) é considerada um dos cereais mais importantes no contexto mundial. Atualmente, uma preocupação latente da indústria cervejeira é o crescimento de fungos filamentosos nos grãos, que acorre devido ao manejo inadequado da matéria prima durante o armazenamento (excesso de umidade), a conde...
Geras'kin, Stanislav A; Oudalova, Alla A; Kim, Jin Kyu; Dikarev, Vladimir G; Dikareva, Nina S
2007-03-01
The induction of chromosome aberrations in Hordeum vulgare germinated seeds was studied after ionizing irradiation with doses in the range of 10-1,000 mGy. The relationship between the frequency of aberrant cells and the absorbed dose was found to be nonlinear. A dose-independent plateau in the dose range from about 50 to 500 mGy was observed, where the level of cytogenetic damage was significantly different from the spontaneous level. The comparison of the goodness of the experimental data fitting with mathematical models of different complexity, using the most common quantitative criteria, demonstrated the advantage of a piecewise linear model over linear and polynomial models in approximating the frequency of cytogenetical disturbances. The results of the study support the hypothesis of indirect mechanisms of mutagenesis induced by low doses. Fundamental and applied implications of these findings are discussed.
Cardinal, Marie-Josée; Kaur, Rajvinder; Singh, Jaswinder
2016-10-01
Domestication and intensive selective breeding of plants has triggered erosion of genetic diversity of important stress-related alleles. Researchers highlight the potential of using wild accessions as a gene source for improvement of cereals such as barley, which has major economic and social importance worldwide. Previously, we have successfully introduced the maize Ac/Ds transposon system for gene identification in cultivated barley. The objective of current research was to investigate the response of Hordeum vulgare ssp. spontaneum wild barley accessions in tissue culture to standardize parameters for introduction of Ac/Ds transposons through genetic transformation. We investigated the response of ten wild barley genotypes for callus induction, regenerative green callus induction and regeneration of fertile plants. The activity of exogenous Ac/Ds elements was observed through a transient assay on immature wild barley embryos/callus whereby transformed embryos/calli were identified by the expression of GUS. Transient Ds expression bombardment experiments were performed on 352 pieces of callus (3-5 mm each) or immature embryos in 4 genotypes of wild barley. The transformation frequency of putative transgenic callus lines based on transient GUS expression ranged between 72 and100 % in wild barley genotypes. This is the first report of a transformation system in H. vulgare ssp. spontaneum.
Glucuronoarabinoxylans from sorghum grain
Verbruggen, M.A.
1996-01-01
Water-unextractable cell wall materials (WUS) were prepared from raw, polished, and malted sorghum ( Sorghum vulgare cv. Fara Fara). Except for the amounts, hardly any difference could be observed between the WUS of these three raw materials. This means that cell wall
Farmers without borders-genetic structuring in century old barley (Hordeum vulgare).
Forsberg, N E G; Russell, J; Macaulay, M; Leino, M W; Hagenblad, J
2015-02-01
The geographic distribution of genetic diversity can reveal the evolutionary history of a species. For crop plants, phylogeographic patterns also indicate how seed has been exchanged and spread in agrarian communities. Such patterns are, however, easily blurred by the intense seed trade, plant improvement and even genebank conservation during the twentieth century, and discerning fine-scale phylogeographic patterns is thus particularly challenging. Using historical crop specimens, these problems are circumvented and we show here how high-throughput genotyping of historical nineteenth century crop specimens can reveal detailed geographic population structure. Thirty-one historical and nine extant accessions of North European landrace barley (Hordeum vulgare L.), in total 231 individuals, were genotyped on a 384 single nucleotide polymorphism assay. The historical material shows constant high levels of within-accession diversity, whereas the extant accessions show more varying levels of diversity and a higher degree of total genotype sharing. Structure, discriminant analysis of principal components and principal component analysis cluster the accessions in latitudinal groups across country borders in Finland, Norway and Sweden. FST statistics indicate strong differentiation between accessions from southern Fennoscandia and accessions from central or northern Fennoscandia, and less differentiation between central and northern accessions. These findings are discussed in the context of contrasting historical records on intense within-country south to north seed movement. Our results suggest that although seeds were traded long distances, long-term cultivation has instead been of locally available, possibly better adapted, genotypes.
International Nuclear Information System (INIS)
Negi, Mahima; Tilak, K.V.B.R.; Sachdev, M.S.
1991-01-01
Response of barley (Hordeum vulgare L.) in a sandy-loam soil under potted conditions revealed that application of nitrogen and phosphorus increased the population of Azospirillium in the barley rhizosphere. A two fold increase was observed in the Azospirillium population at 80 days compared to that at 40 days of plant growth. The unsterilized inoculated roots had more population than the surface sterilized inoculated roots. Increased drymatter production of barley was obtained in A. brasilense inoculated N 0 P 1 (0 kg N and 30 kg P 2 O 5 ha -1 ) treatment than uninoculated control. Also N and P uptake was higher in A. brasilense inoculated plants in the presence of both N and P fertilizers. The 15 N data revealed that at harvest nearly 36 per cent of the total N uptake was from the nitrogen fixed by A. brasilense irrespective of P treatment. (author). 16 refs., 4 tabs
Evaluation of barley (hordeum vulgare l.) germplasm for high forage production under salt stress
International Nuclear Information System (INIS)
Saleem, A.; Qurainy, F.A.; Akram, N.A.
2014-01-01
To explore high biomass producing salt tolerant cultivars of a potential forage crop barley (Hordeum vulgare L.), 30-day old plants of 105 different accessions from different origin were subjected to saline and non-saline (control) conditions for 45 days. Salinity stress (150 mM NaCl) markedly suppressed plant growth (shoot and/or root fresh and dry weights), chlorophyll pigments (a and b), internal CO/sub 2/ concentration, stomatal conductance, rate of transpiration and photosynthesis, while a considerable salt-induced increase was observed in all fluorescence related attributes including efficiency of photosystem-II (Fv/Fm), co-efficient of non-photochemical quenching (QN), photochemical quenching (QP), and non-photochemical quenching (NPQ) in all 105 accessions of barley. The response of all 105 barley accessions to salt stress varied significantly for all the morpho-physiological attributes determined in the present study. Overall, on the basis of shoot and root dry weights, accessions, 4050, 4053, 4056, 4163, 4228, 4229, 4244, 4245, 4290, 4414, 4415, 4427, 4452, Mahali, Jesto, 4165, 4229, 4249, 4405, 4409, 4426, 4456, and Giza 123 were found superior while accessions, 4245, 4158, 4166, 4246, 4406, 4423, 4441, 4442 4447, 4453 and 4458 inferior under saline conditions. (author)
International Nuclear Information System (INIS)
Forster, B.P.; Pakniyat, H.; Macaulay, M.; Matheson, W.; Phillips, M.S.; Thomas, W.T.B.; Powell, W.
1994-01-01
Tests for shoot and root sodium content were carried out on various barley cultivars (Hordeum vulgare) and experimental lines including wild barley (H. spontaneum) and derivatives. Lines were grown in hydroculture with and without the addition of salt (NaCl), and sodium concentrations in shoots and roots were determined. Variation in shoot sodium content was found between the various lines; in contrast, no significant differences were found between the lines tested for root sodium content. The most significant finding was the variation in shoot sodium content between the two cultivars Golden Promise and Maythorpe. Golden Promise is a direct gamma-ray induced mutant of the cultivar Maythorpe and the reduced shoot sodium content of Golden Promise can be attributed to radiation treatment. (author)
Genetic analysis on the competitive ability of barley ( Hordeum ...
African Journals Online (AJOL)
Genetic analysis on the competitive ability of barley ( Hordeum vulgare L.) recombinant inbred lines intercropped with oat ( Avena sativa L.) weeds. ... Furthermore, the commonly used herbicide price is soaring from time to time and out of the reach of the poor farmers in the developing countries. Therefore, this method is an ...
Arias, Milton Senen Barcos; Peña-Cabriales, Juan José; Alarcón, Alejandro; Maldonado Vega, María
2015-01-01
The effect of an arbuscular mycorrhizal fungi (AMF) consortium conformed by (Glomus intraradices, Glomus albidum, Glomus diaphanum, and Glomus claroideum) on plant growth and absorption of Pb, Fe, Na, Ca, and (32)P in barley (Hordeum vulgare L.) and sunflower (Helianthus annuus L.) plants was evaluated. AMF-plants and controls were grown in a substrate amended with powdered Pb slag at proportions of 0, 10, 20, and 30% v/v equivalent to total Pb contents of 117; 5,337; 13,659, and 19,913 mg Pb kg(-1) substrate, respectively. Mycorrhizal root colonization values were 70, 94, 98, and 90%, for barley and 91, 97, 95, and 97%, for sunflower. AMF inoculum had positive repercussions on plant development of both crops. Mycorrhizal barley absorbed more Pb (40.4 mg Pb kg(-1)) shoot dry weight than non-colonized controls (26.5 mg Pb kg(-1)) when treated with a high Pb slag dosage. This increase was higher in roots than shoots (650.0 and 511.5 mg Pb kg(-1) root dry weight, respectively). A similar pattern was found in sunflower. Plants with AMF absorbed equal or lower amounts of Fe, Na and Ca than controls. H. vulgare absorbed more total P (1.0%) than H. annuus (0.9%). The arbuscular mycorrizal consortium enhanced Pb extraction by plants.
Directory of Open Access Journals (Sweden)
Šurlan-Momirović Gordana
2013-01-01
Full Text Available Molecular diversity of 145 barley (Hordeum vulgare subsp. vulgare L. accessions from the Serbian GenBank was assessed by single sequence repeats (SSR markers. A set of 15 SSRs, covering all chromosomes of the diploid barley genome with 2-3 SSR markers per chromosome, with a range of 4-18 alleles per locus were used. In total, 15 loci and 119 alleles were detected, with an average of 7.93 alleles per locus. The Polymorphic information content value ranged from 0.220 to 0.782 with a mean value of 0.534. Regarding the growth habit and row type groups, gene diversity was comparatively higher for the spring (0.616 and six-rowed accessions (0.616 than for the winter and two- rowed accessions (0.322 and 0.478, respectively. Analysis of molecular variance showed that all sources of variation were significant (P < 0.01, but the between-group component was predominant (76.85% for growth habit and 89.45% for row type. Unweighted Pair Group Method with Arithmetic Mean (UPGMA cluster analysis based on the shared allele distance (DSA matrix estimated on the SSR data assigned the genotypes into two clusters - the first smaller consisting of the six 6-rowed spring cultivars and the second comprising six subclusters. Genotype MBR1012 was separated from all other genotypes that constitute UPGMA tree. The associations of genotypes belonging to different growth habit and row type groups were assessed using Principal Coordinate Analysis revealing separation of winter growth habit group from facultative one. The use of the STRUCTURE clustering algorithm allowed the identification of 2 subpopulations of genotypes. [Projekat Ministarstva nauke Republike Srbije, br. TR31092
Green Fodder Production and Water Use Efficiency of Some Forage Crops under Hydroponic Conditions
Ghazi N. Al-Karaki; M. Al-Hashimi
2012-01-01
The objectives of this study were to evaluate five forage crops (alfalfa (Medicago sativa), barley (Hordeum vulgare), cowpea (Vigna unguiculata), sorghum (Sorghum bicolor), and wheat (Triticum aestivum)) for green fodder production and water use efficiency under hydroponic conditions. The experiment has been conducted under temperature-controlled conditions (24 ± 1°C) and natural window illumination at growth room of Soilless Culture Laboratory, Arabian Gulf University, Manama, Bahrain. The r...
Peña, Pamela A; Quach, Truyen; Sato, Shirley; Ge, Zhengxiang; Nersesian, Natalya; Dweikat, Ismail M; Soundararajan, Madhavan; Clemente, Tom
2017-12-01
The expression of a barley alanine aminotransferase gene impacts agronomic outcomes in a C3 crop, wheat. The use of nitrogen-based fertilizers has become one of the major agronomic inputs in crop production systems. Strategies to enhance nitrogen assimilation and flux in planta are being pursued through the introduction of novel genetic alleles. Here an Agrobacterium-mediated approach was employed to introduce the alanine aminotransferase from barley (Hordeum vulgare), HvAlaAT, into wheat (Triticum aestivum) and sorghum (Sorghum bicolor), regulated by either constitutive or root preferred promoter elements. Plants harboring the transgenic HvAlaAT alleles displayed increased alanine aminotransferase (alt) activity. The enhanced alt activity impacted height, tillering and significantly boosted vegetative biomass relative to controls in wheat evaluated under hydroponic conditions, where the phenotypic outcome across these parameters varied relative to time of year study was conducted. Constitutive expression of HvAlaAT translated to elevation in wheat grain yield under field conditions. In sorghum, expression of HvAlaAT enhanced enzymatic activity, but no changes in phenotypic outcomes were observed. Taken together these results suggest that positive agronomic outcomes can be achieved through enhanced alt activity in a C3 crop, wheat. However, the variability observed across experiments under greenhouse conditions implies the phenotypic outcomes imparted by the HvAlaAT allele in wheat may be impacted by environment.
Directory of Open Access Journals (Sweden)
Miriama Kopernická
2016-01-01
Full Text Available Heavy metals and other toxic elements in the environment, mainly located in soil and groundwater, have a significant effect on plant and its productivity that has a huge attention in recent years. Accumulation of heavy metals in soil cause toxicity to plants, and contaminate the food chain. The industrial areas, as well as developing countries have been contaminated with high concentration of heavy metals. Main sources of contamination are mining and other industrial processes, as well as military and or lanfills, sludge dumps or waste disposal sites. The heavy metals are very dangerous to environment and pose serious danger to public health by entering throught the food chain or into drinking water. Phytoextraction is one way how to remove the contaminants from soil by plants. Phytoextraction of heavy metals is a technology that has been studied for several years. It is more ecological and cheaper way how to clean our environment.Several plant species are known becauce they hyperaccumulate a high contents of metals from the soil. The accumulators are mainly herbaceous species, crops and nowadays angiosperm trees with a high growth such as poplars or willows. We have focused on the determination of some morphological (lenght and weight of roots and biomass and physiological (contents of dry mass and number of lief stomata characteristics and the determination of the bioaccumulation factor and the translocation factor of cadmium by spring barley (Hordeum vulgare L.. Imprints of leaves were evaluated using an optical microscope Axiostar Plus, Carl Zeiss, lens CP Achromat 40x/0.65, eyepiece PI 10x / 18, Canon Utilities Software Zoom Browser EX 4.6 and hardware Acer Travel Mate 4600, Canon Power Shot A95. The density of stomata was evaluated on an area of 1 mm2. Samples of the dried plants (leaves and roots were mineralized by acid digestion using microwave digestion device MARS X - press 5. The end of determination to obtain the cadmium content was
Characterization of Gene Candidates for Vacuolar Sodium Transport from Hordeum Vulgare
Scheu, Arne Hagen August
2017-05-01
Soil salinity is a major abiotic stress for land plants, and multiple mechanisms of salt tolerance have evolved. Tissue tolerance is one of these mechanisms, which involves the sequestration of sodium into the vacuole to retain low cytosolic sodium concentrations. This enables the plant to maintain cellular functions, and ultimately maintain growth and yield. However, the molecular components involved in tissue tolerance remain elusive. Several candidate genes for vacuolar sodium sequestration have recently been identified by proteome analysis of vacuolar membranes purified from the salt-tolerant cereal Hordeum vulgare (barley). In this study, I aimed to characterize these candidates in more detail. I successfully cloned coding sequences for the majority of candidate genes with primers designed based on the barley reference genome sequence. During the course of this study a newer genome sequence with improved annotations was published, to which I also compared my observations. To study the candidate genes, I used the heterologous expression system Saccharomyces cerevisiae (yeast). I used several salt sensitive yeast strains (deficient in intrinsic sodium transporters) to test whether the candidate genes would affect their salt tolerance by mediating the sequestration of sodium into the yeast vacuole. I observed a reduction in growth upon expression for several of the gene candidate under salt-stress conditions. However, confocal microscopy suggests that most gene products are subject to degradation, and did not localize to the vacuolar membrane (tonoplast). Therefore, growth effects cannot be linked to protein function without further evidence. Various potential causes are discussed, including inaccuracies in the genome resource used as reference for primer design and issues inherent to the model system. Finally, I make suggestions on how to proceed to further characterize the candidate genes and hopefully identify novel sodium transporters from barley.
Directory of Open Access Journals (Sweden)
Juárez-Cisneros Gladys
2014-11-01
Full Text Available Soil pollution by waste motor oil (WMO caused soil´s lost fertility. The aims of this research where a bioremediation of soil polluted by 10000 ppm of WMO for biostimulation with vermicompost (VC at 3 and 6 % (w/w follow by b phytoremediation (PR of the same soil to eliminate remaining WMO with Sorghum vulgare inoculated with Bacillus cereus and/or Rhizobium etli or Promoting Growth Plant Bacteria (PGPB. At the first step of assay WMO concentration was measured before and after bioremediation. At the second step the same soil phytoremediation was applied for remaining WHO sowing S. vulgare inoculated with PGPB, then at flowering stage its biomass and WHO final concentration was determined. Results showed that soil impacted by WMO biostimulated with VC at 3% was eliminated 8630 ppm of WMO. At the second phase in the same soil PR applied for remaining WMO which was reduced until 210 ppm. Soil polluted by remaining WMO applied PR using S. vulgare plus R. etli WMO was decreased at 260 ppm. While S. vulgare´s biomass inoculated with PGPB was higher compared to S. vulgare grown in soil not polluted by WMO according by ANOVA - Tukey (p > 0.05. These results suggested that soil polluted by WMO could be recovering by applying integrated BR and PR better than just using one type.
High-throughput transcriptome analysis of barley (Hordeum vulgare) exposed to excessive boron.
Tombuloglu, Guzin; Tombuloglu, Huseyin; Sakcali, M Serdal; Unver, Turgay
2015-02-15
Boron (B) is an essential micronutrient for optimum plant growth. However, above certain threshold B is toxic and causes yield loss in agricultural lands. While a number of studies were conducted to understand B tolerance mechanism, a transcriptome-wide approach for B tolerant barley is performed here for the first time. A high-throughput RNA-Seq (cDNA) sequencing technology (Illumina) was used with barley (Hordeum vulgare), yielding 208 million clean reads. In total, 256,874 unigenes were generated and assigned to known peptide databases: Gene Ontology (GO) (99,043), Swiss-Prot (38,266), Clusters of Orthologous Groups (COG) (26,250), and the Kyoto Encyclopedia of Genes and Genomes (KEGG) (36,860), as determined by BLASTx search. According to the digital gene expression (DGE) analyses, 16% and 17% of the transcripts were found to be differentially regulated in root and leaf tissues, respectively. Most of them were involved in cell wall, stress response, membrane, protein kinase and transporter mechanisms. Some of the genes detected as highly expressed in root tissue are phospholipases, predicted divalent heavy-metal cation transporters, formin-like proteins and calmodulin/Ca(2+)-binding proteins. In addition, chitin-binding lectin precursor, ubiquitin carboxyl-terminal hydrolase, and serine/threonine-protein kinase AFC2 genes were indicated to be highly regulated in leaf tissue upon excess B treatment. Some pathways, such as the Ca(2+)-calmodulin system, are activated in response to B toxicity. The differential regulation of 10 transcripts was confirmed by qRT-PCR, revealing the tissue-specific responses against B toxicity and their putative function in B-tolerance mechanisms. Copyright © 2014. Published by Elsevier B.V.
Directory of Open Access Journals (Sweden)
Bouhaouel, I.
2016-01-01
Full Text Available Description of the subject. The present study focuses on the description of the allelopathic interactions between wild and crop species that may occur in a given ecosystem. Objectives. The objective is the evaluation of the allo- and autoinhibition activity of root exudates of barley (Hordeum vulgare L. subsp. vulgare and great brome (Bromus diandrus Roth. seedlings by water-soluble allelochemicals. Method. The allelopathic activities of five Tunisian barley genotypes (modern varieties and landraces, one Saudi Arabian barley landrace and great brome were assessed using a modified laboratory bioassay named "seedling-after-seedling agar method". Results. The barley or the great brome reduced, to a greater extent, the root growth compared to the shoot growth of receiver species. The response of the root system architecture of the great brome towards barley root exudates was studied in detail. All the measured root traits were highly sensitive to the presence of barley. In our conditions, the allelopathic activity of barley root exudates had no apparent relationship with the size of the root and a prominent action of genetic determinants in the allelopathic potential between genotypes is proposed. The alloinhibitory activity of barley or great brome root exudates deferred between the receiver species but was always higher than the autoinhibition potential. The autoinhibition in barley proved to depend on whether the genotypes used as donor and receiver are identical or different, suggesting a specific interaction of allelochemicals with the receiver plant. These molecules seem to be the main actors in the allelopathic barley potential as external factors such variations of pH have no evident relevance in the inhibition process. Conclusions. Barley and great brome exude molecules in their surroundings. This affects the growth of the receiver plants, suggesting that these compounds might contribute to the plant community dynamics.
Directory of Open Access Journals (Sweden)
M.A. Urchei
1994-12-01
Full Text Available Objetivando avaliar os efeitos de défices hídricos, em três estádios fonológicos da cultura da cevada (Hordeum vulgare L., foi conduzido experimento em vasos, com delineamento em blocos ao acaso. Foram utilizados nove tratamentos decorrentes da combinação dos potenciais mínimos de água no solo de -0,05, -0,20 e -1,50 MPa, com os estádios fenológicos de máximo perfilhamento, florescimento e grão leitoso, permanecendo uniformizados durante o restante do ciclo, entre os potenciais de -0,01 a -0,05 MPa. Os resultados de produção, peso e teor de proteína dos grãos, tamanho de espigas, número total e número de espigas chochas, mostraram que os efeitos de défices hídricos variaram com a intensidade, duração e estádio fenológico da cultura, onde o estádio de florescimento mostrou-se mais sensível ao défice de água. A ocorrência de défice hídrico intenso, em cada um dos estádios, bem como ciclos repetidos de défices moderados ou intensos, levaram à diminuições significativas na produção de grãos, além de ocorrer tendência ao aumento do teor de protema dos grãos. O manejo da irrigação na cultura da cevada, quando se busca a máxima eficiência no uso da água, deve levar em conta os diferentes estádios fenológicos.The experiment was carried out under greenhouse conditions, with the objective of evaluating the effects of water deficits in three phenological phases of barley crop (Hordeum vulgare L.. Pots were arranged in a randomized block design with nine treatments. They originated from the combination of minimum soil water potentials of -0,05, -0,20 and -1,50 MPa, with the phenological phases of maximum tillering, flowering and milky grain, having been hold uniformly along the rest of the cycle, between -0,01 and -0,05 MPa potentials. Weight of grain, protein content, spike sizes, spike total number and number of hollow spikes, showed that water deficit effects varied with the intensity, duration and
International Nuclear Information System (INIS)
Kirkensgaard, Kristine G.; Hägglund, Per; Finnie, Christine; Svensson, Birte; Henriksen, Anette
2009-01-01
The first crystal structure of a cereal NTR, a protein involved in seed development and germination, has been determined. The structure is in a conformation that excludes NADPH binding and indicates that a domain reorientation facilitated by Trx binding precedes NADPH binding in the reaction mechanism. Thioredoxins (Trxs) are protein disulfide reductases that regulate the intracellular redox environment and are important for seed germination in plants. Trxs are in turn regulated by NADPH-dependent thioredoxin reductases (NTRs), which provide reducing equivalents to Trx using NADPH to recycle Trxs to the active form. Here, the first crystal structure of a cereal NTR, HvNTR2 from Hordeum vulgare (barley), is presented, which is also the first structure of a monocot plant NTR. The structure was determined at 2.6 Å resolution and refined to an R cryst of 19.0% and an R free of 23.8%. The dimeric protein is structurally similar to the structures of AtNTR-B from Arabidopsis thaliana and other known low-molecular-weight NTRs. However, the relative position of the two NTR cofactor-binding domains, the FAD and the NADPH domains, is not the same. The NADPH domain is rotated by 25° and bent by a 38% closure relative to the FAD domain in comparison with AtNTR-B. The structure may represent an intermediate between the two conformations described previously: the flavin-oxidizing (FO) and the flavin-reducing (FR) conformations. Here, analysis of interdomain contacts as well as phylogenetic studies lead to the proposal of a new reaction scheme in which NTR–Trx interactions mediate the FO to FR transformation
Energy Technology Data Exchange (ETDEWEB)
Kirkensgaard, Kristine G. [Carlsberg Laboratory (Denmark); Enzyme and Protein Chemistry, Department of Systems BioIogy, Technical University of Denmark (Denmark); Hägglund, Per; Finnie, Christine; Svensson, Birte [Enzyme and Protein Chemistry, Department of Systems BioIogy, Technical University of Denmark (Denmark); Henriksen, Anette, E-mail: anette@crc.dk [Carlsberg Laboratory (Denmark)
2009-09-01
The first crystal structure of a cereal NTR, a protein involved in seed development and germination, has been determined. The structure is in a conformation that excludes NADPH binding and indicates that a domain reorientation facilitated by Trx binding precedes NADPH binding in the reaction mechanism. Thioredoxins (Trxs) are protein disulfide reductases that regulate the intracellular redox environment and are important for seed germination in plants. Trxs are in turn regulated by NADPH-dependent thioredoxin reductases (NTRs), which provide reducing equivalents to Trx using NADPH to recycle Trxs to the active form. Here, the first crystal structure of a cereal NTR, HvNTR2 from Hordeum vulgare (barley), is presented, which is also the first structure of a monocot plant NTR. The structure was determined at 2.6 Å resolution and refined to an R{sub cryst} of 19.0% and an R{sub free} of 23.8%. The dimeric protein is structurally similar to the structures of AtNTR-B from Arabidopsis thaliana and other known low-molecular-weight NTRs. However, the relative position of the two NTR cofactor-binding domains, the FAD and the NADPH domains, is not the same. The NADPH domain is rotated by 25° and bent by a 38% closure relative to the FAD domain in comparison with AtNTR-B. The structure may represent an intermediate between the two conformations described previously: the flavin-oxidizing (FO) and the flavin-reducing (FR) conformations. Here, analysis of interdomain contacts as well as phylogenetic studies lead to the proposal of a new reaction scheme in which NTR–Trx interactions mediate the FO to FR transformation.
Hordein Variation in Wild (Hordeum Spontaneum) and Cultivated (H. Vulgare) Barley
DEFF Research Database (Denmark)
Doll, Hans; Brown, A. H. D.
1979-01-01
The storage protein hordein contains two major groups of polypeptides which are highly polymorphic in barley, and in its evolutionary progenitor Hordeum spontaneum Koch. Crosses between the two species showed that the complex electrophoretic phenotypes within the two groups of polypeptides are go...
Directory of Open Access Journals (Sweden)
F. Taghavi Ghasemkheyli
2015-01-01
Full Text Available To investigate the effect of Trichoderma harzianum, as a bioabsorbant to ameliorate the harmful effects of cadmium (Cd on growth and yield of barley (Hordeum vulgare L. variety ‘Sahra’, a factorial pot experiment based on completely randomized design with three replicates was conducted. Trichoderma harzianum withtwo levels (with and without inoculation and cadmium nitrate with four levels (0, 50, 100 and 150 mg.L-1 were the treatments. Results of ANOVA revealed that there was a significant interaction between Trichoderma and cadmium nitrate in terms of biological yield, straw yield, harvest index, spike number per plant and seed number per spike. Mean comparisons showed that Trichoderma inoculation at all Cd levels significantly improved both biological and straw yields. Trichoderma at 50 and 100 mg.L-1 of Cd also increased the spike number per plant (up to 120 and 66%, respectively significantly. Increasing Cd levels decreased seed yield (19%, 1000 seed weight (18%, partitioning coefficient (57% and tolerance index (23% significantly. Inoculation of Trichoderma into growth medium had a significant effect on seed yield and tolerance index (up to 17 and 22%, respectively. In conclusion, Trichoderma harzianum inoculation at lower concentrations of Cd (50 and 100 mg.L-1 could be effective to improve growth parameters of barley plant.
Regrowth in Barley (Hordeum vulgare L.) and Rye (Secale cereale L.)
DEFF Research Database (Denmark)
Christiansen, J L; Jørgensen, Johannes Ravn; Jørnsgård, B
1998-01-01
Regrowth after cutting at four development stages, from heading to grain maturity, was investigated in a pot experiment containing three rye and four barley varieties (including 2 Hordeum spontaneum lines). Regrowth in the barley varieties decreased strongly from heading to grain maturity. Rye ge...
Genome-Wide Association Mapping of Stem Rust Resistance in Hordeum vulgare subsp. spontaneum.
Sallam, Ahmad H; Tyagi, Priyanka; Brown-Guedira, Gina; Muehlbauer, Gary J; Hulse, Alex; Steffenson, Brian J
2017-10-05
Stem rust was one of the most devastating diseases of barley in North America. Through the deployment of cultivars with the resistance gene Rpg1 , losses to stem rust have been minimal over the past 70 yr. However, there exist both domestic (QCCJB) and foreign (TTKSK aka isolate Ug99) pathotypes with virulence for this important gene. To identify new sources of stem rust resistance for barley, we evaluated the Wild Barley Diversity Collection (WBDC) (314 ecogeographically diverse accessions of Hordeum vulgare subsp. spontaneum ) for seedling resistance to four pathotypes (TTKSK, QCCJB, MCCFC, and HKHJC) of the wheat stem rust pathogen ( Puccinia graminis f. sp. tritici , Pgt ) and one isolate (92-MN-90) of the rye stem rust pathogen ( P. graminis f. sp. secalis , Pgs ). Based on a coefficient of infection, the frequency of resistance in the WBDC was low ranging from 0.6% with HKHJC to 19.4% with 92-MN-90. None of the accessions was resistant to all five cultures of P. graminis A genome-wide association study (GWAS) was conducted to map stem rust resistance loci using 50,842 single-nucleotide polymorphic markers generated by genotype-by-sequencing and ordered using the new barley reference genome assembly. After proper accounting for genetic relatedness and structure among accessions, 45 quantitative trait loci were identified for resistance to P. graminis across all seven barley chromosomes. Three novel loci associated with resistance to TTKSK, QCCJB, MCCFC, and 92-MN-90 were identified on chromosomes 5H and 7H, and two novel loci associated with resistance to HKHJC were identified on chromosomes 1H and 3H. These novel alleles will enhance the diversity of resistance available for cultivated barley. Copyright © 2017 Sallam et al.
Directory of Open Access Journals (Sweden)
Balderas-León Iván
2015-02-01
Full Text Available Waste motor oil (WMO pollutes soil and causing lost soil fertility. An alternative to solve this problem its bioremediation (BR by double and following biostimulation (BS with mineral solution (MS and a legume as green manure (GM then using phytoremediation (PR with growth promoting vegetal bacteria (GPVB like Bacillus cereus and Burkholderia cepacia to minimize remaining WMO. The aims of this research were: a bioremediation of polluted soil by 75000 ppm of WMO by biostimulation and then b Its phytoremediation for remaining WMO by Sorghum vulgare inoculated with B. cereus and B. cepacia. Soil polluted by high concentration WMO was biostimulated with MS, and then Phaseolus vulgaris treated by GPVB was incorporated as GM, finally to apply PR to eliminate WMO with S. vulgare with GPVB. Results indicate that soil bioremediated by biostimulation with MS, WMO decreased at 32500 ppm/30 days, and then with GM, WMO was reduced at 10100 ppm after/90 days. Finally, to apply phytoremediation using S. vulgare and GPVB at flowering, WMO was reduced from 2500 ppm to 800 ppm. For recovering soil impacted by high concentration WMO to apply both techniques double and following BS and PR are the best option than each technique separately.
Ford, Brett; Deng, Weiwei; Clausen, Jenni; Oliver, Sandra; Boden, Scott; Hemming, Megan; Trevaskis, Ben
2016-01-01
An increase in global temperatures will impact future crop yields. In the cereal crops wheat and barley, high temperatures accelerate reproductive development, reducing the number of grains per plant and final grain yield. Despite this relationship between temperature and cereal yield, it is not clear what genes and molecular pathways mediate the developmental response to increased temperatures. The plant circadian clock can respond to changes in temperature and is important for photoperiod-dependent flowering, and so is a potential mechanism controlling temperature responses in cereal crops. This study examines the relationship between temperature, the circadian clock, and the expression of flowering-time genes in barley (Hordeum vulgare), a crop model for temperate cereals. Transcript levels of barley core circadian clock genes were assayed over a range of temperatures. Transcript levels of core clock genes CCA1, GI, PRR59, PRR73, PRR95, and LUX are increased at higher temperatures. CCA1 and PRR73 respond rapidly to a decrease in temperature whereas GI and PRR59 respond rapidly to an increase in temperature. The response of GI and the PRR genes to changes in temperature is lost in the elf3 mutant indicating that their response to temperature may be dependent on a functional ELF3 gene. PMID:27580625
International Nuclear Information System (INIS)
Lock, K.; De Schamphelaere, K.A.C.; Becaus, S.; Criel, P.; Van Eeckhout, H.; Janssen, C.R.
2007-01-01
A Biotic Ligand Model was developed predicting the effect of cobalt on root growth of barley (Hordeum vulgare) in nutrient solutions. The extent to which Ca 2+ , Mg 2+ , Na + , K + ions and pH independently affect cobalt toxicity to barley was studied. With increasing activities of Mg 2+ , and to a lesser extent also K + , the 4-d EC50 Co2+ increased linearly, while Ca 2+ , Na + and H + activities did not affect Co 2+ toxicity. Stability constants for the binding of Co 2+ , Mg 2+ and K + to the biotic ligand were obtained: log K CoBL = 5.14, log K MgBL = 3.86 and log K KBL = 2.50. Limited validation of the model with one standard artificial soil and one standard field soil showed that the 4-d EC50 Co2+ could only be predicted within a factor of four from the observed values, indicating further refinement of the BLM is needed. - Biotic Ligand Models are not only a useful tool to assess metal toxicity in aquatic systems but can also be used for terrestrial plants
Szoboszlay, Márton; Näther, Astrid; Mitterbauer, Esther; Bender, Jürgen; Weigel, Hans-Joachim; Tebbe, Christoph C
2017-08-01
The effect of elevated atmospheric CO 2 concentration [CO 2 ] on the diversity and composition of the prokaryotic community inhabiting the rhizosphere of winter barley (Hordeum vulgare L.) was investigated in a field experiment, using open-top chambers. Rhizosphere samples were collected at anthesis (flowering stage) from six chambers with ambient [CO 2 ] (approximately 400 ppm) and six chambers with elevated [CO 2 ] (700 ppm). The V4 region of the 16S rRNA gene was PCR-amplified from the extracted DNA and sequenced on an Illumina MiSeq instrument. Above-ground plant biomass was not affected by elevated [CO 2 ] at anthesis, but plants exposed to elevated [CO 2 ] had significantly higher grain yield. The composition of the rhizosphere prokaryotic communities was very similar under ambient and elevated [CO 2 ]. The dominant taxa were Bacteroidetes, Actinobacteria, Alpha-, Gamma-, and Betaproteobacteria. Elevated [CO 2 ] resulted in lower prokaryotic diversity in the rhizosphere, but did not cause a significant difference in community structure. © 2017 The Authors. MicrobiologyOpen published by John Wiley & Sons Ltd.
Directory of Open Access Journals (Sweden)
Laura Lopez Del Egido
2017-05-01
Full Text Available A comparative analysis was carried out of published methods to assess seed viability using 2,3,5-triphenyltetrazolium chloride (TTC based assays of seed batches. The tests were carried out on seeds of barley (Hordeum vulgare cv. Optic as a model. We established that 10% [w/v] trichloroacetic acid (TCA/methanol is superior to the acetone and methanol-only based methods: allowing the highest recovery of formazan and the lowest background optical density (OD readings, across seed lots comprising different ratios of viable and dead seeds. The method allowed a linear-model to accurately capture the statistically significant relationship between the quantity of formazan that could be extracted using the method we developed and the seed temperature-response, and seed viability as a function of artificially aged seed lots. Other quality control steps are defined to help ensure the assay is robust and these are reported in a Standard Operating Procedure.
Ye, Lingzhen; Huang, Yuqing; Dai, Fei; Ning, Huajiang; Li, Chengdao; Zhou, Meixue; Zhang, Guoping
2015-06-11
In bright beer, haze formation is a serious quality problem, degrading beer quality and reducing its shelf life. The quality of barley (Hordeum vulgare L) malt, as the main raw material for beer brewing, largely affects the colloidal stability of beer. In this study, the genetic mechanism of the factors affecting beer haze stability in barley was studied. Quantitative trait loci (QTL) analysis of alcohol chill haze (ACH) in beer was carried out using a Franklin/Yerong double haploid (DH) population. One QTL, named as qACH, was detected for ACH, and it was located on the position of about 108 cM in chromosome 4H and can explain about 20 % of the phenotypic variation. Two key haze active proteins, BATI-CMb and BATI-CMd were identified by proteomics analysis. Bioinformatics analysis showed that BATI-CMb and BATI-CMd had the same position as qACH in the chromosome. It may be deduced that BATI-CMb and BATI-CMd are candidate genes for qACH, controlling colloidal stability of beer. Polymorphism comparison between Yerong and Franklin in the nucleotide and amino acid sequence of BATI-CMb and BATI-CMd detected the corresponding gene specific markers, which could be used in marker-assisted selection for malt barley breeding. We identified a novel QTL, qACH controlling chill haze of beer, and two key haze active proteins, BATI-CMb and BATI-CMd. And further analysis showed that BATI-CMb and BATI-CMd might be the candidate genes associated with beer chill haze.
Energy Technology Data Exchange (ETDEWEB)
Voorman, R; Penner, D
1986-09-01
(/sup 14/C)-MBOCA was absorbed by cabbage (Brassica oleracea L.), bean (Phaseolus vulgaris L.), and sugar beet (Beta vulgaris L.) leaves, but did not move beyond the absorption point. Radio autographs of bean, sorghum (Sorghum vulgare Pers.), orchard grass (Dactylis glomerata L.) and carrot (Daucus carrota L.) plants exposed to (/sup 14/C)-MBOCA via hydroponic culture showed considerable radioactivity associated with the roots with only limited translocation of (/sup 14/C) into upper plant parts. Bean and cucumber (Cucumis sativa L.) plants grown in (/sup 14/C)-MBOCA amended soil translocated virtually no (/sup 14/C) into aerial parts, but again considerable radioactivity was found on roots. Radioactivity could not be rinsed off roots with water or acetone, and a small amount of radioactivity was observed in the xylem-phloem layer of the carrot root.
Dawn and Dusk Set States of the Circadian Oscillator in Sprouting Barley (Hordeum vulgare Seedlings.
Directory of Open Access Journals (Sweden)
Weiwei Deng
Full Text Available The plant circadian clock is an internal timekeeper that coordinates biological processes with daily changes in the external environment. The transcript levels of clock genes, which oscillate to control circadian outputs, were examined during early seedling development in barley (Hordeum vulgare, a model for temperate cereal crops. Oscillations of clock gene transcript levels do not occur in barley seedlings grown in darkness or constant light but were observed with day-night cycles. A dark-to-light transition influenced transcript levels of some clock genes but triggered only weak oscillations of gene expression, whereas a light-to-dark transition triggered robust oscillations. Single light pulses of 6, 12 or 18 hours induced robust oscillations. The light-to-dark transition was the primary determinant of the timing of subsequent peaks of clock gene expression. After the light-to-dark transition the timing of peak transcript levels of clock gene also varied depending on the length of the preceding light pulse. Thus, a single photoperiod can trigger initiation of photoperiod-dependent circadian rhythms in barley seedlings. Photoperiod-specific rhythms of clock gene expression were observed in two week old barley plants. Changing the timing of dusk altered clock gene expression patterns within a single day, showing that alteration of circadian oscillator behaviour is amongst the most rapid molecular responses to changing photoperiod in barley. A barley EARLY FLOWERING3 mutant, which exhibits rapid photoperiod-insensitive flowering behaviour, does not establish clock rhythms in response to a single photoperiod. The data presented show that dawn and dusk cues are important signals for setting the state of the circadian oscillator during early development of barley and that the circadian oscillator of barley exhibits photoperiod-dependent oscillation states.
Williams, Alwyn; Manoharan, Lokeshwaran; Rosenstock, Nicholas P; Olsson, Pål Axel; Hedlund, Katarina
2017-01-01
Agricultural fertilization significantly affects arbuscular mycorrhizal fungal (AMF) community composition. However, the functional implications of community shifts are unknown, limiting understanding of the role of AMF in agriculture. We assessed AMF community composition at four sites managed under the same nitrogen (N) and phosphorus (P) fertilizer regimes for 55 yr. We also established a glasshouse experiment with the same soils to investigate AMF-barley (Hordeum vulgare) nutrient exchange, using carbon ( 13 C) and 33 P isotopic labelling. N fertilization affected AMF community composition, reducing diversity; P had no effect. In the glasshouse, AMF contribution to plant P declined with P fertilization, but was unaffected by N. Barley C allocation to AMF also declined with P fertilization. As N fertilization increased, C allocation to AMF per unit of P exchanged increased. This occurred with and without P fertilization, and was concomitant with reduced barley biomass. AMF community composition showed no relationship with glasshouse experiment results. The results indicate that plants can reduce C allocation to AMF in response to P fertilization. Under N fertilization, plants allocate an increasing amount of C to AMF and receive relatively less P. This suggests an alteration in the terms of P-C exchange under N fertilization regardless of soil P status. © 2016 The Authors. New Phytologist © 2016 New Phytologist Trust.
Directory of Open Access Journals (Sweden)
Langridge Peter
2007-12-01
Full Text Available Abstract Background Chromosome pairing, recombination and DNA repair are essential processes during meiosis in sexually reproducing organisms. Investigating the bread wheat (Triticum aestivum L. Ph2 (Pairing homoeologous locus has identified numerous candidate genes that may have a role in controlling such processes, including TaMSH7, a plant specific member of the DNA mismatch repair family. Results Sequencing of the three MSH7 genes, located on the short arms of wheat chromosomes 3A, 3B and 3D, has revealed no significant sequence divergence at the amino acid level suggesting conservation of function across the homoeogroups. Functional analysis of MSH7 through the use of RNAi loss-of-function transgenics was undertaken in diploid barley (Hordeum vulgare L.. Quantitative real-time PCR revealed several T0 lines with reduced MSH7 expression. Positive segregants from two T1 lines studied in detail showed reduced MSH7 expression when compared to transformed controls and null segregants. Expression of MSH6, another member of the mismatch repair family which is most closely related to the MSH7 gene, was not significantly reduced in these lines. In both T1 lines, reduced seed set in positive segregants was observed. Conclusion Results presented here indicate, for the first time, a distinct functional role for MSH7 in vivo and show that expression of this gene is necessary for wild-type levels of fertility. These observations suggest that MSH7 has an important function during meiosis and as such remains a candidate for Ph2.
Qiu, Hao; Versieren, Liske; Rangel, Georgina Guzman; Smolders, Erik
2016-01-19
Soil contamination with copper (Cu) is often associated with zinc (Zn), and the biological response to such mixed contamination is complex. Here, we investigated Cu and Zn mixture toxicity to Hordeum vulgare in three different soils, the premise being that the observed interactions are mainly due to effects on bioavailability. The toxic effect of Cu and Zn mixtures on seedling root elongation was more than additive (i.e., synergism) in soils with high and medium cation-exchange capacity (CEC) but less than additive (antagonism) in a low-CEC soil. This was found when we expressed the dose as the conventional total soil concentration. In contrast, antagonism was found in all soils when we expressed the dose as free-ion activities in soil solution, indicating that there is metal-ion competition for binding to the plant roots. Neither a concentration addition nor an independent action model explained mixture effects, irrespective of the dose expressions. In contrast, a multimetal BLM model and a WHAM-Ftox model successfully explained the mixture effects across all soils and showed that bioavailability factors mainly explain the interactions in soils. The WHAM-Ftox model is a promising tool for the risk assessment of mixed-metal contamination in soils.
International Nuclear Information System (INIS)
Mico, C.; Li, H.F.; Zhao, F.J.; McGrath, S.P.
2008-01-01
The influence of soil properties on the bioavailability and toxicity of Co to barley (Hordeum vulgare L.) root elongation was investigated. Ten soils varying widely in soil properties were amended with seven doses of CoCl 2 . Soil properties greatly influenced the expression of Co toxicity. The effective concentration of added Co causing 50% inhibition (EC 50 ) ranged from 45 to 863 mg kg -1 , representing almost 20-fold variation among soils. Furthermore, we investigated Co toxicity in relation to Co concentrations and free Co 2+ activity in soil solution. The EC 50 values showed variation among soils of 17- and 29-fold, based on the Co concentration in soil solution and free Co 2+ activity, respectively. Single regressions were carried out between Co toxicity threshold values and selected soil properties. Models obtained showed that soil effective cation exchange capacity (eCEC) and exchangeable calcium were the most consistent single predictors of the EC 50 values based on soil added Co. - Soil eCEC and exchangeable Ca were found to be the best predictors of the toxicity threshold values of Co to barley root growth on different soils
KESKİNBALTA, Mehmet Anıl; HAMZAOĞLU, Gökhan; ÇELİK, Meryem Yeşim; DERNEKBAŞI, Seval
2015-01-01
Bu araştırmada, Japon balığı (Carassius auratus L. 1758) ve arpa bitkisi (Hordeum vulgare L.) kullanılarak model bir akuaponik sistem oluşturulmuştur. Araştırma süresince arpa bitkisinin suyun nitrit, nitrat ve fosfat değerlerinde yaptığı değişim ve balıkların gelişimi üzerindeki etkilerinin belirlenmesi amaçlanmıştır. 30 günlük araştırma süresince günlük olarak pH, sıcaklık ve oksijen değerleri ölçülmüştür. Haftalık olarak bitki yetiştirme yatağına giren ve bitkiden süzülen suyun nitrit (NO2...
KESKİNBALTA, Mehmet; HAMZAOĞLU, Gökhan; ÇELİK, Meryem; DERNEKBAŞI, Seval
2015-01-01
Bu araştırmada, Japon balığı (Carassius auratus L. 1758) ve arpa bitkisi (Hordeum vulgare L.) kullanılarak model bir akuaponik sistem oluşturulmuştur. Araştırma süresince arpa bitkisinin suyun nitrit, nitrat ve fosfat değerlerinde yaptığı değişim ve balıkların gelişimi üzerindeki etkilerinin belirlenmesi amaçlanmıştır. 30 günlük araştırma süresince günlük olarak pH, sıcaklık ve oksijen değerleri ölçülmüştür. Haftalık olarak bitki yetiştirme yatağına giren ve bitkiden süzülen suyun nitrit (NO2...
Differential responses of two Egyptian barley (Hordeum vulgare L.) cultivars to salt stress.
Elsawy, Hayam I A; Mekawy, Ahmad Mohammad M; Elhity, Mahmoud A; Abdel-Dayem, Sherif M; Abdelaziz, Maha Nagy; Assaha, Dekoum V M; Ueda, Akihiro; Saneoka, Hirofumi
2018-06-01
Although barley (Hordeum vulgare L.) is considered a salt tolerant crop species, productivity of barley is affected differently by ionic, osmotic, and oxidative stresses resulting from a salty rhizosphere. The current study was conducted to elucidate the mechanism of salt tolerance in two barley cultivars, Giza128 and Giza126. The two cultivars were exposed to 200 mM NaCl hydroponically for 12 days. Although both cultivars accumulated a large amount of Na + in their leaves with similar concentrations, the growth of Giza128 was much better than that of Giza126, as measured by maintaining a higher dry weight, relative growth rate, leaf area, and plant height. To ascertain the underlying mechanisms of this differential tolerance, first, the relative expression patterns of the genes encoding Na + /H + antiporters (NHX) and the associated proton pumps (V-PPase and V-ATPase) as well as the gene encoding the plasma membrane PM H + -ATPase were analyzed in leaf tissues. Salt stress induced higher HvNHX1 expression in Giza128 (3.3-fold) than in Giza126 (1.9-fold), whereas the expression of the other two genes, HvNHX2 and HvNHX3, showed no induction in either cultivar. The expression of HvHVP1 and HvHVA was higher in Giza128 (3.8- and 2.1-fold, respectively) than in Giza126 (1.6- and 1.1-fold, respectively). The expression of the PM H + -ATPase (ha1) gene was induced more in Giza128 (8.8-fold) than in Giza126 (1.8-fold). Second, the capacity for ROS detoxification was assessed using the oxidative stress biomarkers electrolyte leakage ratio (ELR) and the concentrations of malondialdehyde (MDA) and hydrogen peroxide (H 2 O 2 ), and these parameters sharply increased in Giza126 leaves by 66.5%, 42.8% and 50.0%, respectively, compared with those in Giza128 leaves. The antioxidant enzyme (CAT, APX, sPOD, GR, and SOD) activities were significantly elevated by salt treatment in Giza128 leaves, whereas in Giza126, these activities were not significantly altered. Overall, the
Hildebrandt, Ulrich; Marsell, Alexander; Riederer, Markus
2018-04-04
Several anthraquinone derivatives are active components of fungicidal formulations particularly effective against powdery mildew fungi. The antimildew effect of compounds such as physcion and chrysophanol is largely attributed to host plant defense induction. However, so far a direct fungistatic/fungicidal effect of anthraquinone derivatives on powdery mildew fungi has not been unequivocally demonstrated. By applying a Formvar-based in vitro system we demonstrate a direct, dose-dependent effect of physcion, chrysophanol, emodin, and pachybasin on conidial germination and appressorium formation of Blumeria graminis f. sp. hordei (DC.) Speer, the causative agent of barley ( Hordeum vulgare L.) powdery mildew. Physcion was the most effective among the tested compounds. At higher doses, physcion mainly inhibited conidial germination. At lower rates, however, a distinct interference with appressorium formation became discernible. Physcion and others may act by modulating both the infection capacity of the powdery mildew pathogen and host plant defense. Our results suggest a specific arrangement of substituents at the anthraquinone backbone structure being crucial for the direct antimildew effect.
Ramakrishna, Ramnarain; Sarkar, Dipayan; Manduri, Avani; Iyer, Shreyas Ganesan; Shetty, Kalidas
2017-10-01
Sprouts of cereal grains, such as barley ( Hordeum vulgare L.), are a good source of beneficial phenolic bioactives. Such health relevant phenolic bioactives of cereal sprouts can be targeted to manage chronic hyperglycemia and oxidative stress commonly associated with type 2 diabetes (T2D). Therefore improving phenolic bioactives by stimulating plant endogenous defense responses such as protective pentose phosphate pathway (PPP) during sprouting has significant merit. Based on this metabolic rationale, this study aimed to enhance phenolic bioactives and associated antioxidant and anti-hyperglycemic functions in dark germinated barley sprouts using exogenous elicitor treatments. Dark-germinated sprouts of two malting barley cultivars (Pinnacle and Celebration), treated with chitosan oligosaccharide (COS) and marine protein hydrolysate (GP), were evaluated. Total soluble phenolic content (TSP), phenolic acid profiles, total antioxidant activity (TA) and in vitro inhibitory activities of hyperglycemia relevant α-amylase and α-glucosidase enzymes of the dark germinated barley sprouts were evaluated at day 2, 4, and 6 post elicitor treatments. Overall, TSP content, TA, and α-amylase inhibitory activity of dark germinated barley sprouts decreased, while α-glucosidase inhibitory activity and gallic acid content increased from day 2 to day 6. Among barley cultivars, high phenolic antioxidant-linked anti-hyperglycemic bioactives were observed in Celebration. Furthermore, GP and COS seed elicitor treatments in selective doses improved T2D relevant phenolic-linked anti-hyperglycemic bioactives of barley spouts at day 6. Therefore, such seed elicitation approach can be strategically used to develop bioactive enriched functional food ingredients from cereal sprouts targeting chronic hyperglycemia and oxidative stress linked to T2D.
Directory of Open Access Journals (Sweden)
Filip Pošćić
2016-06-01
Full Text Available The implications of metal nanoparticles (MeNPs are still unknown for many food crops. The purpose of this study was to evaluate the effects of cerium oxide (nCeO2 and titanium oxide (nTiO2 nanoparticles in soil at 0, 500 and 1000 mg·kg−1 on the nutritional parameters of barley (Hordeum vulgare L. kernels. Mineral nutrients, amylose, β-glucans, amino acid and crude protein (CP concentrations were measured in kernels. Whole flour samples were analyzed by ICP-AES/MS, HPLC and Elemental CHNS Analyzer. Results showed that Ce and Ti accumulation under MeNPs treatments did not differ from the control treatment. However, nCeO2 and nTiO2 had an impact on composition and nutritional quality of barley kernels in contrasting ways. Both MeNPs left β-glucans unaffected but reduced amylose content by approximately 21%. Most amino acids and CP increased. Among amino acids, lysine followed by proline saw the largest increase (51% and 37%, respectively. Potassium and S were both negatively impacted by MeNPs, while B was only affected by 500 mg nCeO2·kg−1. On the contrary Zn and Mn concentrations were improved by 500 mg nTiO2·kg−1, and Ca by both nTiO2 treatments. Generally, our findings demonstrated that kernels are negatively affected by nCeO2 while nTiO2 can potentially have beneficial effects. However, both MeNPs have the potential to negatively impact malt and feed production.
Directory of Open Access Journals (Sweden)
Petr Škarpa
2006-01-01
Full Text Available The effect of three different doses of basic fertilisers and a subsequent pre-sowing supplementary fertilisation on production parameters (yield of grain, number of spikes, and thousand grains weight was evaluated using experimental data obtained within the framework of a one-year pot experiment with spring barley (Hordeum vulgare L. established at the Department of Agrochemistry and Plant Nutrition, Faculty of Agronomy, Mendel University of Agriculture and Forestry Brno in 2003. Results of statistical analysis indicated that the yield of grain was significantly influenced by different doses of fertilisers especially on sandy soils. As compared with control, the second highest dose of fertilisers (i.e. 83 kg N, 31 kg P and 92 kg K.ha–1 increased the yield by 91.7 % and the third one (i.e. 113 kg N, 43 kg P and 125 kg K.ha–1 even by 124.8 %. This increase in the grain yield was positively affected above all by increasing doses of nitrogen fertilisers. A pre-sowing application of P, K and Mg showed also a positive effect on grain yield not only on sandy but above all on clay soils (as compared with non-fertilised control, this increase ranged from 40.6 to 50.2%. Fertilisation showed also a marked effect on the number of spikes. This factor showed a similar trend as the yield of grain. The thousand grains weight was not significantly influenced on both soil types. This value was increased (by 2.9% to 14.8% after the application of fertilisers prior to sowing but the difference was statistically non-significant.
DEFF Research Database (Denmark)
Vigeland, Magnus D; Spannagl, Manuel; Asp, Torben
2013-01-01
Adaptation to temperate environments is common in the grass subfamily Pooideae, suggesting an ancestral origin of cold climate adaptation. Here, we investigated substitution rates of genes involved in low-temperature-induced (LTI) stress responses to test the hypothesis that adaptive molecular...... evolution of LTI pathway genes was important for Pooideae evolution. Substitution rates and signatures of positive selection were analyzed using 4330 gene trees including three warm climate-adapted species (maize (Zea mays), sorghum (Sorghum bicolor), and rice (Oryza sativa)) and five temperate Pooideae...... species (Brachypodium distachyon, wheat (Triticum aestivum), barley (Hordeum vulgare), Lolium perenne and Festuca pratensis). Nonsynonymous substitution rate differences between Pooideae and warm habitat-adapted species were elevated in LTI trees compared with all trees. Furthermore, signatures...
Pandey, Bharati; Grover, Abhinav; Sharma, Pradeep
2018-02-12
The WRKY transcription factors are a class of DNA-binding proteins involved in diverse plant processes play critical roles in response to abiotic and biotic stresses. Genome-wide divergence analysis of WRKY gene family in Hordeum vulgare provided a framework for molecular evolution and functional roles. So far, the crystal structure of WRKY from barley has not been resolved; moreover, knowledge of the three-dimensional structure of WRKY domain is pre-requisites for exploring the protein-DNA recognition mechanisms. Homology modelling based approach was used to generate structures for WRKY DNA binding domain (DBD) and its variants using AtWRKY1 as a template. Finally, the stability and conformational changes of the generated model in unbound and bound form was examined through atomistic molecular dynamics (MD) simulations for 100 ns time period. In this study, we investigated the comparative binding pattern of WRKY domain and its variants with W-box cis-regulatory element using molecular docking and dynamics (MD) simulations assays. The atomic insight into WRKY domain exhibited significant variation in the intermolecular hydrogen bonding pattern, leading to the structural anomalies in the variant type and differences in the DNA-binding specificities. Based on the MD analysis, residual contribution and interaction contour, wild-type WRKY (HvWRKY46) were found to interact with DNA through highly conserved heptapeptide in the pre- and post-MD simulated complexes, whereas heptapeptide interaction with DNA was missing in variants (I and II) in post-MD complexes. Consequently, through principal component analysis, wild-type WRKY was also found to be more stable by obscuring a reduced conformational space than the variant I (HvWRKY34). Lastly, high binding free energy for wild-type and variant II allowed us to conclude that wild-type WRKY-DNA complex was more stable relative to variants I. The results of our study revealed complete dynamic and structural information
International Nuclear Information System (INIS)
Reuber, S.; Bornman, J.F.; Weissenböck, G.
1996-01-01
The aim of the present investigation was to define the role of soluble flavonoids as UV-B protectants in the primary leaf of barley (Hordeum vulgare L.). For this purpose we used a mutant line (Ant 287) from the Carlsberg collection of proanthocyanidin-free barley containing only 7% of total extractable flavonoids in the primary leaf as compared to the mother variety (Hiege 550/75). Seven-day-old leaves from plants grown under high visible light with or without supplementary UV-B radiation were used for the determination of UV-B sensitivity. UV-B-induced changes were assessed from parameters of chlorophyll fluorescence of photosystem II, including initial and maximum fluorescence, apparent quantum yield, and photochemical and non-photochemical quenching. A quartz fibre-optic microprobe was used to evaluate the amount of potentially harmful UV-B (310 nm radiation) penetrating into the leaf as a direct consequence of flavonoid deficiency. Our data indicate an essential role of flavonoids in UV-B protection of barley primary leaves. In leaves of the mutant line grown under supplementary UV-B, an increase in 310nm radiation in the mesophyll and a strong decrease in the quantum yield of photosynthesis were observed as compared to the corresponding mother variety. Primary leaves of liege responded to supplementary UV-B radiation with a 30% increase in the major flavonoid saponarin and a 500% increase in the minor compound lutonarin. This is assumed to be an efficient protective response since no changes in variable chlorophyll fluorescence were apparent. In addition, a further reduction in UV-B penetration into the mesophyll was recorded in these leaves
Taube, Michał; Pieńkowska, Joanna R.; Jarmołowski, Artur; Kozak, Maciej
2014-01-01
SGT1 is an evolutionarily conserved eukaryotic protein involved in many important cellular processes. In plants, SGT1 is involved in resistance to disease. In a low ionic strength environment, the SGT1 protein tends to form dimers. The protein consists of three structurally independent domains (the tetratricopeptide repeats domain (TPR), the CHORD- and SGT1-containing domain (CS), and the SGT1-specific domain (SGS)), and two less conserved variable regions (VR1 and VR2). In the present study, we provide the low-resolution structure of the barley (Hordeum vulgare) SGT1 protein in solution and its dimer/monomer equilibrium using small-angle scattering of synchrotron radiation, ab-initio modeling and circular dichroism spectroscopy. The multivariate curve resolution least-square method (MCR-ALS) was applied to separate the scattering data of the monomeric and dimeric species from a complex mixture. The models of the barley SGT1 dimer and monomer were formulated using rigid body modeling with ab-initio structure prediction. Both oligomeric forms of barley SGT1 have elongated shapes with unfolded inter-domain regions. Circular dichroism spectroscopy confirmed that the barley SGT1 protein had a modular architecture, with an α-helical TPR domain, a β-sheet sandwich CS domain, and a disordered SGS domain separated by VR1 and VR2 regions. Using molecular docking and ab-initio protein structure prediction, a model of dimerization of the TPR domains was proposed. PMID:24714665
DEFF Research Database (Denmark)
Pfeiffer, Matthias; Martis, Mihaela; Asp, Torben
2013-01-01
(Lolium perenne) genome on the basis of conserved synteny to barley (Hordeum vulgare) and the model grass genome Brachypodium (Brachypodium distachyon) as well as rice (Oryza sativa) and sorghum (Sorghum bicolor). A transcriptome-based genetic linkage map of perennial ryegrass served as a scaffold......Whole-genome sequences established for model and major crop species constitute a key resource for advanced genomic research. For outbreeding forage and turf grass species like ryegrasses (Lolium spp.), such resources have yet to be developed. Here, we present a model of the perennial ryegrass...... to establish the chromosomal arrangement of syntenic genes from model grass species. This scaffold revealed a high degree of synteny and macrocollinearity and was then utilized to anchor a collection of perennial ryegrass genes in silico to their predicted genome positions. This resulted in the unambiguous...
Nakurte, Ilva; Keisa, Anete; Rostoks, Nils
2012-01-01
A simple, sensitive, precise, and specific reverse HPLC method was developed and validated for the determination of plant hormones in barley (Hordeum vulgare L.). The method includes extraction in aqueous organic solvent followed by solid-phase extraction, sample evaporation, and reversed-phase HPLC analysis in a general purpose UV-visible (abscisic acid (ABA)) and fluorescence detection (indole-3-acetic acid (IAA) and indole-3-pyruvic acid (IPA)), high-performance liquid chromatography system. The separation was carried out on Zorbax Eclipse XDB C8 column (150 × 4.6 mm I.D) with a mobile phase composed of methanol and 1% acetic acid (60 : 40 v/v) in isocratic mode at a flow rate of 1 ml min(-1). The detection was monitored at 270 nm (ABA) and at 282 nm (Ex) and 360 nm (Em) (IAA, IPA). The developed method was validated in terms of accuracy, precision, linearity, limit of detection, limit of quantification, and robustness. The determined validation parameters are in the commonly acceptable ranges for that kind of analysis.
International Nuclear Information System (INIS)
Mahmood, K.
2011-01-01
Although barley (Hordeum vulgare L.) is regarded as salt tolerant among crop plants, its growth and plant development is severely affected by ionic and osmotic stresses in salt-affected soils. To elucidate the tolerance mechanism, growth and ion uptake of three barley cultivars, differing in salt tolerance, were examined under different levels of NaCl, K/sup +/ Na/sup +/ and NaHCO/sub 3/ in the root medium. The cultivars differed greatly in their responses to varying root medium conditions. Plant growth was more adversely affected by NaHCO/sub 3/ than NaCl. In general, biomass yields were comparable under control and 100 mM NaCl. However, growth of all three cultivars was significantly inhibited by NaHCO/sub 3/ even at low concentration (10 mM). Improved K/sup +/ supply in saline medium increased K/sup +/ uptake and growth of less tolerant cultivars. K/sup +/ uptake was more adversely affected by NaHCO/sub 3/ than NaCl salinity. Selective K/sup +/ uptake and lower Cl/sup -/ in shoots seemed to be associated with the growth responses. K application would help better growth of these cultivars on K-deficient saline-sodic soils and under irrigation with poor quality water having high Residual Sodium Carbonate (RSC) and/or Sodium Adsorption Ratio (SAR). (author)
DEFF Research Database (Denmark)
Linde-Laursen, Ib; Bothmer, R. von
1986-01-01
. The hybrids were stably aneuploid. Both had lost and acquired H. vulgare chromosomes. Thus, somatic elimination of chromosomes was combined with multiplication of chromosomes. The observations of stably aneuploid hybrids have implications for the exploitation of alien germplasm. The activity of non-H. vulgare...
Wang, Qifei; Sun, Genlou; Ren, Xifeng; Wang, Jibin; Du, Binbin; Li, Chengdao; Sun, Dongfa
2017-11-07
Seedling characteristics play significant roles in the growth and development of barley (Hordeum vulgare L.), including stable stand establishment, water and nutrients uptake, biotic resistance and abiotic stresses, and can influence yield and quality. However, the genetic mechanisms underlying seedling characteristics in barley are largely unknown and little research has been done. In the present work, 21 seedling-related characteristics are assessed in a barley double haploid (DH) population, grown under hydroponic conditions. Of them, leaf age (LAG), shoot height (SH), maximum root length (MRL), main root number (MRN) and seedling fresh weight (SFW) were investigated at the 13th, 20th, 27th, and 34th day after germination. The objectives were to identify quantitative trait loci (QTLs) underlying these seedling characteristics using a high-density linkage map and to reveal the QTL expression pattern by comparing the QTLs among four different seedling growth stages. A total of 70 QTLs were distributed over all chromosomes except 4H, and, individually, accounted for 5.01%-77.78% of phenotypic variation. Out of the 70 detected QTLs, 23 showed a major effect on 14 seedling-related characteristics. Ten co-localized chromosomal regions on 2H (five regions), 3H (two regions) and 7H (three regions) involved 39 QTLs (55.71%), each simultaneously influenced more than one trait. Meanwhile, 9 co-localized genomic regions involving 22 QTLs for five seedling characteristics (LAG, SH, MRL, MRN and SFW) at the 13th, 20th, 27th and 34th day-old seedling were common for two or more growth stages of seedling. QTL in the vicinity of Vrs1 locus on chromosome 2H with the favorable alleles from Huadamai 6 was found to have the largest main effects on multiple seedling-related traits. Six QTL cluster regions associated with 16 seedling-related characteristics were observed on chromosome 2H, 3H and 7H. The majority of the 29 regions identified for five seedling characteristics were
Li, Chao; Wang, Aidong; Ma, Xiaoying; Pourkheirandish, Mohammad; Sakuma, Shun; Wang, Ning; Ning, Shunzong; Nevo, Eviatar; Nawrath, Christiane; Komatsuda, Takao; Chen, Guoxiong
2013-03-01
Drought limits plant growth and threatens crop productivity. A barley (Hordeum vulgare) ethylene imine-induced monogenic recessive mutant cer-zv, which is sensitive to drought, was characterized and genetically mapped in the present study. Detached leaves of cer-zv lost 34.2 % of their initial weight after 1 h of dehydration. The transpiration was much higher in cer-zv leaves than in wild-type leaves under both light and dark conditions. The stomata of cer-zv leaves functioned normally, but the cuticle of cer-zv leaves showed increased permeability to ethanol and toluidine blue dye. There was a 50-90 % reduction in four major cutin monomers, but no reduction in wax loads was found in the cer-zv mutant as compared with the wild type. Two F(2) mapping populations were established by the crosses of 23-19 × cer-zv and cer-zv × OUH602. More polymorphisms were found in EST sequences between cer-zv and OUH602 than between cer-zv and 23-19. cer-zv was located in a pericentromeric region on chromosome 4H in a 10.8 cM interval in the 23-19 × cer-zv map based on 186 gametes tested and a 1.7 cM interval in the cer-zv × OUH602 map based on 176 gametes tested. It co-segregated with EST marker AK251484 in both maps. The results indicated that the cer-zv mutant is defective in cutin, which might be responsible for the increased transpiration rate and drought sensitivity, and that the F(2) of cer-zv × OUH602 might better facilitate high resolution mapping of cer-zv.
Energy Technology Data Exchange (ETDEWEB)
Mangelsen, Elke; Kilian, Joachim; Berendzen, Kenneth W.; Kolukisaoglu, Uner; Harter, Klaus; Jansson, Christer; Wanke, Dierk
2008-02-01
WRKY proteins belong to the WRKY-GCM1 superfamily of zinc finger transcription factors that have been subject to a large plant-specific diversification. For the cereal crop barley (Hordeum vulgare), three different WRKY proteins have been characterized so far, as regulators in sucrose signaling, in pathogen defense, and in response to cold and drought, respectively. However, their phylogenetic relationship remained unresolved. In this study, we used the available sequence information to identify a minimum number of 45 barley WRKY transcription factor (HvWRKY) genes. According to their structural features the HvWRKY factors were classified into the previously defined polyphyletic WRKY subgroups 1 to 3. Furthermore, we could assign putative orthologs of the HvWRKY proteins in Arabidopsis and rice. While in most cases clades of orthologous proteins were formed within each group or subgroup, other clades were composed of paralogous proteins for the grasses and Arabidopsis only, which is indicative of specific gene radiation events. To gain insight into their putative functions, we examined expression profiles of WRKY genes from publicly available microarray data resources and found group specific expression patterns. While putative orthologs of the HvWRKY transcription factors have been inferred from phylogenetic sequence analysis, we performed a comparative expression analysis of WRKY genes in Arabidopsis and barley. Indeed, highly correlative expression profiles were found between some of the putative orthologs. HvWRKY genes have not only undergone radiation in monocot or dicot species, but exhibit evolutionary traits specific to grasses. HvWRKY proteins exhibited not only sequence similarities between orthologs with Arabidopsis, but also relatedness in their expression patterns. This correlative expression is indicative for a putative conserved function of related WRKY proteins in mono- and dicot species.
Directory of Open Access Journals (Sweden)
Victor Raboy
2015-04-01
Full Text Available The potential benefits of the low phytic acid (lpa seed trait for human and animal nutrition, and for phosphorus management in non-ruminant animal production, are well documented. However, in many cases the lpa trait is associated with impaired seed or plant performance, resulting in reduced yield. This has given rise to the perception that the lpa trait is tightly correlated with reduced yield in diverse crop species. Here we report a powerful test of this correlation. We measured grain yield in lines homozygous for each of six barley (Hordeum vulgare L. lpa mutations that greatly differ in their seed phytic acid levels. Performance comparisons were between sibling wild-type and mutant lines obtained following backcrossing, and across two years in five Idaho (USA locations that greatly differ in crop yield potential. We found that one lpa mutation (Hvlpa1-1 had no detectable effect on yield and a second (Hvlpa4-1 resulted in yield losses of only 3.5%, across all locations. When comparing yields in three relatively non-stressful production environments, at least three lpa mutations (Hvlpa1-1, Hvlpa3-1, and Hvlpa4-1 typically had yields similar to or within 5% of the wild-type sibling isoline. Therefore in the case of barley, lpa mutations can be readily identified that when simply incorporated into a cultivar result in adequately performing lines, even with no additional breeding for performance within the lpa line. In conclusion, while some barley lpa mutations do impact field performance, a substantial fraction appears to have little or no effect on yield.
Directory of Open Access Journals (Sweden)
Žaltauskaitė J.
2013-04-01
Full Text Available The single and combined effects of copper (Cu and cadmium (Cd (0.1-10 mg L−1 in spring barley (Hordeum vulgare L. plants grown in hydroponics are investigated. The aim of the study was to investigate the interactive effect of the binary mixture of Cu and Cd to the growth of H. vulgare and accumulation of these metals by the plants. Single and combined metal treatment led to major effects in the growth of roots and shoots and dry weight of barley. Exposure to metals altered the content of photosynthetic pigments and caused lipid peroxidation. It was observed that combined effects of heavy metals to plants are endpoint and concentration depending. The binary mixture Cu+Cd exhibited additive or less than additive interaction for dry weight, root length and shoot height. Analysis of tissue metal concentrations showed that Cu and Cd were mainly accumulated in the roots and the combination of Cu+Cd had less than additive response of metal bioaccumulation in the leaves and roots.
Alikhani, Mehdi; Khatabi, Behnam; Sepehri, Mozhgan; Nekouei, Mojtaba Khayam; Mardi, Mohsen; Salekdeh, Ghasem Hosseini
2013-06-01
Piriformospora indica is a root-interacting mutualistic fungus capable of enhancing plant growth, increasing plant resistance to a wide variety of pathogens, and improving plant stress tolerance under extreme environmental conditions. Understanding the molecular mechanisms by which P. indica can improve plant tolerance to stresses will pave the way to identifying the major mechanisms underlying plant adaptability to environmental stresses. We conducted greenhouse experiments at three different salt levels (0, 100 and 300 mM NaCl) on barley (Hordeum vulgare L.) cultivar "Pallas" inoculated with P. indica. Based on the analysis of variance, P. indica had a significant impact on the barley growth and shoot biomass under normal and salt stress conditions. P. indica modulated ion accumulation in colonized plants by increasing the foliar potassium (K(+))/sodium (Na(+)) ratio, as it is considered a reliable indicator of salt stress tolerance. P. indica induced calcium (Ca(2+)) accumulation and likely influenced the stress signal transduction. Subsequently, proteomic analysis of the barley leaf sheath using two-dimensional electrophoresis resulted in detection of 968 protein spots. Of these detected spots, the abundance of 72 protein spots changed significantly in response to salt treatment and P. indica-root colonization. Mass spectrometry analysis of responsive proteins led to the identification of 51 proteins. These proteins belonged to different functional categories including photosynthesis, cell antioxidant defense, protein translation and degradation, energy production, signal transduction and cell wall arrangement. Our results showed that P. indica induced a systemic response to salt stress by altering the physiological and proteome responses of the plant host.
In silico characterization of boron transporter (BOR1 protein sequences in Poaceae species
Directory of Open Access Journals (Sweden)
Ertuğrul Filiz
2013-01-01
Full Text Available Boron (B is essential for the plant growth and development, and its primary function is connected with formation of the cell wall. Moreover, boron toxicity is a shared problem in semiarid and arid regions. In this study, boron transporter protein (BOR1 sequences from some Poaceae species (Hordeum vulgare subsp. vulgare, Zea mays, Brachypodium distachyon, Oryza sativa subsp. japonica, Oryza sativa subsp. indica, Sorghum bicolor, Triticum aestivum were evaluated by bioinformatics tools. Physicochemical analyses revealed that most of BOR1 proteins were basic character and had generally aliphatic amino acids. Analysis of the domains showed that transmembrane domains were identified constantly and three motifs were detected with 50 amino acids length. Also, the motif SPNPWEPGSYDHWTVAKDMFNVPPAYIFGAFIPATMVAGLYYFDHSVASQ was found most frequently with 25 repeats. The phylogenetic tree showed divergence into two main clusters. B. distachyon species were clustered separately. Finally, this study contributes to the new BOR1 protein characterization in grasses and create scientific base for in silico analysis in future.
Directory of Open Access Journals (Sweden)
A. Derakhshan
2017-01-01
Full Text Available Introduction: Seed germination is one of the key stages in the life cycle of plants that can ultimately affect their fitness in the environment. The temporal pattern of seed germination is extremely depended on the soil water potential (Ψ of the germination medium, as this determines the equilibrium water content of the seed. As for temperature, there is a minimum Ψ that must be exceeded in order for seeds complete germination, and seeds in a population vary in the value of this minimum or base Ψ. The germination of a seed population in response to the reduced water potential is modeled using the hydrotime model. According to this model, the time to germination for a given seed fraction (g is inversely related to the difference between the current seed Ψ and the base water potential (Ψb for that fraction (Ψb(g. The hydrotime model functions are well in matching both the timing and the percentage of germination of seed populations in relation to their Ψ environment. In addition, the model outputs which are significant physiologically and ecologically and the parameters of the model can be used to characterize the properties of seed populations. Normal distribution of Ψb among seeds within a population is one of the assumptions of the hydrotime model. However, this assumption may not be met in many species and thus can result in poor predictions. We tried to investigate empirically the validity of this assumption, to compare the fit of alternative distributions and make recommendations to improve germination modeling procedures. Materials and Methods: Seed germination of Melilotus officinalis, Sinapis arvensis and Hordeum vulgare were tested across a range of water potentials (0, -0.2, -0.4, -0.6 and -0.8 MPa for M. officinalis and S. arvensis and 0, -0.3, -0.6, -0.9, -1.2 and -1.5 MPa for H. vulgare and germination responses were described by the hydrotime models based on twelve statistical functions including Normal, Beta, Gamma
Fina, Brenda L; Lupo, Maela; Dri, Nicolas; Lombarte, Mercedes; Rigalli, Alfredo
2016-08-01
Fluorosis is a disease caused by over-exposure to fluoride (F). Argentina's rural lands have higher fluorine content than urban lands. Evidence confirms that plants grown in fluoridated areas could have higher F content. We compared F uptake and growth of crops grown in different F concentrations. The effect of 0-8 ppm F concentrations on maize, soybeans and sorghum germination and growth was compared. After 6 days seeding, the germination was determined, the roots and aerial parts lengths were measured, and vigor index was calculated. F content was measured in each part of the plants. Controls with equal concentrations of NaCl were carried out. Significant decrease in roots and aerial parts lengths, and in vigor index of maize and soybeans plants was observed with F concentrations greater than 2 ppm. This was not observed in sorghum seedlings. Also, the amount of F in all crops augmented as F increases, being higher in roots and ungerminated seeds. Sorghum was the crop with the highest F content. Fluoride decreased the germination and growth of maize and soybeans and therefore could influence on their production. Conversely, sorghum seems to be resistant to the action of F. © 2015 Society of Chemical Industry. © 2015 Society of Chemical Industry.
Rusan, Munir J M; Albalasmeh, Ammar A; Zuraiqi, Said; Bashabsheh, Mohammad
2015-06-01
Olive-mill wastewater (OMW) is a by-product effluent of olive oil extraction process that is produced in large amount in the Mediterranean region. OMW is believed to induce phytotoxic effect on organisms including seed germination and plant growth. The objective of this study was to evaluate the impact of untreated and treated OMW with different techniques on seed germination of barley (Hordeum vulgare L.). The following treatments were investigated: (1) tap water (control); (2) OMW treated by aerobic biological technology in a Jacto Reactor (JR); (3) OMW treated by solar fenton oxidation (SFO); (4) OMW treated by microfiltration followed by nanofiltration (MF+NF); (5) OMW treated by microfiltration followed by reverse osmosis (MF+RO) process; (6) diluted OMW with tap water (25 % OMW); (7) diluted OMW with tap water (50 % OMW); (8) diluted OMW with tap water (75 % OMW); and (9) untreated OMW (100 % OMW). A germination test was conducted in an incubator at temperature of 23 (∘)C. In each petri dish, a filter paper was mounted and ten seeds of barley were placed on the filter paper. Five milliliter of water were added to each petri dish. The seed germination was determined by counting the number of germinated seeds to calculate the percentage of germination (G %). Germination rate index (GRI), seed vigor index (SVI), and phytotoxicity index (PI) were also calculated. Then, the dry weights and lengths of the shoots and the roots of the germinated seeds were measured. The results show that 100, 75, and 50 %OMW were very phytotoxic and completely prohibited seed germination. However, phytotoxicity decreased significantly following treatments of OMW with all techniques investigated and by the 25 % OMW dilution, as results of removing the phenols and other phytotoxic organic compounds from the OMW or by diluting it. This was evidenced by relative enhancement of the dry weights and lengths of shoot and root as well as the G %, GRI, SVG, and PI. It was concluded that if
International Nuclear Information System (INIS)
Ardic, M.; Sezer, O.; Ozgdsd, K.; Yaylaci, O. K.; Koyuncu, O.; Olgun, M.; Bascdftcd, Z. B.; Ayter, N. G.
2015-01-01
The aim of this study is to determine anatomical differences and classification of leaf and leaf cell characteristics (cuticle thickness, upper epidermis thickness, lower epidermis thickness, mesophyll thickness, parenchyma thickness and leaf thickness) between 10 bread wheat cultivars (Triticum aestivum L.) and 10 barley cultivars (Hordeum vulgare L.). Classification of leaf characteristics in bread wheat and barley cultivars and relationship between leaf characteristics are made by principal component and correlation analyses. Highest thickness belongs to W8 Mufitbey cultivar in mesophyll and lower epidermis and W1 Sonmez 01 cultivar have the lowest thickness of upper epidermis in bread wheat. In Barley, B1 Ince cultivar has highest leaf thickness mesophyll and parenchyma; lowest thickness of cuticle is included B7 Cumhuriyet 50 cultivar. All other cultivars have homogenous contents of leaf characteristics. (author)
Delhaize, Emmanuel; Taylor, Phillip; Hocking, Peter J; Simpson, Richard J; Ryan, Peter R; Richardson, Alan E
2009-06-01
Barley (Hordeum vulgare L.), genetically modified with the Al(3+) resistance gene of wheat (TaALMT1), was compared with a non-transformed sibling line when grown on an acidic and highly phosphate-fixing ferrosol supplied with a range of phosphorus concentrations. In short-term pot trials (26 days), transgenic barley expressing TaALMT1 (GP-ALMT1) was more efficient than a non-transformed sibling line (GP) at taking up phosphorus on acid soil, but the genotypes did not differ when the soil was limed. Differences in phosphorus uptake efficiency on acid soil could be attributed not only to the differential effects of aluminium toxicity on root growth between the genotypes, but also to differences in phosphorus uptake per unit root length. Although GP-ALMT1 out-performed GP on acid soil, it was still not as efficient at taking up phosphorus as plants grown on limed soil. GP-ALMT1 plants grown in acid soil possessed substantially smaller rhizosheaths than those grown in limed soil, suggesting that root hairs were shorter. This is a probable reason for the lower phosphorus uptake efficiency. When grown to maturity in large pots, GP-ALMT1 plants produced more than twice the grain as GP plants grown on acid soil and 80% of the grain produced by limed controls. Expression of TaALMT1 in barley was not associated with a penalty in either total shoot or grain production in the absence of Al(3+), with both genotypes showing equivalent yields in limed soil. These findings demonstrate that an important crop species can be genetically engineered to successfully increase grain production on an acid soil.
Exploitation of allelopathy for weed control in annual and perennial cropping systems.
Putnam, A R; Defrank, J; Barnes, J P
1983-08-01
A variety of crops, cultivars, and accessions have been evaluated over the past six years for superior capability to suppress weed growth. The most successful of these approaches has been to grow cover crops of rye (Secale cereale), wheat (Triticum aestivum), sorghum (Sorghum bicolor), or barley (Hordeum vulgare) to a height of 40-50 cm, desiccate the crops by contact herbicides or freezing, and allow their residues to remain on the soil surface. Often, up to 95% control of important agroecosystem weed species was obtained for a 30- to 60-day period following desiccation of the cover crop. The plant residues on the soil surface exhibit numerous physical and chemical attributes that contribute to weed suppression. Physical aspects include shading and reduced soil temperatures which were similarly achieved using poplar (Populus) excelsior as a control mulch. Chemical aspects apparently include direct release of toxins, as well as production of phytotoxic microbial products. Numerous chemicals appear to work in concert or in an additive or synergistic manner to reduce weed germination and growth.
Kegge, Wouter; Ninkovic, Velemir; Glinwood, Robert; Welschen, Rob A. M.; Voesenek, Laurentius A. C. J.; Pierik, Ronald
2015-01-01
Background and Aims Volatile organic compounds (VOCs) play various roles in plant–plant interactions, and constitutively produced VOCs might act as a cue to sense neighbouring plants. Previous studies have shown that VOCs emitted from the barley (Hordeum vulgare) cultivar ‘Alva’ cause changes in biomass allocation in plants of the cultivar ‘Kara’. Other studies have shown that shading and the low red:far-red (R:FR) conditions that prevail at high plant densities can reduce the quantity and alter the composition of the VOCs emitted by Arabidopsis thaliana, but whether this affects plant–plant signalling remains unknown. This study therefore examines the effects of far-red light enrichment on VOC emissions and plant–plant signalling between ‘Alva’ and ‘Kara’. Methods The proximity of neighbouring plants was mimicked by supplemental far-red light treatment of VOC emitter plants of barley grown in growth chambers. Volatiles emitted by ‘Alva’ under control and far-red light-enriched conditions were analysed using gas chromatography–mass spectrometry (GC-MS). ‘Kara’ plants were exposed to the VOC blend emitted by the ‘Alva’ plants that were subjected to either of the light treatments. Dry matter partitioning, leaf area, stem and total root length were determined for ‘Kara’ plants exposed to ‘Alva’ VOCs, and also for ‘Alva’ plants exposed to either control or far-red-enriched light treatments. Key Results Total VOC emissions by ‘Alva’ were reduced under low R:FR conditions compared with control light conditions, although individual volatile compounds were found to be either suppressed, induced or not affected by R:FR. The altered composition of the VOC blend emitted by ‘Alva’ plants exposed to low R:FR was found to affect carbon allocation in receiver plants of ‘Kara’. Conclusions The results indicate that changes in R:FR light conditions influence the emissions of VOCs in barley, and that these altered emissions
Kegge, Wouter; Ninkovic, Velemir; Glinwood, Robert; Welschen, Rob A M; Voesenek, Laurentius A C J; Pierik, Ronald
2015-05-01
Volatile organic compounds (VOCs) play various roles in plant-plant interactions, and constitutively produced VOCs might act as a cue to sense neighbouring plants. Previous studies have shown that VOCs emitted from the barley (Hordeum vulgare) cultivar 'Alva' cause changes in biomass allocation in plants of the cultivar 'Kara'. Other studies have shown that shading and the low red:far-red (R:FR) conditions that prevail at high plant densities can reduce the quantity and alter the composition of the VOCs emitted by Arabidopsis thaliana, but whether this affects plant-plant signalling remains unknown. This study therefore examines the effects of far-red light enrichment on VOC emissions and plant-plant signalling between 'Alva' and 'Kara'. The proximity of neighbouring plants was mimicked by supplemental far-red light treatment of VOC emitter plants of barley grown in growth chambers. Volatiles emitted by 'Alva' under control and far-red light-enriched conditions were analysed using gas chromatography-mass spectrometry (GC-MS). 'Kara' plants were exposed to the VOC blend emitted by the 'Alva' plants that were subjected to either of the light treatments. Dry matter partitioning, leaf area, stem and total root length were determined for 'Kara' plants exposed to 'Alva' VOCs, and also for 'Alva' plants exposed to either control or far-red-enriched light treatments. Total VOC emissions by 'Alva' were reduced under low R:FR conditions compared with control light conditions, although individual volatile compounds were found to be either suppressed, induced or not affected by R:FR. The altered composition of the VOC blend emitted by 'Alva' plants exposed to low R:FR was found to affect carbon allocation in receiver plants of 'Kara'. The results indicate that changes in R:FR light conditions influence the emissions of VOCs in barley, and that these altered emissions affect VOC-mediated plant-plant interactions. © The Author 2015. Published by Oxford University Press on
Two New American Species of Hordeum (Poaceae)
DEFF Research Database (Denmark)
Bothmer, Roland Von; Jacobsen, Niels; Bagger Jørgensen, Rikke
1985-01-01
Two new species of Hordeum are described, viz. the diploid H. erectifolium, native to Argentina, and H. guatemalense, native to Guatemala.......Two new species of Hordeum are described, viz. the diploid H. erectifolium, native to Argentina, and H. guatemalense, native to Guatemala....
Dicty_cDB: Contig-U03338-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available ) 486099E06.x1 486 - leaf primordia cDNA library fr... 155 1e-33 1 ( FL885969 ) CCGN6504.b1 CCGN Panicum virgatum eti...( CF272843 ) EST3049 Zea mays sperm cell cDNA library Zea mays... 105 1e-18 1 ( FE623651 ) CBYY4925.g1 CBYY Panicum virgatu...22B2F04.f1 BG01 - normalized library Leymus ... 266 1e-90 2 ( EX580446 ) HDP26H23w HDP Hordeum vulgare subsp. vulgare... 2 ( EX571824 ) HDP35N10T HDP Hordeum vulgare subsp. vulgare cDNA... 287 5e-90 2 ( CV056143 ) BNEL14D8 Barley EST endosperm library... rachis EST library... 161 2e-35 1 ( AU173547 ) Oryza sativa Japonica Group cDNA, parti
African Journals Online (AJOL)
A. Thameur
2012-05-17
adjustment trait variation in barley (Hordeum vulgare L.). Theor. Appl. Genet., 96: 688-698. Thameur A, Ferchichi A, López-Carbonell M (2011). Quantification of free and conjugated abscisic acid in five genotypes of barley. (Hordeum ...
Cultivate In Vitro Of Anthers Of Barley (Hordeum Vulgare L.) Vars. UNAGRO V-PM6 And DISSA
International Nuclear Information System (INIS)
Marquinez Casas, Xavier
1994-01-01
The barley is a autonomous cereal originated of the wild subspecies H. vulgare L. Only at the end of last century it acquired commercial importance with the establishment of the industry brewer (Chaparro and Moreno 1894); at the moment its national production is far from supplying the demand of the market. The Andean area is the most appropriate region for its cultivation in Colombia, mainly between 1800 and 3200 meters on the level of the sea, in the Boyaca, Cundinamarca and Narino departments. Their production is dedicated in a 80 at 85 for the industry brewer and malt industry and of the 15 at 20 for seeds, human food and animal
Variation of Qingke (Hordeum vulgare linn.var.nudum Hook.f) induced by space flight treatment
International Nuclear Information System (INIS)
Li Xin; Peng Zhengsong; Yang Jun
2007-01-01
108 Dry seeds of Qingke (Hordeum vulgate linn. var. nudum Hook. f) were carried into space by recoverable satellite. after wards, the seeds were germinated into 108 seedlings at room temperature, and root tips were observed with Night microscope, and results and normal mitotic division was found without microkemel at interphase or chromosome bridges at anaphase, which means that chromosomal structure change didn't occur in Qingke seeds during space flight. To investigate whether there were morphology variations taken place, the seedlings were transplanted into field and managed normal. All of plants grew as strong as normal Qingke plants (CK) by eye abservation, except two plants showed abnormal inflorescence morphology, which had two spikes on one tiller. 21 SSR markers on 7 linkage groups were used to analysis the polymorphism of genomic DNA for these Qingke plants. No polymorphism was detected with 20 SSR markers among 63 plants investigated. But varied electrophoretic bands were tested in 10 plants using the marker HVM54 on chromosome 2H, and all the 10 plants showed uniform electrophoretypes. It was concluded that the DNA of the Qingke could be changed during space flight. (authors)
Transgenic sorghum ( Sorghum bicolor L. Moench) developed by ...
African Journals Online (AJOL)
Sorghum (Sorghum bicolor (L.) Moench) is an important food and fodder crop. Fungal diseases such as anthracnose caused by Colletotrichum sublineolum reduce sorghum yields. Genetic transformation can be used to confer tolerance to plant diseases such as anthracnose. The tolerance can be developed by introducing ...
DEFF Research Database (Denmark)
Navrot, Nicolas; Skjoldager, Nicklas; Bunkenborg, Jakob
2015-01-01
Monomeric and dimeric forms of recombinant barley (Hordeum vulgare subsp. vulgare) glutathione peroxidase 2 (HvGpx2) are demonstrated to display distinctly different functional properties in vitro. Monomeric HvGpx2 thus has five fold higher catalytic efficiency than the dimer towards tert-butyl h...
Introduction of sorghum (Sorghum bicolor (L.) Moench) into China ...
African Journals Online (AJOL)
The sorghum is a plant, which has been intentionally introduced in China for foods needs. It is a plant of African origin, which is much cultivated in the northern hemisphere. For millions of people in the semiarid tropic temperature of Asia and Africa, sorghum is the most important staple food. Sorghum is becoming one of the ...
Taxonomy Icon Data: sorghum [Taxonomy Icon
Lifescience Database Archive (English)
Full Text Available sorghum Sorghum bicolor Sorghum_bicolor_L.png Sorghum_bicolor_NL.png Sorghum_bicolor_S.png Sorg...hum_bicolor_NS.png http://biosciencedbc.jp/taxonomy_icon/icon.cgi?i=Sorghum+bicolor&t=L http://b...iosciencedbc.jp/taxonomy_icon/icon.cgi?i=Sorghum+bicolor&t=NL http://biosciencedbc.jp/taxonomy_icon/icon.cgi?i=Sorg...hum+bicolor&t=S http://biosciencedbc.jp/taxonomy_icon/icon.cgi?i=Sorghum+bicolor&t=NS ...
Advances in sorghum genetic mapping with implications for sorghum improvement
International Nuclear Information System (INIS)
Lee, M.
1998-01-01
Despite the importance of the sorghum crop, comprehensive genetic characterization has been limited. Therefore, the primary goal of this research program was to develop basic genetic tools to facilitate research in the genetics and breeding of sorghum. The first phase of this project consisted of constructing a genetic map based on restriction fragment length polymorphisms (RFLPs). The ISU sorghum map was created through linkage analysis of 78 F2 plants of an intraspecific cross between inbred CK60 and accession PI229828. Subsequent mapping, efforts in several labs have enriched the sorghum map to the point where it now contains over 1,500 loci defined by RFLPs and many others defined by mutant phenotypes and QTLs. The ISU map consists of 201 loci distributed among 10 linkage groups covering 1299 cM. Comparison of sorghum and maize RFLP maps on the basis of common sets of DNA probes revealed a high degree of conservation as reflected by homology, copy number, and colinearity. Examples of conserved and rearranged locus orders were observed. The same sorghum population was used to map genetic factors (mutants and QTLS) for several traits including vegetative and reproductive morphology, maturity, insect, and disease resistance. Four QTLs for plant height, an important character for sorghum adaptation in temperate latitudes for grain production, were identified in a sample of 152 F2 plants whereas 6 QTLs were detected among their F3 progeny. These observations and assessments of other traits at 4 QTLs common to F2 plants and their F3 progeny indicate some of these regions correspond to loci (dw) previously identified on the basis of alleles with highly qualitative effects. Four of the six sorghum plant height QTLs seem to be orthologous to plant height QTLs in maize. Other possible instances of orthologous QTLs included regions for maturity and tillering. These observations suggest that the conservation of the maize and sorghum genomes encompasses sequence homology
Pfeifer, Matthias; Martis, Mihaela; Asp, Torben; Mayer, Klaus F.X.; Lübberstedt, Thomas; Byrne, Stephen; Frei, Ursula; Studer, Bruno
2013-01-01
Whole-genome sequences established for model and major crop species constitute a key resource for advanced genomic research. For outbreeding forage and turf grass species like ryegrasses (Lolium spp.), such resources have yet to be developed. Here, we present a model of the perennial ryegrass (Lolium perenne) genome on the basis of conserved synteny to barley (Hordeum vulgare) and the model grass genome Brachypodium (Brachypodium distachyon) as well as rice (Oryza sativa) and sorghum (Sorghum bicolor). A transcriptome-based genetic linkage map of perennial ryegrass served as a scaffold to establish the chromosomal arrangement of syntenic genes from model grass species. This scaffold revealed a high degree of synteny and macrocollinearity and was then utilized to anchor a collection of perennial ryegrass genes in silico to their predicted genome positions. This resulted in the unambiguous assignment of 3,315 out of 8,876 previously unmapped genes to the respective chromosomes. In total, the GenomeZipper incorporates 4,035 conserved grass gene loci, which were used for the first genome-wide sequence divergence analysis between perennial ryegrass, barley, Brachypodium, rice, and sorghum. The perennial ryegrass GenomeZipper is an ordered, information-rich genome scaffold, facilitating map-based cloning and genome assembly in perennial ryegrass and closely related Poaceae species. It also represents a milestone in describing synteny between perennial ryegrass and fully sequenced model grass genomes, thereby increasing our understanding of genome organization and evolution in the most important temperate forage and turf grass species. PMID:23184232
Pfeifer, Matthias; Martis, Mihaela; Asp, Torben; Mayer, Klaus F X; Lübberstedt, Thomas; Byrne, Stephen; Frei, Ursula; Studer, Bruno
2013-02-01
Whole-genome sequences established for model and major crop species constitute a key resource for advanced genomic research. For outbreeding forage and turf grass species like ryegrasses (Lolium spp.), such resources have yet to be developed. Here, we present a model of the perennial ryegrass (Lolium perenne) genome on the basis of conserved synteny to barley (Hordeum vulgare) and the model grass genome Brachypodium (Brachypodium distachyon) as well as rice (Oryza sativa) and sorghum (Sorghum bicolor). A transcriptome-based genetic linkage map of perennial ryegrass served as a scaffold to establish the chromosomal arrangement of syntenic genes from model grass species. This scaffold revealed a high degree of synteny and macrocollinearity and was then utilized to anchor a collection of perennial ryegrass genes in silico to their predicted genome positions. This resulted in the unambiguous assignment of 3,315 out of 8,876 previously unmapped genes to the respective chromosomes. In total, the GenomeZipper incorporates 4,035 conserved grass gene loci, which were used for the first genome-wide sequence divergence analysis between perennial ryegrass, barley, Brachypodium, rice, and sorghum. The perennial ryegrass GenomeZipper is an ordered, information-rich genome scaffold, facilitating map-based cloning and genome assembly in perennial ryegrass and closely related Poaceae species. It also represents a milestone in describing synteny between perennial ryegrass and fully sequenced model grass genomes, thereby increasing our understanding of genome organization and evolution in the most important temperate forage and turf grass species.
Energy Technology Data Exchange (ETDEWEB)
Dahlberg, Jeffrey A. [Univ. of California, Parlier, CA (United States). Kearney Research and Extension Center; Wolfrum, Edward J. [National Renewable Energy Lab. (NREL), Golden, CO (United States). Process and Analytical Engineering Group
2010-09-28
The development of a robust source of renewable transportation fuel will require a large amount of biomass feedstocks. It is generally accepted that in addition to agricultural and forestry residues, we will need crops grown specifically for subsequent conversion into fuels. There has been a lot of research on several of these so-called "dedicated bioenergy crops" including switchgrass, miscanthus, sugarcane, and poplar. It is likely that all of these crops will end up playing a role as feedstocks, depending on local environmental and market conditions. Many different types of sorghum have been grown to produce syrup, grain, and animal feed for many years. It has several features that may make it as compelling as other crops mentioned above as a renewable, sustainable biomass feedstock; however, very little work has been done to investigate sorghum as a dedicated bioenergy crop. The goal of this project was to investigate the feasibility of using sorghum biomass to produce ethanol. The work performed included a detailed examination of the agronomics and composition of a large number of sorghum varieties, laboratory experiments to convert sorghum to ethanol, and economic and life-cycle analyses of the sorghum-to-ethanol process. This work showed that sorghum has a very wide range of composition, which depended on the specific sorghum cultivar as well as the growing conditions. The results of laboratory- and pilot-scale experiments indicated that a typical high-biomass sorghum variety performed very similarly to corn stover during the multi-step process required to convert biomass feedstocks to ethanol; yields of ethanol for sorghum were very similar to the corn stover used as a control in these experiments. Based on multi-year agronomic data and theoretical ethanol production, sorghum can achieve more than 1,300 gallons of ethanol per acre given the correct genetics and environment. In summary, sorghum may be a compelling dedicated bioenergy crop that could help
Identification of differentially expressed genes in sorghum (Sorghum bicolor) brown midrib mutants
Sorghum (Sorghum bicolor L.), with a high biomass yield and excellent tolerance to drought and low nutrition, has been recommended as one of the most competitive bioenergy crops. Brown midrib (bmr) mutant sorghum with reduced lignin content showed a high potential for the improvement of bioethanol ...
Possible evidence for transport of an iron cyanide complex by plants
International Nuclear Information System (INIS)
Samiotakis, M.; Ebbs, S.D.
2004-01-01
Barley (Hordeum vulgare L.), oat (Avena sativa L.), and wild cane (Sorghum bicolor L.), were exposed to 15 N-labeled ferrocyanide to determine whether these plant species can transport this iron cyanide complex. Plants were treated with ferrocyanide in a nutrient solution that simulated iron cyanide contaminated groundwater and soil solutions. This nutrient solution has been shown to maintain ferrocyanide speciation with minimal dissociation to free cyanide. Following treatment, all three plants showed dramatic enrichments in roots (δ 15 N%o=1000-1500) and shoots (δ 15 N%o=500). Barley and oat showed enrichment primarily in roots while wild cane showed a near equal enrichment in root and shoot tissues. Nitrogen-deficient barley plants treated with ferrocyanide showed a significantly greater 15 N enrichment as compared to nitrogen-sufficient plants. While the results are suggestive of ferrocyanide transport by these plant species, additional study will be required to verify these results. - Results suggest ferrocyanide transport by barley, oat and wild cane
Possible evidence for transport of an iron cyanide complex by plants
Energy Technology Data Exchange (ETDEWEB)
Samiotakis, M.; Ebbs, S.D
2004-01-01
Barley (Hordeum vulgare L.), oat (Avena sativa L.), and wild cane (Sorghum bicolor L.), were exposed to {sup 15}N-labeled ferrocyanide to determine whether these plant species can transport this iron cyanide complex. Plants were treated with ferrocyanide in a nutrient solution that simulated iron cyanide contaminated groundwater and soil solutions. This nutrient solution has been shown to maintain ferrocyanide speciation with minimal dissociation to free cyanide. Following treatment, all three plants showed dramatic enrichments in roots ({delta} {sup 15}N%o=1000-1500) and shoots ({delta} {sup 15}N%o=500). Barley and oat showed enrichment primarily in roots while wild cane showed a near equal enrichment in root and shoot tissues. Nitrogen-deficient barley plants treated with ferrocyanide showed a significantly greater {sup 15}N enrichment as compared to nitrogen-sufficient plants. While the results are suggestive of ferrocyanide transport by these plant species, additional study will be required to verify these results. - Results suggest ferrocyanide transport by barley, oat and wild cane.
The diversity of local sorghum (Sorghum bicolor L. Moench) in Nusa Tenggara Timur province
Mukkun, L.; Lalel, H. J. D.; Richana, N.; Pabendon, M. B.; Kleden, S. R.
2018-04-01
Sorghum (Sorghum bicolor L. Moench) is an important food crop in the dry land including Nusa Tenggara Timur (NTT) Province. This plant has a high adaptability to drought, can produce on marginal land, and is relatively resistant to pests and diseases. The study aims to collect and identify the species of local sorghum being cultivated by farmers, and the purposes of cultivation. In addition, this study will preserve germ plasm of local sorghum by providing bank seeds for the next growing season. A collection of local sorghum samples was conducted in 7 districts using survey and observation method. A total of 53 species of sorghum were collected, with various characteristics and different local names. Based on the skin color of the seeds, the accessions were grouped into white groups (26.42%), light yellow (15.09%), black (20.75%), brown (24.52%), and red (13.20 %). Sorghum is used for complementary food for rice, consumption in times of food insecurity, fodder, and as a fence for corn and rice. It is necessary to characterize the type of local sorghum that has the potential to be developed for food, industrial raw materials, and for functional food.
In planta transformation of sorghum (Sorghum bicolor (L.) Moench)
Indian Academy of Sciences (India)
An in planta transformation protocol for sorghum (Sorghum bicolor (L.) Moench) using shoot apical meristem of germinating seedlings is reported in this study. Agrobacterium tumefaciens strain, LBA4404 with pCAMBIA1303 vector and construct pCAMBIA1303TPS1 were individually used for transformation. Since, the ...
Genetic Analysis of Recombinant Inbred Lines for Sorghum bicolor ? Sorghum propinquum
Kong, Wenqian; Jin, Huizhe; Franks, Cleve D.; Kim, Changsoo; Bandopadhyay, Rajib; Rana, Mukesh K.; Auckland, Susan A.; Goff, Valorie H.; Rainville, Lisa K.; Burow, Gloria B.; Woodfin, Charles; Burke, John J.; Paterson, Andrew H.
2013-01-01
We describe a recombinant inbred line (RIL) population of 161 F5 genotypes for the widest euploid cross that can be made to cultivated sorghum (Sorghum bicolor) using conventional techniques, S. bicolor ? Sorghum propinquum, that segregates for many traits related to plant architecture, growth and development, reproduction, and life history. The genetic map of the S. bicolor ? S. propinquum RILs contains 141 loci on 10 linkage groups collectively spanning 773.1 cM. Although the genetic map ha...
Foliar flavonoids from Tanacetum vulgare var. boreale and their geographical variation.
Uehara, Ayumi; Akiyama, Shinobu; Iwashina, Tsukasa
2015-03-01
Foliar flavonoids of Tanacetum vulgare var. boreale were isolated. Eight flavonoid glycosides, 7-O-glucosides of apigenin, luteolin, scutellarein and 6- hydroxyluteolin, and 7-O-glucuronides of apigenin, luteolin, chrysoeriol and eriodictyol were identified. Moreover, eight flavonoid aglycones, apigenin, luteolin, hispidulin, nepetin, eupatilin, jaceosidin, pectolinarigenin and axillarin were also isolated and identified. The flavonoid composition of two varieties of T. vulgare, i.e. var. boreale and var. vulgare, were compared. All samples of var. boreale and one sample of var. vulgare had the same flavonoid pattern, and could be distinguished from almost all the samples of var. vulgare. Thus, the occurrence of chemotypes, which are characterized by either the presence or absence of scutellarein 7-O-glucoside, eriodictyol 7-O-glucuronide and pectolinarigenin was shown in T. vulgare sensu lato.
Foeniculum vulgare Mill (Umbelliferae) Attenuates Stress and ...
African Journals Online (AJOL)
Purpose: To evaluate the anti-stress and memory-enhancing properties of F. vulgare extract in experimental rats. Methods: F. vulgare plant extract was obtained using Soxhlet extraction technique. The extract, at doses of 50, 100 and 200 mg/kg body weight, was administered orally with an orogastric tube. Urinary levels of ...
a survey of sorghum downy mildew in sorghum in the sudano
African Journals Online (AJOL)
DR. AMINU
Sahel savanna AEZs respectively) indicated that the disease was present only at the seedling stage ... In the southern guinea ... northern Nigeria, sorghum downy mildew in sorghum .... There was a significant (P>0.05) difference in SDM.
Marrubium vulgare L.: A review on phytochemical and pharmacological aspects
Directory of Open Access Journals (Sweden)
Santram Lodhi
2017-12-01
Full Text Available Marrubium vulgare L. (family: Lamiaceae, also known as white horehound, is widely used as herbal remedy for chronic coughs and colds. It is used in various disorders related to skin, liver, gastric, heart and immune system. This review abridges phytochemical, pharmacological studies and medicinal uses of M. vulgare and provides scientific proof for various ethnobotanical claims in order to identify gaps, which will give impulsion for novel research on M. vulgare based herbal medicines. This review summarizes selected scientific evidence on phytochemistry and pharmacological properties of M. vulgare over the past 48 years (1968 to 2016. The work reported on M. vulgare was reviewed from various sources like books, internet source i.e. google search engine, pubmed, sciencedirect and chemical abstract. The exhaustive literature was studied and critical analysis was done according to their phytochemical and pharmacological properties. Phytochemical investigations on different parts of M. vulgare have been reported the presence of flavonoids, steroids, terpenoids, tannins, saponins and volatile oils (0.05%. The aerial parts contain marrubiin, together with ursolic acid and choline. Pharmacological activities like, anti-nociceptive, anti-spasmodic, anti-hypertensive, anti-diabetic, gastroprotective, anti-inflammatory, anti-microbial, anti-cancer, antioxidant, and anti-hepatotoxic activity have been reported. M. vulgare has therapeutic potential in the treatment of inflammatory conditions, liver disorders, pain, cardiovascular, gastric and diabetic conditions. Aerial parts of M. vulgare is a good source of labdane type diterpene especially marrubiin which is present in high concentrations. However, further scientific studies are needed to explore clinical efficacy, toxicity and to explore the therapeutic effect of major secondary metabolites like diterpenes, phenylpropanoid and phenylethanoid glycosides of M. vulgare. [J Complement Med Res 2017; 6
TECHNOLOGICAL ADVANCES IN THE OBTAINING OF ETHANOL FROM Sweet sorghum (Sorghum bicolor (L. Moench
Directory of Open Access Journals (Sweden)
Sandro Pedroso Cunha
2010-11-01
Full Text Available ABSTRACT: Replacing the use of gasoline with ethanol in vehicles reduces by 90% CO2 emissions, this justifies the interest in the use of bioethanol as renewable energy. Besides sugar cane, cassava, maize and sugar beet special emphasis is being given to sorghum (Sorghum bicolor L. Moench to produce ethanol for its productivity and resistance. The sorghum is grown in Rio Grande do Sul with a production of about 70,000 tons / year. Embrapa has a program to develop cultivars of sorghum from the time the Pro-Alcohol and currently 25 new varieties of sorghum are being evaluated. Several factors are relevant in the optimization of production such as increased productivity and reduced costs in the production of ethanol. This study aimed to survey recent data that will assess production parameters of ethanol from sorghum. Factors such as reducing the risk of bacterial contamination, the means conducive to fermentation processes or grain sorghum stalk through the use of pretreatment of the sample, have been of great importance because it is basically turning cellulosic biomass into fermentable sugars. Superior genotypes of sweet sorghum for ethanol production are of utmost importance, as well as better ways to convert sugars into ethanol. Lignin, toxic against microorganisms, prevents the conversion of lignocellulose into ethanol. The conversion of lignocellulosic ethanol compounds based on the hydrolysis of cellulose producing simple sugars and fermenting those sugars into ethanol through microbiology.
Czech Academy of Sciences Publication Activity Database
Yeo, F. K. S.; Wang, Y.; Vozábová, Tereza; Huneau, C.; LeRoy, P.; Chalhoub, B.; Qi, X. Q.; Niks, R. E.; Marcel, T. C.
2016-01-01
Roč. 129, č. 2 (2016), s. 289-304 ISSN 0040-5752 Institutional support: RVO:67985939 Keywords : cartial resistance genes * cloning * Hordeum vulgare Subject RIV: EF - Botanics Impact factor: 4.132, year: 2016
Sorghum allelopathy--from ecosystem to molecule.
Weston, Leslie A; Alsaadawi, Ibrahim S; Baerson, Scott R
2013-02-01
Sorghum allelopathy has been reported in a series of field experiments following sorghum establishment. In recent years, sorghum phytotoxicity and allelopathic interference also have been well-described in greenhouse and laboratory settings. Observations of allelopathy have occurred in diverse locations and with various sorghum plant parts. Phytotoxicity has been reported when sorghum was incorporated into the soil as a green manure, when residues remained on the soil surface in reduced tillage settings, or when sorghum was cultivated as a crop in managed fields. Allelochemicals present in sorghum tissues have varied with plant part, age, and cultivar evaluated. A diverse group of sorghum allelochemicals, including numerous phenolics, a cyanogenic glycoside (dhurrin), and a hydrophobic p-benzoquinone (sorgoleone) have been isolated and identified in recent years from sorghum shoots, roots, and root exudates, as our capacity to analyze and identify complex secondary products in trace quantities in the plant and in the soil rhizosphere has improved. These allelochemicals, particularly sorgoleone, have been widely investigated in terms of their mode(s) of action, specific activity and selectivity, release into the rhizosphere, and uptake and translocation into sensitive indicator species. Both genetics and environment have been shown to influence sorgoleone production and expression of genes involved in sorgoleone biosynthesis. In the soil rhizosphere, sorgoleone is released continuously by living root hairs where it accumulates in significant concentrations around its roots. Further experimentation designed to study the regulation of sorgoleone production by living sorghum root hairs may result in increased capacity to utilize sorghum cover crops more effectively for suppression of germinating weed seedlings, in a manner similar to that of soil-applied preemergent herbicides like trifluralin.
Use of hybridization (F1 in forage sorghum (Sorghum bicolor (L. Moench breeding
Directory of Open Access Journals (Sweden)
Pataki Imre
2010-01-01
Full Text Available In plants with bisexual flowers, the development of hybrids and F1 seed production is only possible by using cytoplasmatic male sterility. The discovery of such sterility and the maintainers has made it possible to utilize the phenomenon of heterosis to improve yields and yield components in forage sorghum. It has been shown that the best way to develop forage sorghum hybrids is to cross grain sorghum as the female parent and Sudan grass as the male. The objective of this study was to develop a forage sorghum hybrid for the production of green matter to be used either fresh or for silage. The sorghum hybrid developed in these efforts (Siloking is intended for multiple cutting, as the basal nodes produce buds and regrowth takes place. The performance of the new hybrid with respect to yield and quality was compared to that of the forage sorghum cultivar NS Džin. In a two-year study conducted under different growing conditions in four locations, Siloking produced an average green matter yield of 86.29 t ha-1 (two cuts, a dry matter yield of 25.34 t ha-1, and a crude protein content of 11.85 %. Siloking outperformed NS Džin in terms of yield and quality. .
Transformation of Food Habits through Promotion of Under-Utilized Cereals in High Hills of Nepal
International Nuclear Information System (INIS)
Koirala, Pramod; Bajracharya, Keshari; Chalise, Ananda
2014-01-01
Full text: Malnutrition is a persistent social setback in Nepal. High hills in Nepal is considered as the headquarter of the malnourished people as it holds almost the twice of stunted children than the national average. Food insecurity is the major causes of malnutrition as there is low agriculture production followed by difficult terrain and poor road connectivity. Nevertheless, there are several types of locally produced cereals that are under-utilized because of the traditional food-habit of eating rice. In order to bring a change in local food habit by the high-hill residents, attempts were made in processing of under-utilized cereals. Six different cereals were processed into super flour, porridge, cookies, flakes and traditional sweets for which locally accessible home level processing technology was used. Sorghum (Sorghum bicolor), Foxtail Millet (Setaria italica), Porso Millet (Panicum miliaceum), Buck Wheat (Fagopyrum esculentum), Amaranth (Amaranth caudatus) and Naked Barley (Hordeum vulgare) were processed into diverse products that suit to the local taste. The processing steps were standardized and laboratory analysis was carried out. It was then distributed to local development partners through trainers' training. Now, local people have started processing and consuming these products. It is anticipated that processed products promotion helps in solving food insecurity to some extent, and contributes in reducing malnutrition for the children below two. (author)
African Journals Online (AJOL)
big timmy
... properties of pumpkin (Cucurbita pepo) and sorghum (Sorghum bicolor) flour blends fermented with pure strains of Lactobacillus ... good storage characteristics and affordable cost. (Akinrele ... (MRS), Nutrient agar (NA) and Potato dextrose.
Sorghums: viable biomass candidates
Energy Technology Data Exchange (ETDEWEB)
McClure, T A; Arthur, M F; Kresovich, S; Scantland, D A
1980-01-01
Agronomic studies conducted at Battelle's Columbus Division to evaluate biomass and sugar yields of sweet sorghum are described and the major findings are summarized. Development opportunities for using sorghum cultivars as a large-scale energy crop are discussed. With presently available cultivars, sweet sorghum should produce 3500 to 4000 liters ethanol per hectare from the fermentable sugars alone. Conversion of the stalk fibers into alcohol could increase production by another 1600 to 1900 liters per hectare with existing cultivars. These yields are approximately 30 to 40% greater per hectare than would be obtained from above average yields of grain and stalk fiber with corn. There is reason to believe, that with hybrid sweet sorghum, these yields could be further increased by as much as 30%. Diminishing land availability for agricultural crops necessitates that maximum yields be obtained. Over the next decade, imaginative technological innovations in sorghum harvesting, processing, and crop preservation, coupled with plant breeding research should help this crop realize its full potential as a renewable resource for energy production.
Konečná, Hana; Müller, Lukáš; Dosoudilová, Hana; Potěšil, David; Buršíková, Jana; Sedo, Ondrej; Márová, Ivana; Zdráhal, Zbyněk
2012-03-14
Two-dimensional gel electrophoresis in combination with mass spectrometry has already been applied successfully to study beer proteome. Due to the abundance of protein Z in beer samples, prefractionation techniques might help to improve beer proteome coverage. Proteins from four lager beers of different origins were separated by two-dimensional electrophoresis (2-DE) followed by tandem mass spectrometric analysis. Initially 52 proteins mostly from Hordeum vulgare (22 proteins) and Saccharomyces species (25 proteins) were identified. Preparative isoelectric focusing by OFFGEL Fractionator was applied prior to 2-DE to improve its resolution power. As a result of this combined approach, a total of 70 beer proteins from Hordeum vulgare (30 proteins), from Saccharomyces species (31 proteins), and from other sources (9 proteins) were identified. Of these, 37 proteins have not been previously reported in beer samples.
Analysis of aluminium sensitivity in sorghum (Sorghum bicolor (L.) Moench) genotypes
Tan, K.
1993-01-01
Twelve genotypes of sorghum ( Sorghum bicolor (L.) Moench) differing in Al sensitivity were grown in an acid soil (with additions of lime or MgSO 4 ) and in nutrient solutions (with or without Al at constant pH) for periods between 14 and 35 days.
DEFF Research Database (Denmark)
Mocoeur, Anne Raymonde Joelle
Sorghum (Sorghum bicolor (L.) Moench), a C4 African originated grass, ranks 5th most important crop worldwide, feeding over 500 million people in tropical regions as it withstands a wide panel of biotic and abiotic stresses. The small and simple diploid genome of sorghum was elected as the third...... plant for sequencing in 2009 promoting it as a C4 model plant. Among the very diverse genetic resources available for sorghum, sweet sorghum plants; amassing large quantities of juice-rich and sugar-rich stem, grain and vegetative biomass; have been enlightened as bioenergy crop as it can produced from...... a single plant food, feed and fuel. Sweet sorghum has gained interest in Europe to replace maize, for biogas and bioenergy productions, but this versatile crop is sensitive to chilling temperatures and little breeding efforts have been done toward its cold acclimation. The state-of-art of using...
Achievements and problems in the weed control in grain sorghum (Sorghum Bicolor Moench.
Directory of Open Access Journals (Sweden)
Gr. Delchev
2017-09-01
Full Text Available Abstract. Chemical control has emerged as the most efficient method of weed control. Herbicides combinations and tank mixtures of herbicides with adjuvants, fertilizers, growth regulators, fungicides, insecticides are more effective than when applied alone on sorghum crops. Their combined use often leads to high synergistic effect on yield. The use of herbicide antidotes for the treatment of seeds in sorghum is a safe way to overcome its high sensitivity to many herbicides. Data regarding herbicide for chemical control of annual graminaceous weeds in sorghum crops are quite scarce even worldwide. Problem is the persistence of some herbicides used in the predecessors on succeeding crops, which is directly related to the weather conditions during their degradation. Most of the information on sorghum relates to the conventional technology for weed control. There is no information about the new Concep technology in grain sorghum. A serious problem is also the volunteers of the Clearfield and Express sun sunflower. They have resistance to herbicides different from that of conventional sunflower hybrids. There is no information yet in scientific literature on control of these volunteers.
International Nuclear Information System (INIS)
Ali, Tahira Mohsin; Hasnain, Abid
2013-01-01
Highlights: ► Sorghum starches were chemically modified. ► Starch–lipid complexes were studied in the presence of emulsifiers. ► Type II complexes were also detected in native and oxidized starches on adding GMS. ► Starch–lipid complexes sharply reduced retrogradation in modified starches. - Abstract: The effect of emulsifiers on complexation and retrogradation characteristics of native and chemically modified white sorghum starches was studied. Complex forming tendency of white sorghum starch with commercially available emulsifiers GMS and DATEM improved after acetylation. Presence of emulsifiers reduced λ max (wavelength of maximum absorbance) both for native and modified sorghum starches suggesting lower availability of amylose chains to complex with iodine. In native white sorghum starch (NWSS) and oxidized white sorghum starch (OWSS), both Type I and Type II starch–lipid complexes were observed on addition of 1.0% GMS prior to gelatinization. Acetylated-oxidized white sorghum starch (AOWSS) formed weakest complexes among all the modified starches. The results revealed that antistaling characteristics of modified sorghum starches were enhanced when used in combination with emulsifiers. The most prominent decline in reassociative capability among modified starches was observed for acetylated starches.
Czech Academy of Sciences Publication Activity Database
Sieper, T.; Forczek, Sándor; Matucha, Miroslav; Kraemer, P.; Hartmann, A.; Schroeder, P.
2014-01-01
Roč. 201, č. 2 (2014), s. 545-555 ISSN 1469-8137 Institutional support: RVO:61389030 Keywords : barley (Hordeum vulgare) * monoclonal antibodies * N-acyl-homoserine lactones (HSLs) Subject RIV: EF - Botanics Impact factor: 6.545, year: 2013
Review of Sorghum Production Practices: Applications for Bioenergy
Energy Technology Data Exchange (ETDEWEB)
Turhollow Jr, Anthony F [ORNL; Webb, Erin [ORNL; Downing, Mark [ORNL
2010-06-01
Sorghum has great potential as an annual energy crop. While primarily grown for its grain, sorghum can also be grown for animal feed and sugar. Sorghum is morphologically diverse, with grain sorghum being of relatively short stature and grown for grain, while forage and sweet sorghums are tall and grown primarily for their biomass. Under water-limited conditions sorghum is reliably more productive than corn. While a relatively minor crop in the United States (about 2% of planted cropland), sorghum is important in Africa and parts of Asia. While sorghum is a relatively efficient user of water, it biomass potential is limited by available moisture. The following exhaustive literature review of sorghum production practices was developed by researchers at Oak Ridge National Laboratory to document the current state of knowledge regarding sorghum production and, based on this, suggest areas of research needed to develop sorghum as a commercial bioenergy feedstock. This work began as part of the China Biofuels Project sponsored by the DOE Energy Efficiency and Renewable Energy Program to communicate technical information regarding bioenergy feedstocks to government and industry partners in China, but will be utilized in a variety of programs in which evaluation of sorghum for bioenergy is needed. This report can also be used as a basis for data (yield, water use, etc.) for US and international bioenergy feedstock supply modeling efforts.
Radioinduced variation in genetic improvement of sorghum (Sorghum bicolor (l.). Moench)
International Nuclear Information System (INIS)
Gutierrez del Rio, E.
1984-01-01
A genetic variability study among 25 varieties of sorghum (Sorghum bicolor (L.) Moench) is presented. The populations are irradiated with 0, 10, 20, 30, 40, 50 and 60 Krads of cobalt 60 as far as M 5 generation. An individual selection is done taking into consideration agronomic characteristics like precocity, type, size. height of the plant. (M.A.C.) [pt
Effect of Harvesting Stage on Sweet Sorghum (Sorghum bicolor L. Genotypes in Western Kenya
Directory of Open Access Journals (Sweden)
Moses Owuor Oyier
2017-01-01
Full Text Available Harvesting stage of sweet sorghum (Sorghum bicolor L. Moench cane is an important aspect in the content of sugar for production of industrial alcohol. Four sweet sorghum genotypes were evaluated for harvesting stage in a randomized complete block design. In order to determine sorghum harvest growth stage for bioethanol production, sorghum canes were harvested at intervals of seven days after anthesis. The genotypes were evaluated at different stages of development for maximum production of bioethanol from flowering to physiological maturity. The canes were crushed and juice fermented to produce ethanol. Measurements of chlorophyll were taken at various stages as well as panicles from the harvested canes. Dried kernels at 14% moisture content were also weighed at various stages. Chlorophyll, grain weight, absolute ethanol volume, juice volume, cane yield, and brix showed significant (p=0.05 differences for genotypes as well as the stages of harvesting. Results from this study showed that harvesting sweet sorghum at stages IV and V (104 to 117 days after planting would be appropriate for production of kernels and ethanol. EUSS10 has the highest ethanol potential (1062.78 l ha−1 due to excellent juice volume (22976.9 l ha−1 and EUSS11 (985.26 l ha−1 due to its high brix (16.21.
Oliver, A L; Grant, R J; Pedersen, J F; O'Rear, J
2004-03-01
Total mixed rations containing conventional forage sorghum, brown midrib (bmr)-6 forage sorghum, bmr-18 forage sorghum, or corn silage were fed to Holstein dairy cows to determine the effect on lactation, ruminal fermentation, and total tract nutrient digestion. Sixteen multiparous cows (4 ruminally fistulated; 124 d in milk) were assigned to 1 of 4 diets in a replicated Latin square design with 4-wk periods (21-d adaptation and 7 d of collection). Diets consisted of 40% test silage, 10% alfalfa silage, and 50% concentrate mix (dry basis). Acid detergent lignin concentration was reduced by 21 and 13%, respectively, for the bmr-6 and bmr-18 sorghum silages when compared with the conventional sorghum. Dry matter intake was not affected by diet. Production of 4% fat-corrected milk was greatest for cows fed bmr-6 (33.7 kg/d) and corn silage (33.3 kg/d), was least for cows fed the conventional sorghum (29.1 kg/d), and was intermediate for cows fed the bmr-18 sorghum (31.2 kg/d), which did not differ from any other diet. Total tract neutral detergent fiber (NDF) digestibility was greatest for the bmr-6 sorghum (54.4%) and corn silage (54.1%) diets and was lower for the conventional (40.8%) and bmr-18 sorghum (47.9%) diets. In situ extent of NDF digestion was greatest for the bmr-6 sorghum (76.4%) and corn silage (79.0%) diets, least for the conventional sorghum diet (70.4%), and intermediate for the bmr-18 sorghum silage diet (73.1%), which was not different from the other diets. Results of this study indicate that the bmr-6 sorghum hybrid outperformed the conventional sorghum hybrid; the bmr-18 sorghum was intermediate between conventional and bmr-6 in most cases. Additionally, the bmr-6 hybrid resulted in lactational performance equivalent to the corn hybrid used in this study. There are important compositional differences among bmr forage sorghum hybrids that need to be characterized to predict animal response accurately.
Mutant lines of sorghum with low levels of lignin are potentially useful for bioenergy production, but may have problems with insects or disease. Field grown normal and low lignin bmr6 and bmr12 sorghum (Sorghum bicolor) were examined for insect and disease damage in the field, and insect damage in ...
(Arachis hypogaea) and Sorghum (Sorghum bicolor)
African Journals Online (AJOL)
ADOWIE PERE
as enzyme activities of Arachis hypogaea and Sorghum bicolor in crude oil contaminated soil. Crude oil ... Treatments without crude oil were ... replicates were made for each treatment. .... dead sections of leaf margins, burning and stunted or.
Fermentation characteristics of different purpose sorghum silage
Directory of Open Access Journals (Sweden)
Arthur Behling Neto
2017-08-01
Full Text Available Sorghum stands out among other plants recommended for ensiling due to its forage composition, its resistance to drought, and its planting range. New cultivars of grain and sweet sorghum that can be used for silage production are available, but there is little information regarding their ensiling characteristics. The aim of this study was to evaluate the fermentation characteristics at the ensiling of different purpose sorghum cultivars, at two crop periods. The trial was carried out at the Plant Production Department of the Federal Institute of Education, Science and Technology of Rondônia, Colorado do Oeste campus, Rondônia, Brazil, and chemical analyses were performed at the Laboratory of Animal Nutrition, at the Federal University of Mato Grosso, Cuiabá campus, Mato Grosso, Brazil. The experimental design used was a randomized block, in split-plot design, with four replicates. The plot treatments consisted of six sorghum cultivars grown for different purposes (grain sorghum: BRS 308 and BRS 310; forage sorghum: BR 655 and BRS 610; sweet sorghum: BRS 506 and CMSXS 647. Split-plot treatments consisted of two cropping seasons (first crop and second crop. The grain sorghum cultivar BRS 310 was the only one that had suitable dry matter content for ensiling; however, it was also the only one that did not show ideal water soluble carbohydrate content for ensiling. Nevertheless, all treatments presented pH below than 4.2 and ammonia nitrogen lower than 12% of total N, which indicates that the fermentation inside the silo had proceeded well. For sweet sorghum cultivars, higher ethanol and butyric acid content were observed for the first crop than for the second crop. All evaluated sorghum cultivars can be used for silage production, but the use of sweet sorghum is recommended at the second crop.
Journal of Genetics Online Resources
Indian Academy of Sciences (India)
pdf. Jaiswal S. K., Pandey S. P., Sharma S., Prasad R., Prasad L. C., Verma R. P. S. and Joshi A. K. 2010 Diversity in Indian barley (Hordeum vulgare) cultivars and identification of genotype-specific fingerprints using microsatellite markers.
M. T. Tinoco; M. R. Martins; J. Cruz-Morais
2007-01-01
O Foeniculum vulgare Mill. subsp. vulgare é uma planta espontânea da região mediterrânea, pertencente à família Apiaceae. O seu óleo essencial, principalmente o dos frutos secos, é amplamente utilizado nas indústrias alimentar, farmacêutica, cosmética e perfumaria. Neste trabalho, pretendeu-se avaliar a actividade antimicrobiana do óleo essencial dos frutos verdes e das folhas da variedade de funcho doce colhido no Alentejo, na região de Évora, e relacionar essa actividade com a respectiva co...
Nutritional value of sorghum silage of different purposes
Directory of Open Access Journals (Sweden)
Arthur Behling Neto
Full Text Available ABSTRACT Sorghum is a crop that stands out as an alternative to corn due to lower soil fertility demand and increased tolerance to drought. Lack of information about the qualitative behaviour of sorghum hinders the recommendation of different purpose sorghum cultivars. The goal was to evaluate the chemical composition and in vitro digestibility of different purpose sorghum cultivar silages, at two cropping seasons. The trial was conducted at the Plant Production Department, Federal Institute of Education, Science and Technology of Rondônia, Colorado do Oeste campus, and chemical analyses and in vitro incubation were performed at the Laboratory of Animal Nutrition, Federal University of Mato Grosso, Cuiabá campus. The experimental design was a randomized block with a split-plot arrangement and four replications. Plot treatments consisted of six different purpose sorghum cultivars (BRS 308 and BRS 310, grain sorghum; BR 655 and BRS 610, forage sorghum; and BRS 506 and CMSXS 647, sweet sorghum. Split-plot treatments consisted of two cropping periods (first crop and second crop. Forage sorghum cultivar BRS 655 demonstrated higher non-fiber carbohydrate content and lower potentially digestible fibre content than the other cultivars did. Sweet sorghum cultivars had higher levels of water soluble carbohydrates and non-protein nitrogen based on protein, lower indigestible neutral detergent fibre content at second crop, and higher in vitro dry matter digestibility than the other cultivars. The silages of sweet sorghum cultivars BRS 506 and CMSXS 647, and forage sorghum cultivar BRS 655 presented higher nutritional values.
Development of Perennial Grain Sorghum
Directory of Open Access Journals (Sweden)
Stan Cox
2018-01-01
Full Text Available Perennial germplasm derived from crosses between Sorghum bicolor and either S. halepense or S. propinquum is being developed with the goal of preventing and reversing soil degradation in the world’s grain sorghum-growing regions. Perennial grain sorghum plants produce subterranean stems known as rhizomes that sprout to form the next season’s crop. In Kansas, breeding perennial sorghum involves crossing S. bicolor cultivars or breeding lines to S. halepense or perennial S. bicolorn × S. halepense breeding lines, selecting perennial plants from F2 or subsequent populations, crossing those plants with S. bicolor, and repeating the cycle. A retrospective field trial in Kansas showed that selection and backcrossing during 2002–2009 had improved grain yields and seed weights of breeding lines. Second-season grain yields of sorghum lines regrowing from rhizomes were similar to yields in the first season. Further selection cycles have been completed since 2009. Many rhizomatous lines that cannot survive winters in Kansas are perennial at subtropical or tropical locations in North America and Africa. Grain yield in Kansas was not correlated with rhizomatousness in either Kansas or Uganda. Genomic regions affecting rhizome growth and development have been mapped, providing new breeding tools. The S. halepense gene pool may harbor many alleles useful for improving sorghum for a broad range of traits in addition to perenniality.
Directory of Open Access Journals (Sweden)
Ming-Zhu Ding
Full Text Available The cooperative adaptation of subcultivated Bacillus cereus and Ketogulonicigenium vulgare significantly increased the productivity of 2-keto-L-gulonic acid, the precursor of vitamin C. The mechanism of cooperative adaptation of the serial subcultivated B. cereus and K. vulgare was investigated in this study by culturing the two strains orthogonally on agar plates. It was found that the swarming distance of B. cereus along the trace of K. vulgare on the plate decreased after 150 days' subcultivation. Metabolomic analysis on these co-cultured B. cereus and K. vulgare strains showed that their cooperative adaptation was accomplished by three key events: (i the ability of nutrients (e.g., amino acids and purines searching and intaking, and proteins biosynthesis is increased in the evolved B. cereus; (ii the capability of protein degradation and amino acids transportation is enhanced in evolved K. vulgare; (iii the evolved B. cereus was found to provide more nutrients (mostly amino acids and purines to K. vulgare, thus strengthening the oxidation and energy generation of K. vulgare. Our results provided novel insights into the systems-level understanding of the cooperative adaptation between strains in synergistic consortium.
Leaf rust of cultivated barley: pathology and control.
Park, Robert F; Golegaonkar, Prashant G; Derevnina, Lida; Sandhu, Karanjeet S; Karaoglu, Haydar; Elmansour, Huda M; Dracatos, Peter M; Singh, Davinder
2015-01-01
Leaf rust of barley is caused by the macrocyclic, heteroecious rust pathogen Puccinia hordei, with aecia reported from selected species of the genera Ornithogalum, Leopoldia, and Dipcadi, and uredinia and telia occurring on Hordeum vulgare, H. vulgare ssp. spontaneum, Hordeum bulbosum, and Hordeum murinum, on which distinct parasitic specialization occurs. Although Puccinia hordei is sporadic in its occurrence, it is probably the most common and widely distributed rust disease of barley. Leaf rust has increased in importance in recent decades in temperate barley-growing regions, presumably because of more intensive agricultural practices. Although total crop loss does not occur, under epidemic conditions yield reductions of up to 62% have been reported in susceptible varieties. Leaf rust is primarily controlled by the use of resistant cultivars, and, to date, 21 seedling resistance genes and two adult plant resistance (APR) genes have been identified. Virulence has been detected for most seedling resistance genes but is unknown for the APR genes Rph20 and Rph23. Other potentially new sources of APR have been reported, and additivity has been described for some of these resistances. Approaches to achieving durable resistance to leaf rust in barley are discussed.
COMPARISON OF THE FROST RESISTANCE OF BARLEY ...
African Journals Online (AJOL)
Preferred Customer
immediate recovery of the photosynthetic quantum yield after freezing. Landraces which showed the highest cold tolerance were found to acclimatize best. Key words/phrases: Barley, chlorophyll fluorescence, cold acclimation, Ethiopia, frost tolerance. INTRODUCTION. Barley (Hordeum vulgare L.) is a traditional crop.
Wheat and barley exposure to nanoceria: Implications for agricultural productivity
The impacts of man-made nanomaterials on agricultural productivity are not yet well understood. A soil microcosm study was performed to assess the physiological, phenological, and yield responses of wheat (Triticum aestivum) and barley (Hordeum vulgare L.) exposed to nanoceria (n...
Significance and value of non.traded ecosystem services on farmland
DEFF Research Database (Denmark)
Sandhu, Harpinder; Wratten, Steve; Costanza, Robert
2015-01-01
peas (Pisum sativum), beans (Phaseolus vulgaris), barley (Hordeum vulgare), and wheat (Triticum aestivum). Organic systems were chosen as comparators not because they are the only forms of sustainable agriculture, but because they are subject to easily understood standards. Results. We found...
Studies on the histology of partial resistance in barley to leafrust, Puccinia hordei
Niks, R.E.
1983-01-01
In de gerst (Hordeum vulgare) - dwergroest (Puccinia hordei) relatie zijn twee typen van resistentie te onderscheiden, namelijk overgevoeligheidsresistentie en partiële resistentie. Deze typen kunnen beschouwd worden als voorbeelden van Van der Plank's verticale en horizontale
Sorghum yield and associated satellite-derived meteorological ...
African Journals Online (AJOL)
Sorghum yield and associated satellite-derived meteorological parameters in semi-arid Botswana. ... African Crop Science Journal ... Sorghum (Sorghum bicolor) yield for five seasons (2005/6 to 2009/10) from the Botswana Department of Crop ... Key Words: Coefficient of determination, NDVI, Pearson correlation ...
CSIR Research Space (South Africa)
Pelembe, LAM
2004-01-01
Full Text Available .H., Effect of calcium ions in sor- ghum beer mashing. Journal of the Institute of Brewing, 1988, 94, 68?70. VOL. 110, NO. 4, 2004 325 29. Hardie, D.G., Manners, D.J. and Yellowlees, D., The limit dex- trinase from malted sorghum (Sorghum vulgare...
Genetic analysis of recombinant inbred lines for Sorghum bicolor × Sorghum propinquum.
Kong, Wenqian; Jin, Huizhe; Franks, Cleve D; Kim, Changsoo; Bandopadhyay, Rajib; Rana, Mukesh K; Auckland, Susan A; Goff, Valorie H; Rainville, Lisa K; Burow, Gloria B; Woodfin, Charles; Burke, John J; Paterson, Andrew H
2013-01-01
We describe a recombinant inbred line (RIL) population of 161 F5 genotypes for the widest euploid cross that can be made to cultivated sorghum (Sorghum bicolor) using conventional techniques, S. bicolor × Sorghum propinquum, that segregates for many traits related to plant architecture, growth and development, reproduction, and life history. The genetic map of the S. bicolor × S. propinquum RILs contains 141 loci on 10 linkage groups collectively spanning 773.1 cM. Although the genetic map has DNA marker density well-suited to quantitative trait loci mapping and samples most of the genome, our previous observations that sorghum pericentromeric heterochromatin is recalcitrant to recombination is highlighted by the finding that the vast majority of recombination in sorghum is concentrated in small regions of euchromatin that are distal to most chromosomes. The advancement of the RIL population in an environment to which the S. bicolor parent was well adapted (indeed bred for) but the S. propinquum parent was not largely eliminated an allele for short-day flowering that confounded many other traits, for example, permitting us to map new quantitative trait loci for flowering that previously eluded detection. Additional recombination that has accrued in the development of this RIL population also may have improved resolution of apices of heterozygote excess, accounting for their greater abundance in the F5 than the F2 generation. The S. bicolor × S. propinquum RIL population offers advantages over early-generation populations that will shed new light on genetic, environmental, and physiological/biochemical factors that regulate plant growth and development.
Diurnal oscillation of SBE expression in sorghum endosperm
Energy Technology Data Exchange (ETDEWEB)
Sun, Chuanxin; Mutisya, J.; Rosenquist, S.; Baguma, Y.; Jansson, C.
2009-01-15
Spatial and temporal expression patterns of the sorghum SBEI, SBEIIA and SBEIIB genes, encoding, respectively, starch branching enzyme (SBE) I, IIA and IIB, in the developing endosperm of sorghum (Sorghum bicolor) were studied. Full-length genomic and cDNA clones for sorghum was cloned and the SBEIIA cDNA was used together with gene-specific probes for sorghum SBEIIB and SBEI. In contrast to sorghum SBEIIB, which was expressed primarily in endosperm and embryo, SBEIIA was expressed also in vegetative tissues. All three genes shared a similar temporal expression profile during endosperm development, with a maximum activity at 15-24 days after pollination. This is different from barley and maize where SBEI gene activity showed a significantly later onset compared to that of SBEIIA and SBEIIB. Expression of the three SBE genes in the sorghum endosperm exhibited a diurnal rhythm during a 24-h cycle.
Dhurrin content relates to sorghum (Sorghum bicolor (L) Moench) seedling growth in marginal soils.
Dhurrin content in leaves of mature sorghum plant is a quantitative measure of the level of pre-and postflowering drought tolerance (Burke et al., 2013). Postflowering drought tolerance in sorghum is linked to the staygreen (delayed senescence) trait (Howarth, 2000; Rosenow et al., 1977) which has b...
Dhurrin content relates to sorghum [sorghum bicolor (L.) Moench] seedling growth in marginal soils
Dhurrin content in leaves of mature sorghum plant is a quantitative measure of the level of pre-and postflowering drought tolerance (Burke et al., 2013). Postflowering drought tolerance in sorghum is linked to the staygreen (delayed senescence) trait (Howarth, 2000; Rosenow et al., 1977) which has ...
Czech Academy of Sciences Publication Activity Database
Dockter, C.; Gruszka, D.; Braumann, I.; Druka, A.; Franckowiak, J.; Muller, A.H.; Oklešťková, Jana; Schulz, B.; Zakhrabekova, S.; Hansson, M.
2014-01-01
Roč. 166, č. 4 (2014), s. 1912-1927 ISSN 0032-0889 R&D Projects: GA MŠk LK21306 Institutional support: RVO:61389030 Keywords : HORDEUM-VULGARE L. * GIBBERELLIN-SYNTHESIS * SIGNAL-TRANSDUCTION Subject RIV: EF - Botanics Impact factor: 6.841, year: 2014
DEFF Research Database (Denmark)
Kaczmarczyk, Agnieszka Ewa; Dionisio, Giuseppe; Renaut, Jenny
2012-01-01
The aim of the study was to understand the molecular and biochemical mechanisms underpinning the effect of nitrogen (N) on barley (Hordeum vulgare) storage protein production (hordeins) during grain filling. Using a combination of advanced biochemistry methods, we could comprehensively describe c...
Lifescience Database Archive (English)
Full Text Available me=Ltp1; Synonyms=Papi; Hordeum Vulgare Molecule: Lipid Transfer Protein; Chain: Null; Synonym: Ltp Lipid Tr...ansport M.H.Lerche, F.M.Poulsen M.H.Lerche, F.M.Poulsen Two Different Binding Modes Of Palmitate In The Homologous Mai
Nitrogen accumulation and residual effects of nitrogen catch crops
DEFF Research Database (Denmark)
Jensen, E.S.
1991-01-01
The nitrogen accumulation in Italian ryegrass (Lolium multiflorum Lam.), perennial ryegrass (Lolium perenne L.), white mustard (Sinapis alba L.) and tansy phacelia (Phacelia tanacetifolia L.), under- or aftersown as nitrogen catch crops to spring barley (Hordeum vulgare L.) and field pea (Pisum s...
Wheat and barley seed systems in Ethiopia and Syria
Bishaw, Z.
2004-01-01
Keywords: Wheat,Triticumspp., Barley,Hordeumvulgare L., Seed Systems, Formal Seed Sector, Informal Seed Sector, National Seed Program, Seed Source, Seed Selection, Seed Management, Seed Quality,
Directory of Open Access Journals (Sweden)
Thierry E. Besançon
2016-01-01
Full Text Available Dicamba and 2,4-D are among the most common and inexpensive herbicides used to control broadleaf weeds. However, different studies have pointed the risk of crop injury and grain sorghum yield reduction with postemergence applications of 2,4-D. No research data on grain sorghum response to 2,4-D or dicamba exists in the Southeastern United States. Consequently, a study was conducted to investigate crop growth and yield response to 2,4-D (100, 220, and 330 g acid equivalent ha−1 and dicamba (280 g acid equivalent ha−1 applied on 20 to 65 cm tall sorghum. Greater stunting resulted from 2,4-D applied at 330 g acid equivalent ha−1 or below 45 cm tall sorghum whereas lodging prevailed with 2,4-D at 330 g acid equivalent ha−1 and dicamba applied beyond 35 cm tall crop. Regardless of local environmental conditions, 2,4-D applied up to 35 cm tall did not negatively impact grain yield. There was a trend for yields to be somewhat lower when 2,4-D was applied on 45 or 55 cm tall sorghum whereas application on 65 cm tall sorghum systematically decreased yields. More caution should be taken with dicamba since yield reduction has been reported as early as applications made on 35 cm tall sorghum for a potentially dicamba sensitive cultivar.
SOME CONSIDERATIONS ON THE PROSPECTS OF SORGHUM CROP
Directory of Open Access Journals (Sweden)
Agatha POPESCU
2014-10-01
Full Text Available The paper purpose was to analyze the sorghum statement at world, EU and Romania level in order to establish the main trends in the future of this crop. Sorghum is an important cereal coming on the 5th position after maize, rice, wheat and barley at world level due to its importance in human nutrition, animal feed, in producing bioethanol and green energy, and due to its good impact on environment. It is cultivated on all the continents, in the tropical, subtropical and temperate areas due to its resistance to drought, production potential, low inputs and production cost. It is an alternative to maize crop being more utilized as substituent in animal diets. The world sorghum production reached 63,811 thousand metric tons in 2014, the main producers being the USA, Mexico, Nigeria, India, Argentina, Ethiopia, Sudan and China. The world consumption of sorghum reached 63,148 thousand metric tons and it is continuously increasing. The sorghum exports accounted for 7,690 thousand metric tons in 2014, of which the USA export represents 4,600 thousand metric tons. Besides the USA, other exporting countries are Argentina, Australia, Ethiopia, India, Nigeria, Uruguay, while the main importing countries are China, Japan, Chile, Colombia, Mexico, the EU, Sudan. In 2014, the EU produced 576 thousand metric tons sorghum, imported 200 thousand metric tons, and consumed 770 thousand metric tons. The main EU producers of sorghum are France, Italy, Romania, Spain and Hungary. In 2012, Romania cultivated 20,000 ha with sorghum crop, 18 times more than in 2077. Also, in 2012, Romania produced 37.5 thousand tons of sorghum grains, by 31 times more than in 2007. The sorghum yield was 1,875 kg/ha by 66% higher in 2012 compared to 2007. Therefore, these figures show the increasing importance of sorghum crop at world level. Because Romania is situated in suitable geographical area for producing sorghum, it could increase production and become a more important supplier
Fermentation and enzyme treatments for sorghum
Directory of Open Access Journals (Sweden)
Patrícia Fernanda Schons
2012-03-01
Full Text Available Sorghum (Sorghum bicolor Moench is the fifth most produced cereal worldwide. However, some varieties of this cereal contain antinutritional factors, such as tannins and phytate that may form stable complexes with proteins and minerals which decreases digestibility and nutritional value. The present study sought to diminish antinutritional tannins and phytate present in sorghum grains. Three different treatments were studied for that purpose, using enzymes tannase (945 U/Kg sorghum, phytase (2640 U/Kg sorghum and Paecilomyces variotii (1.6 X 10(7 spores/mL; A Tannase, phytase and Paecilomyces variotii, during 5 and 10 days; B An innovative blend made of tanase and phytase for 5 days followed by a Pv increase for 5 more days; C a third treatment where the reversed order of B was used starting with Pv for 5 days and then the blend of tannase and phytase for 5 more days. The results have shown that on average the three treatments were able to reduce total phenols and both hydrolysable and condensed tannins by 40.6, 38.92 and 58.00 %, respectively. Phytase increased the amount of available inorganic phosphorous, on the average by 78.3 %. The most promising results concerning tannins and phytate decreases were obtained by the enzymes combination of tannase and phytase. The three treatments have shown effective on diminishing tannin and phytate contents in sorghum flour which leads us to affirm that the proposed treatments can be used to increase the nutritive value of sorghum grains destined for either animal feeds or human nutrition.
Fermentation and enzyme treatments for sorghum.
Schons, Patrícia Fernanda; Battestin, Vania; Macedo, Gabriela Alves
2012-01-01
Sorghum (Sorghum bicolor Moench) is the fifth most produced cereal worldwide. However, some varieties of this cereal contain antinutritional factors, such as tannins and phytate that may form stable complexes with proteins and minerals which decreases digestibility and nutritional value. The present study sought to diminish antinutritional tannins and phytate present in sorghum grains. Three different treatments were studied for that purpose, using enzymes tannase (945 U/Kg sorghum), phytase (2640 U/Kg sorghum) and Paecilomyces variotii (1.6 X 10(7) spores/mL); A) Tannase, phytase and Paecilomyces variotii, during 5 and 10 days; B) An innovative blend made of tanase and phytase for 5 days followed by a Pv increase for 5 more days; C) a third treatment where the reversed order of B was used starting with Pv for 5 days and then the blend of tannase and phytase for 5 more days. The results have shown that on average the three treatments were able to reduce total phenols and both hydrolysable and condensed tannins by 40.6, 38.92 and 58.00 %, respectively. Phytase increased the amount of available inorganic phosphorous, on the average by 78.3 %. The most promising results concerning tannins and phytate decreases were obtained by the enzymes combination of tannase and phytase. The three treatments have shown effective on diminishing tannin and phytate contents in sorghum flour which leads us to affirm that the proposed treatments can be used to increase the nutritive value of sorghum grains destined for either animal feeds or human nutrition.
Chernobyl Doses. Volume 3. Habitat and Vegetation Near the Chernobyl Nuclear Reactor Station
1993-01-01
Hordeum vulgare, Avena sativa, Fagopyrum esculentum, Beta vulgaris, Solanum tuberosum, Linum usitatissimum , Cannabis satii, Humulus lupulus, Daucus carota... USITATISSIMUM flax It is grown for fiber. Fine-quality fiber can be obtained from plants grown on podzolic and gley soils with considerable fertilizing. In the
Lopez, S.; Davies, D.; Dhanoa, M.S.; Dijkstra, J.; France, J.
2005-01-01
The nutritive value of 17 straws was determined on the basis of their chemical composition, in vitro dry matter (DM) digestibility and rumen fermentation kinetics (from gas production curves measured in vitro). Five roughages were from the cereal species Avena sativa (oat), Hordeum vulgare (barley),
Sequencing of 15622 gene-bearing BACs clarifies the gene-dense regions of the barley genome
Czech Academy of Sciences Publication Activity Database
Munoz-Amatriain, M.; Lonardi, S.; Luo, M.C.; Madishetty, K.; Svensson, J.T.; Moscou, M. J.; Wanamaker, S.; Kudrna, D.; Zheng, J.; Šimková, Hana; Doležel, Jaroslav; Grimwood, J.; Mammadov, J.; Close, T.J.
2015-01-01
Roč. 84, č. 1 (2015), s. 216-227 ISSN 0960-7412 R&D Projects: GA MŠk(CZ) LO1204 Institutional support: RVO:61389030 Keywords : Barley * Hordeum vulgare L * BAC sequencing Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 5.468, year: 2015
Farmer’s seed sources and seed quality: 2. seed health
Bishaw, Z.; Struik, P.C.; Gastel, van A.J.G.
2013-01-01
The study assessed the health quality of wheat (Triticum aestivum L.) and barley (Hordeum vulgare L.) seed samples collected from formal and informal sector in Ethiopia and Syria. In Ethiopia, several seed-borne fungi were found on wheat samples: Cochliobolus sativum, Fusarium avenaceum, F.
Synthesis of the major storage protein, hordein, in barley
DEFF Research Database (Denmark)
Giese, Nanna Henriette; Andersen, B.; Doll, Hans
1983-01-01
A liquid culture system for culturing detached spikes of barley (Hordeum vulgare L.) at different nutritional levels was established. The synthesis of hordein polypeptides was studied by pulse-labeling with [14C]sucrose at different stages of development and nitrogen (N) nutrition. All polypeptides...
Ceretta, S.S.E.; Eeuwijk, van F.A.
2008-01-01
The efficiency of cultivar trial networks is an important subject in official cultivar testing. We investigated this efficiency for malting barley (Hordeum vulgare L.) in Uruguay, using data on 213 cultivars tested across an eight-year period at six locations. The variance-components approach was
DEFF Research Database (Denmark)
Schelde, Kirsten; Ringgaard, Rasmus; Herbst, Mathias
2011-01-01
limit estimate (disregarding dew evaporation) of evapotranspiration on dry days. During a period of 7 wk, the two independent measuring techniques were applied in a barley (Hordeum vulgare L.) field, and six dry periods were identified. Measurements of daily root zone soil moisture depletion were...
Investigation of GMO and ancient Grains for Bioplastic and Food Applications
DEFF Research Database (Denmark)
Sagnelli, Domenico
I dette projekt er der udviklet nye koncepter for helt naturlige bioplast systemer og sunde diætfibre. Termoplastisk stivelse (TPS) fremstilles ved anvendelse af traditionelle processer, såsom ekstrudering. I dette projekt anvendes transgen byg (Hordeum vulgare, Hv) med en stivelse der indeholder...
PLANT REMAINS FROM ASIKLI-HOYUK, A PRE-POTTERY NEOLITHIC SITE IN CENTRAL ANATOLIA
VANZEIST, W; DEROLLER, GJ
Cereal crop plants at Asikli Hayuk included einkorn wheat (Triticum monococcum), emmer wheat (T. dicoccum), free-threshing wheat (T. cf. durum), hulled two-rowed barley (Hordeum distichum) and naked barley (H. vulgare var. nudum). As for pulses, bitter vetch (Vicia ervilia), lentil (Lens culinaris)
Matthies, I.E.; Hintum, van T.J.L.; Weise, S.; Röder, M.S.
2012-01-01
Diversity arrays technology (DArT) and simple sequence repeat (SSR) markers were applied to investigate population structure, extent of linkage disequilibrium and genetic diversity (kinship) on a genome-wide level in European barley (Hordeum vulgare L.) cultivars. A set of 183 varieties could be
Enhanced ethanol production from stalk juice of sweet sorghum by ...
African Journals Online (AJOL)
Sweet sorghum (sugar sorghum, Sorghum bicolor) is one kind of non-grain energy crops. As a novel green regenerated high-energy crop with high utility value, high yield of biomass, the sweet sorghum is widely used and developed in China. Stalk juice of sweet sorghum was used as the main substrate for ethanol ...
Effect of heat moisture treatment (HMT) on product quality of sorghum starch
Haryani, Kristinah; Hadiyanto, Handayani, Noera; Nugraheni, Dwi; Suryanto
2015-12-01
Sorghum is a cereal plant that rich of nutrition contents. The high content of carbohydrate in sorghum make this plant can be processed into one of the processed food i.e vermicelli. To give better quality, it is necessary to use flour substitution from sorghum starch. The aim of this study was to evaluate the treatment of natural sorghum starch substitution, the addition of CMC, and a comparison of the natural starch with starch sorghum forage sorghum against solid losses value, rehydration weight and texture profiles. The variable used in this study: amount of natural sorghum starch subtituion (10%, 20%, 30%, 40%, 50%), the addition of CMC (0.1%; 0.2%; 0.3%; 0.4%; 0.5%) and substituting sorghum starch Natural: HMT sorghum starch (1: 1; 1: 2; 1: 3; 1: 4; 1: 5) and the quality parameters were evaluated. The result indicated that to substitute sorghum starch naturally at a rate of 50% had the best results with a value of solid losses 5.1% (white sorghum) 5.83% (red sorghum) and weighing rehydration 301.82% (white sorghums) 293.16% (red sorghum), the addition of CMC with 0.5% concentration of 3.96% solid losses value (red sorghum) 4:21% (white sorghums) and weight rehydration 252.71% (white sorghums) 244.45% (red sorghums).
Directory of Open Access Journals (Sweden)
Luiz Henrique dos Santos Gomes
2012-03-01
Full Text Available Nutrition values of silages from different sorghum cultivars are evaluated. Five 26-kg castrated crossbred lambs, housed in pens equipped with feces and urine collectors for the study of their metabolism, were employed in a 5 x 5 Latin square experimental design. Treatments consisted of silage from five different sorghum cultivars: IPA 1011 and IPA 2564 (grain sorghum, IPA 2502 (dual purpose sorghum, IPA FS-25 and IPA 467 (forage sorghum. Protein level was corrected to 12% by adding a mixture of urea: ammonium sulfate (9:1. Treatments IPA 1011, IPA 2564 and IPA 2502 provided high intake of dry matter, total carbohydrate and total digestible nutrients, and low intake of neutral detergent fiber. Cultivars IPA 1011 and IPA 2564 provided high apparent crude protein digestibility coefficient, whereas cultivars IPA 1011 and IPA 2564 had high total digestible nutrient levels. All cultivars provided positive nitrogen. Owing to nutrient intake and digestibility values, grain sorghum silages evidenced high potential in ruminant nutrition.
Characterization of Nitrogen use efficiency in sweet sorghum
Energy Technology Data Exchange (ETDEWEB)
Dweikat, Ismail [University of Nebraska; Clemente, Thomas [University of Nebrask
2014-09-09
Sweet sorghum (Sorghum bicolor L. Moench) has the potential to augment the increasing demand for alternative fuels and for the production of input efficient, environmentally friendly bioenergy crops. Nitrogen (N) and water availability are considered two of the major limiting factors in crop growth. Nitrogen fertilization accounts for about 40% of the total production cost in sorghum. In cereals, including sorghum, the nitrogen use efficiency (NUE) from fertilizer is approximately 33% of the amount applied. There is therefore extensive concern in relation to the N that is not used by the plant, which is lost by leaching of nitrate, denitrification from the soil, and loss of ammonia to the atmosphere, all of which can have deleterious environmental effects. To improve the potential of sweet sorghum as a leading and cost effective bioenergy crop, the enhancement of NUE must be addressed. To this end, we have identified a sorghum line (SanChi San) that displays about 25% increase in NUE over other sorghum lines. As such, the overarching goal of this project is to employ three complementary strategies to enhance the ability of sweet sorghum to become an efficient nitrogen user. To achieve the project goal, we will pursue the following specific objectives: Objective 1: Phenotypic characterization of SanChi San/Ck60 RILs under low and moderate N-availability including biochemical profiles, vegetative growth and seed yield Objective 2: Conduct quantitative trait loci (QTL) analysis and marker identification for nitrogen use efficiency (NUE) in a grain sorghum RIL population. Objective 3: Identify novel candidate genes for NUE using proteomic and gene expression profiling comparisons of high- and low-NUE RILs. Candidate genes will be brought into the pipeline for transgenic manipulation of NUE This project will apply the latest genomics resources to discover genes controlling NUE, one of the most complex and economically important traits in cereal crops. As a result of the
Niks, R.E.; Alemu, Sisay K.; Marcel, T.C.; Heyzen, van Skye
2015-01-01
Barley (Hordeum vulgare L.) mapping populations have been developed that are useful to study the inheritance of quantitative resistance to adapted and unadapted rust fungi. In a recent host range study, we found that the parents of those mapping populations also differed in their resistance to
The Role of alpha-Glucosidase in Germinating Barley Grains
DEFF Research Database (Denmark)
Stanley, Duncan; Rejzek, Martin; Næsted, Henrik
2011-01-01
The importance of alpha-glucosidase in the endosperm starch metabolism of barley (Hordeum vulgare) seedlings is poorly understood. The enzyme converts maltose to glucose (Glc), but in vitro studies indicate that it can also attack starch granules. To discover its role in vivo, we took complementa...
Journal of Genetics | Indian Academy of Sciences
Indian Academy of Sciences (India)
MAO-A promoter polymorphism and idiopathic pulmonary arterial hypertension · Shivani Vadapalli Sujana Katta B. K. S. Sastry Pratibha Nallari · More Details Fulltext PDF. pp e46-e54. Diversity in Indian barley (Hordeum vulgare) cultivars and identification of genotype-specific fingerprints using microsatellite markers.
DEFF Research Database (Denmark)
Rötter, R P; Palosuo, T; Kersebaum, K C
2012-01-01
In this study, the performance of nine widely used and accessible crop growth simulation models (APES-ACE, CROPSYST, DAISY, DSSAT-CERES, FASSET, HERMES, MONICA, STICS and WOFOST) was compared during 44 growing seasons of spring barley (Hordeum vulgare L.) at seven sites in Northern and Central...
Effects of free and chelated iron on in vitro androgenesis in barley and wheat
Czech Academy of Sciences Publication Activity Database
Novotný, J.; Vagera, Jiří; Ohnoutková, Ludmila
2000-01-01
Roč. 63, - (2000), s. 35-40 ISSN 0167-6857 R&D Projects: GA ČR GV521/96/K117 Institutional research plan: CEZ:AV0Z5038910 Keywords : ferrous ions * Hordeum vulgare * Triticum aestivum Subject RIV: EF - Botanics Impact factor: 0.444, year: 2000
A new agro-climatic classification for crop suitability zoning in northern semi-arid Ethiopia
Araya, A.; Keesstra, S.D.; Stroosnijder, L.
2010-01-01
The agro-climatic resources of Giba catchment in northern Ethiopia were assessed and characterized. The objectives were (i) to ascertain the suitability of the climate for growing teff (Eragrostis tef) and barley (Hordeum vulgare); (ii) to determine the onset and length of the growing period (LGP),
DEFF Research Database (Denmark)
Andersen, M.K.; Hauggaard-Nielsen, H.; Ambus, P.
2005-01-01
The interspecific complementary and competitive interactions between pea (Pisum sativum L.), barley (Hordeum vulgare L.) and oilseed rape (Brassica napus L.), grown as dual and tri-component intercrops were assessed in a field study in Denmark. Total biomass production and N use at two levels of ...
Classification and salt tolerance analysis of barley varieties
Katerji, N.; Hoorn, van J.W.; Hamdy, A.; Mastrorilli, M.; Fares, C.; Ceccarelli, S.; Grando, S.; Oweis, T.
2006-01-01
Six varieties of barley (Hordeum vulgare), five of which were provided by ICARDA, were tested in a green house experiment for their salt tolerance. Afterwards the ICARDA variety Melusine, selected from this experiment for its combination of high yield and salt tolerance, was compared in a lysimeter
Yield and grain quality of spring barley as affected by biomass formation at early growth stages
Czech Academy of Sciences Publication Activity Database
Křen, J.; Klem, Karel; Svobodová, I.; Míša, P.; Neudert, L.
2014-01-01
Roč. 60, č. 5 (2014), s. 221-227 ISSN 1214-1178 R&D Projects: GA MZe QI111A133 Keywords : Hordeum vulgare L * above-ground biomass * tillering * grain yield formation * grain protein content Subject RIV: EH - Ecology, Behaviour Impact factor: 1.226, year: 2014
Modification of Sorghum Starch-Cellulose Bioplastic with Sorghum Stalks Filler
Directory of Open Access Journals (Sweden)
Yuli Darni
2017-05-01
Full Text Available This study evaluated the feasibility of bioplastics production by various ratio of sorghum starch and cellulose from red seaweed Eucheuma spinossum, and the use of glycerol as plasticizer and sorghum stalks as filler. Solid-liquid matrix transition should be far over the operating temperature of gelatinization and extracted at 95oC in order to avoid the loss of conductivity. The analyzed variables were starch and cellulose seaweed Eucheuma spinossum and the addition of variation of filler. Sorghum stalk could be expected to affect the mechanical and physical properties of bioplastics. A thin sheet of plastic (plastic film was obtained as a result that have been tested mechanically to obtain the best condition for the formulation of starch-cellulose 8.5:1.5 (g/g. From the result of morphological studies, the fillers in the mixture composites were more randomly in each product and the addition of filler can increase mechanical properties of bioplastics. Chemical modification had a major effect on the mechanical properties. The phenomena of degradation and thermoplasticization were visible at chemical changes that can be observed in FTIR spectrum test results.
Maturation curves of sweet sorghum genotypes
Directory of Open Access Journals (Sweden)
Renan Silva e Souza
2016-02-01
Full Text Available ABSTRACT Sweet sorghum [Sorghum bicolor (L. Moench] stands out as a complementary crop to sugarcane Saccharum spp. for the production of ethanol, since it has juicy stems with directly fermentable sugars. Due to this fact, there is a need for the analysis of sweet sorghum properties in order to meet the agro-industry demand. This work aimed to develop and study the maturation curves of seven sweet sorghum cultivars in ten harvest dates. The results showed a significant difference between cultivars and harvest dates for all parameters analysed (p≤0.01. Regarding the sugar content, the cultivars BRS508, XBWS80147 and CMSX629 showed the highest means for the total reducing sugars (TRS and recoverable sugar (RS. In the production of ethanol per tonne of biomass (EP, the cultivars BRS508 and CMSX629 presented the best results.
SILAGE QUALITY OF CORN AND SORGHUM ADDED WITH FORAGE PEANUTS
Directory of Open Access Journals (Sweden)
WALKÍRIA GUIMARÃES CARVALHO
2016-01-01
Full Text Available Corn and sorghum are standard silage crops because of their fermentative characteristics. While corn and sorghum silages have lower crude protein (CP contents than other crops, intercropping with legumes can increase CP content. Furthermore, one way to increase CP content is the addition of legumes to silage. Consequently, the research objective was to evaluate the fermentative and bromatological characteristics of corn (Zea mays and sorghum (Sorghum bicolor silages added with forage peanuts (Arachis pintoi. The experimental design was completely randomized with four replicates. The treatments consisted of corn silage, sorghum silage, forage peanut silage, corn silage with 30% forage peanut, and sorghum silage with 30% forage peanut. The results showed that the corn and sorghum added with peanut helped to improve the silage fermentative and bromatological characteristics, proving to be an efficient technique for silage quality. The forage peanut silage had lower fermentative characteristics than the corn and sorghum silages. However, the forage peanut silage had a greater CP content, which increased the protein contents of the corn and sorghum silages when intercropped with forage peanuts.
Genomic restructuring in Hordeum chilense durum wheat hybrids ...
Indian Academy of Sciences (India)
ANDREIA DELGADO
4John Innes Centre, Norwich Research Park, Norwich NR4 7UH, UK. 5Departament of Genetics and Biotechnology, University of Tras-os-Montes and Alto ... [Delgado A., Carvalho A., Martín A. C., Martín A. and Lima-Brito J. 2017 Genomic restructuring in F1 Hordeum chilense × durum ...... Academic Press, Burlington,.
Mapping and characterisation of the sorghum cell suspension ...
African Journals Online (AJOL)
Here we reported the first secretomic study of sorghum (Sorghum bicolor), a naturally drought tolerant cereal crop. In this study, we used a gel-based proteomic approach in combination with mass spectrometry to separate and identify proteins secreted into the culture medium of sorghum cell suspensions, a first step ...
PENGARUH INFUS BUAH Foeniculum vulgare Mill PADA SIKLUS ESTRUS DAN BOBOT UTERUS TIKUS PUTIH
Directory of Open Access Journals (Sweden)
Sa'roni Sa'roni
2012-10-01
Full Text Available Buah Foeniculum vulgare Mill (adas secara tradisional untuk obat dan campuran jamu pengatur haid. Diduga buah Foeniculum vulgare Mill mempunyai pengaruh pada sistem reproduksi. Oleh karena itu, kami melakukan penelitian pengaruh infus buah Foeniculum vulgare Mill pada siklus estrus dan bobot uterus tikus putih.Infus diberikan secara oral sekali sehari selama 12 hari dengan dosis setara dengan 7,3 mg, 73 mg dan 219 mg/100 g bobot badan. Selama pemberian bahan, siklus estrus diperiksa setiap hari dan pada hari ke-13 diotopsi dan ditimbang bobot uterusnya.Hasil penelitian menunjukkan bahwa infus buah Foeniculum vulgare Mill setara dengan serbuk 7,3 mg, 73 mg dan 219 mg/100 g bobot badan dapat menghambat fase estrus (masa subur. Infus setara dengan serbuk 7 mg dan 219 mg/100 g bobot badan kelihatan dapat menghambat fase estrus yang sangat nyata dibandingkan dengan akuades. Infus buah Foeniculum vulgare Mill setara dengan serbuk 219 mg/100 g bobot badan dapat menurunkan bobot uterus, tetapi secara statistik tidak berbeda nyata dengan akuades. Kata kunci: Obat tradisional; Foeniculum vulgare Mill; Sistem Reproduksi
Sweet Sorghum Crop. Effect of the Compost Application
International Nuclear Information System (INIS)
Negro, M. J.; Solano, M. L.; Carrasco, J.; Ciria, P.
1998-01-01
A 3 year-plot experiments were performed to determined the possible persistence of the positive effects of treating soil with compost. For this purpose, a sweet sorghum bagasse compost has been used. Experiments were achieved with sweet sorghum (Sorghum bicolor. L. Moench) vr Dale as energy crop. Similar sorghum productivities were obtained both in plots with consecutive compost applications and in plots amended with mineral fertilizers. No residual effect after three years has been detected. It could be due to the low dose of compost application. (Author) 27 refs
Attention is currently focused on developing sustainable supply chains of sugar feedstocks for new, flexible biorefineries. Fundamental processing needs identified by industry for the large-scale manufacture of biofuels and bioproducts from sweet sorghum (Sorghum bicolor L. Moench) include stabiliz...
cultivars and identification of genotype-specific fingerprints using ...
Indian Academy of Sciences (India)
Home; Journals; Journal of Genetics; Volume 89; Online resources. Diversity in Indian barley (Hordeum vulgare) cultivars and identification of genotype-specific fingerprints using microsatellite markers. S. K. Jaiswal Shree P. Pandey S. Sharma R. Prasad L. C. Prasad R. P. S. Verma Arun K. Joshi. Volume 89 Online ...
Zinc biofortification of cereals: rice differs from wheat and barley
Stomph, T.J.; Jiang, W.; Struik, P.C.
2009-01-01
In their review, mainly focused on bread wheat (Triticum aestivum), durum wheat (Triticum durum) and barley (Hordeum vulgare), Palmgren et al. 1 M.G. Palmgren et al., Zinc biofortification of cereals: problems and solutions, Trends Plant Sci. 13 (2008), pp. 464–473. Article | PDF (905 K) | View
DEFF Research Database (Denmark)
Gerhards, R; Christensen, Svend
2003-01-01
with weed infestation levels higher than the economic weed threshold; a review of such work is provided. This paper presents a system for site-specific weed control in sugarbeet (Beta vulgaris L.), maize (Zea mays L.), winter wheat (Triticum aestivum L.) and winter barley (Hordeum vulgare L.), including...
Czech Academy of Sciences Publication Activity Database
Klem, Karel; Rajsnerová, Petra; Novotná, Kateřina; Míša, P.; Křen, J.
2014-01-01
Roč. 60, č. 2 (2014), s. 50-59 ISSN 0551-3677 R&D Projects: GA MZe QI111A133; GA TA ČR TA02010780 Institutional support: RVO:67179843 Keywords : Hordeum vulgare * spectral reflectance * vertical gradient * vegetation indices * nitrogen * grain yield * protein content Subject RIV: GC - Agronomy
Agricultural drought and spring barley yields in the Czech Republic
Czech Academy of Sciences Publication Activity Database
Trnka, M.; Hlavinka, P.; Semerádová, Daniela; Dubrovský, Martin; Žalud, Z.; Možný, M.
2007-01-01
Roč. 53, č. 7 (2007), s. 306-316 ISSN 1214-1178 Institutional research plan: CEZ:AV0Z30420517 Keywords : Hordeum vulgare L * Palmer Z-index * climatic conditions * yield * drought Subject RIV: DG - Athmosphere Sciences, Meteorology http://journals.uzpi.cz:8050/web/_generovani_8050/pse_2007.htm
Variation in shoot tolerance mechanisms not related to ion toxicity in barley
Tilbrook, Joanne
2017-09-27
Soil salinity can severely reduce crop growth and yield. Many studies have investigated salinity tolerance mechanisms in cereals using phenotypes that are relatively easy to measure. The majority of these studies measured the accumulation of shoot Na+ and the effect this has on plant growth. However, plant growth is reduced immediately after exposure to NaCl before Na+ accumulates to toxic concentrations in the shoot. In this study, nondestructive and destructive measurements are used to evaluate the responses of 24 predominately Australian barley (Hordeum vulgare L.) lines at 0, 150 and 250mMNaCl. Considerable variation for shoot tolerance mechanisms not related to ion toxicity (shoot ion-independent tolerance) was found, withsome lines being able to maintain substantial growth rates under salt stress, whereas others stopped growing. Hordeum vulgare spp. spontaneum accessions and barley landraces predominantly had the best shoot ion independent tolerance, although two commercial cultivars, Fathom and Skiff, also had high tolerance. The tolerance of cv. Fathom may be caused by a recent introgression from H. vulgare L. spp. spontaneum. This study shows that the most salt-tolerant barley lines are those that contain both shoot ion-independent tolerance and the ability to exclude Na+ from the shoot (and thus maintain high K+: Na+ ratios).
Variation in shoot tolerance mechanisms not related to ion toxicity in barley
Tilbrook, Joanne; Schilling, Rhiannon K.; Berger, Bettina; Garcia, Alexandre F.; Trittermann, Christine; Coventry, Stewart; Rabie, Huwaida; Brien, Chris; Nguyen, Martin; Tester, Mark A.; Roy, Stuart J.
2017-01-01
Soil salinity can severely reduce crop growth and yield. Many studies have investigated salinity tolerance mechanisms in cereals using phenotypes that are relatively easy to measure. The majority of these studies measured the accumulation of shoot Na+ and the effect this has on plant growth. However, plant growth is reduced immediately after exposure to NaCl before Na+ accumulates to toxic concentrations in the shoot. In this study, nondestructive and destructive measurements are used to evaluate the responses of 24 predominately Australian barley (Hordeum vulgare L.) lines at 0, 150 and 250mMNaCl. Considerable variation for shoot tolerance mechanisms not related to ion toxicity (shoot ion-independent tolerance) was found, withsome lines being able to maintain substantial growth rates under salt stress, whereas others stopped growing. Hordeum vulgare spp. spontaneum accessions and barley landraces predominantly had the best shoot ion independent tolerance, although two commercial cultivars, Fathom and Skiff, also had high tolerance. The tolerance of cv. Fathom may be caused by a recent introgression from H. vulgare L. spp. spontaneum. This study shows that the most salt-tolerant barley lines are those that contain both shoot ion-independent tolerance and the ability to exclude Na+ from the shoot (and thus maintain high K+: Na+ ratios).
Morphological responses of forage sorghums to salinity and ...
African Journals Online (AJOL)
The response of forage sorghum [Sorghum bicolor (L.) Moench] varieties to salinity and irrigation frequency were studied from December 2007 to December 2009. Two forage sorghum varieties (Speedfeed and KFS4) were grown under salinity levels of 0, 5, 10 and 15 dS m-1 and irrigated when the leaf water potential ...
Chromosome aberration assays in barley (Hordeum vulgare)
Energy Technology Data Exchange (ETDEWEB)
Constantin, M J [Univ. of Tennessee, Knoxville; Nilan, R A
1982-01-01
Barley is an exceellent organism for studies of induced chromosome aberrations because of its few (2n = 2x = 14) relatively large chromosomes. Root-tip and shoot-tip cells have been used extensively for the study of ionizing radiation-induced chromosome aberrations. The general procedures are well known, the technology is simple and easy to learn, and the assays are relatively quick and inexpensive. Both root tips and shoot tips can be used for the study of chemical mutagens as well as ionizing radiations. Pollen mother cells are well suited for studying the effects of mutagens on meiotic chromosomes. The literature review for the Gene-Tox Program reported on 61 chemicals tested for their effects on barley chromosomes. Of these, 90% were reported to be either positive or positive dose-related, while 7% were negative and 3% were questionable. Barley assays based on chromosomal aberrations are useful to detect the clastogenic potency of chemicals under laboratory conditions. Indications are that the data from barley can be used to corroborate data obtained from other organisms. Among the classes of chemicals assayed were: alcohols and phenols; alkaloids; epoxides; alkyl sulfates; amides and sulfonamides; aromatic amines; aryl halides; aziridines; alkenes; carbamates; hydroazides; nitroaromatics; nitrosamides; nitrosources; phenothiazines; and polycyclic aromatic hydrocarbons.
Radiosensitivity study of cultured barley (hordeum vulgare)
International Nuclear Information System (INIS)
Wang Cailian; Shen Mei; Xu Gang; Zhao Kongnan; Chen Qiufang
1991-07-01
For studying the radioactivity, forty seven varieties of dormant barley seeds were irradiated with various doses (0 ∼ 400 Gy) of 137 Cs γ-rays. The results showed that the dose-effects relations of seedling growth inhibition could be fitted by an equation of F(D) = 1 - (1 - e -a 1 D ) N , and the dose-effects of cell-nucleus, the frequency of root tip cell with chromosome aberations and peroxidase isoenzyme band could be expressed by a linear regression equation Y = A + B · X. The radioactivity of naked barley was much higher than of covered barley. According to different radiosensitivities the varieties studied could be divided into five types i.e. extreme resistant, resistant, intermediate, sensitive, and extreme sensitive. The results also showed that there was close relationship between the DNA content of cell-nucleus, peroxidase isoenzyme zymogram and radioactivity. The radiosensitivty was proportional to the DNA content. The volume of cell-nucleus varied inversly as D 50 of nucleus volume and no obvious correlation with the D 50 of seedling growth inhibition
(Hordeum Vulgare) Crop Coefficient and Comparative Assessment
African Journals Online (AJOL)
Bheema
The second prerequisite for sustainable use of water was developing/ ... Following the construction of .... pond capacity, the irrigation method, soil type, major crops grown in the area, and the ... determines the viability of any irrigation project. .... lack of awareness, lack of skill, technology and lack of adequate knowledge in ...
Chemical weed control in barley (hordeum vulgare)
International Nuclear Information System (INIS)
Sarwar, M.; Hassan, S.W.; Abid, A.A.
2008-01-01
Effect of two different pre-emergence herbicides i.e. Terbutryn (lgron-500FW) A, 1.01.25 kg a.t. ha/sup -1/ and Flurochloridone (Racer-25 CS) a 0.31, 0.37, 0.44, 0.50 and 0.56 Kg a.i. ha/sup -1/ on weeds and yield of barley wad studied under field conditions hb/sup -1/. All the herbicides significantly reduce the dry weight of weed Maximum reduction (70%) was observed in terbutryn a 1.0 Kg a.i. ha/sup -1/ Growth and yield parameters like number of spike lets per spike. Number of grams per spike. 1000-grain weight. Biological yield. Grain yield straw yield and harvest index showed significant response to various herbicides doses under study. Application of Flurochloridone (Racer-25 (CS) a 0.44 kg a.i. ha/sup -1/ and Terbutryn (lgran-500 FW) a 1.0 kg a.i). The data further revealed that in general all herbicide application treatments exhibited superior performance in respect of growth and yield over control. (author)
The Sorghum bicolor genome and the diversification of grasses
Energy Technology Data Exchange (ETDEWEB)
Paterson, Andrew H.; Bowers, John E.; Bruggmann, Remy; dubchak, Inna; Grimwood, Jane; Gundlach, Heidrun; Haberer, Georg; Hellsten, Uffe; Mitros, Therese; Poliakov, Alexander; Schmutz, Jeremy; Spannagl, Manuel; Tang, Haibo; Wang, Xiyin; Wicker, Thomas; Bharti, Arvind K.; Chapman, Jarrod; Feltus, F. Alex; Gowik, Udo; Grigoriev, Igor V.; Lyons, Eric; Maher, Christopher A.; Martis, Mihaela; Marechania, Apurva; Otillar, Robert P.; Penning, Bryan W.; Salamov, Asaf. A.; Wang, Yu; Zhang, Lifang; Carpita, Nicholas C.; Freeling, Michael; Gingle, Alan R.; hash, C. Thomas; Keller, Beat; Klein, Patricia; Kresovich, Stephen; McCann, Maureen C.; Ming, Ray; Peterson, Daniel G.; ur-Rahman, Mehboob-; Ware, Doreen; Westhoff, Peter; Mayer, Klaus F. X.; Messing, Joachim; Rokhsar, Daniel S.
2008-08-20
Sorghum, an African grass related to sugar cane and maize, is grown for food, feed, fibre and fuel. We present an initial analysis of the approx730-megabase Sorghum bicolor (L.) Moench genome, placing approx98percent of genes in their chromosomal context using whole-genome shotgun sequence validated by genetic, physical and syntenic information. Genetic recombination is largely confined to about one-third of the sorghum genome with gene order and density similar to those of rice. Retrotransposon accumulation in recombinationally recalcitrant heterochromatin explains the approx75percent larger genome size of sorghum compared with rice. Although gene and repetitive DNA distributions have been preserved since palaeopolyploidization approx70 million years ago, most duplicated gene sets lost one member before the sorghum rice divergence. Concerted evolution makes one duplicated chromosomal segment appear to be only a few million years old. About 24percent of genes are grass-specific and 7percent are sorghum-specific. Recent gene and microRNA duplications may contribute to sorghum's drought tolerance.
Giemsa C-banded karyotypes of Hordeum taxa from North America
DEFF Research Database (Denmark)
Linde-Laursen, Ib; Bothmer, R. von; Jacobsen, N.
1986-01-01
submetacentrics than previously reported in Hordeum distinguished the genomes of H. arizonicum and H. brachyantherum (4x) from Newfoundland. A partial inactivation of the nucleolus organizers of one parental genome in interspecific hybrids is considered more common than generally appreciated....
Agronomic and morphological performance of sorghum (sorghum ...
African Journals Online (AJOL)
SARAH
2013-03-30
Mar 30, 2013 ... occasional frost limits growth and seed set of un- adapted cultivars (Arkel, 1979) making seed multiplication of un-adapted varieties unsuccessful. Previous studies have shown that sorghum cultivars adapted to high altitude, low rainfall areas. Journal of Applied Biosciences 63: 4720 – 4726. ISSN 1997– ...
Assessment of Genetic Variability in Sorghum Accessions (Sorghum ...
African Journals Online (AJOL)
ADOWIE PERE
The polymorphic information content (PIC) of individual primer ranged from 0.34 to 0.70 with a mean value of 0.54 indicating enough ... Keywords: Sorghum; Simple Sequence Repeat markers; Genetic variation; Polymorphic Information Content;. Coefficient of ... based techniques include Restriction Fragment Length.
Productivity and Competitiveness of Sorghum Production in ...
African Journals Online (AJOL)
showed that sorghum production in the study areas yielded profitable returns ... Keywords: Sorghum, Profitability, Competitiveness, Investment Potential, .... Guinness Ghana Brewery Limited to estimate cost and returns at the marketing sector ...
A sorghum (Sorghum bicolor mutant with altered carbon isotope ratio.
Directory of Open Access Journals (Sweden)
Govinda Rizal
Full Text Available Recent efforts to engineer C4 photosynthetic traits into C3 plants such as rice demand an understanding of the genetic elements that enable C4 plants to outperform C3 plants. As a part of the C4 Rice Consortium's efforts to identify genes needed to support C4 photosynthesis, EMS mutagenized sorghum populations were generated and screened to identify genes that cause a loss of C4 function. Stable carbon isotope ratio (δ13C of leaf dry matter has been used to distinguishspecies with C3 and C4 photosynthetic pathways. Here, we report the identification of a sorghum (Sorghum bicolor mutant with a low δ13C characteristic. A mutant (named Mut33 with a pale phenotype and stunted growth was identified from an EMS treated sorghum M2 population. The stable carbon isotope analysis of the mutants showed a decrease of 13C uptake capacity. The noise of random mutation was reduced by crossing the mutant and its wildtype (WT. The back-cross (BC1F1 progenies were like the WT parent in terms of 13C values and plant phenotypes. All the BC1F2 plants with low δ13C died before they produced their 6th leaf. Gas exchange measurements of the low δ13C sorghum mutants showed a higher CO2 compensation point (25.24 μmol CO2.mol-1air and the maximum rate of photosynthesis was less than 5μmol.m-2.s-1. To identify the genetic determinant of this trait, four DNA pools were isolated; two each from normal and low δ13C BC1F2 mutant plants. These were sequenced using an Illumina platform. Comparison of allele frequency of the single nucleotide polymorphisms (SNPs between the pools with contrasting phenotype showed that a locus in Chromosome 10 between 57,941,104 and 59,985,708 bps had an allele frequency of 1. There were 211 mutations and 37 genes in the locus, out of which mutations in 9 genes showed non-synonymous changes. This finding is expected to contribute to future research on the identification of the causal factor differentiating C4 from C3 species that can be used
Directory of Open Access Journals (Sweden)
Dongfa Sun
Full Text Available Numerous hybrid and polypoid species are found within the Triticeae. It has been suggested that the H subgenome of allopolyploid Elymus (wheatgrass species originated from diploid Hordeum (barley species, but the role of hybridization between polyploid Elymus and Hordeum has not been studied. It is not clear whether gene flow across polyploid Hordeum and Elymus species has occurred following polyploid speciation. Answering these questions will provide new insights into the formation of these polyploid species, and the potential role of gene flow among polyploid species during polyploid evolution. In order to address these questions, disrupted meiotic cDNA1 (DMC1 data from the allopolyploid StH Elymus are analyzed together with diploid and polyploid Hordeum species. Phylogenetic analysis revealed that the H copies of DMC1 sequence in some Elymus are very close to the H copies of DMC1 sequence in some polyploid Hordeum species, indicating either that the H genome in theses Elymus and polyploid Hordeum species originated from same diploid donor or that gene flow has occurred among them. Our analysis also suggested that the H genomes in Elymus species originated from limited gene pool, while H genomes in Hordeum polyploids have originated from broad gene pools. Nucleotide diversity (π of the DMC1 sequences on H genome from polyploid species (π = 0.02083 in Elymus, π = 0.01680 in polyploid Hordeum is higher than that in diploid Hordeum (π = 0.01488. The estimates of Tajima's D were significantly departure from the equilibrium neutral model at this locus in diploid Hordeum species (P<0.05, suggesting an excess of rare variants in diploid species which may not contribute to the origination of polyploids. Nucleotide diversity (π of the DMC1 sequences in Elymus polyploid species (π = 0.02083 is higher than that in polyploid Hordeum (π = 0.01680, suggesting that the degree of relationships between two parents of a polyploid might be a factor
The productive potentials of sweet sorghum ethanol in China
International Nuclear Information System (INIS)
Zhang, Caixia; Xie, Gaodi; Li, Shimei; Ge, Liqiang; He, Tingting
2010-01-01
As one of the important non-grain energy crops, sweet sorghum has attracted the attention of scientific community and decision makers of the world since decades. But insufficient study has been done about the spatial suitability distribution and ethanol potential of sweet sorghum in China. This paper attempts to probe into the spatial distribution and ethanol potential of sweet sorghum in China by ArcGIS methods. Data used for the analysis include the spatial data of climate, soil, topography and land use, and literatures relevant for sweet sorghum studies. The results show that although sweet sorghum can be planted in the majority of lands in China, the suitable unused lands for large-scale planting (unit area not less than 100 hm 2 ) are only as much as 78.6 x 10 4 hm 2 ; and the productive potentials of ethanol from these lands are 157.1 x 10 4 -294.6 x 10 4 t/year, which can only meet 24.8-46.4% of current demand for E10 (gasoline mixed with 10% ethanol) in China (assumption of the energy efficiency of E10 is equivalent to that of pure petroleum). If all the common grain sorghum at present were replaced by sweet sorghum, the average ethanol yield of 244.0 x 10 4 t/year can be added, and thus the productive potentials of sweet sorghum ethanol can satisfy 63.2-84.9% of current demand for E10 of China. In general, Heilongjiang, Jilin, Inner Mongolia and Liaoning rank the highest in productive potentials of sweet sorghum ethanol, followed by Hebei, Shanxi, Sichuan, and some other provinces. It is suggested that these regions should be regarded as the priority development zones for sweet sorghum ethanol in China.
Genetic diversity in sorghum transpiration efficiency
Sorghum is the fifth most important grain crop and is becoming increasingly important as a biofuel feedstock due to its superior tolerance to water deficit stress. Sorghum is commonly grown under rain-fed conditions in the Southern Plains and other semi-arid regions in the world. Thus, its product...
Responses of growth and primary metabolism of water-stressed barley roots to rehydration
Barley seedlings [Hordeum vulgare L. Brant] were grown in pots in controlled environment chambers and drought treatments were imposed 11 days after sowing. Soil water content decreased from 92% to 10% after an additional 14 days of water stress. Shoot and root growth ceased after 4 and 9 days of wat...
Francia-Martinez, J.R.; Duran Zuazo, V.H.; Martinez-Raya, A.
2006-01-01
Soil erosion, runoff and nutrient-loss patterns over a two-year period (1999¿2000) were monitored in erosion plots on a mountainside with olive (Olea europaea cv. Picual) trees under three different types of soil management: (1) non-tillage with barley (Hordeum vulgare) strips of 4 m width (BS); (2)
Biochemistry, Structure and Function of Non-Wheat Proteins: Case Study of Barley ß-Amylase
The importance of a protein is not always evident and may be due to its multifunctional nature. ß-Amylase in seeds of barley (Hordeum vulgare L.) constitutes approximately 2% of the total protein in mature seeds and is assumed to be important when storage proteins are mobilized to support protein s...
DEFF Research Database (Denmark)
Kaczmarczyk, Agnieszka Ewa
Barley (Hordeum vulgare L.) is cultivated in a range of diverse environments and is widely utilised as feed for animal and as malt in brewing. Nitrogen (N) is a key macronutrient whch directly increases plant growth and is used as a fertiliser to meet the demands for higher yield. However...
Starch and Free Sugars during Kernel Development of Bomi Barley and its High-Lysine Mutant 1508
DEFF Research Database (Denmark)
Kreis, Michael
1978-01-01
At maturity the high-lysine barley (Hordeum vulgare L.) Ris0 mutants 1508, 527 and 29 kernels contained about 20% less starch and twice as much free sugars as the parent varieties Bomi and Carlsberg II. An enhanched effect on starch reduction and free sugar accumulation was observed during kernel...
DEFF Research Database (Denmark)
Hansen, Elly Møller; Munkholm, Lars Juhl; Olesen, Jørgen E
2015-01-01
retention did not significantly increase yields, nor did it reduce leaching, while fodder radish (Raphanus sativus L.) as a catch crop was capable of reducing nitrate leaching to a low level. Thus, YSL of winter wheat (Triticum aestivum L.) was higher than for spring barley (Hordeum vulgare L.) grown after...
Directory of Open Access Journals (Sweden)
C.F. Azevedo
2012-01-01
Full Text Available A erva-doce, Foeniculum vulgare Mill. (Apiaceae, é uma erva entouceirada, aromática que apresenta propriedades condimentares e medicinais; tem origem Européia e é amplamente cultivada em todo o Brasil. Devido à deficiência de informações relativas à organização estrutural de plântulas de espécies medicinais, o presente estudo teve como objetivo fornecer informações sobre a anatomia e o desenvolvimento de plântulas de F. vulgare. As sementes de erva-doce foram semeadas em areia e mantidas em casa de vegetação por 25 dias, sendo realizadas regas diárias. Foram selecionadas plântulas normais e de padrão uniforme, que tiveram raiz, zona de transição, caule, cotilédones e primeiras folhas seccionados à mão livre. Este material foi corado e montado em lâminas com glicerina para observação em microscópio. Em todos os órgãos da plântula de erva-doce a epiderme é unisseriada, cuticularizada e com estômatos; sendo que as duas últimas estruturas não são encontradas na raiz, porém esta apresenta pêlos unicelulares e cônicos. Os cotilédones e as folhas apresentam funções fotossintéticas e nutricionais, indicadas pela presença de grande quantidade de estômatos, cloroplastos e amido. A caracterização anatômica de plântulas de F. vulgare auxilia na identificação da espécie e no conhecimento da organização celular, fornecendo informações que auxiliam em estudos fisiológicos, taxonômicos e ecológicos.Fennel, Foeniculum vulgare Mill. (Apiaceae, is a forming clumps herb and presents aromatic, medicinal and condimental properties. It has European origin and is widely cultivated and used in Brazil. Due to lack of information concerning the structural organization of seedlings of medicinal species, this study aimed to provide information about the anatomy and development of F. vulgare seedlings. The seeds fennel was sowed in sand and maintained in greenhouse for 25 days, with daily waterings. Were selected
International Nuclear Information System (INIS)
Bedry, K. A. M.; Elamin, A. E. M.
2011-01-01
An experiment was conducted at Merowe Research Station farm, in the Northern State, Sudan, during 2008/2009 and 2009/2010 seasons. The objectives of the experiment were to determine the damage inflicted by a wild sorghum species (Sorghum arundinaceum (Del.) Stapf. ) on the yield of faba bean (Vicia faba L.) and to evaluate the efficacy of the post-emergence herbicide clodinafop-propargyl (Topik) on wild sorghum and its effect on faba bean yield. The wild sorghum reduced faba bean crop stand and straw and seed yields by 53% - 76%, 76% - 79% and 88% - 91%, respectively, compared with the hand-weeded control. Faba bean was tolerant to the herbicide. The herbicide, at all rates, effected complete (100%) and persistent control of the wild sorghum and resulted in faba bean seed yield comparable to the hand-weeded control. The lowest dose (0.075 kg a.i/ha) of the herbicide used was equal to 75% of the dose recommended for the control of wild sorghum in wheat. It is concluded that clodinafop-propargyl at 0.075 kg a.e/ha could be used in controlling wild sorghum in faba bean. At this rate, the marginal rate of return was about 35 which indicating that every monetary unit (SDG 1) invested in the mentioned treatment would be returned back, plus additional amount of 35 SDG.(Author)
Chemical Composition of Essential Oil from Marrubium Vulgare L. Leaves
Bayir, Burcu; Gündüz, Hatice; Usta, Tuba; Şahin, Esma; Özdemir, Zeynep; Kayır, Ömer; Sen, Özkan; Akşit, Hüseyin; Elmastaş, Mahfuz; Erenler, Ramazan
2014-01-01
– The essential oils are significant for pharmaceutical, food and cosmetic industries. Marrubium vulgare L. has been used as a traditional medicine to treat the various illnesses. The chemical composition of the essential oil from leaves of Marrubium vulgare L.was obtained by steam distillation using the Clevenger apparatus. The oil was analyzed by gas chromatography and mass spectrometry (GC-MS). The main constituent of the oil was α-pinene (28.85%)
Efficacy of Essential Oils of Thymus vulgaris and Origanum vulgare on Echinococcus granulosus
Directory of Open Access Journals (Sweden)
P. E. Pensel
2014-01-01
Full Text Available The aim of the present work was to determine the in vitro effect of T. vulgaris and O. vulgare essential oils against E. granulosus protoscoleces and cysts. Essential oils were added to the medium resulting in thymol final concentrations of 10 μg/mL. The essential oils had a time-dependent effect provoking the complete loss of protoscolex viability after 72 days of postincubation. The results were confirmed at the ultrastructure level. Loss of infectivity in protoscoleces incubated with O. vulgare after 60 days was observed. On the other hand, the weight of cysts recorded in mice inoculated with T. vulgaris treated protoscoleces was significantly lower than that obtained in control group. Gamma-glutamyl-transpeptidase activity was readily detected in the culture supernatant of protoscoleces treated either with the essential oils or thymol. T. vulgaris and O. vulgare essential oils and thymol can induce cell apoptosis of protoscoleces after short incubation times. The efficacy of T. vulgaris and O. vulgare essential oils was also demonstrated in vitro on E. granulosus murine cysts. Our data suggest that essential oils of T. vulgaris and O. vulgare have anthelmintic effect against protoscoleces and cysts of E. granulosus.
Directory of Open Access Journals (Sweden)
Mohammed eRiyazaddin
2016-04-01
Full Text Available Host plant resistance is one of the major components to control sorghum shoot fly, Atherigona soccata. To understand the nature of gene action for inheritance of shoot fly resistance, we evaluated 10 parents, 45 F1’s and their reciprocals in replicated trials during the rainy and postrainy seasons. Genotypes ICSV 700, Phule Anuradha, ICSV 25019, PS 35805, IS 2123, IS 2146 and IS 18551 exhibited resistance to shoot fly damage across seasons. Crosses between susceptible parents were preferred for egg laying by the shoot fly females, resulting in a susceptible reaction. ICSV 700, ICSV 25019, PS 35805, IS 2123, IS 2146 and IS 18551 exhibited significant and negative general combining ability (gca effects for oviposition, deadheart incidence, and overall resistance score. The plant morphological traits associated with expression of resistance/ susceptibility to shoot fly damage such as leaf glossiness, plant vigor, and leafsheath pigmentation also showed significant gca effects by these genotypes, suggesting the potential for use as a selection criterion to breed for resistance to shoot fly, A. soccata. ICSV 700, Phule Anuradha, IS 2146 and IS 18551 with significant positive gca effects for trichome density can also be utilised in improving sorghums for shoot fly resistance. The parents involved in hybrids with negative specific combining ability (sca effects for shoot fly resistance traits can be used in developing sorghum hybrids with adaptation to postrainy season. The significant reciprocal effects of combining abilities for oviposition, leaf glossy score and trichome density suggested the influence of cytoplasmic factors in inheritance of shoot fly resistance. Higher values of variance due to sca (σ2s, dominance variance (σ2d, and lower predictability ratios than the variance due to gca (σ2g and additive variance (σ2a for shoot fly resistance traits indicated the predominance of dominance type of gene action, whereas trichome density, leaf
7339 BASELINE SURVEY ON FACTORS AFFECTING SORGHUM ...
African Journals Online (AJOL)
muuicathy
2013-01-01
Jan 1, 2013 ... factors affecting sorghum production and the sorghum farming ... The informal seed system includes methods such as retaining seed on-farm from ..... Jaetzold R and H Schmidt Farm Management Handbook of Kenya, Ministry.
Directory of Open Access Journals (Sweden)
Dilek Lemlioglu-Austin
2012-09-01
Full Text Available Bran extracts (70% aqueous acetone of specialty sorghum varieties (tannin, black, and black with tannin were used to investigate the effects of sorghum phenolic compounds on starch digestibility, Estimated Glycemic Index (EGI, and Resistant Starch (RS of porridges made with normal corn starch, enzyme resistant high amylose corn starch, and ground whole sorghum flours. Porridges were cooked with bran extracts in a Rapid Visco-analyser (RVA. The cooking trials indicated that bran extracts of phenolic-rich sorghum varieties significantly reduced EGI, and increased RS contents of porridges. Thus, there could be potential health benefits associated with the incorporation of phenolic-rich sorghum bran extracts into foods to slow starch digestion and increase RS content.
DEFF Research Database (Denmark)
Zerbe, Philipp; Chiang, Angela; Dullat, Harpreet
2014-01-01
Marrubium vulgare (Lamiaceae) is a medicinal plant whose major bioactive compounds, marrubiin and other labdane-related furanoid diterpenoids, have potential applications as anti-diabetics, analgesics or vasorelaxants. Metabolite and transcriptome profiling of M. vulgare leaves identified five...... different candidate diterpene synthases (diTPSs) of the TPS-c and TPS-e/f clades. We describe the in vitro and in vivo functional characterization of the M. vulgare diTPS family. In addition to MvEKS ent-kaurene synthase of general metabolism, we identified three diTPSs of specialized metabolism: MvCPS3...
Genetic architecture of kernel composition in global sorghum germplasm
Sorghum [Sorghum bicolor (L.) Moench] is an important cereal crop for dryland areas in the United States and for small-holder farmers in Africa. Natural variation of sorghum grain composition (protein, fat, and starch) between accessions can be used for crop improvement, but the genetic controls are...
De novo transcriptome assembly of Sorghum bicolor variety Taejin
Directory of Open Access Journals (Sweden)
Yeonhwa Jo
2016-06-01
Full Text Available Sorghum (Sorghum bicolor, also known as great millet, is one of the most popular cultivated grass species in the world. Sorghum is frequently consumed as food for humans and animals as well as used for ethanol production. In this study, we conducted de novo transcriptome assembly for sorghum variety Taejin by next-generation sequencing, obtaining 8.748 GB of raw data. The raw data in this study can be available in NCBI SRA database with accession number of SRX1715644. Using the Trinity program, we identified 222,161 transcripts from sorghum variety Taejin. We further predicted coding regions within the assembled transcripts by the TransDecoder program, resulting in a total of 148,531 proteins. We carried out BLASTP against the Swiss-Prot protein sequence database to annotate the functions of the identified proteins. To our knowledge, this is the first transcriptome data for a sorghum variety derived from Korea, and it can be usefully applied to the generation of genetic markers.
Energy Technology Data Exchange (ETDEWEB)
Shakoor, N; Nair, R; Crasta, O; Morris, G; Feltus, A; Kresovich, S
2014-01-23
Background: Effective improvement in sorghum crop development necessitates a genomics-based approach to identify functional genes and QTLs. Sequenced in 2009, a comprehensive annotation of the sorghum genome and the development of functional genomics resources is key to enable the discovery and deployment of regulatory and metabolic genes and gene networks for crop improvement. Results: This study utilizes the first commercially available whole-transcriptome sorghum microarray (Sorgh-WTa520972F) to identify tissue and genotype-specific expression patterns for all identified Sorghum bicolor exons and UTRs. The genechip contains 1,026,373 probes covering 149,182 exons (27,577 genes) across the Sorghum bicolor nuclear, chloroplast, and mitochondrial genomes. Specific probesets were also included for putative non-coding RNAs that may play a role in gene regulation (e. g., microRNAs), and confirmed functional small RNAs in related species (maize and sugarcane) were also included in our array design. We generated expression data for 78 samples with a combination of four different tissue types (shoot, root, leaf and stem), two dissected stem tissues (pith and rind) and six diverse genotypes, which included 6 public sorghum lines (R159, Atlas, Fremont, PI152611, AR2400 and PI455230) representing grain, sweet, forage, and high biomass ideotypes. Conclusions: Here we present a summary of the microarray dataset, including analysis of tissue-specific gene expression profiles and associated expression profiles of relevant metabolic pathways. With an aim to enable identification and functional characterization of genes in sorghum, this expression atlas presents a new and valuable resource to the research community.
Biological and water-use efficiencies of sorghum-groundnut intercrop
African Journals Online (AJOL)
In order to compare water-use efficiency of sole crops and intercrops, 2 experiments were conducted in 2 consecutive years with sorghum (Sorghum bicolor L. Moench) and groundnut (Arachis hypogaea L.) on a loamy, Grossarenic Paleudult. In a randomized block, split-plot design, sorghum (SS), groundnut (GG), ...
Directory of Open Access Journals (Sweden)
Amelinda Angelina
2013-09-01
Full Text Available Sorghum, Sorghum bicolor (L Moench, adalah sereal paling penting kelima setelah beras, jagung, barley dan gandum. Hasil penelitian menunjukkan bahwa kemampuan substitusi biji sorghum terhadap tepung terigu bisa mencapai 50-75%, walaupun nilai protein pembentuk glutennya tidak dapat menyamai tepung terigu. Tujuan dari penelitian ini adalah mempelajari pengaruh waktu fermentasi terhadap penurunan total asam laktat, nilai pH, dan jumlah total khamir (baker’s yeast tanpa menggunakan nutrient kimia tambahan . Analisa komposisi biji sorghum yang diinvestigasi dalam keadaan wet basis dari laboratorium menghasilkan kadar air, lemak, serat, protein, karbohidrat, dan abu masing-masing sebesar 12.85%, 3.10%, 0.56%, 5.87%, 75.82%, dan 1.79%. Untuk nilai energi total dengan metode bomb kalori didapatkan 4375.94 kcal/kg. Pengujian biji sorghum menghasilkan C-organik sebesar 12,47%. Berdasarkan analisa didapatkan hasil optimal dalam membuat tepung sorghum terfermentasi pada proses fermentasi 60 jam dengan jumlah yeast yang dihasilkan 1,7 x 105 sel/ml dengan kondisi yield % asam laktat 0,214%.
Directory of Open Access Journals (Sweden)
M. Vazirian
2015-12-01
Full Text Available Background and Objectives: Essential oils are very complex mixture of components and their composition may vary in different species or varieties or even within the same variety. Origanum vulgare L. subsp. vulgare is one of the most distributed subspecies within the genus Origanum and has been found to be a poor-oil, categorized in cymyl, bornane or sabinyl chemotypes with higher proportion of sesquiterpenes. In this experiment, the Iranian sample was studied for the chemical composition of the oil and evaluation of its antioxidant activity. Methods: Essential oil was obtained by hydro-distillation and analyzed by GC/MS for determination of components. Antioxidant activity was evaluated by radical scavenging ability (DPPH method and reducing power (FRAP assay. Results: The sample belonged to “thymol” chemotype with the main components as thymol (37.13%, gama-terpinene (9.67%, carvacrol (9.57%, carvacrol methyl ether (6.88, cis-alpha-bisabolene (6.80%, eucalyptol (3.82%, p-cymene (3.58% and elemol (2.04%. The oil of plant showed very strong antioxidant activity (IC50=2.5 µg/mL in DPPH method, which was stronger than the standard antioxidants (Vit E and BHA, p
Optimization of extraction of polyphenols from Sorghum Moench ...
African Journals Online (AJOL)
phenolic acid were assayed using high performance liquid (HPLC). ... quantification of antioxidants and phenolic compounds from Sorghum M, ... Keywords: Response surface methodology, Sorghum moench, Polyphenols, Antioxidants.
Peculiarities in covering the requirements for seed material of sorghum crops
Directory of Open Access Journals (Sweden)
С. І. Мельник
2017-12-01
Full Text Available Purpose. To assess the demand for sorghum seed material and sufficiency of domestic seeds. Results. The analysis of the State register for the period of 2002–2012 showed that there was the tendency not only towards increasing quantity of sorghum crops in general but their substitution by hybrids of foreign breeding. During the period from 2002 to 2017, 72 sorghum varieties were entered on the State register in total, among them only 12 varieties were of domestic breeding, the rest 60 was presented by foreign breeding institutions. Investigation results allowed to determine that the production of base and prebase seeds of sorghum in 2010 amounted to 1,3 t, in 2016 was 43 t. During the same period the production of sugar sorghum increased from 0,2 to 12,0 t, grass sorghum – from 4,0 to 83 t. In 2017, requirements of acreage of such crops as grass sorghum and broomcorn were completely satisfied by the amount of grown seeds. At the same time, the need for seeds of sorghum and sugar sorghum can not be covered completely at the expense of domestic varieties reproduction. In 2017, general demand for sorghum seeds was 400,5 t, among which only 42,0 t was of domestic production. The rest demand for seeds will be met at the expense of import of foreign breeding seeds into the country to be grown and prepared for sowing abroad. Conclusions. In the Register of plant varieties suitable for dissemination in Ukraine, there are 72 sorghum varieties among them only 12 varieties were of domestic breeding, that is 17%, as compared to 83% of recommended great sorghum varieties of foreign breeding. In Ukraine, the area occupied by sorghum cultivation was 22,8 thou ha in 2005, up to 2017 it increased to 89,0 thou ha, and accordingly the demand for seeds run up from 102,6 to 400,5 t. The area occupied by the sugar sorghum in 2005 amounted to only 2,6 thou ha, in 2017 – 20,0 thou ha, that accordingly determined increase of demand for seed material from 13,0 to 99
Coté, Héloïse; Boucher, Marie-Anne; Pichette, André; Legault, Jean
2017-05-25
Background: Tanacetum vulgare L. (Asteraceae) is a perennial herb that has been used to treat multiple ailments. Regional variability of the chemical composition of T. vulgare essential oils is well-known. Despite these regional chemotypes, most relevant studies did not analyze the complete chemical composition of the T. vulgare essential oil and its constituents in relation to their biological activities. Here, we assess the anti-inflammatory, antioxidant, antibacterial, and cytotoxic activities of T. vulgare collected from northern Quebec (Saguenay-Lac-St-Jean), Canada. Methods: Essential oil was extracted from plants by steam distillation and analyzed using GC-FID. Biological activities of essential oil and its main constituents were evaluated in vitro. Results: We identified the major compounds as camphor, borneol, and 1,8-cineole. The oil possesses anti-inflammatory activity inhibiting NO production. It also inhibits intracellular DCFH oxidation induced by tert-butylhydroperoxide. Anti-inflammatory activity of essential oil appears driven mainly by α-humulene while antioxidant activity is provided by α-pinene and caryophyllene oxide. Essential oil from T vulgare was active against both Escherichia coli and Staphylococcus aureus with camphor and caryophyllene oxide responsible for antibacterial activity. Finally, T. vulgare essential oil was slightly cytotoxic against the human healthy cell line WS1 while α-humulene and caryophyllene oxide were moderately cytotoxic against A-549, DLD-1, and WS1. Conclusion: We report, for the first time, links between the specific compounds found in T. vulgare essential oil and anti-inflammatory, antioxidant, antibacterial, and cytotoxic activities. T. vulgare essential oil possesses interesting biological properties.
Directory of Open Access Journals (Sweden)
Héloïse Coté
2017-05-01
Full Text Available Background: Tanacetum vulgare L. (Asteraceae is a perennial herb that has been used to treat multiple ailments. Regional variability of the chemical composition of T. vulgare essential oils is well-known. Despite these regional chemotypes, most relevant studies did not analyze the complete chemical composition of the T. vulgare essential oil and its constituents in relation to their biological activities. Here, we assess the anti-inflammatory, antioxidant, antibacterial, and cytotoxic activities of T. vulgare collected from northern Quebec (Saguenay-Lac-St-Jean, Canada. Methods: Essential oil was extracted from plants by steam distillation and analyzed using GC-FID. Biological activities of essential oil and its main constituents were evaluated in vitro. Results: We identified the major compounds as camphor, borneol, and 1,8-cineole. The oil possesses anti-inflammatory activity inhibiting NO production. It also inhibits intracellular DCFH oxidation induced by tert-butylhydroperoxide. Anti-inflammatory activity of essential oil appears driven mainly by α-humulene while antioxidant activity is provided by α-pinene and caryophyllene oxide. Essential oil from T vulgare was active against both Escherichia coli and Staphylococcus aureus with camphor and caryophyllene oxide responsible for antibacterial activity. Finally, T. vulgare essential oil was slightly cytotoxic against the human healthy cell line WS1 while α-humulene and caryophyllene oxide were moderately cytotoxic against A-549, DLD-1, and WS1. Conclusion: We report, for the first time, links between the specific compounds found in T. vulgare essential oil and anti-inflammatory, antioxidant, antibacterial, and cytotoxic activities. T. vulgare essential oil possesses interesting biological properties.
Enhanced ethanol production from stalk juice of sweet sorghum by ...
African Journals Online (AJOL)
user
2012-03-15
Mar 15, 2012 ... Sweet sorghum (sugar sorghum, Sorghum bicolor) is one kind of non-grain energy ... government that only ''non-grain” materials can be used ... In this work, ... inoculated (10%, v/v) into fermentation medium prepared with the.
Effect of Fungicide Applications on Grain Sorghum (Sorghum bicolor L. Growth and Yield
Directory of Open Access Journals (Sweden)
Dan D. Fromme
2017-01-01
Full Text Available Field studies were conducted in the upper Texas Gulf Coast and in central Louisiana during the 2013 through 2015 growing seasons to evaluate the effects of fungicides on grain sorghum growth and development when disease pressure was low or nonexistent. Azoxystrobin and flutriafol at 1.0 L/ha and pyraclostrobin at 0.78 L/ha were applied to the plants of two grain sorghum hybrids (DKS 54-00, DKS 53-67 at 25% bloom and compared with the nontreated check for leaf chlorophyll content, leaf temperature, and plant lodging during the growing season as well as grain mold, test weight, yield, and nitrogen and protein content of the harvested grain. The application of a fungicide had no effect on any of the variables tested with grain sorghum hybrid responses noted. DKS 53-67 produced higher yield, greater test weight, higher percent protein, and N than DKS 54-00. Results of this study indicate that the application of a fungicide when little or no disease is present does not promote overall plant health or increase yield.
Next-generation sequencing technology for genetics and genomics of sorghum
DEFF Research Database (Denmark)
Luo, Hong; Mocoeur, Anne Raymonde Joelle; Jing, Hai-Chun
2014-01-01
and grain sorghum. NGS has also been used to examine the transcriptomes of sorghum under various stress conditions. Besides identifying interesting transcriptonal adpatation to stress conditions, these study show that sugar could potentially act as an osmitic adjusting factor via transcriptional regulation....... Furthermore, miRNAs are found to be important adaptation to both biotic and abiotic stresses in sorghum. We discuss the use of NGS for further genetic improvement and breeding in sorghum....
AFLP genetic polymorphism in wild barley (Hordeum spontaneum) populations in Israel
Turpeinen, T.; Vanhala, T.; Nevo, E.; Nissila, E.
2003-01-01
The genetic diversity produced by the amplified fragment length polymorphism (AFLP) method was studied in 94 genotypes of wild barley, Hordeum spontaneum (C. Koch) Thell., originating from ten ecologically and geographically different locations in Israel. Eight primer pairs produced 204 discernible
Origanum vulgare (Lamiaceae OVICIDAL POTENTIAL ON GASTROINTESTINAL NEMATODES OF CATTLE
Directory of Open Access Journals (Sweden)
Luciana Laitano Dias de Castro
2013-12-01
Full Text Available Due to anthelmintic resistance in nematodes, several research studies have been developed seeking control alternatives to these parasites. This study evaluated the in vitro action of Origanum vulgare on gastrointestinal nematode eggs of cattle. In order to evaluate the ability to inhibit egg hatch, different dried leaves extracts of this plant were tested, such as dye, hydroalcoholic and aqueous extracts at concentrations varying from 0.62 to 80 mg/mL. Each assay was accompanied by control containing levamisole hydrochloride (0.2 mg/mL, distilled water and 70 ºGL grain alcohol at the same concentration of the extracts. Test results showed that the different O. vulgare extracts inhibited egg hatch of cattle gastrointestinal nematodes at a percentage that varied from 8.8 to 100%; dye and hydroalcoholic extract were the most promising inhibitors. In view of this ovicidal property, O. vulgare may be an important source of viable antiparasitic compounds for nematodiosis control in ruminants.
Directory of Open Access Journals (Sweden)
A.C. Rodrigues
2012-01-01
Full Text Available O objetivo do presente trabalho foi à verificação do efeito alelopático de Hyptis. suaveolens na germinação de sorgo, alface e rabanete, bem como, a comprovação da existência de compostos com potencial alelopático. Sementes de sorgo, alface e rabanete foram semeadas em substrato constituído de areia, terra e adubo orgânico contendo folhas de H. suaveolens. As análises da germinação foram feitas considerando a protrusão da radícula para o término do evento germinativo. Foi calculado o IVG (índice de velocidade de germinação e %G (porcentagem de germinação. Os resultados mostraram que sorgo e a alface foram mais susceptíveis ao potencial alelopático de H. suaveolens, sendo que para o rabanete foi observado um efeito benéfico. Entre os tratamentos, o substrato esterilizado e não esterilizado mostraram diferenças entre si. A análise cromatográfica do óleo essencial presente nas folhas de H. suaveolens revelou a presença de compostos com potencial alelopático. Portanto, H. suaveolens, pode apresentar efeito alelopático positivo no IVG de sementes de rabanete e a presença de microorganismos pode ser necessária para que esse efeito alelopático aconteça.The aim of this study was to verify the allelopathic effect of H. suaveolens on the germination of sorghum, lettuce and radish, as well as to prove the existence of compounds with allelopathic potential. Seeds of sorghum, lettuce and radish were sown in substrate consisting of sand, soil and organic fertilizer containing leaves of H. suaveolens. The germination tests were performed considering the protrusion of the radicle for the conclusion of the germinative event. GSI (germination speed index and G% (percentage of germination were calculated. The results showed that sorghum and lettuce were more susceptible to the allelopathic potential of H. suaveolens, while for radishes a beneficial effect was observed. Between treatments, the sterilized and unsterilized
Nutrient and carbohydrate partitioning in sorghum stover
International Nuclear Information System (INIS)
Powell, J.M.; Hons, F.M.; McBee, G.G.
1991-01-01
Sorghum [Sorghum bicolor (L.) Moench] stover has been demonstrated to be a potential biomass energy source. Complete aboveground crop removal, however, can result in soil degradation. Differential dry matter, nutrient, and carbohydrate partitioning by sorghum cultivars may allow management strategies that return certain parts to the field while removing other portions for alternative uses, such as energy production. A field study was conducted to determine N,P,K, nonstructural carbohydrate, cellulose hemicellulose, and lignin distributions in stover of three diverse sorghum cultivars of differing harvest indices. Determinations were based on total vegetative biomass; total blades; total stalks; and upper middle, and lower blades and stalks. Concentrations of N and P were higher in blades than stalks and generally declines from upper to lower stover parts. Large carbohydrate and lignin concentration differences were observed on the basis of cultivar and stover part. Greater nutrient partitioning to the upper third of the intermediate and forage-type sorghum stovers was observed as compared to the conventional grain cultivar. Stover carbohydrates for all cultivars were mainly contained in the lower two-thirds of the stalk fraction. A system was proposed for returning upper stover portion to soil, while removing remaining portions for alternative uses
Tapping the US sweet sorghum collection to identify biofuel germplasm
The narrow genetic base in sweet sorghum [Sorghum bicolor (L.) Moench] breeding programs is limiting the development of new varieties for biofuel production. Therefore, the identification of genetically diverse sweet sorghum germplasm in the U.S. National Plant Germplasm System (NPGS) collection is...
Directory of Open Access Journals (Sweden)
M. T. Tinoco
2007-01-01
Full Text Available O Foeniculum vulgare Mill. subsp. vulgare é uma planta espontânea da região mediterrânea, pertencente à família Apiaceae. O seu óleo essencial, principalmente o dos frutos secos, é amplamente utilizado nas indústrias alimentar, farmacêutica, cosmética e perfumaria. Neste trabalho, pretendeu-se avaliar a actividade antimicrobiana do óleo essencial dos frutos verdes e das folhas da variedade de funcho doce colhido no Alentejo, na região de Évora, e relacionar essa actividade com a respectiva composição química. A extracção dos óleos essenciais foi efectuada por hidrodestilação e a sua análise foi feita por GC-FID e GC-MS. No óleo das folhas foram identificados como componentes maioritários os fenilpropanóides anetol, fenchona e estragol e o monoterpeno a-felandreno, enquanto que o óleo dos frutos apresentou como constituintes predominantes anetol e fenchona. A actividade antimicrobiana dos óleos foi avaliada face às estirpes Staphylococcus aureus, Escherichia coli, Saccharomyces spp., Fusarium oxysporum e Penicillium sp.. Os óleos essenciais apresentaram actividade antimicrobiana contra S. aureus, Saccharomyces spp. e Fusarium oxysporum.Foeniculum vulgare Mill. ssp. vulgare is a spontaneous plant of Mediterranean region that belongs to the Apiaceae family. Its essential oil is used as additives in food, pharmaceutical, cosmetic and perfume industries mainly that one obtained from dried seeds. The main goal of this work were to evaluate the antimicrobial activity of essential oils obtained from fresh leaves and unripe seeds of sweet fennel, collected in Évora-Alentejo, in face of their chemical composition. The extraction of the essentials oils was made by hydrodistillation. Chemical analyses were carried out by GC-FID and GCMS. Phenylpropanoides anethole, fenchone, estragole and the monoterpene aphellandrene were the most abundant compounds of leaves essential oil. Seeds essential oil showed as main components
Registration of ‘Kardia’, a Two-Rowed Spring Food Barley
‘Kardia’ (Reg. No. XXXX, XXXX), a two-rowed spring food barley (Hordeum vulgare L.) developed by the USDA-ARS, Aberdeen, ID, in cooperation with the University of Idaho Agricultural Experiment Station, was released in 2015. Kardia is derived from the cross of ‘03AH3054 / 98Ab12019’ and was advanced...
Effects of Net Blotch ( Pyrenophora teres ) on Malt Barley Yield and ...
African Journals Online (AJOL)
Barley (Hordeum vulgare L.) production is constrained by diseases such as net blotch caused by Pyrenophora teres Drechsl. The objectives of this study were to assess the effects of net blotch disease on malt barley yield and grain quality under natural infection. Four malt barley varieties (Beka, HB 120, HB 52 and Holker), ...
Directory of Open Access Journals (Sweden)
Pataki Imre
2011-01-01
Full Text Available Aim of this research was determination of mode of inheritance, gene effects components of genetic variance, combining abilities, average contribution of lines and testers and their interactions in expression of stem thickness in forage sorghum F1 generation. Method line x tester was applied. Material comprised of eight genetically divergent A-inbred lines of grain sorghum three R lines-testers of Sudan grass and twenty-four F1 hybrids obtained by crossing lines with testers. Among tested genotypes there were significant differences in mean values of stem thickness. Analysis of variance of combining abilities showed that there were highly significant differences for general combining abilities (GCA and specific combining abilities (SCA non-additive component of genetic variance (dominance and epistasis had greater portion in total genetic variance for stem thickness. During the first research year, interaction between inbred maternal line with testers had the largest contribution in expression of stem thickness of F1 hybrid at both locations, while in the second year at location Rimski Šančevi the largest contribution belongs to lines and at location Mačvanski Prnjavor the largest contribution belongs to testers. Assessment of combining abilities showed that these inbred lines of grain sorghum can be used as mothers: SS-1 646, SS-1 688 and S-8 682 in breeding forage sorghum for thicker stem. According to SCA, promising forage sorghum hybrids are S-8 682 x ST-R lin H and P-21 656 x C-198. This research can be of importance for developing new high-yielding forage sorghum hybrids.
Energy Technology Data Exchange (ETDEWEB)
Wangai, L.K.; Mbeo, C.O. [Kenya Industrial Research and Development Inst., Nairobi (Kenya); Kamau, C.K. [Kenya Agricurtural Research Inst.(s), Machakos (Kenya)
2012-11-01
There are over 500 sorghum genotypes grown locally in Kenya. This study was an investigation and selection of suitable sorghum genotypes for sustainable bio-ethanol production in Kenya. For the study, 500 genotypes of sorghum were planted and grown using the recommended agricultural practices. Random sampling of 230 genotypes was done and the samples analysed for juice and sugar content. The 26 best yielding genotypes were selected and grown again in duplicate for further detailed study. Data on date of flowering, pest resistance, {sup 0}brix, wet and dry weight, plant population, ratooning, grain yield and juice yield and juice sugar content were recorded and analyzed using GENstat. Sampling was done for each genotype when about 50% of the crop had flowered and there after, every 2 weeks until the grains dried. Crushing was done with a three roller mill crusher [8]. The sugar content was measured using a digital refractometer. Sugar yield obtained ranged between 10.3{sup 0}Brix and 19.3{sup 0}Brix and juice yield between 268 litres/hectare and 11390 litres/hectare. Five indigenous sorghum varieties, GBK-007130, GBK-007076, GBK-007102, GBK-007296, GBK-007098 were found to have the highest sugar and juice yields and were considered the most suitable sweet sorghum genotypes among those studied, for bio-ethanol production in Kenya.
Directory of Open Access Journals (Sweden)
Saeide Saeidi
2014-10-01
Full Text Available Background: Herbal medicines are the major remedy in traditional medical systems and made a great contribution in maintaining human health and in preventing many infectious diseases. The present study was carried out to determine the potential antibacterial effect of ethanol extracts and essential oil of Marrubium vulgare L. against Staphylococcus aureus which is antibiotic resistant. Materials and Methods: All 17 strains of S. aureus isolated from nose and throat sample from 160 healthy subjects, hospital staffs and inpatient in the city of Zabol (Amir Al-Momenin hospital, Zabol, south-eastern Iran were screened during years 2010-2011. In this study, the essential oil of Marrubium vulgare L. obtained by hydrodistillation was analyzed by gas chromatography coupled to mass spectrometry (GC-MS in order to determine their chemical composition. The minimum inhibitory concentrations were investigated to characterize the antimicrobial activities of this essential oil and extract. Results: Thirty-one components in the oil of Marrubium vulgare were identified. The results demonstrated that the major components of the essential oil were γ-Eudesmol (11%, Germacrene (10%, D-Citronelly formate (10%, β-Citronellol (8%, Geranyl tiglate (7.1%, Geranyl formate (6.02%. The least MIC value of extract M. vulgare was 2.5 mg/mL and the highest MIC value of essential oil M. vulgare was 2.5 mg/mL. Conclusion: This investigation showed that the M. vulgare essential oil and extract has a potent antimicrobial activity against S. aureus. The present studies confirm the use of this essential oil and extract as antibacterial agent. Further research is required to evaluate the practical values of therapeutic applications.
In Vitro Screening for Drought Tolerance in Different Sorghum (Sorghum bicolor (L. Moench Varieties
Directory of Open Access Journals (Sweden)
Yohannes Tsago
2013-08-01
Full Text Available Drought is one of the complex environmental factors affecting growth and yield of sorghum in arid and semi-arid areas of the world. Sixteen elite sorghum (Sorghum bicolor (L Moench genotypes were evaluated for their genetic potential to drought tolerance at callus induction and plant regeneration stage for drought tolerance. The non-ionic water soluble polymer polyethylene glycol (PEG of molecular weight 6000 was used as osmoticum to simulate water stress. The factorial experiment was laid down in a completely randomized design which comprised of a combination of two factors (genotypes and five PEG stress level; 0, 0.5, 1.0, 1.5, and 2.0% (w/v treatments. Data were recorded for callus induction efficiency, callus fresh weight, embryogenic callus percentage and plant regeneration percentage. Significant differences were observed among the genotypes, treatments and their interactions for the evaluated plant traits suggesting a great amount of variability for drought tolerance in sorghum. The correlation analysis also revealed strong and significant association between embryogenic callus percent and plant regeneration percent as well as between embryogenic callus percent and plant regeneration percent. By taking into consideration all the measured traits, Mann Whitney rank sum test revealed that 76T1#23 and Teshale followed by Meko, Gambella-1107 and Melkam showed better drought stress tolerance. Therefore they are recommended to be used as parents for genetic analysis, gene mapping and improvement of drought tolerance while Chelenko, Hormat and Raya appear to be drought sensitive.
Directory of Open Access Journals (Sweden)
A. V. Toledo
Full Text Available Se investigó la ocurrencia natural del hongo entomopatógeno Conidiobolus coronatus (Costantin Batko (Zygomycetes: Entomophthorales en adultos de Delphacodes kuscheli Fennah y D. haywardi Muir (Hemiptera: Delphacidae, criados sobre Hordeum vulgare L. bajo condiciones de invernadero. Los insectos muertos, por una sospechada infección fúngica, fueron recolectados, esterilizados superficialmente, y examinados en el laboratorio. Conidiobolus coronatus fue aislado en cultivos puros, descrito morfológicamente y depositado en colecciones micológicas. Este trabajo presenta el primer registro de C. coronatus contra insectos perjudiciales en la Argentina.The natural occurrence of the entomopathogenic fungus Conidiobolus coronatus (Costantin Batko (Zygomycetes: Entomophthorales in adults of Delphacodes kuscheli Fennah and D. haywardi Muir (Hemiptera: Delphacidae, reared on Hordeum vulgare L. under greenhouse conditions, was investigated. Dead insects, suspected of fungal infection, were collected, surface sterilized, and examined in the laboratory. Conidiobolus coronatus was isolated in pure cultures, described morphologically, and deposited in mycological collections. This paper presents the first record of C. coronatus against harmful insects in Argentina.
DEFF Research Database (Denmark)
Thomsen, I.K.; Jensen, E.S.
1994-01-01
The recovery by spring barley (Hordeum vulgare L.) of nitrogen mineralized from N-15-labelled straw and ryegrass material was followed for 3 years in the field. The effects of separate and combined applications of straw and ryegrass were studied using cross-labelling with N-15. Reference plots re...... mineral fertilizer was in the second and third barley crop similar to the recovery of N from incorporated plant residues.......The recovery by spring barley (Hordeum vulgare L.) of nitrogen mineralized from N-15-labelled straw and ryegrass material was followed for 3 years in the field. The effects of separate and combined applications of straw and ryegrass were studied using cross-labelling with N-15. Reference plots...... receiving (NH4NO3)-N-15-N-15 were included. Plant samples were taken every second week until maturity during the first growing season and at maturity in the two following years. Incorporation of plant material had no significant influence on the above-ground dry matter yield of the barley. The barley...
Implementation of biochemical screening to improve baking quality of barley
DEFF Research Database (Denmark)
Vincze, Éva; Dionisio, Giuseppe; Aaslo, Per
2011-01-01
Barley (Hordeum vulgare) has the potential to offer considerable human nutritional benefits, especially as supplement to wheat-based breads. Under current commercial baking conditions it is not possible to introduce more that 20% barley flour to the wheat bread without negative impact on the phys......Barley (Hordeum vulgare) has the potential to offer considerable human nutritional benefits, especially as supplement to wheat-based breads. Under current commercial baking conditions it is not possible to introduce more that 20% barley flour to the wheat bread without negative impact...... on the physical chemical properties of the bread products due to the poor baking properties of barley flour. As a consequence, the nutritional advantages of barley are not fully exploited. The inferior leavening and baking properties of barley can, in part, be attributed to the physical properties of the storage...... proteins. Changing the storage protein composition can lessen this problem. Our working hypothesis was that exploiting the substantial genetic variation within the gene pool for storage proteins could enable improving the baking qualities of barley flour. We characterised forty-nine barley cultivars...
Structure and chemistry of the sorghum grain
Sorghum is grown around the world and often under harsh and variable environmental conditions. Combined with the high degree of genetic diversity present in sorghum, this can result in substantial variability in grain composition and grain quality. While similar to other cereal grains such as maize ...
EVALUATION OF TWO VARIETIES OF SORGHUM FOR STARCH EXTRACTION
Directory of Open Access Journals (Sweden)
Leyanis Rodríguez Rodríguez
2015-01-01
Full Text Available In Cuba, the wet milling process for the extraction of starch is made from corn, cereal which is currently imported, that is why it is required to substitute it for another grain of national production as it is the case of sorghum. Given the similarities of the two grains in their starch content and considering the potential of sorghum for the food industry, it is developed in this work an assessment process, taking into account two sorghum varieties: red (CIAPR-132 and white (UDG-110. In this sense, a factorial design of the type 2k-1 is made, where the independent variables of most influence in the laboratory process are considered, such as: (x1 type of sorghum, (x2 soaking time and (x3 solution concentration. It is considered that there is no interaction between them and it is taken as the response variable the starch yield in the extraction process. We conclude that the type of sorghum and soaking time are the most influential variables, obtaining the best results for white sorghum subjected for 48 hours to soak in a solution of SO2 at a concentration of 1800 ppm.
Performance of Sorghum Varieties under Variable Rainfall in Central Tanzania.
Msongaleli, Barnabas M; Tumbo, S D; Kihupi, N I; Rwehumbiza, Filbert B
2017-01-01
Rainfall variability has a significant impact on crop production with manifestations in frequent crop failure in semiarid areas. This study used the parameterized APSIM crop model to investigate how rainfall variability may affect yields of improved sorghum varieties based on long-term historical rainfall and projected climate. Analyses of historical rainfall indicate a mix of nonsignificant and significant trends on the onset, cessation, and length of the growing season. The study confirmed that rainfall variability indeed affects yields of improved sorghum varieties. Further analyses of simulated sorghum yields based on seasonal rainfall distribution indicate the concurrence of lower grain yields with the 10-day dry spells during the cropping season. Simulation results for future sorghum response, however, show that impacts of rainfall variability on sorghum will be overridden by temperature increase. We conclude that, in the event where harms imposed by moisture stress in the study area are not abated, even improved sorghum varieties are likely to perform poorly.
Taxonomy, Variation, and Relationships in the Hordeum parodii Group (Poaceae)
DEFF Research Database (Denmark)
Von Bothmer, R.; Jacobsen, N.; Bagger Jørgensen, Rikke
1986-01-01
The Hordeum parodii group contains three species, viz. H. parodii Covas (6x), H. tetraploidum Covas (4x), and H. fuegianum Bothmer, Jacobsen, et Jorgensen, sp. nov. (4x). The former two species mainly occur in C and S Argentina, while H. fuegianum is native to Tierra del Fuego. All three species...
Directory of Open Access Journals (Sweden)
Ayşe YAZLIK
2015-09-01
Full Text Available Jonsongrass (Sorghum halepense (L. Pers. (SORHA is one of the most troublesome perennial weeds caused important yield reductions in the agricultural and environmental problems in the non-agricultural fields. Using a combination of several control strategies is required because Sorha cannot be effectively controlled by a single control method. One of the methods that can be used for the control of Sorha is the usage of allelopathic chemicals. The efficiency of the plants [oregano (Origanum vulgare L., lavender (Lavandula angustifolia L. and rosemary (Rosmarinus officinalis L.] that have allelochemicals on the SORHA were examined with this study. Using rosemary oil at the high rate (16 μl 38.465 cm2 gave the best results and reduced dry weight at 41.0% when it was applied as pre-emergence. The same essential oil rate obtained from rosemary was the highest adversely effects on the Sorha growth (48.0% when it was used as post-emergence. Post-emergence application of all three volatile oils has provided more influence on the Sorha growth compared to the pre-emergence application.
Evaluation of the multi-seeded (msd) mutant of sorghum for ethanol production
Grain sorghum [Sorghum bicolor (L.) Moench], a cost effective crop in semiarid regions, is an underestimated supplement to corn in starch based ethanol production. Twenty three multi-seeded (msd) mutant sorghums and one wild type sorghum BTx623 were evaluated for ethanol production and effect of che...
Physiological effects and transport of 24-epibrassinolide in heat-stressed barley
Czech Academy of Sciences Publication Activity Database
Janeczko, A.; Oklešťková, Jana; Pociecha, E.; Koscielniak, J.; Mirek, M.
2011-01-01
Roč. 33, č. 4 (2011), s. 1249-1259 ISSN 0137-5881 R&D Projects: GA AV ČR IAA400550801; GA ČR GA301/08/1649 Institutional research plan: CEZ:AV0Z50380511 Keywords : Brassinosteroid transport * Dark respiration * Hordeum vulgare L * PSII efficiency * Metabolic activity Subject RIV: EF - Botanics Impact factor: 1.639, year: 2011
DEFF Research Database (Denmark)
Thomsen, Ingrid K; Pedersen, Asger R; Nyord, Tavs
2010-01-01
, and losses via N2O. Two field experiments were carried out on a loamy sand. Pig slurry was applied to established crops, i.e., to spring barley (Hordeum vulgare L.) in May 2007, and to winter wheat (Triticum aestivum L.) in April 2008. In 2007 the slurry was applied by direct injection using either winged...
Ridging in autumn as an alternative to mouldboard ploughing in a humid-temperate region
DEFF Research Database (Denmark)
Henriksen, Jens Christian Martin Bugge; Rasmussen, Jesper; Søgaard, Carsten
2006-01-01
and ploughing. Residue treatments were stubble, stubble + straw and stubble + liquid manure in order to create a gradient of C/N ratios. From the time of harvest until planting of a subsequent barley crop (Hordeum vulgare L.), inorganic N was determined 11 times in 1998–1999 and 10 times in 1999–2000 in the 0...
International Nuclear Information System (INIS)
Ramulu, K.S.
1980-01-01
The M 2 and M 3 plants derived from both fast neutron and X-ray treatments have been studied to detect and analyse reciprocal translocations in Arabidopsis thaliana (L.) Heynh. cv. Landsberg erecta (2n=10), Hordeum vulgare L. cv. Aramir (2n=14) and Secale cereale L., summer inbred line ZF9 (2n=14). (Auth.)
Czech Academy of Sciences Publication Activity Database
Efimova, N.V.; Vaňková, Radomíra; Kusnetsov, V.; Litvinovskaya, R. P.; Zlobin, Y.L.; Dobrev, Petre; Vedenicheva, N.P.; Savchuk, A. L.; Karnachuk, R. A.; Kudryakova, N.V.; Kuznetsov, V. D.
2017-01-01
Roč. 120, APR (2017), s. 32-40 ISSN 0039-128X Institutional support: RVO:61389030 Keywords : lupinus-luteus cotyledons * arabidopsis-thaliana * de-etiolation * abscisic-acid * brassinosteroid biosynthesis * plant development * hormonal balance * mutant * expression * growth * Brassinosteroids * Cytokinin * Gene expression * Green light * Hordeum vulgare * Transcription Subject RIV: EF - Botanics OBOR OECD: Plant sciences, botany Impact factor: 2.282, year: 2016
Bioethanol production from dried sweet sorghum stalk
Energy Technology Data Exchange (ETDEWEB)
Almodares, A.; Etemadifar, Z.; Ghoreishi, F.; Yosefi, F. [Biology Dept. Univ. of Isfahan, Isfahan (Iran, Islamic Republic of)], e-mail: aalmodares@yahoo.com
2012-11-01
Bioethanol as a renewable transportation fuel has a great potential for energy and clean environment. Among crops sweet sorghum is one of the best feedstock for ethanol production under hot and dry climatic conditions. Because it has higher tolerance to salt and drought comparing to sugarcane and corn that are currently used for bio-fuel production in the world. Generally mills are used to extract the juice from sweet sorghum stalks. Three roller mills extract around nearly 50 percent of the juice and more mills is needed to extract higher percentage of the juice. More over under cold weather the stalks become dry and juice is not extracted from the stalk, therefore reduce harvesting period. In this study stalks were harvested, leaves were stripped from the stalks and the stalks were chopped to nearly 4 mm length and sun dried. The dry stalks were grounded to 60 mesh powder by a mill. Fermentation medium consists of 15-35% (w/w) sweet sorghum powder, micronutrients and active yeast inoculum from 0.5-1% (w/w) by submerge fermentation method. The fermentation time and temperature were 48-72 hours and 30 deg, respectively. The results showed the highest amount of ethanol (14.5 % w/w sorghum) was produced with 10% sweet sorghum powder and 1% of yeast inoculum, three day fermentation at 30 deg.
Sorghum stem yield and soluble carbohydrates under different ...
African Journals Online (AJOL)
STORAGESEVER
2008-11-19
Nov 19, 2008 ... Key words: Sweet sorghum, grain sorghum, salinity, stem yield, ... The effect of salinity on the stem yield and sucrose was .... growth and polyamine metabolism in two citrus rootstocks with ... Growth and osmoregulation in two.
Directory of Open Access Journals (Sweden)
Manzoor A. Rather
2016-11-01
Full Text Available Foeniculum vulgare (Apiaceae commonly known as fennel is a well known and important medicinal and aromatic plant widely used as carminative, digestive, lactogogue and diuretic and in treating respiratory and gastrointestinal disorders. Its seeds are used as flavourings in baked goods, meat and fish dishes, ice cream, alcoholic beverages and herb mixtures. Phenols, phenolic glycosides and volatile aroma compounds such as trans-anethole, estragole and fenchone have been reported as the major phytoconstituents of this species. Different pharmacological experiments in a number of in vitro and in vivo models have convincingly demonstrated the ability of F. vulgare to exhibit antifungal, antibacterial, antioxidant, antithrombotic and hepatoprotective activities, lending support to the rationale behind several of its therapeutic uses. Phenolic compounds isolated from F. vulgare are considered to be responsible for its antioxidant activity while the volatile aroma compounds make it an excellent flavouring agent. The present review is an up-to-date and comprehensive analysis of the chemistry, pharmacology, traditional uses and safety of F. vulgare.
Relationships in the barley genus (Hordeum): An electrophoretic examination of proteins
DEFF Research Database (Denmark)
Bagger Jørgensen, Rikke
1986-01-01
The relationships between all known Hordeum species except H. guatemalense were inferred from the electrophoresis of the six enzyme systems Got, 6-Pgd, Mdh, Idh, .alpha.- and.beta.- amylases. A total of eleven loci were scored for in these systems. Maximum likelihood clusters and Wagner networks...
Li, Ya; Wang, Qi; Wang, Lu; He, Lin-Yan; Sheng, Xia-Fang
2016-02-01
Endophytic bacterial strain K3-2 was isolated from the roots of Sorghum sudanense (an bioenergy plant) grown in a Cu mine wasteland soils and characterized. Strain K3-2 was identified as Enterobacter sp. based on 16S rRNA gene sequence analysis. Strain K3-2 exhibited Cu resistance and produced 1-aminocyclopropane-1-carboxylate (ACC) deaminase, indole-3-acetic acid (IAA), siderophores, and arginine decarboxylase. Pot experiments showed that strain K3-2 significantly increased the dry weight and root Cu accumulation of Sorghum sudanense grown in the Cu mine wasteland soils. Furthermore, increase in total Cu uptake (ranging from 49% to 95%) of the bacterial inoculated-Sorghum sudanense was observed compared to the control. Notably, most of Cu (83-86%) was accumulated in the roots of Sorghum sudanense. Furthermore, inoculation with strain K3-2 was found to significantly increase Cu bioconcentration factors and the proportions of IAA- and siderophore-producing bacteria in the root interiors and rhizosphere soils of Sorghum sudanense compared with the control. Significant decrease in the available Cu content was also observed in the rhizosphere soils of the bacterial-inoculated Sorghum sudanense. The results suggest that the endophytic bacterial strain K3-2 may be exploited for promoting Sorghum sudanense biomass production and Cu phytostabilization in the Cu mining wasteland soils. Copyright © 2015 Elsevier Inc. All rights reserved.
Radiation balance in the sweet sorghum crop
International Nuclear Information System (INIS)
Assis, F.N. de; Mendez, M.E.G.; Martins, S.R.; Verona, L.A.
1987-01-01
The fluxes of incident solar radiation, reflected and net radiation were measured during the growing cicle of two fields of sweet sorghum (Sorghum bicolor L.), cus. BR-501 and BR-503, maintained under convenient irrigation level. Resultant data allowed to estimate the crop albedo as well as the estimates of Rn. (M.A.C.) [pt
Suwarti; Efendi, R.; Massinai, R.; Pabendon, M. B.
2018-03-01
Sweet sorghum (Sorghum bicolor L. [Moench]) crop management that is use for raw source of bioethanol for industrial purpose in Indonesia is less developed. The aim of this research was to evaluated sweet sorghum variety at several population to determine optimum density for juice production. Experiment design was set on split-plot design with three replications, conducted on August to December 2016 at the Indonesian Cereals Research Institute Research Station, Maros South Sulawesi. Main plot were six variation of plant row, and sub plot were three sweet sorghum varieties. Result of the study showed that plant population was high significanty affect to stalk weight, total biomass yield, leaf weight, and also significantly affect bagass weight and juice volume. Varieties were high significantly different in plant height, juice volume, and number of nodes. Super 1 variety on population at 166,667 plants/ha (P1) was obtained the highest juice volume (19,445 lHa-1), meanwhile the highest brix value obtained from Numbu at the same plants population. Furthermore juice volume had significant correlation with biomass weight at the r=0.73. Based on ethanol production, Super 2 and Numbu had the highest volume at 83.333 plants/ha density (P3) and Super 1 at 166.667 plants/ha density with the ethanol volume were 827.68 l Ha-1, 1116.50 l/ha and 993.62 l Ha-1 respectively.
Energy Technology Data Exchange (ETDEWEB)
Ian J. Bonner; Kevin L. Kenney
2012-10-01
Cellulosic energy varieties of Sorghum bicolor (L.) Moench show promise as a bioenergy feedstock, however, high moisture content at the time of harvest results in unacceptable levels of degradation when stored in aerobic conditions. To safely store sorghum biomass for extended periods in baled format, the material must be dried to inhibit microbial growth. One possible solution is allowing the material to dry under natural in-field conditions. This study examines the differences in thin-layer drying rates of intact and conditioned sorghum under laboratory-controlled temperatures and relative humidity levels (20 degrees C and 30 degrees C from 40% to 85% relative humidity), and models experimental data using the Page’s Modified equation. The results demonstrate that conditioning drastically accelerates drying times. Relative humidity had a large impact on the time required to reach a safe storage moisture content for intact material (approximately 200 hours at 30 degrees C and 40% relative humidity and 400 hours at 30 degrees C and 70% relative humidity), but little to no impact on the thin-layer drying times of conditioned material (approximately 50 hours for all humidity levels < 70% at 30 degrees C). The drying equation parameters were influenced by temperature, relative humidity, initial moisture content, and material damage, allowing drying curves to be empirically predicted. The results of this study provide valuable information applicable to the agricultural community and to future research on drying simulation and management of energy sorghum.
The genetics and mechanism of avoidance of rust infection in Hordeum chilense
Vaz Patto, M.C.
2001-01-01
Hordeum chilense is a perennial species occurring in Chile and Argentina. This wild barley species shows a very wide range of variation of morphological and agronomic characters and crosses easily with other members of the Triticeae
Changes in protein and starch digestibility in sorghum flour during heat-moisture treatments.
Vu, Thanh-Hien; Bean, Scott; Hsieh, Chao-Feng; Shi, Yong-Cheng
2017-11-01
Heat-moisture treatment (HMT) has been used to modify properties of sorghum starches. However, information is limited on the effects of HMT on the digestibility of starch and the concurrent changes in protein in sorghum flour. The objectives of this research were to identify heat-moisture conditions to increase the resistant starch (RS) content of sorghum flour and investigate changes in sorghum proteins and starch structure. Sorghum flours with different moisture contents (0, 125, 200, and 300 g kg -1 w.b.) were heated at three temperatures (100, 120 and 140 °C) and times (1, 2 and 4 h). HMT of sorghum flour increased its RS level. The flour treated at 200 g kg -1 moisture and 100 °C for 4 h had a high RS content (221 g kg -1 vs. 56 g kg -1 for the untreated flour). Starch was not gelatinized when sorghum flours heated at moisture content of 200 g kg -1 or below. Sorghum protein digestibility and solubility decreased during HMT. The increase in RS of sorghum flour upon HMT was attributed to enhanced amylose-lipid complexes and heat induced structural changes in its protein fraction. HMT can be used to increase RS content in sorghum flour without gelatinizing its starch, thereby providing sorghum flour with unique food applications. © 2017 Society of Chemical Industry. © 2017 Society of Chemical Industry.
Sorghum as a renewable feedstock for production of fuels and industrial chemicals
Directory of Open Access Journals (Sweden)
Nhuan P. Nghiem
2016-01-01
Full Text Available Considerable efforts have been made in the USA and other countries to develop renewable feedstocks for production of fuels and chemicals. Among these, sorghum has attracted strong interest because of its many good characteristics such as rapid growth and high sugar accumulation, high biomass production potential, excellent nitrogen usage efficiency, wide adaptability, drought resistance, and water lodging tolerance and salinity resistance. The ability to withstand severe drought conditions and its high water usage efficiency make sorghum a good renewable feedstock suitable for cultivation in arid regions, such as the southern US and many areas in Africa and Asia. Sorghum varieties include grain sorghum, sweet sorghum, and biomass sorghum. Grain sorghum, having starch content equivalent to corn, has been considered as a feedstock for ethanol production. Its tannin content, however, may cause problems during enzyme hydrolysis. Sweet sorghum juice contains sucrose, glucose and fructose, which are readily fermentable by Saccharomyces cerevisiae and hence is a good substrate for ethanol fermentation. The enzyme invertase, however, needs to be added to convert sucrose to glucose and fructose if the juice is used for production of industrial chemicals in fermentation processes that employ microorganisms incapable of metabolizing sucrose. Biomass sorghum requires pretreatment prior to enzymatic hydrolysis to generate fermentable sugars to be used in the subsequent fermentation process. This report reviews the current knowledge on bioconversion of sorghum to fuels and chemicals and identifies areas that deserve further studies.
Effect of sowing date on grain quality of sorghum ( Sorghum bicolor ...
African Journals Online (AJOL)
IVHAA) while minerals; iron and zinc were determined using Atomic Absorption Spectrophotometry. Significant site by variety by sowing date interactions at P < 0.05 level of probability were obtained for protein, iron and zinc content of sorghum ...
Environmental adaptibility of tansy ( Tanacetum vulgare L ...
African Journals Online (AJOL)
Ecological role of essential oils is reflected in the interaction of plants with environmental factors. Environmental adaptability of the plants can be assumed from essential oil contents. Essential oils are agents, which communicate with the plant environment. Tansy (Tanacetum vulgare L.) was selected for laboratory research ...
Environmental adaptibility of tansy (Tanacetum vulgare L.)
African Journals Online (AJOL)
STORAGESEVER
2009-11-16
Nov 16, 2009 ... Ecological role of essential oils is reflected in the interaction of plants with environmental factors. Environmental adaptability of the plants can be assumed from essential oil contents. Essential oils are agents, which communicate with the plant environment. Tansy (Tanacetum vulgare L.) was selected for.
Efficacy of herbicide seed treatments for controlling Striga infestation of Sorghum
Tuinstra, M.R.; Soumana, S.; Al-Khatib, K.; Kapran, I.; Toure, A.; Ast, van A.; Bastiaans, L.; Ochanda, N.W.; Salami, I.; Kayentao, M.; Dembele, S.
2009-01-01
Witchweed (Striga spp.) infestations are the greatest obstacle to sorghum [Sorghum bicolor (L.) Moench] grain production in many areas in Africa. The objective of this study was to evaluate the efficacy of herbicide seed treatments for controlling Striga infestation of sorghum. Seeds of an
Evaluation of sorghum genotypes under drought stress conditions ...
African Journals Online (AJOL)
Seven genotypes of sorghum (Sorghum bicolour (L.) Moench) were studied in both drought and normal conditions. In each condition, the genotypes were evaluated using a split plot based randomized complete block design with three replications. Drought tolerance indices including stability tolerance index (STI), mean ...
Performance of Broiler Chicks Fed Irradiated Sorghum Grains
International Nuclear Information System (INIS)
Farag, M.D.D.; Farag, M.F. S. El-D.; Afify, A.S.
2003-01-01
Substitution of yellow corn with raw sorghum grains in chick diets resulted in decreases in live body weight, accumulative feed consumption and efficiency of feed utilization as compared with reference diet. Relative to raw sorghum diet, inclusion of sorghum grains irradiated at 60 and 100 kGy and/or supplemented with PEG in chick diets resulted in increases in accumulative feed consumption an efficiency feed utilization. The study suggested that irradiation treatment up to 100 kGy up grade broiler chicks performance and the combinations between radiation and PEG treatments sustain the effect of each other
Faleiro, Leonor; Miguel, Graça; Gomes, Sónia; Costa, Ludmila; Venâncio, Florencia; Teixeira, Adriano; Figueiredo, A Cristina; Barroso, José G; Pedro, Luis G
2005-10-19
Antilisterial activities of Thymbra capitata and Origanum vulgare essential oils were tested against 41 strains of Listeria monocytogenes. The oil of T. capitata was mainly constituted by one component, carvacrol (79%), whereas for O. vulgare three components constituted 70% of the oil, namely, thymol (33%), gamma-terpinene (26%), and p-cymene (11%). T. capitata essential oil had a significantly higher antilisterial activity in comparison to O. vulgare oil and chloramphenicol. No significant differences in L. monocytogenes susceptibilities to the essential oils tested were registered. The minimum inhibitory concentration values of T. capitata essential oil and of carvacrol were quite similar, ranging between 0.05 and 0.2 microL/mL. Antioxidant activity was also tested, the essential oil of T. capitata showing significantly higher antioxidant activity than that of O. vulgare. Use of T. capitata and O. vulgare essential oils can constitute a powerful tool in the control of L. monocytogenes in food and other industries.
Tapping the US historic sweet sorghum collection to identify biofuel germplasm
Sweet sorghum [Sorghum bicolor (L.) Moench] has gained an important role as a viable alternative to fossil fuels and a more profitable option than maize and sugarcane. Nevertheless, the actual narrow genetic base in sweet sorghum breeding programs is limiting the development of new biofuel varietie...
PAV markers in Sorghum bicolour
DEFF Research Database (Denmark)
Shen, Xin; Liu, Zhiquan; Mocoeur, Anne Raymonde Joelle
2015-01-01
Abstract Genic presence/absence variants (PAVs) correlate closely to the phenotypic variation, impacting plant genome sizes and the adaption to the environment. To shed more light on their genome-wide patterns, functions and to test the possibility of using them as molecular markers, we analyzed...... enriched in stress responses and protein modification. We used 325 polymorphic PAVs in two sorghum inbred lines Ji2731 and E-Tian, together with 49 SSR markers, and constructed a genetic map, which consisted of 10 linkage groups corresponding to the 10 chromosomes of sorghum and spanned 1430.3 cM in length...
Genetic dissection of bioenerrgy traits in sorghum
Energy Technology Data Exchange (ETDEWEB)
Vermerris, Wilfred; Kresovich, Stephen; Murray, Seth; Pedersen, Jeffery; Rooney, William; Sattler, Scott.
2012-06-15
Specific Objectives: 1. To identify the gene(s) underlying a major QTL for stem sugar concentration located on chromosome 3. 2. To identify QTL for stem juice volume and stalk sugar concentration and to identify the underlying genes. 3. To classify 60 novel sorghum bmr mutants from the USDA TILLING population in allelic groups based on cell wall chemistry and allelism tests. 4. To select representative bmr mutants from each allelic group and selected NIR spectral mutants for their potential value as feedstock for ethanol production. 5. To clone and characterize those Bmr genes that represent loci other than Bmr12 and Bmr6 using a mapping and a candidate gene approach. Objective 1 The experiments for this objective are largely complete and the data have been analyzed. Data interpretation and follow-up experiments are still in progress. A manuscript is in preparation (Vermerris et al.; see publication list for full details). The main results are: 1) 16 cDNA libraries were prepared and sequenced at Cornell University. The libraries represent internode tissue and flag leaf tissue at booting, internode tissue and peduncle at soft-dough stage, from two plants per sampling time with the Rio allele for the QTL on chromosome 3, and two plants with the BTx623 allele on chromosome 3 (4 tissues x 2 genotypes x 2 replicates) 2) 480 million 86-nucleotide reads were generated from four lanes of Illuminia HiSeqII 3) 74% of the reads could be mapped to the sorghum transcriptome, indicative of good sequence quality 4) Of the 216 genes within the QTL, 17 genes were differentially expressed among plants with and without the Rio QTL. None of these 17 genes had obvious roles in sucrose metabolism 5) Clustering algorithms identified a group of 721 co-expressed genes. One of these genes is a sucrose synthase gene. This cluster also contains 10 genes from the QTL. 6) Among these co-expressed genes are regulatory genes for which knock-out lines in Arabidopsis have been obtained. Analysis of
DNA replication after mutagenic treatment in Hordeum vulgare.
Kwasniewska, Jolanta; Kus, Arita; Swoboda, Monika; Braszewska-Zalewska, Agnieszka
2016-12-01
The temporal and spatial properties of DNA replication in plants related to DNA damage and mutagenesis is poorly understood. Experiments were carried out to explore the relationships between DNA replication, chromatin structure and DNA damage in nuclei from barley root tips. We quantitavely analysed the topological organisation of replication foci using pulse EdU labelling during the S phase and its relationship with the DNA damage induced by mutagenic treatment with maleic hydrazide (MH), nitroso-N-methyl-urea (MNU) and gamma ray. Treatment with mutagens did not change the characteristic S-phase patterns in the nuclei; however, the frequencies of the S-phase-labelled cells after treatment differed from those observed in the control cells. The analyses of DNA replication in barley nuclei were extended to the micronuclei induced by mutagens. Replication in the chromatin of the micronuclei was rare. The results of simultanous TUNEL reaction to identify cells with DNA strand breaks and the labelling of the S-phase cells with EdU revealed the possibility of DNA replication occurring in damaged nuclei. For the first time, the intensity of EdU fluorescence to study the rate of DNA replication was analysed. Copyright © 2016 Elsevier B.V. All rights reserved.
Diversity in Indian barley (Hordeum vulgare) cultivars and ...
Indian Academy of Sciences (India)
tinguish varieties of crop plants and establish their purity as a prerequisite for any ... of genetic material in germplasm collection and as a general guide for the choice ... Sixty-nine barley cultivars were grown under field condi- tions in three ...
Study on genotypic variation for ethanol production from sweet sorghum juice
Energy Technology Data Exchange (ETDEWEB)
Ratnavathi, C.V.; Suresh, K.; Kumar, B.S. Vijay; Pallavi, M.; Komala, V.V.; Seetharama, N. [Directorate of Sorghum Research, Rajendranagar, Hyderabad 500030, Andhra Pradesh (India)
2010-07-15
Sugarcane molasses is the main source for ethanol production in India. Sweet sorghum with its juicy stem containing sugars equivalent to that of sugarcane is a very good alternative for bio-ethanol production to meet the energy needs of the country. Sweet sorghum is drought resistant, water logging resistant and saline-alkaline tolerant. Growing sweet sorghum for ethanol production is relatively easy and economical and ethanol produced from sweet sorghum is eco-friendly. In view of this, it is important to identify superior genotypes for ethanol production in terms of percent juice brix, juice extractability, total fermentable sugars, ethanol yield and fermentation efficiency. This paper presents the study on the variability observed for the production of ethanol by various sweet sorghum genotypes in a laboratory fermentor. Five Sweet Sorghum (Sorghum bicolor L. Moench) genotypes were evaluated for ethanol production from stalk juice (Keller, SSV 84, Wray, NSSH 104 and BJ 248). Sweet sorghum juice differs from cane juice mainly in its higher content of starch and aconitic acid. Data were collected for biomass yield; stalk sugar yield and ethanol production in five genotypes. Maximum ethanol production of 9.0%w/v ethanol was obtained with Keller variety (20% sugar concentration was used), and decreased for other genotypes. A distiller's strain of Saccharomyces cerevisiae (gifted by Seagram Distilleries Ltd.) was employed for fermentation. The fermentation efficiency (FE) was 94.7% for this strain. High biomass of yeast was obtained with BJ 248 variety. When the similar experiments were conducted with unsterile sweet sorghum juice (15% sugar concentration) 6.47%w/v ethanol was produced. (author)
Coupling amplified DNA from flow-sorted chromosomes to high-density SNP mapping in barley
Czech Academy of Sciences Publication Activity Database
Šimková, Hana; Svensson, J.T.; Condamine, P.; Hřibová, Eva; Suchánková, Pavla; Bhat, P.R.; Bartoš, Jan; Šafář, Jan; Close, T.J.; Doležel, Jaroslav
2008-01-01
Roč. 9, č. 294 (2008), s. 1-9 ISSN 1471-2164 R&D Projects: GA ČR GD521/05/H013; GA MŠk ME 884; GA MŠk(CZ) LC06004 Institutional research plan: CEZ:AV0Z50380511 Keywords : Flow cytometry * DNA amplification * Hordeum vulgare L. Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 3.926, year: 2008
Czech Academy of Sciences Publication Activity Database
Rayapuram, C.; Hemzalová, Vendula; Lyngkjaer, M. E.
2011-01-01
Roč. 93, č. 3 (2011), s. 613-625 ISSN 1125-4653 R&D Projects: GA MZe QH72117 Institutional research plan: CEZ:AV0Z50380511 Keywords : Blumeria graminis f. sp hordei * Hordeum vulgare * hypersensitive response Subject RIV: GF - Plant Pathology, Vermin, Weed, Plant Protection Impact factor: 0.912, year: 2011 http://sipav.org/main/jpp/index.php/jpp/article/view/1229
Radiation induced early maturing mutants in barley
International Nuclear Information System (INIS)
Kumar, R.; Chauhan, S.V.S.; Sharma, R.P.
1978-01-01
In M 2 generation, two early maturing plants were screened from a single spike progeny of a plant obtained from 20 kR of gamma-ray irradiation of a six-rowed barley (Hordeum vulgare L. var. Jyoti). Their true breeding nature was confirmed in M 3 generation. These mutants flower and mature 38 and 22 days earlier than those of control. (auth.)
Factors influencing beta-amylase activity in sorghum malt
CSIR Research Space (South Africa)
Taylor, JRN
1993-09-01
Full Text Available isozyme of pI approximately 4.4-4.5, unlike the many isozymes all of higher pI in barley. However, like barley, sorghum beta-amylase was more temperature-labile than its alpha-amylase. Beta-amylase activity in sorghum malt was increased by germination time...
The environment strongly affects estimates of heterosis in hybrid sweet sorghum
Sweet sorghum (Sorghum bicolor (L.) Moench) has potential as a biofuel feedstock but hybrid cultivars are needed to support an industry based on this crop. The purpose of this study was to compare five inbred sweet sorghum lines and 15 hybrids derived from them, and to determine the extent of envir...
Estimation of in situ mating systems in wild sorghum (Sorghum ...
Indian Academy of Sciences (India)
The high outcrossing rates of wild/weedy sorghum populations in Ethiopia indicate a high potential for crop genes (including transgenes) to spread within the wild pool. Therefore, effective risk management strategies may be needed if the introgression of transgenes or other crop genes from improved cultivars into wild or ...
Lactic acid fermentation of two sorghum varieties is not affected by ...
African Journals Online (AJOL)
The study was conducted to investigate sorghum grain variety differences in lactic acid fermentation based on their differences in phenolic contents. The study wa s conductedas a 2 x 5 x 4 factorial design with three factors: Factor 1: Sorghum variety (white and red sorghum); Factor 2: Control treatment without lactic acid ...
Epicoccum nigrum the new pathogen of sorghum seed in Serbia
Directory of Open Access Journals (Sweden)
Ristić Danijela
2012-01-01
Full Text Available Sixteen samples of sorghum seed (Sorghum bicolor (L. Moench. 'Alba', 'Gold', 'Prima' and 'Reform' were analyzed in the localities of Bački Petrovac and Čantavir in the period 2009-2011. Tipresence of species belonging to the genera Epicoccum, Fusarium, Alternaria, Aspergillus and Penicillium was established in single and mixed infections. From the infected sorghum seed, monosporial cultures identified as Epicoccum nigrum based on morphology, proved their pathogenicity on artificially inoculated sorghum seedlings. Molecular identification was performed by PCR and amplification of the ITS region of ribosomal DNA. Gene sequences of selected isolates 291-09 (JQ619838 and 315-09 (JQ619839 exhibited 99-100% nucleotide identity with the sequences of 31 isolates of E. nigrum deposited in the GenBank. It obtained results represent the first detailed characterization of E. nigrum in Serbia. The presence of a large number of phytopathogenic fungi on sorghum seed should be further investigated in order to clarify their relationships and relative significance.
Incorporating a Sorghum Habitat for Enhancing Lady Beetles (Coleoptera: Coccinellidae in Cotton
Directory of Open Access Journals (Sweden)
P. G. Tillman
2012-01-01
Full Text Available Lady beetles (Coleoptera: Coccinellidae prey on insect pests in cotton. The objective of this 2 yr on-farm study was to document the impact of a grain sorghum trap crop on the density of Coccinellidae on nearby cotton. Scymnus spp., Coccinella septempunctata (L., Hippodamia convergens Guérin-Méneville, Harmonia axyridis (Pallas, Coleomegilla maculata (De Geer, Cycloneda munda (Say, and Olla v-nigrum (Mulsant were found in sorghum over both years. Lady beetle compositions in sorghum and cotton and in yellow pyramidal traps were similar. For both years, density of lady beetles generally was higher on cotton with sorghum than on control cotton. Our results indicate that sorghum was a source of lady beetles in cotton, and thus incorporation of a sorghum habitat in farmscapes with cotton has great potential to enhance biocontrol of insect pests in cotton.
International Nuclear Information System (INIS)
Linton, Joseph A.; Miller, J. Corey; Little, Randall D.; Petrolia, Daniel R.; Coble, Keith H.
2011-01-01
This study examines the feasibility of producing sweet sorghum (Sorghum bicolor (L.) Moench) as an ethanol feedstock in the southeastern United States through representative counties in Mississippi. We construct enterprise budgets along with estimates of transportation costs to estimate sweet sorghum producers' breakeven costs for producing and delivering sweet sorghum biomass. This breakeven cost for the sweet sorghum producer is used to estimate breakeven costs for the ethanol producer based on wholesale ethanol price, production costs, and transportation and marketing costs. Stochastic models are developed to estimate profits for sweet sorghum and competing crops in two representative counties in Mississippi, with sweet sorghum consistently yielding losses in both counties. -- Highlights: → We examine the economic feasibility of sweet sorghum as an ethanol feedstock. → We construct enterprise budgets along with estimates of transportation costs. → We estimate breakeven costs for producing and delivering sweet sorghum biomass. → Stochastic models determine profits for sweet sorghum in two Mississippi counties.
The application of secondary metabolites in the study of sorghum insect resistance
Chunming, Bai; Yifei, Liu; Xiaochun, Lu
2018-03-01
Insect attack is one of the main factors for limiting the production of rice and sorghum. To improve resistance to pests of rice and sorghum will be of great significance for meliorating their production and quality. However, the source and material of anti-pest was scarce. In this study, we will study on the expression patterns of hydrocyanic acid biosynthesis relative genes in sorghum firstly. And we will also genetically transform them into rice and sorghum by specific and constitutive promoters and verify their pest-resistant ability. Finally, high pest-resistant genetically modified new sorghum cultivars will be bred with favorable comprehensive agronomic traits.
PASCAL D. C. AGBANGNAN; CHRISTINE TACHON; HELENE BONIN; ANNA CHROSTOWKA; ERIC FOUQUET; DOMINIQUE C. K. SOHOUNHLOUE
2012-01-01
The full phytochemical screening of red sorghum from Benin (Sorghum caudatum) achieved in this work reveals the presence of leucoanthocyanins, flavonoides, free quinones, combined anthracene derivatives, sterols and terpenes in higher concentration in the leaf sheath and marrow of stem than in the seed. Catechin tannin content is 11.4% in the leaf sheath (slightly higher than that of red wine), 5.8% in the marrow and 2.8% in the seed. Gallic tannins, saponins and the mucilage present in the l...
Grain sorghum is a viable feedstock for ethanol production.
Wang, D; Bean, S; McLaren, J; Seib, P; Madl, R; Tuinstra, M; Shi, Y; Lenz, M; Wu, X; Zhao, R
2008-05-01
Sorghum is a major cereal crop in the USA. However, sorghum has been underutilized as a renewable feedstock for bioenergy. The goal of this research was to improve the bioconversion efficiency for biofuels and biobased products from processed sorghum. The main focus was to understand the relationship among "genetics-structure-function-conversion" and the key factors impacting ethanol production, as well as to develop an energy life cycle analysis model (ELCAM) to quantify and prioritize the saving potential from factors identified in this research. Genetic lines with extremely high and low ethanol fermentation efficiency and some specific attributes that may be manipulated to improve the bioconversion rate of sorghum were identified. In general, ethanol yield increased as starch content increased. However, no linear relationship between starch content and fermentation efficiency was found. Key factors affecting the ethanol fermentation efficiency of sorghum include protein digestibility, level of extractable proteins, protein and starch interaction, mash viscosity, amount of phenolic compounds, ratio of amylose to amylopectin, and formation of amylose-lipid complexes in the mash. A platform ELCAM with a base case showed a positive net energy value (NEV) = 25,500 Btu/gal EtOH. ELCAM cases were used to identify factors that most impact sorghum use. For example, a yield increase of 40 bu/ac resulted in NEV increasing from 7 million to 12 million Btu/ac. An 8% increase in starch provided an incremental 1.2 million Btu/ac.
Characterizing Sorghum Panicles using 3D Point Clouds
Lonesome, M.; Popescu, S. C.; Horne, D. W.; Pugh, N. A.; Rooney, W.
2017-12-01
To address demands of population growth and impacts of global climate change, plant breeders must increase crop yield through genetic improvement. However, plant phenotyping, the characterization of a plant's physical attributes, remains a primary bottleneck in modern crop improvement programs. 3D point clouds generated from terrestrial laser scanning (TLS) and unmanned aerial systems (UAS) based structure from motion (SfM) are a promising data source to increase the efficiency of screening plant material in breeding programs. This study develops and evaluates methods for characterizing sorghum (Sorghum bicolor) panicles (heads) in field plots from both TLS and UAS-based SfM point clouds. The TLS point cloud over experimental sorghum field at Texas A&M farm in Burleston County TX were collected using a FARO Focus X330 3D laser scanner. SfM point cloud was generated from UAS imagery captured using a Phantom 3 Professional UAS at 10m altitude and 85% image overlap. The panicle detection method applies point cloud reflectance, height and point density attributes characteristic of sorghum panicles to detect them and estimate their dimensions (panicle length and width) through image classification and clustering procedures. We compare the derived panicle counts and panicle sizes with field-based and manually digitized measurements in selected plots and study the strengths and limitations of each data source for sorghum panicle characterization.
Sorghum as an alternative of cultivation to maize; Sorghumhirse als Anbaualternative zum Mais
Energy Technology Data Exchange (ETDEWEB)
Jaekel, Kerstin; Theiss, Markus; Poetzschke, Karen [Saechsisches Landesamt fuer Umwelt, Landwirtschaft und Geologie (LfULG), Dresden (Germany)] [and others
2013-10-01
Due to their high dry matter yield potential Sorghum bicolor and Sorghum bicolor x sudanense are well fitted as feedstock for biogas production. Similar to maize, both species show a high efficiency in their use of water (C4-plants). However, Sorghum has a higher drought tolerance in comparison with maize but is more sensitive to low temperatures. Hence a cultivation of Sorghum is recommendable especially in dry and relatively warm regions, including recultivated areas and even on loess soil, provided that the required temperatures are given. Due to the fact that Sorghum is not affected by the corn root worm, it also could gain relevance in regions were the cultivation of maize is restricted. Furthermore, Sorghum is usable as a catch crop as well as a main crop because of its variable sowing time. Catch crop cultivation, however, yields a significantly lower amount of dry matter and -quality which is a result of its shorter vegetation period. Owing to its higher crude fiber concentration Sorghum achieves a lower theoretically attainable specific methane yield (Weissbach) than maize. Thus only on rare occasions Sorghum does achieve methane yields per hectare that are comparable to maize. Eventually, the competitiveness of Sorghum greatly depends on provision of enhanced cultivars achieved through genetic improvement. (orig.)
Effects of main traits of sweet sorghum irradiated by carbon ions
International Nuclear Information System (INIS)
Li Wenjian; He Jingyu; Liu Qingfang; Yu Lixia; Dong Xicun
2009-01-01
To investigate the influence of carbon ion irradiation on important agronomic characters of sweet sorghum, dry seeds of Sweet Sorghum BJ0601 and BJ0602 were irradiated by 100 MeV/u 12 C +6 ion beam to different doses at Heavy Ion Accelerator National Laboratory in Lanzhou (HIANLL). When matured, the main traits of sweet sorghum were measured. The correlation coefficient of five main agronomic characters, i.e. number of node, plant height, stalk diameter, sugar content and stem weight per plant, were analyzed using the SPSS 13.0 software. The results indicated that the obvious influence of sweet sorghum irradiated by carbon ion beam was observed. In addition, the correlation of main traits was studied. This study may provide rudimental data to select novel variety of sweet sorghum suited for fuel ethanol production. In addition, the average of sugar content of early mutant BJ0601-1 is higher than BJ0601 in M2, and the sugar content of sweet sorghum may be improved by carbon ion beam irradiation. (authors)
Directory of Open Access Journals (Sweden)
PASCAL D. C. AGBANGNAN
2012-06-01
Full Text Available The full phytochemical screening of red sorghum from Benin (Sorghum caudatum achieved in this work reveals the presence of leucoanthocyanins, flavonoides, free quinones, combined anthracene derivatives, sterols and terpenes in higher concentration in the leaf sheath and marrow of stem than in the seed. Catechin tannin content is 11.4% in the leaf sheath (slightly higher than that of red wine, 5.8% in the marrow and 2.8% in the seed. Gallic tannins, saponins and the mucilage present in the leaf sheath and marrow, are virtually absent in the seed. Marrow and leaf sheath extracts (1 g/50 mL showed a concentration of anthocyanins (147 mg/L and 213.5 mg/L similar to that of rosy wine and red wine with short maceration. The grain of sorghum is four times, respectively two times less rich in phenolic compounds than the leaf sheath and the marrow of stem.
Mutation breeding in sorghum (sorghum bicolor L.) for improving plant as ruminant feed
International Nuclear Information System (INIS)
H, Soeranto
1998-01-01
Mutation breeding using gamma irradiation in sorghum was aimed at improving the quality and production of sorghum plant as ruminant feed. Seeds of local sorghum variety Keris with moisture of about 14% were irradiated with gamma rays from Cobalt-60 source using the dose levels up to 0.5 kgy. The MI plant were grown in Pasar Jumat, the M2 and M3 were grown in Citayam experimental station. The M2 plants were harvested 40 days after sowing by cutting plants 20 cm above ground surface. Two weeks later observations for the ability of plants to produce new buds (buds variable). The plants green products in green products in from of their dry weight (product variable) were collected 40 days after harvesting and drying process in oven at 105 0 C for 24 hours. Plant selections with intensity of 20% were done for the bud variable among samples of M2 plants. Selection responses in the M3 were found to vary from the lowest at 0.5 kgy population (R s = 0.8507). The share of genetic factors to selection responses in bud variable varied from 7.25% at 0,5 kgy population to 22.35% at 0.3 kgy population. Selection for bud variable gave directly impact in increasing product variable in the M3. (author)
African Journals Online (AJOL)
sunny
2014-11-12
Nov 12, 2014 ... Biomass materials require reduction and densification for the purpose of handling and space requirements. Guinea corn (Sorghum bi-color) is a major source of biomass material in the tropic regions. The densification process involves some ... a closed-end die, the temperature and the use of binder.
Omslaget - hvid okseøje (Leucanthemum vulgare)
DEFF Research Database (Denmark)
Friis, Ib
2010-01-01
Artiklen redergør for den historiske baggrund for den illustration (tavle 994 fra Flora Danica, udgivet i 1790) af hvid okseøje (Leucanthemum vulgare), der er anvendt som illustration på festskriftets omslag. De illustratorer, der blev anvendt af Martin Vahl, udgiver af Flora Danica da tavle 994...
NDVI to Detect Sugarcane Aphid Injury to Grain Sorghum.
Elliott, N C; Backoulou, G F; Brewer, M J; Giles, K L
2015-06-01
Multispectral remote sensing has potential to provide quick and inexpensive information on sugarcane aphid, Melanaphis sacchari (Zehntner), pest status in sorghum fields. We describe a study conducted to determine if injury caused by sugarcane aphid to sorghum plants in fields of grain sorghum could be detected using multispectral remote sensing from a fixed wing aircraft. A study was conducted in commercial grain sorghum fields in the Texas Gulf Coast region in June 2014. Twenty-six commercial grain sorghum fields were selected and rated for the level of injury to sorghum plants in the field caused by sugarcane aphid. Plant growth stage ranged from 5.0 (watery ripe) to 7.0 (hard dough) among fields; and plant injury rating from sugarcane aphid ranged from 1.0 (little or no injury) to 4.0 (>40% of plants displaying injury) among fields. The normalized differenced vegetation index (NDVI) is calculated from light reflectance in the red and near-infrared wavelength bands in multispectral imagery and is a common index of plant stress. High NDVI indicates low levels of stress and low NDVI indicates high stress. NDVI ranged from -0.07 to 0.26 among fields. The correlation between NDVI and plant injury rating was negative and significant, as was the correlation between NDVI and plant growth stage. The negative correlation of NDVI with injury rating indicated that plant stress increased with increasing plant injury. Reduced NDVI with increasing plant growth probably resulted from reduced photosynthetic activity in more mature plants. The correlation between plant injury rating and plant growth stage was positive and significant indicating that plant injury from sugarcane aphid increased as plants matured. The partial correlation of NDVI with plant injury rating was negative and significant indicating that NDVI decreased with increasing plant injury after adjusting for its association with plant growth stage. We demonstrated that remotely sensed imagery acquired from grain
Electrochemical evaluation of sweet sorghum fermentable sugar bioenergy feedstock
Redox active constituents of sorghum, e.g., anthocyanin, flavonoids, and aconitic acid, putatively contribute to its pest resistance. Electrochemical reactivity of sweet sorghum stem juice was evaluated using cyclic voltammetry (CV) for five male (Atlas, Chinese, Dale, Isidomba, N98) and three fema...
Utilization of Iles-Iles and Sorghum Starch for Bioethanol Production
Directory of Open Access Journals (Sweden)
Kusmiyati Kusmiyati
2014-05-01
Full Text Available The aims of this study were to convert the starches from iles-iles tubers (Amorphophalus campanulatus and sorghum grains (Sorghum bicolor L into bioethanol as an alternative energy. Both of these agricultural products contains a high content starches and they do not use as the major foods in Indonesia. To find out the maximum ethanol concentration and yield, both the raw materials were converted to ethanol on various process variables including the concentration of flour substrate solution (100-300 g/L, β-amylase enzyme concentration (0.8 - 6.4 ml/kg of flour , the concentration of dry yeast S. cerevisiae (2-15 g, and fermentation time (72-168 hours. The results showed that at the flour substrate concentration of 250 g/L produced the maximum ethanol contents of 100.29 g/L and 95.11 g/L for iles-iles and sorghum, respectively. Effect of β-amylase enzyme in the saccharification process showed that at concentration of 3.2 ml/kg the maximum reducing sugar content of 204.94 g/L and 193.15 g/L for iles-iles and sorghum substrate, respectively were generated therefore it was corresponding to the maximum ethanol production. The concentration effect of dry yeast S. cerevisiae in the fermentation stage for the iles-iles and sorghum substrate revealed that the maximum ethanol obtained at 5 g yeast activated in 100 ml medium starter resulted the highest ethanol content 100.29 g/L 95.11 g/L for iles-iles and sorghum substrate, respectively. To determine the effect of fermentation time on ethanol yield from iles-iles and sorghum substrate, the fermentation process were performed at 3, 5, and 7 days. The maximum ethanol fermentation was obtained at 5 days fermentation. The ethanol yield is calculated by weight of ethanol is formed (g divided by the weight of flour (g. Based on the experiment results, conducted, generally the highest ethanol yield of iles-iles was higher than that of sorghum flour. The highest yield (g/g iles-iles and sorghum
Performance of elite grain sorghum varieties in the West Nile Agro ...
African Journals Online (AJOL)
ACSS
Ouma, J.P. and Akuja, T.E. 2013. Agronomic and morphological performance of sorghum (Sorghum bicolor L.) for the dry highlands of. Kenya. www.m.elewa.org. Schatz, B.G., Schneiter, A.A. and Gardner,. J.E. 1987. Effect of plant density on grain sorghum production in North. Dakota. pp. 16-17. Snider, J.L., Randy, L.R. and ...
Fungal endophytes of sorghum in Burkina Faso
DEFF Research Database (Denmark)
Zida, E P; Thio, I G; Néya, B J
2014-01-01
A survey was conducted to assess the natural occurrence and distribution of fungal endophytes in sorghum in relation to plant performance in two distinct agro-ecological zones in Burkina Faso. Sorghum farm-saved seeds were sown in 48 farmers’ fields in Sahelian and North Sudanian zones to produce...... sorghum plants. In each field, leaf samples were collected from five well-developed (performing) and five less-developed (non-performing) plants at 3-5 leaf stage, while at plant maturity leaf, stem and root samples were collected from the same plants and fungal endophytes were isolated. A total of 39...... fungal species belonging to 25 genera were isolated. The most represented genera included Fusarium, Leptosphaeria, Curvularia, Nigrospora and Penicillium. The genera Fusarium and Penicillium occurred significantly higher in performing plants as compared to non-performing plants while the genera...
Experimental study on bread yeast cultured in sweet sorghum juice
International Nuclear Information System (INIS)
Wang Jufang; Dong Xicun; Li Wenjian; Xiao Guoqing; Ma Liang; Gao Feng
2008-01-01
As a substitute for food supplies, sweet sorghum juice with high grade has demonstrated out- standing advantage in fermentation. To obtain the optimized fermentation conditions, the growth, the bio- mass of bread yeast cultured in sweet sorghum juice and total residual sugar were investigated in the paper. The fermentation was performed and optimized in a 10-100 1 bio-reactor. The results show that the application of sweet sorghum juice in bread yeast production is very potential. (authors)
Sorghum stem yield and soluble carbohydrates under different ...
African Journals Online (AJOL)
STORAGESEVER
2008-11-19
Nov 19, 2008 ... The aim of this study was to select the most suitable cultivar for salty land in this geographical area. Two sweet sorghum cultivars (Keller and Sofra) and one grain sorghum cultivar (Kimia) were grown in greenhouse benches under four salinity levels of 2, 4, 8 and 12 dSm-1 to evaluate the effects of salinity.
Morphological characteristics of BRS 501 sweet sorghum under water stress
Directory of Open Access Journals (Sweden)
Luciano Rezende Moreira
2016-12-01
Full Text Available Sorghum [Sorghum bicolor (L. Moench] crop is distinguished from other crops for its tolerance to both water deficit and excess soil moisture, under very dry and/or very hot environmental situations in which the productivity of other cereals becomes uneconomical. This work was conducted to evaluate the effects of irrigation on root conformation at the initial development phase of sweet sorghum. So, BRS 501 cv. was subjected to four irrigation levels based on 80%, 60%, 40% and 20% of the field capacity (CC. The decreased availability of water in the soil negatively affected the majority of the characteristics under evaluation except for the relationship between the root system and the aerial part (SR/PA, average root diameter (DMR and specific root area (ARE. We concluded that the growth of sweet sorghum plants under evaluation is sensible to the decrease of water in the soil, as it is affected by low water availability. This methodology, common to other crops, can be used for saccharine sorghum in order to establish hydric availabilities in new experiments to discriminate the drought-tolerant cultivars.
Directory of Open Access Journals (Sweden)
Evaline Chepng’etich
2015-01-01
Full Text Available Majority of the rural households in Kenya depend on agriculture as a source of food and livelihood. Agricultural productivity has been declining due to many factors resulting in increased food insecurity in the country. Consequently, there is a renewed interest in promoting drought-tolerant crops such as sorghum which thrives in the arid and semiarid lands of the developing world. However, performance of sorghum production among the smallholder farmers has still remained low. This study was thus carried out to identify factors that influence technical efficiency of sorghum production among smallholder farmers in Machakos and Makindu districts of the lower eastern Kenya. Collected data on farm and farmer characteristics were analysed by use of descriptive statistics and Tobit model. Result highlights show that technical efficiency was influenced positively by formal education level of the household, experience in sorghum farming, membership in farmers associations, use of hired labour, production advice, and use of manure. Surprisingly household size, meant to enhance labour, had a negative influence. To increase technical efficiency, efforts should focus on improving information flows on agronomic practices. Farmers should also be encouraged to form and actively participate in various farmers associations, which enhance learning and pooling of labour resources, hence improving technical efficiency.
Energy sorghum--a genetic model for the design of C4 grass bioenergy crops.
Mullet, John; Morishige, Daryl; McCormick, Ryan; Truong, Sandra; Hilley, Josie; McKinley, Brian; Anderson, Robert; Olson, Sara N; Rooney, William
2014-07-01
Sorghum is emerging as an excellent genetic model for the design of C4 grass bioenergy crops. Annual energy Sorghum hybrids also serve as a source of biomass for bioenergy production. Elucidation of Sorghum's flowering time gene regulatory network, and identification of complementary alleles for photoperiod sensitivity, enabled large-scale generation of energy Sorghum hybrids for testing and commercial use. Energy Sorghum hybrids with long vegetative growth phases were found to accumulate more than twice as much biomass as grain Sorghum, owing to extended growing seasons, greater light interception, and higher radiation use efficiency. High biomass yield, efficient nitrogen recycling, and preferential accumulation of stem biomass with low nitrogen content contributed to energy Sorghum's elevated nitrogen use efficiency. Sorghum's integrated genetics-genomics-breeding platform, diverse germplasm, and the opportunity for annual testing of new genetic designs in controlled environments and in multiple field locations is aiding fundamental discovery, and accelerating the improvement of biomass yield and optimization of composition for biofuels production. Recent advances in wide hybridization between Sorghum and other C4 grasses could allow the deployment of improved genetic designs of annual energy Sorghums in the form of wide-hybrid perennial crops. The current trajectory of energy Sorghum genetic improvement indicates that it will be possible to sustainably produce biofuels from C4 grass bioenergy crops that are cost competitive with petroleum-based transportation fuels. © The Author 2014. Published by Oxford University Press on behalf of the Society for Experimental Biology. All rights reserved. For permissions, please email: journals.permissions@oup.com.
Foderstater för ökad konsumtion av vallfoder
DEFF Research Database (Denmark)
Hetta, M.; Lund, Peter; Tahir, M.N.
2011-01-01
nedbrytningen från våmmen till tunntarmen. Nedbrytning av stärkelse i tunntarmen leder till högre energieffektivitet i ämnesomsättningen. Stärkelse hos korn (Hordeum Vulgare, L) anses i litteraturen ha en snabb omsättning i våmmen och stärkelse hos majs (Zea Mays, L) anses ha en långsam nedbrytning (Mills et al...
Toxicities of TNT and RDX to Terrestrial Plants in Five Soils with Contrasting Characteristics
2013-07-01
lettuce ( Lactuca sativa (L.)) and barley (Hordeum vulgare (L.)), respectively, at analytically determined soil concentrations up to and including 3320... sativa L.), Japanese millet (J. millet; Echinochloa crus-galli L. [Beauv.]), and perennial ryegrass (Lolium perenne L.) in five natural soils that...of the test. The test species in these studies were Medicago sativa (L.) var. Canada no. 1 (alfalfa), Echinochloa crus-galli (L.) P. Beauv. var
The Phytotoxicity of Designated Pollutants on Plant Species
1984-03-01
Only seeds collected from those flowers exposed during pollin 20. DISTRIBUTION/AVAILABILITY OF ABSTRACT 21. ABSTRACT SECURITY CLASSIFICATION...acid exposure during pollination lowered the germination rate of mature seeds. Plant injury was chiefly a function of acid concentration, but amount...TESTS Species Name Variety Barley Hordeum vulgare L. CM67 Bean Phaseolus vulgaris L. Pinto Citrus Citrus limon (L.) Lupe Lemon Lettuce Lactuca sativa
Sorghum - An alternative energy crop for marginal lands and reclamation sites
Lukas, Stefan; Theiß, Markus; Jäkel, Kerstin
2017-04-01
The production of biogas and the associated cultivation of energy crops are still of great importance. Considering increasing restrictions for the cultivation of standard biogas crop maize regarding an environmentally friendly production of biomass, a wider range of energy crops is needed. The cultivation of sorghum can contribute to this. As maize, sorghum is a C4-plant and offers a high biomass yield potential. Originated in the semi-arid tropics, sorghum is well adapted to warm and dry climate and particularly noted for its drought tolerance compared to maize. It also makes few demands on soil quality and shows a good capability of nutrient acquisition. Therefore, particularly on marginal areas and reclamation sites with low soil nutrient and water content sorghum can contribute to secure crop yield and income of farmers. The applied research project aims at and reflects on the establishment of sorghum as a profitable and ecological friendly cropping alternative to maize, especially in the face of probable climate change with increasing risks for agriculture. For this purpose, site differentiated growing and cultivar trials with a standardized planting design as well as several practical on-farm field experiments were conducted. The agronomical and economic results will lead to scientifically based procedures and standards for agricultural practice with respect to cultivation methods (drilling, pest-management, fertilization), cropping sequence and technique, cropping period or position in crop rotation. Even by now there is a promising feedback from the agricultural practice linked with an increasing demand for information. Moreover, the specific cropping area is increasing continuously. Therefore, the leading signs for the establishment of sorghum as profitable alternative to maize biogas production are positive. Sorghum cultures perform best as main crops in the warm D locations in the middle and East German dry areas. Here, the contribution margin
Antimicrobial evaluation of red, phytoalexin-rich sorghum food biocolorant
Akogou, Folachodé U.G.; Besten, Den Heidy M.W.; Polycarpe Kayodé, A.P.; Fogliano, Vincenzo; Linnemann, Anita R.
2018-01-01
Sorghum (Sorghum bicolor) extract is traditionally used as red biocolorant in West Africa to colour foods, among which wagashi, a soft cheese. This biocolorant is a source of the phytoalexin apigeninidin and phenolic acids, and users claim that it has preservative effects next to its colouring
Directory of Open Access Journals (Sweden)
Roghayyeh Sheykhbaglou
2014-03-01
Full Text Available Seed priming methods have been used to increases germination characteristics under stress conditions. The study aimed was to determine the effect of salicylic acid and gibberellin on seed reserve utilization, germination and enzyme activity of sorghum (Sorghum bicolor L. seeds under drought stress. Factorial experiment was carried out in completely randomized design with three replications. The first factor was the seed treatments (unpriming, salicylic acid and gibberellin and the second factor was drought stress (0, -4, -8 and -12 bar. The results indicated that for these traits: germination percentage, germination index, weight of utilized (mobilized seed, seed reserve utilization efficiency, seedling dry weight and seed reserve depletion percentage was a significant treatment Ч drought interaction. Thus priming improved study traits in Sorghum (Sorghum bicolor L. seeds under drought stress. Also, priming improves enzyme activity as compared to the unprimed seeds.
Karakteristik Sensori dan Fisiko-Kimia Beras Analog Sorghum dengan Penambahan Rempah Campuran
Directory of Open Access Journals (Sweden)
Maya Indra Rasyid
2017-02-01
Full Text Available The purpose of this study was to obtain the formula of sorghum rice analogue by mixed spices addition with acceptable sensory and physico-chemical characteristics. The selection of sorghum rice analogue formula was tested by using hedonic test with 70 untrained panelists. The addition of mixed spices powder was as follows: 30 % onion, 20 % garlic, 10 % bay leaves, 20 % ginger and 20 % lemongrass. Those mixed spices powder were added to the sorghum rice analogue at percentage of 0.25 %, 0,5 %, 1 %, 2 %, 3 % and 0 % (control from total dough weight. The sorghum rice analogue was made using extrusion technology (a twin screw extruder. The overall sensory evaluation result showed that the addition of spice mixed had significant effect (p ≤ 0.05 on the characteristics of sorghum rice analogue. The panelists accepted the sorghum rice analogue with 1% mixed spice. The preferred formulation was the addition of 1% mixed spice which contain of 9.56 % moisture, 0.72 % ash, 0.53 % fat, 6.22 % protein, 92.53 % carbohydrate, 26.48 % amyloseand 6,67 % dietary fiber. Sorghum rice analogue enriched by spices is a potential as a rich fiber source. ABSTRAK Tujuan penelitian adalah mendapatkan formula beras analog berbahan dasar sorgum dengan penambahan rempah campuran yang dapat diterima secara sensori. Pemilihan formula dilakukan dengan uji hedonik menggunakan 70 orang panelis tidak terlatih. Rempah yang ditambahkan berupa bubuk rempah campuran yang terdiri atas bawang merah 30%, bawang putih 20 %, daun salam 10 %, jahe 20 % dan sereh 20 %. Penambahan bubuk rempah campuran untuk pembuatan beras analog sorghum berturut-turut 0,25 %, 0,5 %, 1 %, 2 %, 3 % dan kontrol (tanpa rempah dari total berat adonan diluar air. Beras analog sorghum dibuat dengan teknologi ekstrusi menggunakan ekstruder ulir ganda. Hasil uji sensori secara keseluruhan menunjukkan bahwa penambahan rempah campuran berpengaruh nyata (p <0,05 terhadap nasi beras analog yang dihasilkan
Registration of six grain sorghum pollinator (R) lines
Six sorghum [Sorghum bicolor (L.) Moench] pollinators [KS142R (Reg. No. PI XXXX), KS143R (Reg. No. PI XXXX), KS144R (Reg.No. PI XXXX), KS145R (Reg. No. PI XXXX), KS146R (Reg. No. PI XXXX) and KS147R (Reg. No. PI XXXX) were developed from random mating using a recurrent selection followed by pedigree...
Effect of Excessive Soil Moisture Stress on Sweet Sorghum: Physiological Changes and Productivity
International Nuclear Information System (INIS)
Zhang, F.; Wang, Y.; Yu, H.; Zhu, K.; Zhang, Z.; Zou, F. L. J.
2016-01-01
Sweet sorghum [Sorghum bicolor (L.) Moench] is a potential bioenergy feedstock. Research explaining the response of sweet sorghum to excessive soil moisture (EM) stress at different growth stage is limited. To investigate the effect of EM stress on sweet sorghum antioxidant enzymes, osmotic regulation, biomass, quality, and ethanol production, an experiment was conducted in a glasshouse at the National Sorghum Improvement Center, Shenyang, China. Sweet sorghum (cv. LiaoTian1) was studied in four irrigation treatments with a randomized block design method. The results showed that the protective enzyme, particularly the SOD, CAT and APX in it, was significantly affected by EM stress. EM stress deleteriously affected sweet sorghum growth, resulting in a remarkable reduction of aboveground biomass, stalk juice quality, stalk juice yield, and thus, decreased ethanol yield. EM stress also caused significant reduction in plant relative water content, which further decreased stalk juice extraction rate. Sweet sorghum grown under light, medium, and heavy EM treatments displayed 5, 19, and 30% fresh stalk yield reduction, which showed a significant difference compared to control. The estimated juice ethanol yield significantly declined from 1407 ha/sup -1/ (under optimum soil moisture) to 1272, 970, and 734 L ha/sup -1/ respectively. (author)
Effect of gamma irradiation on chemical composition and nutritive value of sorghum grains
International Nuclear Information System (INIS)
Mekkawy, S.H.
1996-01-01
Sorghum grains were gamma irradiated at 0, 10, 50, 100, 150 and 200 KGy doses using cobalt-60 source. Irradiated and unirradiated sorghum samples were analyzed for crude fiber contents, total nitrogen, fat, ash and tannic acid. Neutral-detergent fiber (NDF), acid-detergent fiber (ADF) and acid detergent lignin (ADL) were also determined. In addition, digestibility coefficient received special attention. The irradiated sorghum grains were incorporated into basal diets and fed to rats during the digestion trials. The results indicated that gamma irradiation had no effects on total nitrogen, fat and ash contents of sorghum grains. Irradiation treatments of sorghum did not cause a pronounced effect on tannic acid content even those received the highest irradiation dose (200 kGy). Moreover, the irradiation treatments decreased the NDF content of sorghum especially those subjected to 100 or 200 kGy. On the other hand, the ADF and ADL values did not show a remarkable change due to irradiation treatments. Hemicellulose content was decreased with the increase of irradiation dose levels. Also, it was noticed that feeding rats on basal diets enriched with irradiated sorghum grains had a beneficial effects on digestibility coefficient. This trend was obvious with animals supplemented with sorghum grains subjected to the relatively high irradiation dose levels. 4 tabs
Predominant lactic acid bacteria associated with the traditional malting of sorghum grains
DEFF Research Database (Denmark)
Sawadogo-Lingani, H.; Diawara, B.; Glover, R.K.
2010-01-01
dominated the microbiota from sorghum grains to malted sorghum. These isolates had technological properties comparable to those responsible for the acidification of sorghum beer (dolo, pito) wort produced from sorghum malt (previously studied), suggesting their potential for use as starter cultures....... Suitable isolates of L. fermentum are promising candidates to be used as starter cultures from the initial step of malting, that is, the steeping and are expected to inhibit the growth and survival of pathogens and spoilage microflora, and to control the lactic fermentation of dolo and pito wort or other...
Performance evaluation of biomass sorghum in Hawaii and Texas
Although biomass sorghum [Sorghum bicolor (L.) Moench] has been identified as a high yielding bioenergy feedstock crop on the continental USA, there is lack of conclusive data on its performance in HI. The objective of this study was to (i) determine the adaptability and productivity of two biomass...
Effect of Sources and Storage Conditions on Quality of Sorghum ...
African Journals Online (AJOL)
The germination test of sorghum seeds varied highly significantly (P<0.001) from Kwimba. 74%, Chamwino .... Mean separation test was done using Least. Significance ... for QDS sorghum is 98%. One dot represents more than one sample.
Characteristics of African traditional beers brewed with sorghum malt: a review
Directory of Open Access Journals (Sweden)
Lyumugabe, F.
2012-01-01
Full Text Available Traditional sorghum beers are produced in several countries of Africa, but variations in the manufacturing process may occur depending on the geographic localization. These beers are very rich in calories, B-group vitamins including thiamine, folic acid, riboflavin and nicotinic acid, and essential amino acids such as lysine. However, the traditional sorghum beer is less attractive than Western beers because of its poorer hygienic quality, organoleptic variations and shorter shelf life. Research into the microbiological and biochemical characteristics of traditional sorghum beers as well as their technologies have been performed and documented in several African countries. This review aims to summarize the production processes and compositional characteristics of African traditional sorghum beers (ikigage, merissa, doro, dolo, pito, amgba and tchoukoutou. It also highlights the major differences between these traditional beers and barley malt beer, consumed worldwide, and suggests adaptations that could be made to improve the production process of traditional sorghum beer.
Genomic dissection of anthracnose resistant response in sorghum [Sorghum bicolor (L.)
The goal of this project is to use a genomics-based approaches to identify anthracnose resistance loci from diverse sorghum germplasm as an effort to the disease resistance mechanism of at least one of these genes. This information will provide plant breeders with a tool kit that can be used to maxi...
Prospecting for Energy-Rich Renewable Raw Materials: Sorghum Stem Case Study.
Byrt, Caitlin S; Betts, Natalie S; Tan, Hwei-Ting; Lim, Wai Li; Ermawar, Riksfardini A; Nguyen, Hai Yen; Shirley, Neil J; Lahnstein, Jelle; Corbin, Kendall; Fincher, Geoffrey B; Knauf, Vic; Burton, Rachel A
2016-01-01
Sorghum vegetative tissues are becoming increasingly important for biofuel production. The composition of sorghum stem tissues is influenced by genotype, environment and photoperiod sensitivity, and varies widely between varieties and also between different stem tissues (outer rind vs inner pith). Here, the amount of cellulose, (1,3;1,4)-β-glucan, arabinose and xylose in the stems of twelve diverse sorghum varieties, including four photoperiod-sensitive varieties, was measured. At maturity, most photoperiod-insensitive lines had 1% w/w (1,3;1,4)-β-glucan in stem pith tissue whilst photoperiod-sensitive varieties remained in a vegetative stage and accumulated up to 6% w/w (1,3;1,4)-β-glucan in the same tissue. Three sorghum lines were chosen for further study: a cultivated grain variety (Sorghum bicolor BTx623), a sweet variety (S. bicolor Rio) and a photoperiod-sensitive wild line (S. bicolor ssp. verticilliflorum Arun). The Arun line accumulated 5.5% w/w (1,3;1,4)-β-glucan and had higher SbCslF6 and SbCslH3 transcript levels in pith tissues than did photoperiod-insensitive varieties Rio and BTx623 (<1% w/w pith (1,3;1,4)-β-glucan). To assess the digestibility of the three varieties, stem tissue was treated with either hydrolytic enzymes or dilute acid and the release of fermentable glucose was determined. Despite having the highest lignin content, Arun yielded significantly more glucose than the other varieties, and theoretical calculation of ethanol yields was 10 344 L ha-1 from this sorghum stem tissue. These data indicate that sorghum stem (1,3;1,4)-β-glucan content may have a significant effect on digestibility and bioethanol yields. This information opens new avenues of research to generate sorghum lines optimised for biofuel production.
Prospecting for Energy-Rich Renewable Raw Materials: Sorghum Stem Case Study.
Directory of Open Access Journals (Sweden)
Caitlin S Byrt
Full Text Available Sorghum vegetative tissues are becoming increasingly important for biofuel production. The composition of sorghum stem tissues is influenced by genotype, environment and photoperiod sensitivity, and varies widely between varieties and also between different stem tissues (outer rind vs inner pith. Here, the amount of cellulose, (1,3;1,4-β-glucan, arabinose and xylose in the stems of twelve diverse sorghum varieties, including four photoperiod-sensitive varieties, was measured. At maturity, most photoperiod-insensitive lines had 1% w/w (1,3;1,4-β-glucan in stem pith tissue whilst photoperiod-sensitive varieties remained in a vegetative stage and accumulated up to 6% w/w (1,3;1,4-β-glucan in the same tissue. Three sorghum lines were chosen for further study: a cultivated grain variety (Sorghum bicolor BTx623, a sweet variety (S. bicolor Rio and a photoperiod-sensitive wild line (S. bicolor ssp. verticilliflorum Arun. The Arun line accumulated 5.5% w/w (1,3;1,4-β-glucan and had higher SbCslF6 and SbCslH3 transcript levels in pith tissues than did photoperiod-insensitive varieties Rio and BTx623 (<1% w/w pith (1,3;1,4-β-glucan. To assess the digestibility of the three varieties, stem tissue was treated with either hydrolytic enzymes or dilute acid and the release of fermentable glucose was determined. Despite having the highest lignin content, Arun yielded significantly more glucose than the other varieties, and theoretical calculation of ethanol yields was 10 344 L ha-1 from this sorghum stem tissue. These data indicate that sorghum stem (1,3;1,4-β-glucan content may have a significant effect on digestibility and bioethanol yields. This information opens new avenues of research to generate sorghum lines optimised for biofuel production.
Transcriptome Characterization and Functional Marker Development in Sorghum Sudanense.
Directory of Open Access Journals (Sweden)
Jieqin Li
Full Text Available Sudangrass, Sorghum sudanense, is an important forage in warm regions. But little is known about its genome. In this study, the transcriptomes of sudangrass S722 and sorghum Tx623B were sequenced by Illumina sequencing. More than 4Gb bases were sequenced for each library. For Tx623B and S722, 88.79% and 83.88% reads, respectively were matched to the Sorghum bicolor genome. A total of 2,397 differentially expressed genes (DEGs were detected by RNA-Seq between the two libraries, including 849 up-regulated genes and 1,548 down-regulated genes. These DEGs could be divided into three groups by annotation analysis. A total of 44,495 single nucleotide polymorphisms (SNPs were discovered by aligning S722 reads to the sorghum reference genome. Of these SNPs, 61.37% were transition, and this value did not differ much between different chromosomes. In addition, 16,928 insertion and deletion (indel loci were identified between the two genomes. A total of 5,344 indel markers were designed, 15 of which were selected to construct the genetic map derived from the cross of Tx623A and Sa. It was indicated that the indel markers were useful and versatile between sorghum and sudangrass. Comparison of synonymous base substitutions (Ks and non-synonymous base substitutions (Ka between the two libraries showed that 95% orthologous pairs exhibited Ka/Ks<1.0, indicating that these genes were influenced by purifying selection. The results from this study provide important information for molecular genetic research and a rich resource for marker development in sudangrass and other Sorghum species.
76 FR 314 - Sorghum Promotion, Research, and Information Program: Referendum
2011-01-04
... DEPARTMENT OF AGRICULTURE Agricultural Marketing Service [Doc. No. AMS-LS-10-0103] Sorghum Promotion, Research, and Information Program: Referendum AGENCY: Agricultural Marketing Service, USDA. ACTION: Notice of Opportunity to Participate in the Sorghum Promotion, Research, and Information...
Directory of Open Access Journals (Sweden)
Jonathan Brassac
Full Text Available Polyploidization is a major mechanism of speciation in plants. Within the barley genus Hordeum, approximately half of the taxa are polyploids. While for diploid species a good hypothesis of phylogenetic relationships exists, there is little information available for the polyploids (4×, 6× of Hordeum. Relationships among all 33 diploid and polyploid Hordeum species were analyzed with the low-copy nuclear marker region TOPO6 for 341 Hordeum individuals and eight outgroup species. PCR products were either directly sequenced or cloned and on average 12 clones per individual were included in phylogenetic analyses. In most diploid Hordeum species TOPO6 is probably a single-copy locus. Most sequences found in polyploid individuals phylogenetically cluster together with sequences derived from diploid species and thus allow the identification of parental taxa of polyploids. Four groups of sequences occurring only in polyploid taxa are interpreted as footprints of extinct diploid taxa, which contributed to allopolyploid evolution. Our analysis identifies three key species involved in the evolution of the American polyploids of the genus. (i All but one of the American tetraploids have a TOPO6 copy originating from the Central Asian diploid H. roshevitzii, the second copy clustering with different American diploid species. (ii All hexaploid species from the New World have a copy of an extinct close relative of H. californicum and (iii possess the TOPO6 sequence pattern of tetraploid H. jubatum, each with an additional copy derived from different American diploids. Tetraploid H. bulbosum is an autopolyploid, while the assumed autopolyploid H. brevisubulatum (4×, 6× was identified as allopolyploid throughout most of its distribution area. The use of a proof-reading DNA polymerase in PCR reduced the proportion of chimerical sequences in polyploids in comparison to Taq polymerase.
Factors Influencing the Adoption of Improved Sorghum Varieties in ...
African Journals Online (AJOL)
The findings of the study indicated that age and distance to input market were negatively and significantly related to improved sorghum varieties whereas farm size and type of house owned were found to have been positively and significantly related to improved sorghum varieties. The results of the study confirm that ...
Millet and corn oil in sorghum-based diets for broilers
Directory of Open Access Journals (Sweden)
João Paulo Rodrigues Bueno
2015-12-01
Full Text Available ABSTRACT: This study evaluated the effects of millet and corn oil additions to sorghum-based diets on the performance, carcass yields and prime cuts (i.e., wings, breasts, thighs and drumsticks and the relative weights of edible offal (i.e., gizzard, heart, and liver of broiler chickens. A total of 684 Hubbard Flex chickens, including 342 broilers of each sex, were housed. The design was completely randomized, and the following diets were supplied: A sorghum and soybean meal + soybean oil (control; B sorghum and soybean meal + corn oil; and C sorghum and soybean meal + millet and soybean oil. Six replicates with 38 birds each (19 males and 19 females were evaluated regarding each experimental diet. At 14, 21, 35 and 42 days of age, the feed intake, weight gain, feed conversion and viability of the chickens were evaluated. At 42 days, the live weight, carcass yield, prime cuts and relative weight of the edible offal were measured. The dietary inclusion of either millet or corn oil did not affect any of the parameters. In conclusion, additions of millet and corn oil to sorghum-based diets of broilers do not compromise poultry performance.
Antibacterial activity of whole plant extract of Marrubium vulgare
African Journals Online (AJOL)
SERVER
2007-11-26
Nov 26, 2007 ... Key words: Disc diffusion, antibacterial activity, Marrubium vulgare. INTRODUCTION .... Glossary of Indian Medicinal. Plants, CSIR, V ed. ... 22. E. coli MTCC 443. 0. 0. 0. 10. 15. 400. 25. P. vulgaris MTCC 426. 0. 0. 0. 11. 16.
Directory of Open Access Journals (Sweden)
Shamkant B. Badgujar
2014-01-01
Full Text Available Foeniculum vulgare Mill commonly called fennel has been used in traditional medicine for a wide range of ailments related to digestive, endocrine, reproductive, and respiratory systems. Additionally, it is also used as a galactagogue agent for lactating mothers. The review aims to gather the fragmented information available in the literature regarding morphology, ethnomedicinal applications, phytochemistry, pharmacology, and toxicology of Foeniculum vulgare. It also compiles available scientific evidence for the ethnobotanical claims and to identify gaps required to be filled by future research. Findings based on their traditional uses and scientific evaluation indicates that Foeniculum vulgare remains to be the most widely used herbal plant. It has been used for more than forty types of disorders. Phytochemical studies have shown the presence of numerous valuable compounds, such as volatile compounds, flavonoids, phenolic compounds, fatty acids, and amino acids. Compiled data indicate their efficacy in several in vitro and in vivo pharmacological properties such as antimicrobial, antiviral, anti-inflammatory, antimutagenic, antinociceptive, antipyretic, antispasmodic, antithrombotic, apoptotic, cardiovascular, chemomodulatory, antitumor, hepatoprotective, hypoglycemic, hypolipidemic, and memory enhancing property. Foeniculum vulgare has emerged as a good source of traditional medicine and it provides a noteworthy basis in pharmaceutical biology for the development/formulation of new drugs and future clinical uses.
Inclusion of sweet sorghum flour in bread formulations | Araujo ...
African Journals Online (AJOL)
Sweet sorghum (Sorghum bicolor L. Moench) has been studied as an additional source of raw material for production or partial replacement of foods due to its high fiber concentration. Its consumption is associated with the prevention of some diseases and nutritional benefits. The aim of this study was to evaluate the partial ...
Directory of Open Access Journals (Sweden)
Shuyu Shen
2018-05-01
Full Text Available Sorghum grains with different applications had different phenolic profiles, which were corresponded to various antioxidant capacities. In this study, total phenolic, proanthocyanidins and flavonoids contents, as well as contents of individual phenolic compounds from sorghum grains with various applications were determined, and their antioxidant capacities were evaluated. Total phenolic contents (TPC and total proanthocyanidins contents (TPAC showed strong correlation with antioxidant activities (r > 0.95, p < 0.01. Hongyingzi (S-1, one of the brewing sorghums, showed the highest level of TPC and TPAC, while white grain sorghum (S-8 had the lowest. Except for black grain sorghum (S-7, that contained the highest contents of ferulic acid, brewing sorghum grains contained the higher contents of the most individual phenolic compounds, especially the variety S-1. The correlation among individual phenolic compounds and antioxidant activities indicated that the free forms of protocatechuic acid (r = 0.982 of FRAPassay, p < 0.01 and taxifolin (r = 0.826 of FRAP assay, p < 0.01 may be the main functional compounds. These results indicate that brewing sorghum grains can also be utilized as effective materials for functional foods.
Fermentation of sweet sorghum syrup to butanol in the presence of natural nutrients and inhibitors
Sweet sorghum syrups represent a renewable raw material that can be available year-round for production of biofuels and biochemicals. Sweet sorghum sugars have been used as sources for butanol production in the past but most often the studies focused on sweet sorghum juice and not on sweet sorghum s...
Effect of dietary oregano ( Origanum vulgare L.) essential oil on ...
African Journals Online (AJOL)
Effect of dietary oregano ( Origanum vulgare L.) essential oil on growth performance, cecal microflora and serum antioxidant activity of broiler chickens. ... promoting effects and also displayed potent antibacterial effects against cecal E. coli.
Energy Technology Data Exchange (ETDEWEB)
Wolfrum, E.
2011-10-01
The goal of this project was to investigate the feasibility of using sorghum to produce ethanol. The work performed included a detailed examination of the agronomics and composition of a large number of sorghum varieties, laboratory experiments to convert sorghum to ethanol, and economic and life-cycle analyses of the sorghum-to-ethanol process. This work showed that sorghum has a very wide range of composition, which depended on the specific sorghum cultivar as well as the growing conditions. The results of laboratory- and pilot-scale experiments indicated that a typical high-biomass sorghum variety performed very similarly to corn stover during the multi-step process required to convert biomass feedstocks to ethanol; yields of ethanol for sorghum were very similar to the corn stover used as a control in these experiments. Based on multi-year agronomic data and theoretical ethanol production, sorghum can achieve more than 1,300 gallons of ethanol per acre given the correct genetics and environment. In summary, sorghum may be a compelling dedicated bioenergy crop that could help provide a portion of the feedstocks required to produce renewable domestic transportation fuels.
Directory of Open Access Journals (Sweden)
Hyun-Geun Min
2017-09-01
Full Text Available Throughout year 2015 to 2016, 101 proso millet and 200 sorghum samples were collected from five provinces in South Korea. The samples were subjected to paired-end RNA sequencing and further analyzed by RT-PCR. The results indicated that Rice black-streaked dwarf virus (RBSDV was detected from sorghum collected in Gyeongsang province. The other four viruses, including RBSDV, Rice stripe virus (RSV, Barley virus G (BVG, and Cereal yellow dwarf virus (CYDV, were detected from proso millet. Among four viruses, both RSV and RBSDV were identified high frequency from proso millet collected from Gyeongsang province. Otherwise, BVG was nearly equally identified from five provinces, suggesting that the virus was supposedly widespread nationwide. RBSDV was first identified from both proso millet and sorghum in South Korea. The other virus annotated CYDV identified proso millet was shown to have relatively low identities compared to CYDV previously reported, suggesting that the virus might be new member of Polerovirus.
Identification of widely varying levels of resistance to meloidogyne incognita in sweet sorghum
Sweet sorghum (Sorghum bicolor) is a potential bioenergy crop that could be incorporated into annual cropping systems in the southern US, where it would likely be rotated with cotton. The desirability of including sweet sorghum in a cotton cropping system will be influenced by sweet sorghum’s host ...
An economic analysis of sweet sorghum cultivation for ethanol production in North China
Liu, H.; Ren, L.; Spiertz, J.H.J.; Zhu, Y.; Xie, G.H.
2015-01-01
Sweet sorghum [Sorghum bicolor (L.) Moench] is a promising non-food energy crop. The objective of this study was to determine the economic costs and input sensitivity of sweet sorghum compared to cotton, maize, and sunflower, at two saline-alkali sites in Shandong (Wudi County) and Inner Mongolia
Comparison of sorghum classes for grain and forage yield and forage nutritive value
Sorghum represents a broad category of plants that includes those grown primarily for forage (FS) or grain. Sorghum sudan crosses (SS) are also considered sorghum. Each of these groups can be further classified as brown midrib (BMR), nonBMR, photoperiod sensitive (PS), and nonPS. In our study, sor...
Directory of Open Access Journals (Sweden)
Alex de Matos Teixeira
2014-01-01
Full Text Available The purpose of this study was to evaluate the voluntary intake and digestibility of three sorghum (Sorghum bicolor, L. Moench hybrid silages in sheep. The hybrids used were H1 -BRS 655 (CMSXS 222 A × CMSXS 235 R, with tannin; H2 -(ATF54 A × CMSXS 235 R, without tannin; and H3 -BRS 610 (CMSXS 232 A × CMSXS 234 R, without tannin. The intake and digestibility of dry matter (DM, gross energy (GE, neutral detergent fiber (NDF, acid detergent fiber (ADF and crude protein (CP were measured. Eighteen crossbred sheep weighing 59.4 kg (±8.3 were used in the trial. A completely randomized design with three treatments (hybrids and six repetitions (sheep was used. There were no differences in the DM intake or apparent digestibility among the hybrids. Silage of hybrid BRS 610 displayed higher digestibility coefficients for CP, NDF, ADF, and GE compared with the other silages, which did not differ from each other. The neutral detergent fiber, ADF and digestible energy (DE intakes were similar among the hybrids silages. All of the hybrids resulted in a positive N balance in sheep. The levels of DE were superior in hybrid silage BRS 610 in comparison with the other hybrids. Sorghum hybrid BRS 610 silage exhibited superior nutritional value compared with the other hybrids, which is most likely in part due to the absence of tannins. Sorghum silage made with hybrid BRS 610 (CMSXS 232 A × CMSXS 234 R presents superior gross energy, crude protein, neutral detergent fiber and acid detergent fiber digestibility coefficients, as well as greater digestible energy levels than BRS 655 (CMSXS 222 A × CMSXS 235 R and (ATF54 A × CMSXS 235 R.
Direct conversion of sorghum carbohydrates to ethanol by a mixed microbial culture
Energy Technology Data Exchange (ETDEWEB)
Christakopoulos, Paul; Lianwu Li; Kekos, Dimitris; Macris, B.J. (National Technical Univ. of Athens (Greece). Dept. of Chemical Engineering)
1993-01-01
The carbohydrates of sweet sorghum were directly converted to ethanol by a mixed culture of Fusarium oxysporum F3 and Saccharomyces cerevisiae 2541. A number of factors affecting this bioconversion was studied. Optimum ethanol yields of 33.2 g/100 g of total sorghum carbohydrates, corresponding to 10.3 g/100 g of fresh stalks, were obtained. These values represented 68.6% of the theoretical yield based on total polysaccharides and exceeded that based on oligosaccharides of sorghum by 53.7%. The results demonstrated that more than half of the sorghum polysaccharides were directly fermented to ethanol, thus making the process worthy of further investigation. (author)
Directory of Open Access Journals (Sweden)
Stefan Reuscher
Full Text Available The concentrations of both essential nutrients and chemically similar toxic analogues accumulated in cereal grains have a major impact on the nutritional quality and safety of crops. Naturally occurring genetic diversity can be exploited for the breeding of improved varieties through introgression lines (ILs. In this study, multi-element analysis was conducted on vegetative leaves, senesced flag leaves and mature grains of a set of 54 ILs of the wild ancestral Hordeum vulgare ssp. spontaneum in the cultivated variety Hordeum vulgare ssp. vulgare cv. Scarlett. Plants were cultivated on an anthropogenically heavy metal-contaminated soil collected in an agricultural field, thus allowing simultaneous localization of quantitative trait loci (QTL for the accumulation of both essential nutrients and toxic trace elements in barley as a model cereal crop. For accumulation of the micronutrients Fe and Zn and the interfering toxin Cd, we identified 25, 16 and 5 QTL, respectively. By examining the gene content of the introgressions, we associated QTL with candidate genes based on homology to known metal homeostasis genes of Arabidopsis and rice. Global comparative analyses suggested the preferential remobilization of Cu and Fe, over Cd, from the flag leaf to developing grains. Our data identifies grain micronutrient filling as a regulated and nutrient-specific process, which operates differently from vegetative micronutrient homoeostasis. In summary, this study provides novel QTL for micronutrient accumulation in the presence of toxic analogues and supports a higher degree of metal specificity of trace element partitioning during grain filling in barley than previously reported for other cereals.
Directory of Open Access Journals (Sweden)
Xiaolin Yang
2018-03-01
Full Text Available Under dual pressures of energy and environmental security, sweet sorghum is becoming one of the most promising feedstocks for biofuel production. In the present study, the technical feasibility of sweet sorghum production was assessed in eight agricultural regions in China using the Sweet Sorghum Production Technique Maturity Model. Three top typical agricultural zones were then selected for further sustainability assessment of sweet sorghum production: Northeast China (NEC, Huang-Huai-Hai Basin (HHHB and Ganxin Region (GX. Assessment results demonstrated that NEC exhibited the best sustainable production of sweet sorghum, with a degree of technical maturity value of 0.8066, followed by HHHB and GX, with corresponding values of 0.7531 and 0.6594, respectively. Prospective economic profitability analysis indicated that bioethanol production from sweet sorghum was not feasible using current technologies in China. More efforts are needed to dramatically improve feedstock mechanization logistics while developing new bioethanol productive technology to reduce the total cost. This study provides insight and information to guide further technological development toward profitable industrialization and large-scale sweet sorghum bioethanol production.
Czech Academy of Sciences Publication Activity Database
Štroch, Michal; Materová, Z.; Vrábl, D.; Karlický, Václav; Šigut, Ladislav; Nezval, J.; Špunda, Vladimír
2015-01-01
Roč. 96, nov (2015), s. 90-96 ISSN 0981-9428 R&D Projects: GA MŠk(CZ) LO1415; GA MŠk(CZ) LM2010007 Grant - others:EHP(CZ) EHP-CZ02-OV-1-014-2014 Program:CZ02 Institutional support: RVO:67179843 Keywords : barley (Hordeum vulgare L.) * chlorophyll fluorescence * photosynthesis * photosynthetic pigments * UV-A radiation * UV-B radiation Subject RIV: BO - Biophysics Impact factor: 2.928, year: 2015
The Effects of Designated Pollutants on Plants
1978-11-01
Persea americana Mill. Haas and Bacon Barley Hordeum vulgare L. CM 67 Bean Phaseolus vulgaris L. Pinto, U.I. III Briza Briza maxima L. Ornamental...Tagetes patula L. French dwarf double goldie Marigold Tagetes erecta L. American ,Senator Dirksen Petunia Petunia hybrida Vilm. White cascade Radish...Probit analysis of five plant species: citrus seedlings, lemon, orange,, grape, French marigold, American marigold. Probit scale is the probability that a
Variability of barley aleurone layer induced by X-rays
Directory of Open Access Journals (Sweden)
Romuald Kosina
2015-05-01
Full Text Available A series of Hordeum vulgare cultivars was irradiated by X-rays to induce mutations in endosperm. Many structural defects of endosperm were revealed in plants irradiated 8 DAF. Change of a cell cycle was especially frequent and this was visible in the form of clones of small or large cells in the aleurone layer. X-irradiation appeared as a successful tool in the study of development.
Evers, Logan
2018-01-01
This article is intended for readers in the production agriculture industry who deal with grain sorghum throughout the growing season. This publication will discuss the impacts of the sugarcane aphid in various crops and the ways to manage and identify them as they continue to advance north.
Several varieties of sugar sorghum and their possibilities for alcohol production
Energy Technology Data Exchange (ETDEWEB)
Bergeret, P W; Fernandez, P W
1956-01-01
To study the possibility of using sugar sorghum as a raw material for the production of industrial alcohol, 17 sugar-sorghum varieties from the USA were grown experimentally under field conditions in Uruguay. The best were White African, Honey (Texas) T.S. 21001, and Axtell, which yielded 35,300, 34,200, and 32,450 kg. of stems (1271), 1539, and 14211.100% alcohol)/ha., respectively. The quantity of alcohol/ha obtained from sugar sorghum is almost 3 times that obtained from corn.
Begnini, Karine Rech; Nedel, Fernanda; Lund, Rafael Guerra; Carvalho, Pedro Henrique de Azambuja; Rodrigues, Maria Regina Alves; Beira, Fátima Tereza Alves; Del-Pino, Francisco Augusto Burkert
2014-10-01
Cancer is a leading cause of death and is responsible for one in eight deaths worldwide. The use of herbs as complementary medicine for cancer, especially advanced cancer, has recently increased. The aim of this study was to evaluate in vitro, the antiproliferative effect of Origanum vulgare against human breast adenocarcinoma (MCF-7), and human colon adenocarcinoma (HT-29). The essential oil (EO) was extracted from a bought amount of O. vulgare dried leaves and analyzed in a gas chromatograph interfaced with a mass selective detector. The cytotoxicity test was performed by sulforhodamine B assay. The results show that the EO is composed mostly of 4-terpineol and induces a high cytotoxicity effect in HT-29. In the MCF-7 cell line the EO was less effective. In conclusion, this study showed that O. vulgare main component is 4-terpineol and was effective in inducing cancer cell growth inhibition.
Impact of the Soak and the Malt on the Physicochemical Properties of the Sorghum Starches
Directory of Open Access Journals (Sweden)
Huiming Zhou
2010-08-01
Full Text Available Starches were isolated from soaked and malted sorghum and studied to understand their physicochemical and functional properties. The swelling power (SP and the water solubility index (WSI of both starches were nearly similar at temperatures below 50 °C, but at more than 50 °C, the starch isolated from malted sorghum showed lower SP and high WSI than those isolated from raw and soaked sorghum. The pasting properties of starches determined by rapid visco-analyzer (RVA showed that malted sorghum starch had a lower viscosity peak value (86 BU/RVU than raw sorghum starch (454 BU/RVU. For both sorghum, X-ray diffractograms exhibited an A-type diffraction pattern, typical of cereal starches and the relative degrees of crystallinity ranged from 9.62 to 15.50%. Differential scanning calorimetry (DSC revealed that raw sorghum starch showed an endotherm with a peak temperature (Tp at 78.06 °C and gelatinization enthalpies of 2.83 J/g whereas five-day malted sorghum starch had a Tp at 47.22 °C and gelatinization enthalpies of 2.06 J/g. Storage modulus (G′ and loss modulus (G″ of all starch suspensions increased steeply to a maximum at 70 °C and then decreased with continuous heating. The structural analysis of malted sorghum starch showed porosity on the granule’s surface susceptible to the amylolysis. The results showed that physicochemical and functional properties of sorghum starches are influenced by soaking and malting methods.
S Hasibi; H Farahbakhsh; Gh Khajoeinejad
2016-01-01
Introduction Nowadays, salinity is one of the limiting factors for crop production in arid and semi-arid regions. On the other hand, sorghum (Sorghum bicolor L.) is a self-pollinated and short-day plant, which partly has been adapted to salinity and water stress conditions; also play an important role in humans, livestock and poultry nourishments. All studies have showed the positive effects of Silicon on growth and yield of plants in both normal and stress conditions. The aim of this exp...
Directory of Open Access Journals (Sweden)
Jaime Humberto Bernal
2014-12-01
Full Text Available Sugar production in sweet sorghums is affected by the environment. Therefore, in this study on the effects of the genotype x environment interaction on sugar accumulation, plant traits associated with the sugar content in the stem were evaluated in ten sorghum genotypes grown in six contrasting environments. The results indicated that the stem dry weight, juice sugar concentration (°Brix, stem sugar content and juice volume were controlled by the genetic constitution of the genotype, with a large environmental contribution to their expression. The results allowed for the identification of the sweet sorghum genotypes that have a high potential for the biofuel agroindustry due to their high sugar contents in the environmental conditions of Palmira, Espinal, Cerete and Codazzi. Humid tropical environments such as Gaitan and Villavicencio were less favorable for the competitive production of sweet sorghums for bioethanol due to their low levels of solar radiation and soil fertility.
Three sorghum serpin recombinant proteins inhibit midgut trypsin activity and growth of corn earworm
The sorghum (Sorghum bicolor) genome contains at least 17 putative serpin (serine protease inhibitor) open reading frames, some of which are induced by pathogens. Recent transcriptome studies found that most of the putative serpins are expressed but their roles are unknown. Four sorghum serpins were...
FEEDING BROWN MIDRIB FORAGE SORGHUM SILAGE AND CORN GLUTEN FEED TO LACTATING DAIRY COWS
Brown midrib (BMR) forage sorghum contains less lignin , resulting in increased NDF digestibility compared to conventional sorghum . An experiment was conducted to evaluate the effects of BMR forage sorghum silage in diets containing wet corn gluten feed (WCGF). The objective was to determine the e...
Influence of Chemical Treatments Sequence on Morphology and Crystallinity of Sorghum Fibers
Directory of Open Access Journals (Sweden)
Ismojo Ismojo
2018-05-01
Full Text Available Micro-fibrillated cellulose (MFC derived from natural fibre is continuously gaining interest to produce an environmentally-friendly material, due to economic and ecological reasons. In consequence, sorghum is one of the most-cultivated crops that usually remain the waste as by product of bioethanol production. Indeed, it will be a promising area to utilize sorghum waste to produce MFC for enhancing polymer performance, especially in terms of crystallinity. The objective of this study is to investigate the effect of a sequence of chemical modification was applied to sorghum fibres, i.e. alkalization using 4% sodium hydroxide followed by bleaching using 1.7% sodium chlorite plus acetic acid as a buffer. The treatment was purposed to unbundle the lignocellulose networks into microfibrils cellulose with less amorphous part and lower hydrophilic properties. Evaluation of the chemical treatments effect on internal microstructure, crystallinity index and chemical composition of sorghum fibre was measured via Field-Emission Scanning Electron microscope (FE-SEM, X-ray Diffraction (XRD and Fourier Transformation Infra-Red (FTIR Spectroscopy. The experiments show that treatments led to a removal of binding materials, such as amorphous parts hemicellulose and lignin, from the sorghum fibres, resulting MFC of sorghum fibres and enhanced crystallinity index from 41.12 % to 75.73%.
Solid-state fermentation from dried sweet sorghum stalk for bioethanol production
Energy Technology Data Exchange (ETDEWEB)
Almodares, A.; Etemadifar, Z.; Omidi, A. [Univ. of Isfahan, Biology Dept., Univ. of Isfahan, Isfahan (Iran, Islamic Republic of)], e-mail: aalmodares@yahoo.com
2012-11-01
Due to depletion of global crude oil, countries are interested to alternate fuel energy resources. Presently bioethanol as a source of energy has been a subject of great interest for the industrialized countries. Therefore, there is need for efficient bioethanol production with low cost raw material and production process. Among energy crops, sweet sorghum is the best candidate for bioethanol production. It has been identified as having higher drought tolerance, lower input cost and higher biomass yield than other energy crops. In addition it has wide adoptability and tolerance to abiotic stresses. Moreover due to the shortage of water in dry and hot countries there is a need to reduce water requirement for bioethanol production and solid state fermentation could be the best process for making bioethanol in these countries. The purpose of this study is to achieve the highest ethanol production with lowest amount of water in solid state fermentation using sweet sorghum stalk. In this study the sweet sorghum particles were used for solid state fermentation. Fermentation medium were: sweet sorghum particles with nutrient media, active yeast powder and different moisture contents. The fermentation medium was incubated for 2-3 days at 30 deg C temperature. The results showed sweet sorghum particles (15% w/w) fermented in medium containing 0.5% yeast inoculums, 73.5% moisture content and 3 days incubation period produced the highest amount of ethanol (13% w/w sorghum)
Review of genetic basis of protein digestibility in Grain sorghum
Sorghum, an ancient crop of the semiarid tropics, plays a key role in food and nutritional security for over half-a-billion people in Africa and Asia. In industrialized nations, sorghum is cultivated as animal feed and more recently as a feedstock for biofuel production and as health food alternativ...
Sorghum cobalt analysis on not determined wave length with atomic ...
African Journals Online (AJOL)
This study was to know the better wave length on measuring cobalt content in forage sorghum hybrid (Sorghum bicolor) with an atomic absorption spectrophotometer. The analysis was on background correction mode with three wave lengths; 240.8, 240.7 (determined wave length or recommended wave length) and 240.6 ...
Souza,Evandro Leite de; Stamford,Tânia Lúcia Montenegro; Lima,Edeltrudes de Oliveira
2006-01-01
Origanum vulgare L. (oregano), Lamiaceae, has been known as plant specie with prominent biological properties for a long time. This study aimed to evaluate the antibacterial activity of Origanum vulgare essential oil on various Gram-positive and Gram-negative spoiling and/or pathogen food-related bacteria, as well as to observe its antimicrobial effectiveness in a food conservation micromodel. The results showed a strong antibacterial activity of the assayed essential oil noted by large growt...
108-110 Registration of Guta Barley (Hordeium vulgare L.)
African Journals Online (AJOL)
adoption potential by the local farmers. Keywords: Guta; Barley (Hordeium vulgare L); Yield ... evaluated along with Aruso and Shage as the local and standard variety, respectively at altitudinal range of 2400- ... 6. Farmers Evaluation of the Variety. To evaluate the perception and preferences of the local farmers, farmers' ...
Genetic diversity in barley landraces (Hordeum vulgare L. subsp ...
Indian Academy of Sciences (India)
SDS-PAGE was performed to separate the extracted pro- teins by using 12% separating and 5% stacking gels with a. Mini Protean System from Bio-Rad according to Laemmli modified method (Laemmli 1970). In this study, we adopted constant current electrophoresis instead of constant voltage. The loading of sample was ...
Genetic Variability in Barley (Hordeum vulgare l.) Landraces from ...
African Journals Online (AJOL)
segregating progenies with maximum genetic variability for selection. .... cultivar Clipper applied in slots of the first two, the tenth, and the last ... solution (50 ml glacial acetic acid, 200 ml methanol and 250 ml distilled water) ...... Adelaide, South.
Radiosensitivities of cultured barley of different type (Hordeum vulgare)
International Nuclear Information System (INIS)
Wang Cailian; Shen Mei; Xu Gang; Zhao Kongnan
1990-01-01
The dormant seeds (with 13% moisture) of 47 barley varieties were irradiated with various doses (0-40 krad) of 137 Cs γ-rays. The radiosensitivities of naked barley was significantly higher than that of hulled barley. The sensitive coefficients of seedling height were 0.04945 and 0.03667 for naked barley and hulled barley, respectively. The radiosensitivity of four-row naked barley was significantly higher than that of two-row hulled barley and six-row hulled barley. 47 varieties studied could be divided into five types with different radiosensitivities, i.e. extreme resistant, resistant, intermediate, sensitive and extreme sensitive. It was also found that the dose-effect curves of cell nucleus volume had a peal at 30 krad
Lysine-Rich Proteins in High-Lysine Hordeum Vulgare Grain
DEFF Research Database (Denmark)
Ingversen, J.; Køie, B.
1973-01-01
The salt-soluble proteins in barley grain selected for high-lysine content (Hiproly, CI 7115 and the mutants 29 and 86) and of a control (Carlsberg II) with normal lysine content, contain identical major proteins as determined by MW and electrophoretic mobility. The concentration of a protein gro...
Genetic diversity in barley landraces (Hordeum vulgare L. subsp ...
Indian Academy of Sciences (India)
its nutritional value and low glycemic index (Ullrich 2011). Lebanon belongs to the ... Rim Mzid and Farhat Chibani contributed equally to this work. biochemical accomplished ..... environment interaction of hordein content. J. Cereal Sci. 34,.
Latent manganese deficiency increases transpiration in barley (Hordeum vulgare).
Hebbern, Christopher A; Laursen, Kristian Holst; Ladegaard, Anne H; Schmidt, Sidsel B; Pedas, Pai; Bruhn, Dan; Schjoerring, Jan K; Wulfsohn, Dvoralai; Husted, Søren
2009-03-01
To investigate if latent manganese (Mn) deficiency leads to increased transpiration, barley plants were grown for 10 weeks in hydroponics with daily additions of Mn in the low nM range. The Mn-starved plants did not exhibit visual leaf symptoms of Mn deficiency, but Chl a fluorescence measurements revealed that the quantum yield efficiency of PSII (F(v)/F(m)) was reduced from 0.83 in Mn-sufficient control plants to below 0.5 in Mn-starved plants. Leaf Mn concentrations declined from 30 to 7 microg Mn g(-1) dry weight in control and Mn-starved plants, respectively. Mn-starved plants had up to four-fold higher transpiration than control plants. Stomatal closure and opening upon light/dark transitions took place at the same rate in both Mn treatments, but the nocturnal leaf conductance for water vapour was still twice as high in Mn-starved plants compared with the control. The observed increase in transpiration was substantiated by (13)C-isotope discrimination analysis and gravimetric measurement of the water consumption, showing significantly lower water use efficiency in Mn-starved plants. The extractable wax content of leaves of Mn-starved plants was approximately 40% lower than that in control plants, and it is concluded that the increased leaf conductance and higher transpirational water loss are correlated with a reduction in the epicuticular wax layer under Mn deficiency.
Analysis of sorghum wax and carnauba wax by reversed phase liquid chromatography mass spectrometry
Sorghum is a genus in the grass family, which is used for both grain and forage production throughout the world. In the United States, sorghum grain is predominantly used as livestock feed, and in ethanol production. In recent years however, sorghum grain has been investigated for other industrial a...
International Nuclear Information System (INIS)
Bansal, Y.K.; Sen, Sumitra
1987-01-01
Rate of replication and transcription between normal and giant endopolyploid nuclei of differentiated tissue of Hordeum vulgare L. (2n=14) roots and Phlox drummondii Hook. (2n=14) and Zea mays L. (2n=20) endosperms were studied by labelling experiments with tritiated thymidine and uridine. The incorporation of thymidine and uridine was identical in both diploid and giant endopolyploid nuclei of the roots of H. vulgare. The endosperm cells of P. drummondii and Z. mays, however, exhibit markedly different labelling pattern in normal (i.e. triploid) and endopolyploid nuclei where both replication and transcription were rather high. The nutritive function of the endosperm is probably responsible for this high degree of activity. (author). 14 refs., 10 figs., 3 tables
Genetic diversity among wild and cultivated barley as revealed by RFLP
DEFF Research Database (Denmark)
Petersen, L.; Østergård, H.; Giese, H.
1994-01-01
Genetic variability of cultivated and wild barley, Hordeum vulgare ssp. vulgare and spontaneum, respectively, was assessed by RFLP analysis. The material consisted of 13 European varietes, single-plant offspring lines of eight land races from Ethiopia and Nepal, and five accessions of ssp. sponta...... an intermediate level. The proportion of gene diversity residing among,geographical groups (F-ST) varied from 0.19 to 0.94 (average 0.54) per RFLP pattern, indicating large diversification between geographical groups....... was estimated and the barley lines clustered into five groups reflecting geographical origin. The geographical groups of land-race lines showed less intragroup variation than the geographical groups of spontaneum lines. The group of European varieties, representing large variation in agronomic traits, showed...
Potential of multiseeded mutant (msd) to boost sorghum grain yield
Seed number per plant is an important determinant of the grain yield in cereal and other crops. We have isolated a class of multiseeded (msd) sorghum (Sorghum bicolor L. Moench) mutants that are capable of producing three times the seed number and twice the seed weight per panicle as compared with t...
The fall armyworm [Spodoptera frugiperda (Lepidoptera: Noctuidae)] is an economically important pest of sorghum [Sorghum bicolor (L) Moench]. However, resistance to fall armyworm in sweet sorghum has not been extensively studied. A collection of primarily sweet sorghum accessions were evaluated in t...
Sweet Sorghum Alternative Fuel and Feed Pilot Project
Energy Technology Data Exchange (ETDEWEB)
Slack, Donald C. [Univ. of Arizona, Tucson, AZ (United States). Agricultural and Biosystems Engineering Dept.; Kaltenbach, C. Colin [Univ. of Arizona, Tucson, AZ (United States)
2013-07-30
The University of Arizona undertook a “pilot” project to grow sweet sorghum on a field scale (rather than a plot scale), produce juice from the sweet sorghum, deliver the juice to a bio-refinery and process it to fuel-grade ethanol. We also evaluated the bagasse for suitability as a livestock feed and as a fuel. In addition to these objectives we evaluated methods of juice preservation, ligno-cellulosic conversion of the bagasse to fermentable sugars and alternative methods of juice extraction.
African Journals Online (AJOL)
sorghum plants mitigates the negative effect of drought stress, favoring this crop cultivation in areas of low water ... It is a salt and aluminum-tolerant crop, making areas suitable for ... its growth or decrease its metabolic activity and later, when water ..... and osmoregulation, but also in stabilizing the structures and enzyme ...
Koleva, Vanya; Dragoeva, Asya; Stoyanova, Zheni; Yordanova, Zhenia; Ali, Selime; Uzunov, Nikolay M.; Melendez-Alafort, Laura; Rosato, Antonio; Enchev, Dobromir D.
2018-03-01
Medicinal plants produce various secondary metabolites as a part of their chemical defence and survival in nature. These compounds have a wide range of biological activities. Nowadays, medicinal plants are used as source of allelochemicals and new effective anticancer agents. Our previous studies revealed allelopathic potential of water extracts of Adonis vernalis L. (Ranunculaceae), Origanum vulgare ssp. vulgare L. and Nepeta nuda subsp. nuda (Lamiaceae). Present study aimed to evaluate the effect of the same extracts in vitro on human hepatoma cell line SK-HEP-1. Cell proliferation/viability was assessed using Premixed WST-1 Cell Proliferation Reagent. Adonis water extract (1.83mg/ml) had notable negative influence on cancer cell line tested. Oregano (3.5 mg/ml) also exerted negative effect, but to a lesser degree. On the contrary, nepeta water extract (6.59 mg/ml) had an opposite effect, stimulating cell proliferation. One possible explanation could be the type of extraction: after treatment with nepeta methanol extract (6.59 mg/ml) cell viability was significantly reduced. In conclusion, Adonis vernalis and Nepeta nuda subsp. nuda possess metabolites with growth inhibitory effect on human hepatoma cell line SK-HEP-1. Further research is needed to clarify biological activity of lower concentrations which are appropriate to enable the design of new anticancer drugs.
Supplementary data: Mapping of shoot fly tolerance loci in sorghum ...
Indian Academy of Sciences (India)
Supplementary data: Mapping of shoot fly tolerance loci in sorghum using SSR markers. D. B. Apotikar, D. Venkateswarlu, R. B. Ghorade, R. M. Wadaskar, J. V. Patil and P. L. Kulwal. J. Genet. 90, 59–66. Table 1. List of SSR primers for sorghum. Primer code. Forward and reverse. Annealing temperature (°C). Product.
Nutritional, functional and rheological properties of processed sorghum and ragi grains
Directory of Open Access Journals (Sweden)
Himadri Mahajan
2015-12-01
Full Text Available This study was undertaken to determine the effect of different treatments such as roasting, puffing and germination of white sorghum, red sorghum and ragi grains on physicochemical, antioxidant, protein, amylose, bulk density, colour index and rheological properties of respective flour. In case of ragi, after roasting treatment, total phenolic content (TPC content for flour was increased from 0.331 ± 0.001 to 0.373 ± 0.004 mg of gallic acid equivalents per gram of dry sample. However, total flavonoids content was also increased slightly after different processing treatments. The rheological properties of respective flour were studied using Chopin Mixolab, where wheat flour dough profile acts as a reference to study the effect of different treatments. Dough elasticity which is expressed by the values of amplitude (Nm was found to be low in case of untreated flour as compared to wheat flour dough. Elasticity values of untreated flour such as white sorghum, red sorghum and ragi were 0.02, 0.00 and 0.06 Nm, respectively. Whereas, after processing treatments, values of elasticity for roasted flour dough of white sorghum, puffed flour dough of red sorghum and roasted flour dough of ragi increased to 0.36, 0.11 and 0.15 Nm, respectively, as compared to wheat flour dough of 0.10 Nm. The results found that roasted ragi flour had higher rate of starch gelatinization, lower starch retrogradation, high antioxidant and amylose contents which were found to be prospective ingredients in whole wheat flour in various baked and fermented food applications.
DEFF Research Database (Denmark)
Giese, Nanna Henriette; Hejgaard, Jørn
1984-01-01
The accumulation of salt-soluble proteins in the endosperm of developing barley (Hordeum vulgare L.) grains was examined. Detached spikes of barley were cultured at different levels of nitrogen nutrition and pulse-labeled with [14C] sucrose at specific times after anthesis. Proteins were extracted...... to increased nitrogen nutrition. Two major components, β-amylase and protein Z in particular, had a synthesis profile almost identical to that of the endosperm storage protein, hordein....
Double row spacing and drip irrigation as technical options in energy sorghum management
Directory of Open Access Journals (Sweden)
Neri Roncucci
2014-02-01
Full Text Available The effect of two row spacing configurations and four water supply levels was investigated on sweet and fibre sorghum in Central Italy for two consecutive years. Results highlighted the influence of both irrigation and row spatial configuration on crop productivity. Indeed, several studies have pointed out the positive response of sorghum to irrigation in Mediterranean climate, as in this environment water stress represents one of the main limiting factors on crop productivity. On the other hand, few attempts have been made to explore the role of row spacing on energy sorghum productivity. Results outlined an average increase in sorghum dry biomass yield ranging from +23% to +79% at variable rates of water supply as compared to rainfed control. The positive effect of irrigation was also observed on leaf area index and radiation use efficiency. Moreover, we observed a crop yield increase, from 9% to 20%, under double row spacing compared to the standard planting pattern (i.e. single row spacing. Finally, it was confirmed the efficient use of water by sorghum and the great ability of sorghum to increase its biomass yield in response to increasing volumes of water supplied. Therefore, this work suggests how row spacing configuration and drip irrigation could be feasible technical options to increase sorghum biomass yields in Mediterranean environments. These techniques should be experienced by farmers towards a sustainable intensification of current cropping systems.
SOME CONSIDERATIONS ON THE PROSPECTS OF SORGHUM CROP
Agatha POPESCU; Reta CONDEI
2014-01-01
The paper purpose was to analyze the sorghum statement at world, EU and Romania level in order to establish the main trends in the future of this crop. Sorghum is an important cereal coming on the 5th position after maize, rice, wheat and barley at world level due to its importance in human nutrition, animal feed, in producing bioethanol and green energy, and due to its good impact on environment. It is cultivated on all the continents, in the tropical, subtropical and temperate areas due to ...
Kajian Nilai Energi Metabolis Biji Sorghum Melalui Teknologi Sangrai Pada Ayam Petelur Periode Afkir
Directory of Open Access Journals (Sweden)
Hanny Indrat Wahyuni
2008-04-01
Full Text Available Evaluation of metabolic energy value of roasted sorghum in culled laying chickens ABSTRACT. Tannin contained in sorghum can be reduced by using technology processing such as roasting. By using this way, husk of sorghum can be removed leading to decrease of tannin content which is reflected by the value of metabolism energy. The purpose of this experiment is to investigate the effect of roasted sorghum on metabolism energy of culled laying chickens. Measurement of metabolic energy as mathematic is used as comparison. The material used in his experiment was red sorghum, water, and 39 culled laying chickens. Equipment used in this experiment was balance, roasting tool, plastic, force feeding equipment, metabolism cages and bomb calori-meter. This experiment used completely randomized design consisting of 4 treatments and 4 replications (each replication 3 chickens. Treatment consisted of T0 = no roasted sorghum, T1 = roasted for 5 minutes and T2 = roasted for 10 minutes. Data collected were metabolism energy of roasted sorghum both biologically (force feeding and mathematically (proximate analysis at culled laying chickens. All data were statistically calculated, further statistically was conducted by using Duncan and compression of metabolism energy was calculated by using t-Test. The results show that, no statistically effect (p>0, 05 on duration of roasting on metabolism energy of sorghum. Based on t-Test analysis, there was a significantly difference (p<0, 05 between biological metabolism and mathematical metabolism. From this experiment, it can be concluded that 10 minutes of roasting cannot increase of sorghum metabolic energy. The average of biological metabolic was lower (3105, 94 kcal/kg compared to the average of mathematical metabolic energy (3766, 82 kcal/kg.
The Kraft Pulp And Paper Properties of Sweet Sorghum Bagasse (Sorghum bicolor L Moench
Directory of Open Access Journals (Sweden)
Widya Fatriasari
2015-05-01
Full Text Available This study investigated the potency of sweet sorghum (Sorghum bicolor bagasse as raw material for pulp and paper using kraft pulping. The effects of alkali and sulfidity loading on kraft pulp and paper properties were also investigated. The pulping condition of the kraft pulp consisted of three levels of alkali loading (17, 19 and 22% and sulfidity loading (20, 22 and 24%. The maximum cooking temperature was 170°C for 4 h with a liquid to wood ratio of 10:1. Kraft pulping of this Numbu bagasse produced good pulp indicated by high screen yield and delignification selectivity with a low Kappa number (< 10. The unbleached pulp sheet produced a superior brightness level and a high burst index. The increase of active alkali loading tended to produce a negative effect on the pulp yield, Kappa number and paper sheet properties. Therefore, it is suggested to use a lower active alkaline concentration.
Quality and Quantity of Sorghum Hydroponic Fodder from Different Varieties and Harvest Time
Chrisdiana, R.
2018-02-01
This experiment was designed to compare different varieties and harvest time of sorghum hydroponic fodder based on nutrient content and biomass production. Experimental design for fodder productivity was completely randomized design with 2 x 3 factorial, i.e., sorghum varieties (KD 4 and Super-1) and time of harvesting the sorghum hydroponic fodder (8,12 and 16 d). Total biomass and DM production, were affected significantly (p<0.05) on harvest time. Total biomass and nutrient content were increased in longer harvest time. The nutrient content were increased with decreasing total value of DM. Super-1 varieties produce larger biomass and nutrient content higher than KD4 (p<0.05). Based on sorghum hidroponic fodder quality and quantity, sorghum hidroponic fodder with Super-1 varieties harvested at 12 d had a good quality of fodder and it can be alternative of technology providing quality forage and land saving with a short time planting period and continous production.
Path analysis of the productive traits in Sorghum species
Directory of Open Access Journals (Sweden)
Ikanović Jela
2011-01-01
Full Text Available This research studied the phenotypic correlation coefficients between three Sorghum species, namely forage sorghum S. bicolor Moench. (c. NS-Džin, Sudan grass S. sudanense L. (c. Zora and interspecies hybrid S. bicolor x S. sudanense (c. Siloking. The analyses were performed on plant material samples taken from the first cutting, when plants were in the beginning phase of tasseling. The following morphologic traits were studied: plant height, number of leaves per plant, stem leaf weight and mean stem weight. Additionally, their direct and indirect effect on dependent variable green biomass yield was analyzed, for which path coefficients were calculated. This method enables more quality and full insight into relations existing among the studied traits, more precise establishment of cause-effect connections among them, as well as to separate direct from indirect effects of any particular trait on dependent variable, being biomass yield in this case. The analysis of phenotypic coefficients revealed differences in direct and indirect effect of certain traits on dependent variable. Sudan grass had the highest stem (2.281 m and most leaves per plant (7.917. Forage sorghum had the largest leaf weight per plant (49.05 g, while interspecies hybrid had the highest mean stem weight (80.798 g. Variations of these morphologic traits among species were found to be significant and very significant. Morphologic traits - stem height and weight significantly affected sorghum green biomass yield. Leaf number and leaf portion in total biomass were negatively correlated with yield. Cultivars differed significantly regarding morphologic and productive traits. Sudan grass had the lowest green biomass yield, while forage sorghum and interspecies hybrid had significant yield increase.
Effects of Cerium Oxide Nanoparticles on Sorghum Plant Traits
Mu, L.; Chen, Y.; Darnault, C. J. G.; Rauh, B.; Kresovich, S.; Korte, C.
2015-12-01
Nanotechnology and nanomaterials are considered as the development of the modern science. However, besides with that wide application, nanoparticles arouse to the side effects on the environment and human health. As the catalyst of ceramics and fuel industry, Cerium (IV) oxide nanoparticles (CeO2 NPs) can be found in the environment following their use and life-cycle. Therefore, it is critical to assess the potential effects that CeO2 NPs found in soils may have on plants. In this study, CeO2 NPs were analyzed for the potential influence on the sorghum [Sorghum bicolor (L.) Moench] (Reg. no. 126) (PI 154844) growth and traits. The objectives of this research were to determine whether CeO2 NPs impact the sorghum germination and growth characteristics. The sorghum was grown in the greenhouse located at Biosystems Research Complex, Clemson University under different CeO2 NPs treatments (0mg; 100mg; 500mg; 1000mg CeO2 NPs/Kg soil) and harvested around each month. At the end of the each growing period, above ground vegetative tissue was air-dried, ground to 2mm particle size and compositional traits estimated using near-infrared spectroscopy. Also, the NPK value of the sorghum tissue was tested by Clemson Agriculture Center. After the first harvest, the result showed that the height of above ground biomass under the nanoparticles stress was higher than that of control group. This difference between the control and the nanoparticles treatments was significant (F>F0.05; LSD). Our results also indicated that some of the compositional traits were impacted by the different treatments, including the presence and/or concentrations of the nanoparticles.
Productivity and Nutrient Quality of Some Sorghum Mutant Lines at Different Cutting Ages
Directory of Open Access Journals (Sweden)
R. E. Puteri
2015-08-01
Full Text Available The objective of the study was to explore the appropriate cutting age to produce optimal biomass and good nutrient quality from sorghum mutant lines BMR i.e., PATIR 3.5 M7, PATIR 3.6 M7, and PATIR 3.7 M7, also SAMURAI I (M17. A completely randomized in Split Plot design with 2 factors and 3 replicates was used. The first factor was the type of sorghum (SAMURAI I M17, PATIR 3.5, PATIR 3.6, PATIR 3.7 as the main plot and the second factor was the cutting age (85, 95, 105 as a subplot. Parameters observed were the production of stems, leaves, grains, total biomass production, ash, crude fat, crude fiber, crude protein, NFE, TDN, percentage of DMD, OMD and N-NH3. Data were analyzed by using ANOVA followed by DMRT (Duncan Multiple Range Test. The results showed that there were highly significant interactions (P<0.01 between cutting age and type of sorghum in production of stems, leaves, grains, total biomass production, value of TDN, DMD, OMD, and N-NH3. Increasing cutting age significantly increased the percentage of ash content, crude protein and crude fat. The sorghum type significantly affected crude fat content nonBMR sorghum variety of SAMURAI I (M17 and achieved optimal biomass production and nutrient content at cutting age of 85 d similar to BMR sorghum mutant lines PATIR 3.6 and PATIR 3.5, whereas BMR sorghum mutant lines of PATIR 3.7 achieved optimum production at the age of 95 d of cutting. All types of sorghum varieties was not recommended to be harvested at 105 d. Biomass production increased with the increasing of cutting age, but the nutrient content decreased.
Panagiotopoulos, I.A.; Bakker, R.R.; Vrije, de G.J.; Koukios, E.G.; Claassen, P.A.M.
2010-01-01
Pretreatment of sweet sorghum bagasse, an energy crop residue, with NaOH for the production of fermentable substrates, was investigated. Optimal conditions for the alkaline pretreatment of sweet sorghum bagasse were realized at 10% NaOH (w/w dry matter). A delignification of 46% was then observed,
The effect of alpha amylase enzyme on quality of sweet sorghum juice for chrystal sugar
Marwati, T.; Cahyaningrum, N.; Widodo, S.; Astiati, U. T.; Budiyanto, A.; Wahyudiono; Arif, A. B.; Richana, N.
2018-01-01
Sweet sorghum juice (Sorghum bicolor L. Moench) has characteristics similar to sugar cane juice and potentially used for sugar substitutes that can support food security. Nevertheless the sweet sorghum juicecontain starch which impede sorghum sugar crystallization. Therefore, research on the enzymatic process is needed to convert starch into reducing sugar. The experimental design used was the Factorial Randomized Design with the first factor was alpha amylase enzyme concentration (0, 20, 40, 60, 80, 100, 120 μL/100 mL) and second factor was incubation time (0, 30, 60, 90 minute) at temperature 100°C. The experiment was conducted on fresh sweet sorghum. The results showed that the addition of the alpha amylase enzyme increased the content of reducing sugar and decreased levels of starch. Elevating concentration of alpha amylase enzyme will increase the reducing sugar content in sweet sorghum juice. The optimum alpha amylase enzyme concentration to produce the highest total sugar was 80 μL/100 mL of sweet sorghum juice with the optimum incubation time was 90 minutes. The results of this study are expected to create a new sweetener for sugar substitution. From the economic prospective aspect, sorghum is a potential crop and can be relied upon to support the success of the food diversification program which further leads to the world food security
Vulgarization of popular music tradition in Serbia
Božilović, Nikola
2011-01-01
The vulgarization of tradition in this paper implies the alteration, false representation, and adaptation of tradition in line with the interests of certain individuals or groups in power. The author observes popular music in Serbia (jazz, pop, rock) under a sociological magnifying glass, attempting to explain and motivate the thesis which proposes a valid historical foundation of popular culture and music in the social life of Serbia. In his opinion, this kind of tradition is being 'swept un...
Grain sorghum dust increases macromolecular efflux from the in situ nasal mucosa.
Gao, X P
1998-04-01
The purpose of this study was to determine whether an aqueous extract of grain sorghum dust increases macromolecular efflux from the nasal mucosa in vivo and, if so, whether this response is mediated, in part, by substance P. Suffusion of grain sorghum dust extract on the in situ nasal mucosa of anesthetized hamsters elicits a significant increase in clearance of fluorescein isothiocyanate-labeled dextran (FITC-dextran; mol mass, 70 kDa; P grain sorghum dust elicits neurogenic plasma exudation from the in situ nasal mucosa.
Lipids characterization of ultrasound and microwave processed germinated sorghum.
Hassan, Sadia; Imran, Muhammad; Ahmad, Nazir; Khan, Muhammad Kamran
2017-06-27
Cereal crops and oilseeds provide diverse pool of fatty acids with characteristic properties. Sorghum (Sorghum bicolor (L.) Moench) provides the staple food with serving as main source of energy and protein. Germination of sorghum generally increases the nutritive value of seeds and the effects of germination on lipids composition of seeds vary greatly with processing conditions. Therefore, the current study was conducted to compare the effect of emerging processing techniques such as ultrasound (US) and microwave (MW) on fatty acids composition and oil yield of sorghum seeds before and after germination. Initially sorghum grains were soaked with 5% NaOCl (sodium hypochlorite) for surface sterilization. Afterwards, grains were soaked in excess water for 22 h at room temperature and were divided into four portions. The first portion (100 g grains) was subjected to germination without applying any microwave and ultrasonic treatment (T 0 ). Second portion was further divided into four groups (T 1 , T 2 , T 3 , T 4 ) (100 g of each group) and grains were subjected to ultrasonic treatments using two different ultrasonic intensities (US 1 : 40%; US 2 : 60%) within range of 0-100% and with two different time durations (t US1 : 5 min; t US2 : 10 min) at constant temperature. Third portion was also divided into four groups (T 1 , T 2 , T 3 , T 4 ) (100 g of each group) and exposed to microwave treatments at two different power levels (MW 1 : 450 watt; MW 2 : 700 watt) within the range of 100-900 W for two different time durations (t MW1 : 15 s; t MW2 : 30s). Similarly, fourth portion was divided into four groups (T 1 , T 2 , T 3 , T 4 ) (100 g of each group). Each group was exposed to both MW (MW 1 , MW 2 ) (100-900 watt power) & US (US 1 , US 2 ) (0-100% intensity) treatments at two different time levels (t US , t MW ). Then, germination was carried out and pre-treated raw and pre-treated germinated sorghum grains were analyzed for total oil yield, fatty acid
CSIR Research Space (South Africa)
Grootboom, AW
2010-01-01
Full Text Available of transformation. In sorghum, concerns about flow of herbicide and antibiotic resistance gene into genetically related wild and weedy species have a direct bearing on the choice of suitable selectable markers in many tropical and subtropical regions. The authors...
Sorghum (Sorghum bicolor) varieties adopt strongly contrasting strategies in response to drought.
Ogbaga, Chukwuma C; Stepien, Piotr; Johnson, Giles N
2014-10-01
Sorghum is one of the most drought tolerant crops but surprisingly, little is known about the mechanisms achieving this. We have compared physiological and biochemical responses to drought in two sorghum cultivars with contrasting drought tolerance. These closely related cultivars have starkly contrasting responses to water deficit. In the less tolerant Samsorg 40, drought induced progressive loss of photosynthesis. The more drought tolerant Samsorg 17 maintained photosynthesis, transpiration and chlorophyll content until the most extreme conditions. In Samsorg 40, there was a highly specific down-regulation of selected proteins, with loss of PSII and Rubisco but maintenance of PSI and cytochrome b6 f, allowing plants to maintain ATP synthesis. The nitrogen released allows for accumulation of glycine betaine and proline. To the best of our knowledge, this is the first example of specific reengineering of the photosynthetic apparatus in response to drought. In contrast, in Samsorg 17 we detected no substantial change in the photosynthetic apparatus. Rather, plants showed constitutively high soluble sugar concentration, enabling them to maintain transpiration and photosynthesis, even in extremely dry conditions. The implications for these strikingly contrasted strategies are discussed in relation to agricultural and natural systems. © 2014 Scandinavian Plant Physiology Society.
Phenolic compounds and related enzymes as determinants of sorghum for food use
Dicko, M.H.; Gruppen, H.; Traore, A.S.; Voragen, A.G.J.; Berkel, van W.J.H.
2006-01-01
Phenolic compounds and related enzymes such as phenol biosynthesizing enzymes (phenylalanine ammonia lyase) and phenol catabolizing enzymes (polyphenol oxidase and peroxidase) are determinants for sorghum utilization as human food because they influence product properties during and after sorghum
Dlamini, Bhekisisa C; Buys, Elna M; Taylor, John R N
2015-01-01
Sorghum types suitable for brewing and bioethanol production are required. The effect of sorghum type (white non-tannin versus white type II tannin) on free amino nitrogen (FAN) production from sorghum grain and malt using exogenous protease enzymes was investigated over extended incubation at moderate temperature (45 °C). With grain in the absence of exogenous proteases, white non-tannin sorghum produced substantially higher levels of FAN than white type II tannin sorghum, due to the tannins in the latter. Incubating sorghum grain with neutral proteinase and amino-peptidase in combination improved FAN production. The two sorghum types produced similar FAN levels when malted and incubated in the absence of the exogenous proteases. When both sorghums were malted and incubated with neutral proteinase alone substantially more FAN yield (124-126 mg 100 g(-1)) occurred than with grains (61-84 mg 100 g(-1)). The combination of amino-peptidase and proteinase did not improve FAN further. Neither, did malting influence wort free amino acid profile. Group B amino acids constituted the highest percentage (42-47%). With grain, white non-tannin sorghum plus proteinase and amino-peptidase yields the highest FAN, with malt both white non-tannin and white type II tannin sorghums plus proteinase yield the highest FAN. © 2014 Society of Chemical Industry.
Arsenic-contaminated soils. Phytotoxicity studies with sunflower and sorghum
Energy Technology Data Exchange (ETDEWEB)
Lyubun, Y.V.; Kosterin, P.V.; Zakharova, E.A.; Fedorov, E.E. [Inst. of Biochemistry and Physiology of Plants and Microorganisms, Russian Academy of Sciences, Saratov (Russian Federation); Shcherbakov, A.A. [Saratov Military Inst. of Radiological, Chemical and Biological Defence, Saratov (Russian Federation)
2002-07-01
Background, Aim and Scope. Environmental pollution caused by arsenic (As) is a major ecological problem. There has been intense worldwide effort to find As-hyperaccumulating plants that can be used in phytoremediation - the green-plant-assisted removal of chemical pollutants from soils. For phytoremediation, it is natural to prefer cultivated rather than wild plants, because their agriculture is well known. This study was conducted to evaluate the tolerance of common sunflower (Helianthus annuus L.) and sugar sorghum (Sorghum saccharatum Pers.) for soil-As contents of 10-100 mg As kg{sup -1} soil, with sodium arsenite as a model contaminant. Methods. Plants were grown in a growth chamber for 30 days. Microfield experiments were conducted on experimental plots. To study the phytoremediation effect of the auxins indole-3-acetic acid (IAA) and 2,4-dichlorophenoxyacetic acid (2,4-D), we treated 1- and 3-day-old plant seedlings with water solutions of the auxins (concentrations of 10{sup -5}, 10{sup -7}, and 10{sup -9} g l{sup -1}). The soil and plant-biomass samples were analyzed for total As by using the color reaction of ammonium molybdate with As. Results and Discussion. Phytotoxicity studies showed that 100 mg as kg{sup -1} soil poisoned sunflower and sorghum growth by 50%. There was a linear correlation between soil-As content and As accumulation in the plants. Laboratory experiments showed that the soil-As content was reduced two- to threefold after sunflower had been grown with 10-100 mg As kg{sup -1} soil for 30 days. Treatment of sunflower and sorghum seedlings with IAA and 2,4-D at a concentration of 10{sup -5} g l{sup -1} in microfield experiments enhanced the phytoremediation two- to fivefold as compared with untreated control plants. The best results were obtained with 3-day-old seedlings. Conclusion, Recommendation and Outlook. (a) Sunflower and sorghum are good candidates to remediate As-polluted soils. (b) Phytoremediation can be improved with IAA or 2
Kayodé, A.P.P.
2006-01-01
This thesis focuses on the diversity of sorghum and its post-harvest processing into food. We studied the contribution that sorghum can make to Fe and Zn intake by poor people in Africa, using the situation in Benin as a study context. The culinary and sensory characteristics of sorghum crops and
International Nuclear Information System (INIS)
Kanimoli, S.; Marimuthu, P.; Arulmozhiselvan, K.
2010-01-01
For studying the benefits of inoculation of N 2 fixing diazotrophs in the root zone of sorghum crop, a pot culture was conducted on neutral red sandy loam soil with sorghum cv. CO26, using 15 N tracer. At the end of 45 days duration after sowing, Beijerinckia indica inoculation contributed 56.9 per cent N derived from N 2 fixation, out of total N concentration in whole drymatter of sorghum plant. It proved to be the efficient N 2 fixer by contributing N from N 2 fixation to the tune of 17.6 Kg -1 . Accumulation of N derived from N 2 fixation from B. indica was primarily in leaf blade (50.0%) followed by stem (31.8%), leaf sheath (14.0%) and root (4.2%). Inoculation of Azospirillum brasllense accelerated uptake of N from soil and fertilizer N sources compared to B. indica and hence registered low N fixation. (author)
International Nuclear Information System (INIS)
2003-01-01
Agriculture is the mainstay of the Malian economy and yet cereal imports absorb 6.5% of GDP. Food self-sufficiency is therefore a national priority. The Joint FAO/IAEA Division is supporting a programme to improve local varieties of sorghum and rice by using nuclear techniques to develop new cultivars that will produce higher yields under Mali's semi-arid climatic conditions. (IAEA)
Ast, van A.
2006-01-01
Keywords: Striga hermonthica , Sorghum bicolor , infection time, infection level, tolerance.This thesis presents the results of a study on the interaction between the parasitic weed Strigahermonthica (Del.) Benth. and sorghum ( Sorghum bicolor [L.] Moench). The main objective of the study was
Energy analysis of ethanol production from sweet sorghum
Energy Technology Data Exchange (ETDEWEB)
Worley, J.W. (Georgia Univ., Athens, GA (United States). Dept. of Agricultural Engineering); Vaughan, D.H.; Cundiff, J.S. (Virginia Polytechnic Inst. and State Univ., Blacksburg, VA (United States). Dept. of Agricultural Engineering)
1992-01-01
The Piedmont System is a collection of equipment for efficiently removing the juice from sweet sorghum stalks for the production of ethanol. The concept is to separate the whole stalks into pith and rind-leaf fractions, pass only the pith fraction through a screw press, and thus achieve an improvement in juice-expression efficiency and press capacity. An energy analysis was done for two options of this proposed harvesting/processing system: (Option 1) The juice is evaporated to syrup and used throughout the year to produce ethanol, and the by-products are used as cattle feed. (Option 2) The juice is fermented as it is harvested, and the by-products (along with other cellulosic materials) are used as feedstock for the remainder of the year. Energy ratios (energy output/energy input) of 0.9, 1.1 and 0.8 were found for sweet sorghum Option 1, sweet sorghum Option 2, and corn, respectively, as feedstocks for ethanol. If only liquid fuels are considered, the ratios are increased to 3.5, 7.9 and 4.5. (author).
The effect of abandoned mining ponds on trace elements dynamics in the soil-plant system
Gabarrón, María; Faz, Ángel; Zornoza, Raúl; Acosta, Jose A.
2017-04-01
In semiarid climate regions lack of vegetation and dryer climate contribute to erosion of abandoned mining surface areas making them up important potential sources of metal pollution into the environment. The objectives of this study were to determine the influence of mine ponds in agriculture and forest soils, and identify the dynamic of metals in the soil-plant system for native plant species (Ballota hirsuta) and crop species (Hordeum vulgare) in two ancient mining districts: La Unión and Mazarrón. To achieve these objectives, wastes samples from mine ponds and soil samples (rhizosphere and non-rhizosphere soils) from natural and agricultural lands were collected. In addition, six plants (Ballota hirsuta) from natural area and 3 plants (Hordeum vulgare) from crops were collected. Physicochemical properties and total, water soluble and bioavailable metals (Cd, Co, Cr, Cu, Fe, Mn, Ni, Pb, and Zn) and arsenic were measured in waste/soil samples. The chemical speciation of metals in soil was estimated by a sequential extraction procedure. For plants analyses, each plant were divided in roots, stem and leaves and metal content measured by ICP-MS. Results indicated that mine, natural and agricultural soils were contaminated by As, Cd, Cu, Pb, and Zn. Chemical partitioning revealed higher mobility of metals in mine ponds than natural and agriculture soils while only Fe and As are completely bound to the soil matrix due to the mineralogical compositions of soils. The accumulation of metals in Ballota hirsuta in La Union decrease as Fe>As>Cr>Ni>Cu>Zn>Cd>Mn>Co>Pb while in Mazarrón did as As>Fe>Cr>Pb>Cu>Ni>Co>Mn>Zn>Cd. Ballota hirsuta showed high ability to bio-accumulate Cu, Cr, Fe, Ni, and As, transferring a large amount to edible parts without exceeding the toxicity limits for animals. Results for barley plants (Hordeum vulgare) showed the ability to absorb and accumulate As, Fe, Mn, Pb and Zn, although the transfer ability of As, Cd and Pb was lower. Although the
Sorghum grain as human food in Africa: relevance of content of ...
African Journals Online (AJOL)
Sorghum is a staple food grain in many semi-arid and tropic areas of the world, notably in Sub-Saharan Africa because of its good adaptation to hard environments and its good yield of production. Among important biochemical components for sorghum processing are levels of starch (amylose and amylopectin) and starch ...
Directory of Open Access Journals (Sweden)
ARIEL J FABERI
2011-09-01
Full Text Available The studies of Armadillidium vulgare as pest are virtually null worldwide. However under no-tillage systems this species has found an adequate environment for its development and it has become an important pest in some crops in Argentina. It has been shown that the composition of vegetables affects the isopods biology. Our hypothesis was that soybean leaf litter has high nutritive value which allows A. vulgare to grow faster, survive longer, and have higher fecundity favoring the population increase and turning it into a crop pest. Growth and survivorship of juveniles and adults, egg incubation period, offspring number per female and offspring mean body weight were determined in individuals fed with leaf litter of soybean, sunflower, wheat and pasture. The growth rate coefficient, k, in juveniles was higher for soybean, intermediate for pasture and lower for sunflower. Adult growth was faster under the soybean diet. Survivorship under soybean and pasture was longer than under sunflower and wheat in both juveniles and adults. The reproductive parameters were similar in all diets, food did not generate any change in the reproductive aspects of A. vulgare. Results of the present study represent a source of information about the A. vulgare biology under different diets of agricultural origin to establish the basis for Integrated Management of this species as pest. Under soybean litter provision A. vulgare found the best conditions for faster growth, longer survival and relatively higher fecundity. In fields with soybean as preceding crop or in systems with high frequency of soybean in the crop rotation a more abundant population of A. vulgare would be found as well as with larger individuals which could cause more damage to the following crop in the rotation.Los estudios sobre Armadillidium vulgare como plaga son virtualmente nulos a nivel mundial. Sin embargo, en los sistemas bajo siembra directa esta especie ha encontrado un ambiente adecuado para
Nutrient content of sorghum beer strainings
African Journals Online (AJOL)
Sorghum beer strainings were analysed for starch, protein, fat, crude fibre, ash, minerals and ... The importance of minerals in animal nutrition has been recognized for many ..... strainings is probably due to yeast activity during fermentation ...
Strip Tillage and Early-Season Broadleaf Weed Control in Seeded Onion (Allium cepa)
Sarah Gegner-Kazmierczak; Harlene Hatterman-Valenti
2016-01-01
Field experiments were conducted in 2007 and 2008 near Oakes, North Dakota (ND), USA, to evaluate if strip tillage could be incorporated into a production system of seeded onion (Allium cepa) to eliminate the standard use of a barley (Hordeum vulgare) companion crop with conventional, full width tillage, yet support common early-season weed control programs. A split-factor design was used with tillage (conventional and strip tillage) as the main plot and herbicide treatments (bromoxynil, DCPA...
Salo , Tapio J.; Palosuo , Taru; Kersebaum , Kurt Christian; Nendel , Claas; Angulo , Carlos; Ewert , Frank; Bindi , Marco; Calanca , Pierluigi; Klein , Tommy; Moriondo , Marco; Ferrise , Roberto; Olesen , Jørgen Eivind; Patil , Rasmi H.; Ruget , Francoise; Takac , Jozef
2016-01-01
Eleven widely used crop simulation models (APSIM, CERES, CROPSYST, COUP, DAISY, EPIC, FASSET, HERMES, MONICA, STICS and WOFOST) were tested using spring barley (Hordeum vulgare L.) data set under varying nitrogen (N) fertilizer rates from three experimental years in the boreal climate of Jokioinen, Finland. This is the largest standardized crop model inter-comparison under different levels of N supply to date. The models were calibrated using data from 2002 and 2008, of which 2008 included si...
Isozyme differences in barley mutants
International Nuclear Information System (INIS)
AI-Jibouri, A.A.M.; Dham, K.M.
1990-01-01
Full text: Thirty mutants (M 11 ) of barley (Hordeum vulgare L.) induced by physical and chemical mutagens were analysed for isozyme composition using polyacrylamide gel electrophoresis. Results show that these mutants were different in the isozymes leucine aminopeptidase, esterase and peroxidase. The differences included the number of forms of each enzyme, relative mobility value and their intensity on the gel. Glutamate oxaloacetate transaminase isozyme was found in six molecular forms and these forms were similar in all mutants. (author)
Irena Januskaitiene; Jūratė Žaltauskaitė; Austra Dikšaitytė; Gintarė Sujetovienė; Diana Miškelytė; Giedrė Kacienė; Sandra Sakalauskienė; Jurga Miliauskienė; Romualdas Juknys
2018-01-01
This work focuses on the investigation of competition interaction between C3 crop barley (Hordeum vulgare L.) and C4 weed barnyard grass (Echinochloa crus-galli L.) at 2 times higher than ambient [CO2] and +4 0C higher ambient temperature climate conditions. It was hypothesized that interspecific competition will change the response of the investigated plants to increased [CO2] and temperature. The obtained results showed that in the current climate conditions, a higher biomass and photosynth...
Guo, Jian Rong; Fan, Hai; Wang, Bao Shan
2018-06-01
Lodging is a serious problem in plant growth, especially in crops growth of the natural habitat. In order to determine the influence of lodging on the growth characters of sweet sorghum, plants grown in natural saline-alkali environment were used to investigate the fresh weight, dry weight, sugar content in the stalks and the photosynthesis index of salt tolerant crop sweet sorghum. Results showed that lodging significantly reduced the growth of sweet sorghum, the fresh weight and dry weight was only 28.3% and 22.5% of the normal plants when lodging occurred after 49 days. Lodging also reduced the stalks sugar content of sweet sorghum, the stalk sugar content of lodged plants was only 45.4% of that in the normal plants, when lodging occurred for 49 days. Lodging reduced the growth and sugar content by reducing the photosynthesis parameters of sweet sorghum grown in the saline-alkali field, thus, affected the accumulation of photosynthate. Interestingly, with the extension of the lodging time, lodging led to a decrease in photosynthetic rate of sweet sorghum mainly due to non-stomatal factors.
Soil Organic Carbon Response to Cover Crop and Nitrogen Fertilization under Bioenergy Sorghum
Sainju, U. M.; Singh, H. P.; Singh, B. P.
2015-12-01
Removal of aboveground biomass for bioenergy/feedstock in bioenergy cropping systems may reduce soil C storage. Cover crop and N fertilization may provide additional crop residue C and sustain soil C storage compared with no cover crop and N fertilization. We evaluated the effect of four winter cover crops (control or no cover crop, cereal rye, hairy vetch, and hairy vetch/cereal rye mixture) and two N fertilization rates (0 and 90 kg N ha-1) on soil organic C (SOC) at 0-5, 5-15, and 15-30 cm depths under forage and sweet sorghums from 2010 to 2013 in Fort Valley, GA. Cover crop biomass yield and C content were greater with vetch/rye mixture than vetch or rye alone and the control, regardless of sorghum species. Soil organic C was greater with vetch/rye than rye at 0-5 and 15-30 cm in 2011 and 2013 and greater with vetch than rye at 5-15 cm in 2011 under forage sorghum. Under sweet sorghum, SOC was greater with cover crops than the control at 0-5 cm, but greater with vetch and the control than vetch/rye at 15-30 cm. The SOC increased at the rates of 0.30 Mg C ha-1 yr-1 at 0-5 cm for rye and the control to 1.44 Mg C ha-1 yr-1 at 15-30 cm for vetch/rye and the control from 2010 to 2013 under forage sorghum. Under sweet sorghum, SOC also increased linearly at all depths from 2010 to 2013, regardless of cover crops. Nitrogen fertilization had little effect on SOC. Cover crops increased soil C storage compared with no cover crop due to greater crop residue C returned to the soil under forage and sweet sorghum and hairy vetch/cereal rye mixture had greater C storage than other cover crops under forage sorghum.
Statistical screening and selection of sweet sorghum varieties for bioethanol production
International Nuclear Information System (INIS)
Mehmood, S.; Aqil, T.; Tahir, M.S.
2014-01-01
This study aims at the screening of four cultivars of sorghums as a feedstock for bioethanol production. The straw of these varieties were subjected to pretreatment (dilute sulfuric acid) followed by enzyme hydrolysis to evaluate their potential to produce sugars. Four factor full factorial experimental design (2*2*2*4=32) was used to investigate the effects of experimental factors; sorghum varieties (84-Y-01, 85-G-86, Mr. Buster and RARI S-3), acid concentration (1 and 2%), temperature (121 and 140 degree C) and pretreatment time (30 and 60 min). The tested sorghum varieties follow the order 85-G-86 (47 g/100g) > Mr. Buster (44.6 g/100g) > 84-Y-01 (42 g/100g) > RARI S-3 (36 g/100g) for their sugar yield. The factors followed given order of significance; variety > temperature > acid concentration > pretreatment time. Sorghum variety (85-G-86) was selected as an appropriate feedstock for bioethanol production due to its higher sugar yield and lower concentration of by-products and furans. (author)
Growing sweet sorghum as a source of fermentable sugars for energy
Energy Technology Data Exchange (ETDEWEB)
Gascho, G.J.; Nichols, R.L.; Powell-Gaines, T.
1984-08-01
Studies were undertaken on the southern coastal plain (Georgia) of the USA on sweet sorghum to evaluate its potential as a fuel ethanol feedstock. Field experiments were designed over three years to study several aspects of the production of fermentable sugars from sweet sorghum and these included cultivar types, fertility needs, weed control and growth regulation. Wray was the best cultivar, producing a high sugar per hectare. To justify the operation of an ethanol plant, sweet sorghum should be harvested over a period of months, so cultivars were selected for yearly, medium and late maturity, thus ensuring a constant supply of feedstock over a four month period. The fertility needs of sweet sorghum appear to be relatively low and the yield response to applications of N, P, K are given. The best weed control was achieved by treating with Propazine plus Metolacheor. Application of several growth regulators such as Gibberellin didn't significantly increase the yield of sugars. Finally, a method to measure the fermentable sugars was developd using the Technicon Autoanalyser II.
Both sugarcane (Saccharum officinarum) and sweet sorghum (Sorghum bicolor) crops are members of the grass (Poaceae) family, and consist of stalks rich in soluble sugars. The extracted juice from both of these crops contains insoluble starch, with much greater quantities occurring in sweet sorghum. ...
The role of phenylpropanoid pathway metabolites in resistance of sorghum to pathogens
Sorghum is being developed for diverse uses, including for bioenergy and food. In order to increase efficiency of ethanol production from plant materials, sorghum lines with reduced lignin were developed by incorporating two mutations in lignin biosynthesis pathway genes: brown midrib (bmr) 6 and bm...
Using Genotyping by Sequencing to Map Two Novel Anthracnose Resistance Loci in Sorghum bicolor.
J Felderhoff, Terry; M McIntyre, Lauren; Saballos, Ana; Vermerris, Wilfred
2016-07-07
Colletotrichum sublineola is an aggressive fungal pathogen that causes anthracnose in sorghum [Sorghum bicolor (L.) Moench]. The obvious symptoms of anthracnose are leaf blight and stem rot. Sorghum, the fifth most widely grown cereal crop in the world, can be highly susceptible to the disease, most notably in hot and humid environments. In the southeastern United States the acreage of sorghum has been increasing steadily in recent years, spurred by growing interest in producing biofuels, bio-based products, and animal feed. Resistance to anthracnose is, therefore, of paramount importance for successful sorghum production in this region. To identify anthracnose resistance loci present in the highly resistant cultivar 'Bk7', a biparental mapping population of F3:4 and F4:5 sorghum lines was generated by crossing 'Bk7' with the susceptible inbred 'Early Hegari-Sart'. Lines were phenotyped in three environments and in two different years following natural infection. The population was genotyped by sequencing. Following a stringent custom filtering protocol, totals of 5186 and 2759 informative SNP markers were identified in the two populations. Segregation data and association analysis identified resistance loci on chromosomes 7 and 9, with the resistance alleles derived from 'Bk7'. Both loci contain multiple classes of defense-related genes based on sequence similarity and gene ontologies. Genetic analysis following an independent selection experiment of lines derived from a cross between 'Bk7' and sweet sorghum 'Mer81-4' narrowed the resistance locus on chromosome 9 substantially, validating this QTL. As observed in other species, sorghum appears to have regions of clustered resistance genes. Further characterization of these regions will facilitate the development of novel germplasm with resistance to anthracnose and other diseases. Copyright © 2016 Felderhoff et al.
Granivorous birds and sorghum crop in the province of Villa Clara,Cuba
Directory of Open Access Journals (Sweden)
Orlando Miguel Saucedo Castillo
2017-07-01
Full Text Available In order to reduce the damages granivorous birds cause to sorghum (Sorghum bicolor L. Moench in the province of Villa Clara, Cuba, research based on the determination of the major endemic, migratory birds and their relationship with the distribution were made space of historical meteorological variables in the province in the seasonal behavior of birds in different climatic regions. Population to sorghum producers grouped in different forms surveys were conducted, which yielded a large database, such as the determination of the main grain-eating birds percentage damage incurred, varieties, grain color, growth stage and other indicators. Nine main species affecting sorghum grain-eating birds in our province were recorded; Passer domesticus, Lonchura malacca, Lonchura punctulata, Dives atroviolaceus, Passerina cyanea, Zonotrichia leucophrys, Columbina passerine, Zenaida macroura y Zenaida asiatica. The spatial distribution of meteorological variables and their relation to the seasonal behavior of birds in different climatic regions of the province was determined, based on record four preferential habitat areas. The results allowed us to provide companies and different forms of production in Villa Clara, the possibility of a varietal structure planting of sorghum on the basis of different preferential areas granivorous birds, together with the morphological and physiological characteristics of different genotypes introduced in agricultural production of the province and nationally.
Fuel ethanol production from sweet sorghum using repeated-batch fermentation.
Chohnan, Shigeru; Nakane, Megumi; Rahman, M Habibur; Nitta, Youji; Yoshiura, Takanori; Ohta, Hiroyuki; Kurusu, Yasurou
2011-04-01
Ethanol was efficiently produced from three varieties of sweet sorghum using repeated-batch fermentation without pasteurization or acidification. Saccharomyces cerevisiae cells could be recycled in 16 cycles of the fermentation process with good ethanol yields. This technique would make it possible to use a broader range of sweet sorghum varieties for ethanol production. Copyright © 2010 The Society for Biotechnology, Japan. Published by Elsevier B.V. All rights reserved.
Directory of Open Access Journals (Sweden)
Somayyeh Sadrefozalayi
2014-02-01
Full Text Available Objective: Foeniculum vulgare seed (F. vulgare is a herbal plant which is used with phytoestrogene compounds for polycystic ovary syndrome (PCOS treatment. In this research, renoprotective effect of the aqueous extract of Foeniculum vulgare (AEF in experimental PCOS female rats is studied. Materials and Methods: Forty female rats were randomly divided into five groups. The first group served as control,was injected with an equivalent volume (0.2 ml of normal saline, and received normal diet. Animals in the second group were non poly cystic ovary syndrome (PCOS rats which were treated with intragastric administration of aqueous extract of F. vulgare (150 mg/kg b.w.. In the third group, the rats were treated with intraperitoneal injection of estradiolvalerate (EV (4 mg in 0.2 ml of sesame oil. The fourth groups were treated with EV and AEF (150mg/kg bw with the same route. The fifth groups were treated with EV and AEF (100mg/kg bw. After 4 weeks of study, all of the rats were sacrificed, their kidneys tissues were processed for light microscopy, and some biochemical parameters of serum were measured. Results: The mean values of blood urea nitrogen in PCOS rats treated with low dose of AEF and EV and non-treated, was significantly (p
Household production of sorghum beer in Benin: technological and socio-economic aspects
Kayodé, A.P.P.; Hounhouigan, J.D.; Nout, M.J.R.; Niehof, A.
2007-01-01
This study evaluated the sorghum brewing microenterprises in Benin with emphasis on the beer quality, the social significance of the product as well as the income generated. Tchoukoutou, the Benin opaque sorghum beer, has important social functions as it fosters the cooperative spirit and remains an
Supplemental irrigation for grain sorghum production in the US Eastern Coastal Plain
Grain sorghum is an important grain crop throughout the world and is generally considered drought tolerant. Recently, in the US eastern Coastal Plain region, there was an emphasis on increasing regional grain production with grain sorghum having an important role. The region soils have low water hol...
Intercropping Urochloa brizantha and sorghum inoculated with Azospirillum brasilense for silage
Directory of Open Access Journals (Sweden)
Allan Hisashi Nakao
Full Text Available ABSTRACT Livestock performance in the Brazilian Cerrado has been limited by the low availability of good quality fodder, especially during periods of low rainfall. The aim of this study was to evaluate growth and dry matter production in two cultivars of sorghum, inoculated or not with diazotrophic bacteria, and as a monocrop or intercropped with palisade grass under a system of crop-livestock integration. The experiments were carried out in the field in the Cerrado region during the autumn-winter period of 2015 and 2016, on the experimental farm of the Faculty of Engineering at Ilha Solteira, UNESP, in Selvíria, in the State of Mato Groso do Sul, Brazil (MS. A randomised complete block experimental design was used in a 2 x 2 x 2 factorial scheme with four replications. The treatments corresponded to two agricultural years (2015 and 2016; the cultivation of dual-purpose grain sorghum, alone or intercropped with palisade grass; with or without inoculation of the sorghum seeds with the bacterium Azospirillum brasilense. The dry matter production of the plant components and plant growth were evaluated for the preparation of silage. Inoculation of sorghum seeds with the bacterium Azospirillum brasilense increases the production of plant dry matter for silage, irrespective of the cultivar or intercrop. Dual-purpose grain sorghum intercropped with palisade grass is a viable agronomic system for producing plant matter for silage during the autumn season.
Oreganum vulgare Linn. leaf: An Extensive Pharmacognostical and Phytochemical Quality Assessment
Directory of Open Access Journals (Sweden)
Veni Bharti
2013-08-01
Full Text Available Purpose: Standardization and detailed pharmacognostical studies of Oreganum vulgare Linn. leaf for authentication and commercial utilization. Methods: Oreganum vulgare Linn. leaf was with standardization according to standard procedures described in WHO, 2011 and I.P. 1996. Results: The physicochemical parameters total ash, acid insoluble ash, water soluble ash and sulphated ash were found to be 11.5%, 11%, 5, 10.5% w/w respectively. Foaming index was found be <100. The trace elements were found to be copper, lead, cadmium, zinc, cobalt, manganese, nickel and copper in ethanol extract and phytochemical screening of aqueous and ethanol extract showed the presence of carbohydrates, flavonoids, anthocyanins, phenolic compounds etc. Conclusion: The standardization parameters viz. physico-chemical parameters, macroscopy, microscopy, taxonomy, anatomy and preliminary phytochemical screening, microbial and aflatoxin count, HPTLC profile is being reported to help in authentication and development of monograph of this plant.
Directory of Open Access Journals (Sweden)
A. Mehraban
2012-10-01
Full Text Available To evaluate the influence of vesicular arbuscular mycorrhizal (VAM on yield and yield components of three sorghum cultivars, a factorial experiment based randomized complete block design with four replications was carried out in 2007, at the Agricultural Research Center of Zahak, Iran. The treatments were different mycorrhiza species in three levels: without mycorrhiza (M1, Glomus etanicatum (M2 and G. mosseae(M3 and three cultivars of sorghum: local cultivars (C1, KGS25 (C2 and KGS29 (C3. The results showed that all of the traits measured were increased by inoculation of cultivars with mycorrhiza. The highest plant height (165.1 cm, stem diameter (1.61 cm, flag leaf length (27.22 cm, flag leaf width (3.67 cm and ear width (5.00 cm was obtained by inoculation of seed with Glumus etanicatum, and highest ear length (19.21 cm, ear number (2.51, seed number per ear (10252.11, 1000-seed weight (17.56 g and grain yield (1967.32 kg/ha by using Glumus mossea. The highest leaf width and length belonged to local cultivar, and the highest seed yield to KGS 29 cultivar. However, differences of other traits among sorghum cultivars were not significant. Based on the experimental results it can be concluded that highest grain yield may be obtained by inoculating seeds of KGS 29 with Glumus mossea.
Fuel ethanol production from sweet sorghum bagasse using microwave irradiation
International Nuclear Information System (INIS)
Marx, Sanette; Ndaba, Busiswa; Chiyanzu, Idan; Schabort, Corneels
2014-01-01
Sweet sorghum is a hardy crop that can be grown on marginal land and can provide both food and energy in an integrated food and energy system. Lignocellulose rich sweet sorghum bagasse (solid left over after starch and juice extraction) can be converted to bioethanol using a variety of technologies. The largest barrier to commercial production of fuel ethanol from lignocellulosic material remains the high processing costs associated with enzymatic hydrolysis and the use of acids and bases in the pretreatment step. In this paper, sweet sorghum bagasse was pretreated and hydrolysed in a single step using microwave irradiation. A total sugar yield of 820 g kg −1 was obtained in a 50 g kg −1 sulphuric acid solution in water, with a power input of 43.2 kJ g −1 of dry biomass (i.e. 20 min at 180 W power setting). An ethanol yield based on total sugar of 480 g kg −1 was obtained after 24 h of fermentation using a mixed culture of organisms. These results show the potential for producing as much as 0.252 m 3 tonne −1 or 33 m 3 ha −1 ethanol using only the lignocellulose part of the stalks, which is high enough to make the process economically attractive. - Highlights: • Different sweet sorghum cultivars were harvested at 3 and 6 months. • Sweet sorghum bagasse was converted to ethanol. • Microwave pretreatment and hydrolysis was done in a single step. • Sugar rich hydrolysates were converted to ethanol using co-fermentation
YIELD AND QUALITY OF SORGHUM IN IRRIGATED AGRO LANDSCAPES OF REPUBLIC OF DAGESTAN
Directory of Open Access Journals (Sweden)
M G. Muslimov
2016-01-01
Full Text Available Aim. One of drought-resistant crops that can provide stable high yields is sorghum, which is salt-tolerant, heat-resistant and a flexible crop of versatile use (green forage, silage, hay, grass meal, grain forage. The research conducted in 2010-2013 included studies on the effectiveness of the methods and norms of sowing the sorghum, required quantities of mineral fertilizers to increase the crop yields and nutritional value of sorghum sown in the irrigated lowland areas of Dagestan. Methods. We conducted three field researches. In experiments with grain sorghum (the middle ripening group Zernogradskiy 88 we studied drill and broad-cast methods of sowing, seeding rate, the calculated doses of mineral fertilizers on programmable levels of crop yields: 6 t/ha (N160P112K70, 7 t/ha (N190P128K80 and 8 t/ha (N220P144K90. Seeding rate was 300, 350 and 400 thousand viable seeds per 1 ha; broadcast was chosen as a sowing method.A field experiment with sweet sorghum included promising hybrid crop Debut, fertilizers N140P80K70, N190P110K95 and N240P140K120 to obtain 60, 70 and 80 t/ha of green mass for two mowings, respectively. Results. The use of fertilizers based on a given level of productivity at optimum plant population can significantly improve the nutritional regime of the soil during the growing season of the sweet sorghum and create optimal conditions for nitrogen, phosphorus and potassium security for the crops and thus obtain the planned crop yield. Conclusion. The fodder quality of sweet sorghum varies depending on the nutrient status of the soil and mowing time.
Upadhyaya, Hari D; Wang, Yi-Hong; Sharma, Rajan; Sharma, Shivali
2013-06-01
Anthracnose in sorghum caused by Colletotrichum sublineolum is one of the most destructive diseases affecting sorghum production under warm and humid conditions. Markers and genes linked to resistance to the disease are important for plant breeding. Using 14,739 SNP markers, we have mapped eight loci linked to resistance in sorghum through association analysis of a sorghum mini-core collection consisting of 242 diverse accessions evaluated for anthracnose resistance for 2 years in the field. The mini-core was representative of the International Crops Research Institute for the Semi-Arid Tropics' world-wide sorghum landrace collection. Eight marker loci were associated with anthracnose resistance in both years. Except locus 8, disease resistance-related genes were found in all loci based on their physical distance from linked SNP markers. These include two NB-ARC class of R genes on chromosome 10 that were partially homologous to the rice blast resistance gene Pib, two hypersensitive response-related genes: autophagy-related protein 3 on chromosome 1 and 4 harpin-induced 1 (Hin1) homologs on chromosome 8, a RAV transcription factor that is also part of R gene pathway, an oxysterol-binding protein that functions in the non-specific host resistance, and homologs of menthone:neomenthol reductase (MNR) that catalyzes a menthone reduction to produce the antimicrobial neomenthol. These genes and markers may be developed into molecular tools for genetic improvement of anthracnose resistance in sorghum.
Characterization of novel Brown midrib 6 mutations affecting lignin biosynthesis in sorghum
The presence of lignin reduces the quality of lignocellulosic biomass for forage materials and feedstock for biofuels. In C4 grasses, the brown midrib phenotype has been linked to mutations to genes in the monolignol biosynthesis pathway. For example, the Bmr6 gene in sorghum (Sorghum bicolor) has b...
Directory of Open Access Journals (Sweden)
M.B. Cleff
2008-04-01
Full Text Available In vitro activity of the essential oil Origanum vulgare against Sporothrix schenckii was determined by the MIC (Minimum Inhibitory Concentration. For this, seven samples of S. schenckii were studied, two isolated from two cases of human sporotrichosis and five isolated from cats. Analysis of the essential oil was carried out in a gas chromatograph (GC/FID for the identification and quantification of thymol and carvacrol (antifungal agents. MIC was obtained based on the microdilution method according to the adapted document NCCLS-M 27A2 for fitopharmacy. All the isolates presented sensibility to the essential oil. S. schenckii was inhibited in a concentration of 0.25% (250m l/ml. Chromatographic analysis showed that thymol concentration was bigger than carvacrol. The antifungal activity demonstrated by the essential oil of O. vulgare against S. Schenckii stimulates the accomplishment of more studies, including in vivo studies.
Critical periods of sorghum and palisadegrass in intercropped cultivation for climatic risk zoning
Directory of Open Access Journals (Sweden)
Nino Rodrigo Cabral de Barros Lima
2011-07-01
Full Text Available The objective of this work was to define critical periods for sorghum and palisadegrass cultivated on crop-livestock integrated systems under water deficit. An experiment was carried out in a completely random block design with four treatments (control and interruption of water supply in three periods and three replicates. Water supply was interrupted until soil water humidity was close to permanent wilting point at the phases: germination of palisadegrass seeds; start of tillering of palisadegrass and initiation of panicles of shorghum; start of shorghum flowering. Water deficit starting at palisadegrass germination delayed intital development of the plants because of the reduction in tillering. Water restriction at panicle initiation phase and at sorghum flowering determined reduction of grain production. Critical periods for intercrop of sorghum and palisadegrass correspond to palisadegrass germination phase and flowering and panicle inititation phase of sorghum.
Directory of Open Access Journals (Sweden)
Thompson Karen J
2002-01-01
Full Text Available Abstract Background Factors that affect flowering vary among different plant species, and in the grasses in particular the exact mechanism behind this transition is not fully understood. The brown midrib (bm mutants of maize (Zea mays L., which have altered cell wall composition, have different flowering dynamics compared to their wild-type counterparts. This is indicative of a link between cell wall biogenesis and flowering. In order to test whether this relationship also exists in other grasses, the flowering dynamics in sorghum (Sorghum bicolor (L. Moench were investigated. Sorghum is evolutionarily closely related to maize, and a set of brown midrib (bmr mutants similar to the maize bm mutants is available, making sorghum a suitable choice for study in this context. Results We compared the flowering time (time to half-bloom of several different bmr sorghum lines and their wild-type counterparts. This revealed that the relationship between cell wall composition and flowering was conserved in sorghum. Specifically, the mutant bmr7 flowered significantly earlier than the corresponding wild-type control, whereas the mutants bmr2, bmr4, bmr6, bmr12, and bmr19 flowered later than their wild-type controls. Conclusion The change in flowering dynamics in several of the brown midrib sorghum lines provides evidence for an evolutionarily conserved mechanism that links cell wall biosynthesis to flowering dynamics. The availability of the sorghum bmr mutants expands the germplasm available to investigate this relationship in further detail.
Submergence tolerance in Hordeum marinum
DEFF Research Database (Denmark)
Pedersen, Ole; Malik, Al I.; Colmer, Timothy D.
2010-01-01
Floodwaters differ markedly in dissolved CO(2), yet the effects of CO(2) on submergence responses of terrestrial plants have rarely been examined. The influence of dissolved CO(2) on underwater photosynthesis and growth was evaluated for three accessions of the wetland plant Hordeum marinum Huds....... All three accessions tolerated complete submergence, but only when in CO(2) enriched floodwater. Plants submerged for 7 days in water at air equilibrium (18 mM CO(2)) suffered loss of biomass, whereas those with 200 mM CO(2) continued to grow. Higher underwater net photosynthesis at 200 mM CO(2......) increased by 2.7- to 3.2-fold sugar concentrations in roots of submerged plants, compared with at air equilibrium CO(2). Leaf gas films enhancing gas exchange with floodwater, lack of a shoot elongation response conserving tissue sugars and high tissue porosity (24-31% in roots) facilitating internal O(2...
Molecular markers associated with aluminium tolerance in Sorghum bicolor.
Too, Emily Jepkosgei; Onkware, Augustino Osoro; Were, Beatrice Ang'iyo; Gudu, Samuel; Carlsson, Anders; Geleta, Mulatu
2018-01-01
Sorghum ( Sorghum bicolor , L. Moench) production in many agro-ecologies is constrained by a variety of stresses, including high levels of aluminium (Al) commonly found in acid soils. Therefore, for such soils, growing Al tolerant cultivars is imperative for high productivity. In this study, molecular markers associated with Al tolerance were identified using a mapping population developed by crossing two contrasting genotypes for this trait. Four SSR ( Xtxp34 , Sb5_236 , Sb6_34 , and Sb6_342 ), one STS ( CTG29_3b ) and three ISSR ( 811_1400 , 835_200 and 884_200 ) markers produced alleles that showed significant association with Al tolerance. CTG29_3b, 811_1400 , Xtxp34 and Sb5_ 236 are located on chromosome 3 with the first two markers located close to Alt SB , a locus that underlie the Al tolerance gene ( SbMATE ) implying that their association with Al tolerance is due to their linkage to this gene. Although CTG29_3b and 811_ 1400 are located closer to Alt SB , Xtxp34 and Sb5_236 explained higher phenotypic variance of Al tolerance indices. Markers 835_200 , 884_200 , Sb6_34 and Sb6_342 are located on different chromosomes, which implies the presence of several genes involved in Al tolerance in addition to S bMATE in sorghum. These molecular markers have a high potential for use in breeding for Al tolerance in sorghum.
Genetic diversity among sorghum landraces and polymorphism ...
African Journals Online (AJOL)
breeding program through marker-assisted selection. ... Keywords: Sorghum, diversity, stay-green trait, marker, polymorphism. ..... Na: Number of different alleles; Na Freq: Frequency of different alleles; Ne: Number of effective alleles; ...
Yield and forage value of a dual-purpose bmr-12 sorghum hybrid
Grain sorghum [Sorghum bicolor (L.) Moench] is an important crop for rainfed production systems with 2.7 million ha grown in the USA in 2013. The brown-midrib (bmr) mutations, especially bmr-12, have resulted in low stover lignin and high fiber digestibility without reducing grain yield in some sor...
Genetic analysis of male sterility genes in different A and B sorghum ...
African Journals Online (AJOL)
Hybrid seed production requires use of cytoplasmic male sterility (CMS). Without this system, hybrid seed production would not be economically feasible. There is, therefore, need for developing A and B sorghum lines, as an essential step for development of hybrid sorghum industry. A genetic study of male sterility in ...
Jia, Weitao; Lv, Sulian; Feng, Juanjuan; Li, Jihong; Li, Yinxin; Li, Shizhong
2016-09-01
Cadmium (Cd) contamination is a worldwide environmental problem, and remediation of Cd pollution is of great significance for food production as well as human health. Here, the responses of sweet sorghum cv. 'M-81E' to cadmium stress were studied for its potential as an energy plant in restoring soils contaminated by cadmium. In hydroponic experiments, the biomass of 'M-81E' showed no obvious change under 10 μM cadmium treatment. Cadmium concentration was the highest in roots of seedlings as well as mature plants, but in agricultural practice, the valuable and harvested parts of sweet sorghum are shoots, so promoting the translocation of cadmium to shoots is of great importance in order to improve its phytoremediation capacity. Further histochemical assays with dithizone staining revealed that cadmium was mainly concentrated in the stele of roots and scattered in intercellular space of caulicles. Moreover, the correlation analysis showed that Cd had a negative relationship with iron (Fe), zinc (Zn), and manganese (Mn) in caulicles and leaves and a positive relationship with Fe in roots. These results implied that cadmium might compete with Fe, Zn, and Mn for the transport binding sites and further prevent their translocation to shoots. In addition, transmission electron microscopic observations showed that under 100 μM cadmium treatment, the structure of chloroplast was impaired and the cell wall of vascular bundle cells in leaves and xylem and phloem cells in roots turned thicker compared to control. In summary, morphophysiological characteristic analysis demonstrated sweet sorghum can absorb cadmium and the growth is not negatively affected by mild level cadmium stress; thus, it is a promising material for the phytoremediation of cadmium-contaminated soils considering its economic benefit. This study also points out potential strategies to improve the phytoremediation capacity of sweet sorghum through genetic modification of transporters and cell wall
Vaz Patto, M.C.; Aardse, A.; Buntjer, J.; Rubiales, D.; Martin, A.; Niks, R.E.
2001-01-01
In Hordeum chilense Roem. & Schult., a high variation in the level of avoidance to infection of barley leaf rust (Puccinia hordei Otth) occurs. Probably resulting from the properties of the stomata, the rust germ tube overgrows stomata, and the infection process fails in an early stage. In the
Map-based cloning and expression analysis of BMR-6 in sorghum.
Li, Jieqin; Wang, Lihua; Zhang, Qiuwen; Liu, Yanlong
2015-09-01
Brown midrib mutants in sorghum are associated with reduced lignin content and increased cell wall digestibility. In this study, we characterized a bmr-6 sorghum mutant, which shows reddish pigment in the midrib and stem after the fifth-leaf stage. Compared to wild type, Kalson lignin content of bmr-6 is decreased significantly. We used histological analysis to determine that the mutant exhibited a modified pattern of lignin staining and found an increased polysaccharide content. We cloned BMR-6 gene, a gene encoded a cinnamyl alcohol dehydrogenase (CAD), using a map-based cloning approach. Genetic complementation confirmed that CAD is responsible for the BMR-6 phenotype. BMR-6 gene was expressed in all tested sorghum tissues, with the highest being in midrib and stem. Transient expression assays in Nicotiana benthamiana leaves demonstrated cytomplasmic localization of BMR-6. We found that the expression level of bmr-6 was significantly decreased in the mutant but expression of SbCAD3 and SbCAD5 were significantly increased. Our results indicate that BMR-6 not only affects the distribution of lignin but also the biosynthesis of lignin in sorghum.
Batonon-Alavo, D I; Bastianelli, D; Lescoat, P; Weber, G M; Umar Faruk, M
2016-07-01
Two experiments were conducted to investigate the use of sorghum, cottonseed meal and millet in broiler diets and their interaction when they are used simultaneously. In Experiment 1, a corn-soybean meal control diet was compared with eight experimental treatments based on low tannin sorghum (S30, S45 and S60), cottonseed meal (CM15, CM40) or both ingredients included in the same diet (S30/CM40, S45/CM25 and S60CM15). Results showed that BW gain was not affected by the inclusion of sorghum or cottonseed meal. However, feed intake tended to be affected by the cereal type with the highest values with sorghum-based diets. Feed conversion ratio increased (Pdigestibility (%) of protein and energy with the cottonseed meal and sorghum/cottonseed meal-based diets having lower protein and energy digestibility compared with corn-based diets. In Experiment 2, a control diet was compared with six diets in which corn was substituted at 60%, 80% or 100% by either sorghum or millet and other three diets with simultaneous inclusion of these two ingredients (S30/M30, S40/M40, S50/M50). Single or combined inclusion of sorghum and millet resulted in similar feed intake and growth performance as the control diet. Apparent ileal digestibility of protein and energy was higher with millet-based diets (Pdigestibility of protein in sorghum and millet-based diets tended to decrease linearly with the increasing level of substitution. Sorghum-based diets resulted in lower total tract digestibility of fat compared with millet and sorghum/millet-based diets (Pdigestibility of starch were obtained with the control diet and millet-based diets compared with the sorghum-based treatments. Results of the two experiments suggest that broiler growth performance was not affected by the dietary level of sorghum, millet or cottonseed meal. Nutrient digestion can, however, be affected by these feed ingredients.
Compartmentation of sucrose during radial transfer in mature sorghum culm
Directory of Open Access Journals (Sweden)
Vietor Donald M
2007-06-01
Full Text Available Abstract Background The sucrose that accumulates in the culm of sorghum (Sorghum bicolor (L. Moench and other large tropical andropogonoid grasses can be of commercial value, and can buffer assimilate supply during development. Previous study conducted with intact plants showed that sucrose can be radially transferred to the intracellular compartment of mature ripening sorghum internode without being hydrolysed. In this study, culm-infused radiolabelled sucrose was traced between cellular compartments and among related metabolites to determine if the compartmental path of sucrose during radial transfer in culm tissue was symplasmic or included an apoplasmic step. This transfer path was evaluated for elongating and ripening culm tissue of intact plants of two semidwarf grain sorghums. The metabolic path in elongating internode tissue was also evaluated. Results On the day after culm infusion of the tracer sucrose, the specific radioactivity of sucrose recovered from the intracellular compartment of growing axillary-branch tissue was greater (nearly twice than that in the free space, indicating that sucrose was preferentially transferred through symplasmic routes. In contrast, the sucrose specific radioactivity in the intracellular compartment of the mature (ripening culm tissue was probably less (about 3/4's than that in free space indicating that sucrose was preferentially transferred through routes that included an apoplasmic step. In growing internodes of the axillary branch of sorghum, the tritium label initially provided in the fructose moiety of sucrose molecules was largely (81% recovered in the fructose moiety, indicating that a large portion of sucrose molecules is not hydrolysed and resynthesized during radial transfer. Conclusion During radial transfer of sucrose in ripening internodes of intact sorghum plants, much of the sucrose is transferred intact (without hydrolysis and resynthesis and primarily through a path that includes an
As diet is one of the major controllable factors in cancer development, potentially chemopreventive foods are of significant interest to public health. One such food is sorghum (Sorghum bicolor), a cereal grain that contains varying concentrations of polyphenols. In a panel of 15 sorghum germplasm...
Characterization of novel multi-seeded (msd) mutants of sorghum for increasing grain number
The tribe Andropogoneae of the Poaceae family exhibits highly branched inflorescence known as panicle or tassel. Characteristically, each spikelet in a panicle or tassel comprise of a combination of sessile/fertile and sterile florets. In sorghum, (Sorghum bicolor L. Moench), the existing cultivars ...
Factors affecting the porridge-making quality in South African sorghums
CSIR Research Space (South Africa)
Taylor, JRN
1997-04-01
Full Text Available fermented, sour porridges remain popular, particularly among the Tswana of Botswana and South Africa (Novellie 1982; Sooliman 1993) The production of sorghum porridge involves ?rst producing a meal from sorghum grain. Commercially, this is generally done..., South Africa. the remaining part of the kernel (essentially endosperm) into a coarse meal. Alternatively, endosperm meal can be produced directly from grain by roller milling (Munck 1995). The meal is then cooked with boiling water into a porridge...
Isozyme differences in barley mutants
Energy Technology Data Exchange (ETDEWEB)
AI-Jibouri, A A.M.; Dham, K M [Department of Botany, Nuclear Research Centre, Baghdad (Iraq)
1990-01-01
Full text: Thirty mutants (M{sub 11}) of barley (Hordeum vulgare L.) induced by physical and chemical mutagens were analysed for isozyme composition using polyacrylamide gel electrophoresis. Results show that these mutants were different in the isozymes leucine aminopeptidase, esterase and peroxidase. The differences included the number of forms of each enzyme, relative mobility value and their intensity on the gel. Glutamate oxaloacetate transaminase isozyme was found in six molecular forms and these forms were similar in all mutants. (author)
Host genotype is an important determinant of the cereal phyllosphere mycobiome
DEFF Research Database (Denmark)
Sapkota, Rumakanta; Knorr, Kamilla; Jørgensen, Lise Nistrup
2015-01-01
The phyllosphere mycobiome in cereals is an important determinant of crop health. However, an understanding of the factors shaping this community is lacking. Fungal diversity in leaves from a range of cultivars of winter wheat (Triticum aestivum), winter and spring barley (Hordeum vulgare...... and location have minor effects. We found many host-specific fungal pathogens, but also a large diversity of fungi that were relatively insensitive to host genetic background, indicating that host-specific pathogens live in a 'sea' of nonspecific fungi....
DOES JASMONIC ACID PREVENT THE GERMINATION
ÇAVUŞOĞLU, Kürşat
2009-01-01
Abstract: Effect of jasmonic acid on seed germination and seedling growth of barley (Hordeum vulgare L. cv. Bülbül 89) was investigated in the present study. Jasmonic acid concentrations less than 1500 µM have not inhibited the seed germination, while 1500 and 2000 µM jasmonic acid levels caused atypical germination. The germination was completely inhibited at 3000 µM level of jasmonic acid. However, the seedling growth clearly slowed down with increasing concentrations of jasmonic acid. Furt...
DEFF Research Database (Denmark)
Kaczmarczyk, Agnieszka Ewa; Dionisio, Giuseppe; Renaut, Jenny
2012-01-01
The aim of the study was to understand the molecular and biochemical mechanisms underpinning the effect of nitrogen (N) on barley (Hordeum vulgare) storage protein production (hordeins) during grain filling. Using a combination of advanced biochemistry methods, we could comprehensively describe......-regimes caused significant differences in both quantity and quality of the storage proteins transcripts. Principal Component Analysis of the amino acid (AA) profiles also indicated dissimilarity in individual AA percentages, correlated to hordein content. The abundance values of proteins of interest confirmed...
Hernández Díaz-Ambrona, Carlos Gregorio
1999-01-01
Este trabajo profundiza en el estudio de los sistemas agrícolas de secano de la Meseta Central. Sobre la base de la alternativa tradicional ce^eal^arbecho, se han estudiado durante tres años de cultivo 1995/96, 1996/97 y 1997/98 seis rotaciones diferentes: monocultivo de cebada (Hordeum vulgare L.), cebada/barbecho, cebada/habas (Viciafaba L.), cebada/guisantes {Pisum sativum L.), cebada/habas/barbecho y cebada/guisantes/barbecho. Entre las rotaciones, se ha comparado la biomasa, el rendimien...
Resistance to Barley Leaf Stripe
DEFF Research Database (Denmark)
Nørgaard Knudsen, J. C.
1986-01-01
in well adapted Northwest European spring cultivars. Virulence matching two hitherto not overcome resistances was demonstrated. Differences in apparent race nonspecific or partial resistance were also present, changing the percentage of infected plants of susceptible genotypes from about 20 to 44 per cent.......Ten barley [Hordeum vulgare] genotypes were inoculated with twelve isolates of Pyrenophora graminea of diverse European and North African origin. Race specific resistance occurred. Four, possibly five, genetically different sources of race-specific resistance were found, three of them occurring...
Directory of Open Access Journals (Sweden)
Nan Jia
Full Text Available Bacillus strains have been widely used as the companion strain of Ketogulonigenium vulgare in the process of vitamin C fermentation. Different Bacillus strains generate different effects on the growth of K. vulgare and ultimately influence the productivity. First, we identified that Bacillus endophyticus Hbe603 was an appropriate strain to cooperate with K. vulgare and the product conversion rate exceeded 90% in industrial vitamin C fermentation. Here, we report the genome sequencing of the B. endophyticus Hbe603 industrial companion strain and speculate its possible advantage in the consortium. The circular chromosome of B. endophyticus Hbe603 has a size of 4.87 Mb with GC content of 36.64% and has the highest similarity with that of Bacillus megaterium among all the bacteria with complete genomes. By comparing the distribution of COGs with that of Bacillus thuringiensis, Bacillus cereus and B. megaterium, B. endophyticus has less genes related to cell envelope biogenesis and signal transduction mechanisms, and more genes related to carbohydrate transport and metabolism, energy production and conversion, as well as lipid transport and metabolism. Genome-based functional studies revealed the specific capability of B. endophyticus in sporulation, transcription regulation, environmental resistance, membrane transportation, extracellular proteins and nutrients synthesis, which would be beneficial for K. vulgare. In particular, B. endophyticus lacks the Rap-Phr signal cascade system and, in part, spore coat related proteins. In addition, it has specific pathways for vitamin B12 synthesis and sorbitol metabolism. The genome analysis of the industrial B. endophyticus will help us understand its cooperative mechanism in the K. vulgare-Bacillus strain consortium to improve the fermentation of vitamin C.
Variation of Transpiration Efficiency in Sorghum
Declining freshwater resources, increasing population, and growing demand for biofuels pose new challenges for agriculture research. To meet these challenges, the concept “Blue Revolution” was proposed to improve water productivity in agriculture--“More Crop per Drop”. Sorghum is the fifth most imp...
Variation in transpiration efficiency in sorghum
Declining freshwater resources, increasing population, and growing demand for biofuels pose new challenges for agriculture research. To meet these challenges, the concept “Blue Revolution” was proposed to improve water productivity in agriculture--“More Crop per Drop”. Sorghum is the fifth most imp...
On the extent of genetic variation for transpiration efficiency in sorghum
International Nuclear Information System (INIS)
Hammer, G.L.; Broad, I.J.; Farquhar, G.D.
1997-01-01
A glasshouse study examined 49 diverse sorghum lines for variation in transpiration efficiency. Three of the 49 lines grown were Sorghum spp. native to Australia; one was the major weed Johnson grass (Sorghum halepense), and the remaining 45 lines were cultivars of Sorghum bicolor. All plants were grown under non-limiting water and nutrient conditions using a semi-automatic pot watering system designed to facilitate accurate measurement of water use. Plants were harvested 56-58 days after sowing and dry weights of plant parts were determined. Transpiration efficiency differed significantly among cultivars. The 3 Australian native sorghums had much lower transpiration efficiency than the other 46 cultivars, which ranged from 7.7 to 6.0 g/kg. For the 46 diverse cultivars, the ratio of range in transpiration efficiency to its l.s.d. was 2.0, which was similar to that found among more adapted cultivars in a previous study. This is a significant finding as it suggests that there is likely to be little pay-off from pursuing screening of unadapted material for increased variation in transpiration efficiency. It is necessary, however, also to examine absolute levels of transpiration efficiency to determine whether increased levels have been found. The cultivar with greatest transpiration efficiency in this study (IS9710) had a value 9% greater (P < 0.05) than the accepted standard for adapted sorghum cultivars. The potential impact of such an increase in transpiration efficiency warrants continued effort to capture it. Transpiration efficiency has been related theoretically and experimentally to the degree of carbon isotope discrimination in leaf tissue in sorghum, which thus offers a relatively simple selection index. In this study, the variation in transpiration efficiency was not related simply to carbon isotope discrimination. Significant associations of transpiration efficiency with ash content and indices of photosynthetic capacity were found. However, the
Directory of Open Access Journals (Sweden)
Pattarawadee Sumthong Nakmee
2016-05-01
Full Text Available Sorghum (Sorghum bicolor Linn. seedlings were grown in pots using Pakchong soil from Nakhon Ratchasima province. Ten species of native Arbuscular mycorrhizal (AM fungi: Glomus sp. 1, Glomus sp. 2, Glomus sp. 3, Glomus aggregatum, Glomus fasciculatum, Acaulospora longula, Glomus occultum, Acaulospora scrobiculata, Acaulospora spinosa and Scutellospora sp., were used to inoculate sorghum seedlings. The sorghum growth and uptake of several major nutrients were evaluated at the harvesting stage. The results revealed that sorghum inoculated with A. scrobiculata produced the greatest biomass, grain dry weight and total nitrogen uptake in shoots. The highest phosphorus uptake in shoots was found in A. spinosa-inoculated plants, followed by Glomus sp. and A. scrobiculata, whereas Scutellospora sp.-inoculated plants showed the highest potassium uptake in shoots followed by A. scrobiculata. Overall, the most efficient AM fungi for improvement of nutrient uptake, biomass and grain dry weight in sorghum were A. scrobiculata.
International Nuclear Information System (INIS)
Ntaikou, I.; Antonopoulou, G.; Marazioti, C.; Lyberatos, G.
2008-01-01
Full text: The present study focuses on the exploitation of sweet sorghum biomass for gas biofuel production in continuous and batch systems. Sweet sorghum is an annual C 4 plant of tropical origin, well-adapted to sub-tropical and temperate regions and highly productive in biomass. It is rich in readily fermentable sugars and thus it can be considered as an excellent raw material for biohydrogen production from many different fermentative microorganisms. Extraction of free sugars from the sorghum stalks was achieved using water at 30 degrees centigrade. After the extraction process a liquid fraction (sorghum extract), rich in sucrose, and a solid fraction (sorghum cellulosic-hemicellulosic residues or sorghum bagasse), containing the cellulose and hemicelluloses, were obtained. A two-step continuous process was developed for the biological hydrogen production and the subsequent production of biogas from sweet sorghum extract. In the first reactor sugars were fermented to hydrogen, volatile fatty acids and alcohols b mixed acidogenic culture derived from the indigenous microfauna of sweet sorghum. The hydrogen producing reactor was operated at five different hydraulic retention times (HRT), i.e 24h, 12h, 8h, 6h and 4h. The HRT of 12h proved to be the most effective leading to the production 10.4 L H 2 /kg sweet sorghum biomass. Subsequently, the effluent was fed to the methanogenic reactor, where all the residual organic compounds were digested by an acclimated methanogenic culture derived from activated sludge. The operation of the methanogenic reactor was studied at three different HRTs, i.e 20d, 15d and 10d with the latter being the most prosing leading to the production 35.2 L CH 4 /kg sweet sorghum biomass. Both continuous and batch cultures were used for the investigation of hydrogen production from sweet sorghum biomass using Ruminococcus albus. R. albus is an important, fibrolytic bacterium of the rumen that can hydrolyse both cellulose and hemicellulose
Response of Fusarium thapsinum to sorghum brown midrib lines and to phenolic metabolites
Presentation type: poster Presentation title: Response of Fusarium thapsinum to sorghum brown midrib lines and to phenolic metabolites Sorghum lines were bred for reduced lignin for cellulosic bioenergy uses, through the incorporation of brown midrib (bmr) bmr6 and/or 12 into two gen...
Genetic diversity of sweet sorghum germplasm in Mexico using AFLP and SSR markers
The objective of this work was to evaluate the diversity and genetic relationships between lines and varieties of the sweet sorghum (Sorghum bicolor) germplasm bank of the National Institute for Forestry, Agriculture and Livestock Research, Mexico, using AFLP and SSR markers. The molecular markers ...
Directory of Open Access Journals (Sweden)
A. Hedayatipour
2012-10-01
Full Text Available The chemical and fermentative parameters of three fresh forages and silages of sorghum including Sweet, Pegah and Speedfeed varieties were compared with corn using in vitro method, also degradability coefficients of forages and silages were determined by in situ method. Forages were planted in the same condition and harvested in soft dough stage, then ensilaged in four replicates for each time of 30, 60 and 90 days of preservation in mini silos. Buffering capacity in green Sweet sorghum was lower than corn and Speedfeed, and acid detergent fiber and water soluble carbohydrates respectively were significantly highest and lowest in fresh forage of Speedfeed sorghum. In time of 60 days, percent of acid detergent lignin of corn silage was lower than Sweet and Speedfeed sorghum silages; similarly, residual water soluble carbohydrate was lowest in corn silage. The lactate Concentration in corn and Pegah sorghums was higher than Sweet and Speedfeed silages. In corn and Sweet sorghum silages, Contents of acetic acid and ammonium nitrogen were highest and lowest, respectively. In nylon bag experiment, Degradation rate of corn and Pegah sorghum forages were significantly higher than Sweet and Speedfeed sorghums that cause to more effective degradability with passage rate of 0.08 in this forages. Also, the slowly degradation coefficient of corn silage was higher than sorghums silages. In conclusion, Speedfeed sorghum forage is not suitable for making silage in comparison others, and corn silage had more potential of degradability.
Akhter, S R; Ikezaki, H; Gao, X P; Rubinstein, I
1999-05-01
The purpose of this study was to determine whether dexamethasone attenuates grain sorghum dust extract-induced increase in macromolecular efflux from the in situ hamster cheek pouch and, if so, whether this response is specific. By using intravital microscopy, we found that an aqueous extract of grain sorghum dust elicited significant, concentration-dependent leaky site formation and increase in clearance of FITC-labeled dextran (FITC-dextran; mol mass, 70 kDa) from the in situ hamster cheek pouch (P grain sorghum dust extract- and substance P-induced increases in macromolecular efflux from the in situ hamster cheek pouch in a specific fashion.
Potensi penggunaan beberapa varietas sorgum manis (Sorghum bicolor (L. Moench sebagai tanaman pakan
Directory of Open Access Journals (Sweden)
Mustikoweni Purnomohadi
2012-02-01
Full Text Available Sweet sorghum is a versatile crop that can be used as grain crop, sugar alcohol production and even as forage crop. The aim of this study was to evaluate the potential use of sweet sorghum either as grain crop or forage crop. The experiment used four varieties of sweet sorghum: Rio, Cawley, Keller and Wray, which were planted in polybag with six replication using Completely Randomized Design. The result of the research showed that Keller and Wray had longer vegetative growth, and good quality of chemical composition for forage than Rio and Cawley.
Post-anthesis nitrate uptake is critical to yield and grain protein content in Sorghum bicolor.
Worland, Belinda; Robinson, Nicole; Jordan, David; Schmidt, Susanne; Godwin, Ian
2017-09-01
Crops only use ∼50% of applied nitrogen (N) fertilizer creating N losses and pollution. Plants need to efficiently uptake and utilize N to meet growing global food demands. Here we investigate how the supply and timing of nitrate affects N status and yield in Sorghum bicolor (sorghum). Sorghum was grown in pots with either 10mM (High) or 1mM (Low) nitrate supply. Shortly before anthesis the nitrate supply was either maintained, increased 10-fold or eliminated. Leaf sheaths of sorghum grown with High nitrate accumulated nitrate in concentrations >3-times higher than leaves. Removal of nitrate supply pre-anthesis resulted in the rapid reduction of stored nitrate in all organs. Plants receiving a 10-fold increase in nitrate supply pre-anthesis achieved similar grain yield and protein content and 29% larger grains than those maintained on High nitrate, despite receiving 24% less nitrate over the whole growth period. In sorghum, plant available N is important throughout development, particularly anthesis and grain filling, for grain yield and grain protein content. Nitrate accumulation in leaf sheaths presents opportunities for the genetic analysis of mechanisms behind nitrate storage and remobilization in sorghum to improve N use efficiency. Copyright © 2017 Elsevier GmbH. All rights reserved.
Directory of Open Access Journals (Sweden)
Evandro Leite de Souza
2006-12-01
Full Text Available Origanum vulgare L. (oregano, Lamiaceae, has been known as plant specie with prominent biological properties for a long time. This study aimed to evaluate the antibacterial activity of Origanum vulgare essential oil on various Gram-positive and Gram-negative spoiling and/or pathogen food-related bacteria, as well as to observe its antimicrobial effectiveness in a food conservation micromodel. The results showed a strong antibacterial activity of the assayed essential oil noted by large growth inhibition zones (30-37 mm. MIC values were between 20-40 µL/mL for the most bacteria strains. Essential oil was able to cause significant (POriganum vulgare L. (orégano, Lamiaceae, tem sido reconhecida como uma espécie vegetal com destacáveis propriedades biológicas por um longo tempo. Este estudo objetivou avaliar a atividade antibacteriana do óleo essencial de Origanum vulgare L. sobre várias bactérias Gram positivas e Gram negativas deteriorantes e/ou patogênicas de interesse em alimentos, bem como observar sua efetividade antimicrobiana em um micromodelo de conservação de alimentos. Os resultados mostraram uma considerável atividade antibacteriana do óleo essencial ensaiado notada por grandes zonas de inibição do crescimento bacteriano (30-37 mm. Os valores de CIM encontrados oscilaram entre 20-40 µL/mL para a maioria das bactérias. A CIM do óleo essencial causou um significante (P<0.05 efeito inibitório sobre a viabilidade bacteriana, sendo caracterizado uma propriedade bacteriostática após 24 horas de exposição. Ainda, a CIM causou uma diminuição significante (P<0.05 da contagem da flora bacteriana autóctone em carne moída armazenada sob refrigeração. Estes dados suportam a possibilidade do uso do óleo essencial de Origanum vulgare L. como composto antimicrobiano alternativo em sistemas de conservação de alimentos.
Martínez, F; Ciacco, C F; Salinas, Y
1992-06-01
The objective of this work was to study the effect of the extrusion process in the color of instant flours and its tortillas prepared with mixtures of commercial instant corn flour. In the extrusion process four flours from two genotypes of sorghum (whole and decorticated sorghum of each genotype) were used. These flours were processed in a single screw Brabender laboratory extruder. In the preparation of sorghum tortillas and sorghum-corn tortillas four flours were selected from the extrusion process. 1) genotype CMSXS 9A: Whole flour extruded with moisture content of 15% and screw rate of 130 rpm, flour from decorticated sorghum with particle size less than 0.420 mm extruded with moisture content of 15% and screw rate of 130 rpm, 2) genotype CMSXS 145: whole flour extruded with moisture content of 18% and screw rate of 170 rpm, decorticated sorghum flour extruded with moisture content of 15% and screw rate of 130 rpm. Also these flours were utilized with mixtures of commercial instant cornflour for the preparation of tortillas. The instant sorghum flours and tortillas from decorticated sorghum (20% = presented whiter color compared to instant whole sorghum flour and its tortillas. The addition of different levels of commercial instant corn flour (10, 20, 30, 40 and 50%) to the instant sorghum flours improved the color of the mixtures of flour and tortillas. This improvement was more pronounced with instant sorghum flour from whole sorghum grain.(ABSTRACT TRUNCATED AT 250 WORDS)
Cost to deliver sweet sorghum fermentables to a central plant
International Nuclear Information System (INIS)
Cundiff, J.S.
1991-01-01
The major obstacle to a sweet sorghum-for-ethanol industry in the Piedmont of Virginia is the short harvest season of eight weeks. A Piedmont harvesting system is described that will enable the Piedmont to compete with Louisiana in production of sweet sorghum for ethanol. The cost to supply feedstock (up to the point fermentation begins) for a one million GPY ethanol plant was estimated to be $2.35/gal expected ethanol yield. This amount compared favorably with two other options
Brown midrib sorghum deserves a look
Forage sorghum varieties have been developed to allow them to thrive under low moisture and poor soil conditions while producing adequate amounts of forage. In addition, newer varieties, such as the brown midrib (BMR) hybrids, can be alternatives to conventional varieties as they contain less lignin...
Smale, Melinda; Assima, Amidou; Kergna, Alpha; Thériault, Véronique; Weltzien, Eva
2018-01-01
Uptake of improved sorghum varieties in the Sudan Savanna of West Africa has been limited, despite the economic importance of the crop and long-term investments in sorghum improvement. One reason why is that attaining substantial yield advantages has been difficult in this harsh, heterogeneous growing environment. Release in Mali of the first sorghum hybrids in Sub-Saharan Africa that have been developed primarily from local germplasm has the potential to change this situation. Utilizing plot data collected in Mali, we explain the adoption of improved seed with an ordered logit model and apply a multivalued treatment effects model to measure impacts on farm families, differentiating between improved varieties and hybrids. Since farm families both consume and sell their sorghum, we consider effects on consumption patterns as well as productivity. Status within the household, conferred by gender combined with marital status, generation, and education, is strongly related to the improvement status of sorghum seed planted in these extended family households. Effects of hybrid use on yields are large, widening the range of food items consumed, reducing the share of sorghum in food purchases, and contributing to a greater share of the sorghum harvest sold. Use of improved seed appears to be associated with a shift toward consumption of other cereals, and also to greater sales shares. Findings support on-farm research concerning yield advantages, also suggesting that the use of well-adapted sorghum hybrids could contribute to diet diversification and the crop's commercialization by smallholders.
A weed suppressive index for spring barley (Hordeum vulgare) varieties
DEFF Research Database (Denmark)
Hansen, P K; Kristensen, K; Willas, J
2008-01-01
A screening programme for crop variety competitiveness would ideally be based on only a few, non-destructive measurements of key growth traits. In this study we measured the weed suppressive ability of 79 varieties of spring barley in two ways: (i) directly, by weed coverage assessments under wee...
Isolating Barley ( Hordeum vulgare L.) B1 Hordein Gene Promoter ...
African Journals Online (AJOL)
Promoters play the most important role in determining the temporal and spatial expression pattern and transcript level of a gene. Some strong constitutive promoters, such as cauliflower mosaic virus 35s promoter, are widely used in plant genetic engineering research. However, the expression levels of the foreign genes in ...
Isolating Barley (Hordeum vulgare L.) B1 Hordein Gene Promoter ...
African Journals Online (AJOL)
Yomi
2012-04-10
Apr 10, 2012 ... proline and glutamine (Piston et al., 2004). The four main groups of ... account for approximately 50% of the total protein in the. *Corresponding author. ..... inheritance, chromosomal location, and population dynamics. PNAS,.
Identification of a Phytase Gene in Barley (Hordeum vulgare L.)
Dai, Fei; Qiu, Long; Ye, Lingzhen; Wu, Dezhi; Zhou, Meixue; Zhang, Guoping
2011-01-01
Background Endogenous phytase plays a crucial role in phytate degradation and is thus closely related to nutrient efficiency in barley products. The understanding of genetic information of phytase in barley can provide a useful tool for breeding new barley varieties with high phytase activity. Methodology/Principal Findings Quantitative trait loci (QTL) analysis for phytase activity was conducted using a doubled haploid population. Phytase protein was purified and identified by the LC-ESI MS/MS Shotgun method. Purple acid phosphatase (PAP) gene was sequenced and the position was compared with the QTL controlling phytase activity. A major QTL for phytase activity was mapped to chromosome 5 H in barley. The gene controlling phytase activity in the region was named as mqPhy. The gene HvPAP a was mapped to the same position as mqPhy, supporting the colinearity between HvPAP a and mqPhy. Conclusions/Significance It is the first report on QTLs for phytase activity and the results showed that HvPAP a, which shares a same position with the QTL, is a major phytase gene in barley grains. PMID:21533044
Identification of a phytase gene in barley (Hordeum vulgare L..
Directory of Open Access Journals (Sweden)
Fei Dai
Full Text Available BACKGROUND: Endogenous phytase plays a crucial role in phytate degradation and is thus closely related to nutrient efficiency in barley products. The understanding of genetic information of phytase in barley can provide a useful tool for breeding new barley varieties with high phytase activity. METHODOLOGY/PRINCIPAL FINDINGS: Quantitative trait loci (QTL analysis for phytase activity was conducted using a doubled haploid population. Phytase protein was purified and identified by the LC-ESI MS/MS Shotgun method. Purple acid phosphatase (PAP gene was sequenced and the position was compared with the QTL controlling phytase activity. A major QTL for phytase activity was mapped to chromosome 5 H in barley. The gene controlling phytase activity in the region was named as mqPhy. The gene HvPAP a was mapped to the same position as mqPhy, supporting the colinearity between HvPAP a and mqPhy. CONCLUSIONS/SIGNIFICANCE: It is the first report on QTLs for phytase activity and the results showed that HvPAP a, which shares a same position with the QTL, is a major phytase gene in barley grains.
Comparison of stability statistics for yield in barley (Hordeum vulgare ...
African Journals Online (AJOL)
STORAGESEVER
2010-03-15
Mar 15, 2010 ... statistics and yield indicated that only TOP method would be useful for simultaneously selecting for high yield and ... metric stability methods; i) they reduce the bias caused by outliers, ii) ...... Biometrics, 43: 45-53. Sabaghnia N ...
Registration of Food Barley (Hordeum vulgare L.) Variety HB 1307 ...
African Journals Online (AJOL)
Six-rowed food type barley, HB 1307, was developed by Holetta Agricultural Research Center (HARC) from a cross between a landrace line and exotic germplasm (Awra gebs-1 x IBON93/91) and released in 2006 for mid and high altitude areas. The three consecutive years\\' (2002-2004) tests proved its superiority in grain ...