Analysis of Urine Composition in Type II Diabetic Mice after Intervention Therapy Using Holothurian Polypeptides

Directory of Open Access Journals (Sweden)

Yanyan Li

2017-07-01

Full Text Available Hydrolysates and peptide fractions (PF obtained from sea cucumber with commercial enzyme were studied on the hyperglycemic and renal protective effects on db/db rats using urine metabolomics. Compared with the control group the polypeptides from the two species could significantly reduce the urine glucose and urea. We also tried to address the compositions of highly expressed urinary proteins using a proteomics approach. They were serum albumins, AMBP proteins, negative trypsin, elastase, and urinary protein, GAPDH, a receptor of urokinase-type plasminogen activator (uPAR, and Ig kappa chain C region. We used the electronic nose to quickly detect changes in the volatile substances in mice urine after holothurian polypeptides (HPP fed, and the results show it can identify the difference between treatment groups with the control group without overlapping. The protein express mechanism of HPP treating diabetes was discussed, and we suggested these two peptides with the hypoglycemic and renal protective activity might be utilized as nutraceuticals.

Studies of the reproductive biology of deep sea megabenthos VIII. Biochemical and calorific content of the reproductive organs of deep sea holothurians

International Nuclear Information System (INIS)

Tyler, P.A.; Walker, M.

1987-01-01

The data for protein, lipid, carbohydrate and ash content of the ovary, testes, gut and body wall of a variety of deep sea holothurians are presented. The dominant biochemical is insoluble protein in all tissues followed by lipid in the ovary. The ash content was lowest in the gonads and highest in the body wall of most species. The mean calorific content of the species studied is 25.08Jmg -1 thus representing a significant energy store in the deep sea. The data suggest active metabolic pathways in these species which may pass radionuclides to the developing gametes and after spawning to dispersal in deep waters. (author)

Testing the FOODBANCS hypothesis: Seasonal variations in near-bottom particle flux, bioturbation intensity, and deposit feeding based on 234Th measurements

Science.gov (United States)

McClintic, Mark A.; DeMaster, David J.; Thomas, Carrie J.; Smith, Craig R.

2008-11-01

.5 to 97 cm 2 yr -1. Mixing coefficients were significantly lower during FB-II than during FB-III, but no other time comparisons were statistically significant ( p>0.05). 234Th Dbs showed no distinct seasonality, and no correlation with either organic carbon flux into the sediment traps or 234Th inventory in the seabed. The four surface deposit feeders examined, an echiuran worm and three holothurians ( Protelpidia murrayi, Bathyplotes fuscivinculum, and Peniagone vignoni), exhibited greater particle selection for recently deposited sediment during ingestion than the two subsurface deposit feeders studied (a head-down deposit feeding holothurian, Molpadia musculus, and an irregular urchin, Amphipneustes lorioli). All six deposit feeders contained excess 234Th activity in gut sediments during all five cruises, indicating sediment ingestion year round, even during the austral winter. The lack of seasonal variation in bioturbation intensity and the demonstration of year-round feeding in deposit feeders are consistent with the hypothesis that the seafloor sediments accumulate labile organic matter produced during periods of high primary production and that deposit feeders utilize this food source as a food bank on a year-round basis.

PEMANFAATAN Spirulina platensis SEBAGAI SUPLEMEN PROTEIN SEL TUNGGAL (PST MENCIT (Mus musculus

Directory of Open Access Journals (Sweden)

Haryo Kuntoro Adi

2007-06-01

Full Text Available The using of Spirulina platensis as Supplement of Single-Celled Protein (SCP to Mice. High protein in Spirulina platensis can be used as a source of Single-Celled Protein. By using mice (Mus musculus as a animal laboratory, the objective of this research is to know the influence of Biomass S. platensis to the increase of body weight of mice. The name of species is Mus musculus, strain is Swiss derivate. Utilized mice were male, 30-50 weighing gram, and 5-7 weeks of age. Treatment group was given by palette and given by biomass of S. Platensis, while control also fed palette but did not give biomass of S. platensis. Yielded biomass was used as food mixed with palette with composition of dry biomass S. platensis with palette was 0%, 10%, 20%, 30%, 40%, and 50%. Data analysis was conducted by using t-tes and analysis of variance. The results showed that by giving of dry biomass of S. platensis affected to the increasement of body weight from the first day until twelfth day of observation, and decrease on the thirteenth and fourteenth day. Pursuant to result of statistic, there is a significant difference (p < 0,05 between before giving and after giving of dry biomass S. platensis during 17 day. By giving dry biomass of S. platensis to mice (Mus musculus at first and second week, it was found the difference of average mice body weight among six concentrations of biomass but did not at the third week. It means that not all concentration of biomass have same effect to the increase of mice body weight as a Single-Celled Protein.

Comparison of Trap Types, Placement, and Colors for Monitoring Anthonomus musculus (Coleoptera: Curculionidae) Adults in Highbush Blueberries

Science.gov (United States)

Silva, Diego; Salamanca, Jordano; Kyryczenko-Roth, Vera; Alborn, Hans T; Rodriguez-Saona, Cesar

2018-01-01

Abstract The cranberry weevil, Anthonomus musculus Say (Coleoptera: Curculionidae), is a key (univoltine) pest of highbush blueberries in the northeast United States. To date, however, no trapping system has been developed to successfully monitor this pest. In 2012–2014, studies were conducted in commercial highbush blueberry farms in New Jersey to 1) evaluate the efficacy of various commercially available traps, designed for other weevil species (e.g., pepper weevil, plum curculio, boll weevil, red palm weevil, and black vine weevil), in capturing A. musculus adults; 2) test whether the relative location of traps within the blueberry canopy affects adult captures and 3) determine the effects of different colored (yellow, white, green, red, blue, brown, and black) sticky traps on weevil captures. For a comparison with existing techniques, we also monitored the number of overwintered adult weevils on blueberry bushes using beat sheet sampling. Of all traps and colors tested, the most A. musculus adults were caught on yellow sticky traps and more adults were captured when these traps were placed at the bottom half of the blueberry canopy, i.e., 0.5–1.0 m above ground. Most weevils were caught on colored traps late in the season (i.e., during bloom), which corresponds mostly to the second (summer) adult generation. Thus, number of overwintered adults caught on traps did not correlate with those on bushes. Although our study identified traps that can be used to capture A. musculus adults, these traps alone (i.e., without semiochemicals) have so far limited applicability for monitoring overwintered adult weevils in highbush blueberries.

Teratogenic effect of yogurt in mice fetus (Mus musculus)

OpenAIRE

Dwisari Dillasamola; Almahdy A; Amirah Desri; Skunda Diliarosta

2018-01-01

Yogurt is one of the dairy products made from lactic acid fermentation by using Lactobacillus bulgaricus and Streptococcus thermophilus. A study on teratogenic effects of yogurt on the white female mice fetus (Mus musculus) has been carried out. Pregnant mice used were 20 which divided into 4 groups : the control group, D1, D2, and D3. The treatments giveThe mice were Distidelled water (control), 0.52 yogurt (D1), 1.04  yogurt (D2), and 2.08 g yogurt (D3). Data were analyzed using one-way ANO...

Food preferences of wild house-mice (Mus musculus L.)*

Science.gov (United States)

Rowe, F. P.; Bradfield, A.; Redfern, R.

1974-01-01

The relative acceptance of various plain foods by wild house-mice (Mus musculus L.) was compared in laboratory choice tests. The palatability of glycerine and six oils, each included at 5% in pinhead oatmeal, was compared in a similar manner. The most favoured food was found to be whole canary seed (Phalaris canariensis). Pinhead oatmeal and wheat were also comparatively well accepted. Glycerine, corn oil, arachis oil and mineral oil were more palatable than either olive, linseed or cod-liver oils. The results of the choice tests are considered in relation to the use of poison baits for the control of free-living mice. PMID:4531454

Efficacy of drugs against Giardia muris in mice Mus musculus naturally infected/
Eficácia de drogas contra Giardia muris em camundongos Mus musculus naturalmente infectados

OpenAIRE

Silvia Gonzalez Monteiro; Régis Adriel Zanette; Camila Belmonte Oliveira; Marcos Kipper da Silva; Aleksandro Schafer da Silva

2008-01-01

This study aimed to evaluate the efficacy of metronidazole, fenbendazole and secnidazole against Giardia muris in mice naturally infected. Forty mice of the species Mus musculus were divided in four groups of ten each, being group A non treated, the control group and groups B, C and D treated with 4mg/ml of metronidazole, fenbendazole and secnidazole, respectively. Two feces collection, on day 0 and on day 10 after treatment, were done in order to evaluate the efficacy of the drugs. Samples w...

Methylation patterns of repetitive DNA sequences in germ cells of Mus musculus.

OpenAIRE

Sanford, J; Forrester, L; Chapman, V; Chandley, A; Hastie, N

1984-01-01

The major and the minor satellite sequences of Mus musculus were undermethylated in both sperm and oocyte DNAs relative to the amount of undermethylation observed in adult somatic tissue DNA. This hypomethylation was specific for satellite sequences in sperm DNA. Dispersed repetitive and low copy sequences show a high degree of methylation in sperm DNA; however, a dispersed repetitive sequence was undermethylated in oocyte DNA. This finding suggests a difference in the amount of total genomic...

Accumulation of silver from drinking water into cerebellum and musculus soleus in mice

International Nuclear Information System (INIS)

Pelkonen, Kai H.O.; Heinonen-Tanski, Helvi; Haenninen, Osmo O.P.

2003-01-01

In spite of the general toxicity, ecotoxicity and sparsely known metabolism of silver, WHO allows silver ions (Ag) up to 0.1 mg/l in drinking water disinfection. In order to determine the accumulation and distribution of silver in a mammalian body, mice were given for 1 and 2 weeks drinking water containing a 3-fold lower concentration, namely 0.03 mg/l silver ions as silver nitrate labelled with 110m Ag. The silver concentrations in different tissues were analysed by gamma radioactivity. The saturation of tissues with silver seems to occur quickly, as there were no statistical differences between silver contents of mice tissues in spite of the study design that mice were administered silver for 1 or 2 weeks. The highest concentrations were found in musculus soleus (m. soleus), cerebellum, spleen, duodenum, and myocardial muscle in the rank order. Concentrations of silver in musculus gastrocnemius (m. gastrocnemius) were found to correlate negatively with cerebrum and positively with blood and kidneys. The accumulation of silver into organs and tissues important in motor functions may be of relevance especially in emergency and catastrophe situations in which accurate motor functions may be critical. A re-evaluation of the present recommendations on the use of silver salts for disinfection of drinking water might be necessary

Chromosomal heterozygosity and fertility in house mice (Mus musculus domesticus) from Northern Italy.

OpenAIRE

Hauffe, H C; Searle, J B

1998-01-01

Following the discovery of over 40 Robertsonian (Rb) races of Mus musculus domesticus in Europe and North Africa, the house mouse has been studied extensively as an ideal model to determine the chromosomal changes that may cause or accompany speciation. Current models of chromosomal speciation are based on the assumption that heterozygous individuals have a particularly low fertility, although recent studies indicate otherwise. Despite their importance, fertility estimates for the house mouse...

Interval training by normobaric hypoxia accelerates the reinnervation of musculus extensor digitorum longus in mice

DEFF Research Database (Denmark)

Vardya, Irina; (Vard'ya); Mospanova, Svetlana V.

2000-01-01

Dokl Biol Sci. 2000 Mar-Apr;371:112-4. Interval training by normobaric hypoxia accelerates the reinnervation of musculus extensor digitorum longus in mice. Vard'ya IV , Mospanova SV , Portnov VV , Balezina OP , Koshelev VB . Department of Human and Animal Physiology, Faculty of Biology, Moscow St...... State University, Russia. PMID: 10833635 [PubMed - indexed for MEDLINE] Udgivelsesdato: 2000...

Comparison of trap types, placement, and colors for monitoring Anthonomus musculus (Coleoptera: Curculionidae) adults in highbush blueberries

Science.gov (United States)

Cranberry weevil, Anthonomus musculus Say (Coleoptera: Curculionidae), is a key pest of highbush blueberries in the northeast USA. To date, however, no trapping system has been developed to successfully monitor this pest. In 2012-2014, studies were conducted in commercial blueberry farms in New Jers...

Genomic resources for wild populations of the house mouse, Mus musculus and its close relative Mus spretus

Science.gov (United States)

Harr, Bettina; Karakoc, Emre; Neme, Rafik; Teschke, Meike; Pfeifle, Christine; Pezer, Željka; Babiker, Hiba; Linnenbrink, Miriam; Montero, Inka; Scavetta, Rick; Abai, Mohammad Reza; Molins, Marta Puente; Schlegel, Mathias; Ulrich, Rainer G.; Altmüller, Janine; Franitza, Marek; Büntge, Anna; Künzel, Sven; Tautz, Diethard

2016-01-01

Wild populations of the house mouse (Mus musculus) represent the raw genetic material for the classical inbred strains in biomedical research and are a major model system for evolutionary biology. We provide whole genome sequencing data of individuals representing natural populations of M. m. domesticus (24 individuals from 3 populations), M. m. helgolandicus (3 individuals), M. m. musculus (22 individuals from 3 populations) and M. spretus (8 individuals from one population). We use a single pipeline to map and call variants for these individuals and also include 10 additional individuals of M. m. castaneus for which genomic data are publically available. In addition, RNAseq data were obtained from 10 tissues of up to eight adult individuals from each of the three M. m. domesticus populations for which genomic data were collected. Data and analyses are presented via tracks viewable in the UCSC or IGV genome browsers. We also provide information on available outbred stocks and instructions on how to keep them in the laboratory. PMID:27622383

The Antarctic holothurian genus Echinopsolus Gutt, 1990 (Dendrochirotida, Cucumariidae): brood pouches, spermatozoa, spermatozeugmata and taxonomic implications.

Science.gov (United States)

Bohn, Jens Michael; Heß, Martin

2014-07-29

An examination of seven Antarctic brooding cucumariid and psolid holothurian species revealed a variety of characters all of them have in common: (1) All are gonochoric. (2) A genital papilla is present on the oral disc (permanent and digitiform in males). (3) Females brood their offspring in five anterior interradial brood pouches that are situated at the transition of body to introvert. (4) Multiple spermatozoa are always bundled to bunch-like spermato-zeugmata. (5) The spermatozoa have a fusiform head and a hollow cylinder-like mid-piece encircling the anterior end of the flagellum. This combination of characters so far is unique, and indicates a close relationship based on common origin. As a consequence, we unite all species sharing this set of synapomorphies in the genus Echinopsolus Gutt, 1990. The herewith included species are: E. acanthocola Gutt, 1990, E. acutus (Massin, 1992) comb. nov., E. charcoti (Vaney, 1906) comb. nov., E. koehleri (Vaney, 1914) comb. nov., E. mollis (Ludwig & Heding, 1935) comb. nov., E. parvipes Massin, 1992 and E. splendidus (Gutt, 1990) comb. nov.. Because the current assignment of Echinopsolus to the family Psolidae can not be retained, the genus is tranferred to the family Cucumariidae, as relationships to taxa within this family are obvious. The peculiar spermatozoa and spermato-zeugmata of all Echinopsolus species are described using light- and electron-microscopical techniques and the results are evaluated and discussed concerning their taxonomy and phylogeny. 

Efficacy of drugs against Giardia muris in mice Mus musculus naturally infected/ Eficácia de drogas contra Giardia muris em camundongos Mus musculus naturalmente infectados

Directory of Open Access Journals (Sweden)

Silvia Gonzalez Monteiro

2008-08-01

Full Text Available This study aimed to evaluate the efficacy of metronidazole, fenbendazole and secnidazole against Giardia muris in mice naturally infected. Forty mice of the species Mus musculus were divided in four groups of ten each, being group A non treated, the control group and groups B, C and D treated with 4mg/ml of metronidazole, fenbendazole and secnidazole, respectively. Two feces collection, on day 0 and on day 10 after treatment, were done in order to evaluate the efficacy of the drugs. Samples were analyzed by the centrifugal-flotation method with zinc sulfate. Efficacy of 97,05% for metronidazole, 98,30% for fenbendazole and 100% for secnidazole were observed in the study. According to the results it was concluded that the tested drugs were effective for the treatment of mice parasitized by Giardia muris.Este estudo visou avaliar a eficácia do metronidazol, fenbendazole e secnidazol contra Giardia muris em camundongos naturalmente infectados. Foram utilizados 40 camundongos da espécie Mus musculus divididos em quatro grupos de 10 animais cada, sendo grupo A, grupo controle, não tratados, e grupos B, C e D tratados com 4mg/ml de metronidazol, fenbendazole e secnidazol, respectivamente. Para avaliar a eficácia dos medicamentos foram realizadas duas coletas de fezes uma no dia zero e outra 10 dias após tratamento. As amostras foram processadas e analisadas a partir do método de centrífugo-flutuação com sulfato de zinco. No estudo observou-se eficácia de 97,05% para metronidazol, 98,30% para fenbendazole e 100% para secnidazol no tratamento de giardiase murina. Com base nos resultados concluí-se que as drogas testadas apresentaram eficácia no tratamento de camundongos parasitados por Giardia muris.

PENGARUH PEMBERIAN “KOMBUCHA” TEH ROSELLA TERHADAP PROFIL DARAH MENCIT (Mus musculus L)

OpenAIRE

Mukhani Dwi Hidayanti; Sussi Astuti; Maria Erna Kustyawati

2015-01-01

“Kombucha” rosella tea is a functional fermented beverage product solution from the petals of rosella tea and sugar using a microbial starter “Kombucha” (Acetobacter xylinum and several kind of yeast). The objective of the experiment was to determine the effect of “Kombucha” rosella tea on the blood profile of mice (Mus musculus L). The experiment compiled in a completely randomized design with 4 treatments dose “Kombucha” rosella tea was 0,73 ml/20 g BB mice (distilled water) (K), 0,36 ml...

Inorganic carbon turnover caused by digestion of carbonate sands and metabolic activity of holothurians

Science.gov (United States)

Schneider, Kenneth; Silverman, Jacob; Kravitz, Ben; Rivlin, Tanya; Schneider-Mor, Aya; Barbosa, Sergio; Byrne, Maria; Caldeira, Ken

2013-11-01

Recent measurements have shown that holothurians (sea cucumbers) may play an important role in the cycling of CaCO3 in tropical coral reef systems through ingestion and processing of carbonate sediment. In this report, we present estimates of inorganic carbon turnover rates determined from laboratory incubations of Holothuria atra, Holothuria leucospilota and Stichopus herrmanni. The pH values of the gut lumen ranged from 7.0 to 7.6 when digestive tracts were filled with sediment compared with 6.1-6.7 in animals with empty digestive tracts. Empty gut volume estimates for H. atra and S. herrmanni were 36 ± 4 mL and 151 ± 14 mL, respectively. Based on these measurements and the density and porosity of carbonate sediments of coral reefs, it is estimated that these species process 19 ± 2 kg and 80 ± 7 kg CaCO3 sand yr-1 per individual, respectively. The annual CaCO3 dissolution rates per H. atra and S. herrmanni individual are estimated to be 6.5 ± 1.9 g and 9.6 ± 1.4 g, respectively, suggesting that 0.05 ± 0.02% and 0.1 ± 0.02% of the CaCO3 processed through their gut annually is dissolved. During incubations the CaCO3 dissolution of the fecal casts was 0.07 ± 0.01%, 0.04 ± 0.01% and 0.21 ± 0.05% for H. atra, H. leucospilota and S. herrmanni, respectively. The CaCO3 saturation state in the incubation seawater decreased markedly due to a greater increase in dissolved inorganic carbon (DIC) relative to total alkalinity (AT) as a result of respiration by the animals. Our results support the hypothesis that deposit feeders such as sea cucumbers play an important ecological role in the coral reef CaCO3 cycle.

Inorganic Carbon Turnover caused by Digestion of Carbonate Sands and Metabolic Activity of Holothurians

Energy Technology Data Exchange (ETDEWEB)

Schneider, Kenneth; Silverman, Jacob; Kravitz, Benjamin S.; Rivlin, Tanya; Schneider-Mor, Aya; Barbosa, Sergio; Byrne, Maria; Caldeira, Ken

2013-11-20

Recent measurements have shown that holothurians (sea cucumbers) play an important role in the cycling of CaCO3 in tropical coral reef systems through ingestion and processing of carbonate sediment. In this study inorganic additional aspects of carbon turnover were determined in laboratory incubations of Holothuria atra, H. leucospilota and Stichopus herrmanni from One Tree Reef, Great Barrier Reef. The pH values of the gut lumen ranged from 6.1 to 6.7 in animals with empty digestive tracts as opposed to 7.0 to 7.6 when digestive tracts were filled with sediment. Empty gut volume estimates for H. atra and S. herrmanni were 36 ± 4 mL and 151 ± 14 mL, respectively. Based on these measurements it is estimated that these species process 19 ± 2kg and 80 ± 7kg CaCO3 sand yr-1 per individual, respectively. The annual dissolution rates of H. atra and S. herrmanni of 6.5±1.9g and 9.6±1.4g, respectively, suggest that 0.05±0.02% and 0.1±0.02% of the CaCO3 processed through their gut annually is dissolved. During the incubations the CaCO3 dissolution was 0.07±0.01%, 0.04±0.01% and 0.21±0.05% of the fecal casts for H. atra, H. leucospilota and S. herrmanni, respectively. The CaCO3 saturation state for both aragonite and calcite minerals during laboratory incubations decreased markedly due to a greater increase in dissolved inorganic carbon (DIC) relative to total alkalinity (AT) as a result of respiration by the animals. Our results support the hypothesis that deposit feeders such as sea cucumbers play an important ecological role in the coral reef CaCO3 cycle.

EFEK ANTIFERTILITAS EKSTRAK AKAR SOM JAWA (Talinum paniculatum Gaertn. PADA MENCIT (Mus musculus L. JANTAN

Directory of Open Access Journals (Sweden)

Tetri Widiyani

2012-10-01

Full Text Available Talinum paniculatum Gaertn commonly is used as aphrodisiac herb. Phytosterol, saponin, flavonoid and tannin of the herb have a certain bioactivity and may affect to the body system. The objective of this research was to examine the antifertility effects of sam jawa (Talinum paniculatum Gaertn. root extract (SJRE on male mice (Mus musculus L.. Twenty male mice were divided into 4 groups randomly with 5 replications. SJRE was dissolved in aquadest and given orally everyday for 34 days. The treatment dosages were 0 (control, 100,200, and 300 mg/kg BW. At 35th day mice were sacrificed and sectioned to remove testes and epididymis spermatozoas. Testes were sectioned using paraffin method and stained using Haematoxyllin-Eosin. Spermatogenic cells in each seminiferous tubule were counted to investigated spermatogenesis activity of testes. Epididymis sperm suspension was used to investigate sperm quality i.e: morphology, velocity and motility. Quantitatives data were analized using ANOVA and continued DMRT on 5% significance level. The result showed SJRE had antifertility effects on male mice (Mus musculus L. could inhibit spermatogenesis (decrease the spermatogenic cells count and decrease the sperm quality (increase percentage of abnormal sperm, decrease sperm motility and also decrease sperm velocity.

Molecular heterogeneity in major urinary proteins of Mus musculus subspecies: potential candidates involved in speciation

Science.gov (United States)

Hurst, Jane L.; Beynon, Robert J.; Armstrong, Stuart D.; Davidson, Amanda J.; Roberts, Sarah A.; Gómez-Baena, Guadalupe; Smadja, Carole M.; Ganem, Guila

2017-01-01

When hybridisation carries a cost, natural selection is predicted to favour evolution of traits that allow assortative mating (reinforcement). Incipient speciation between the two European house mouse subspecies, Mus musculus domesticus and M.m.musculus, sharing a hybrid zone, provides an opportunity to understand evolution of assortative mating at a molecular level. Mouse urine odours allow subspecific mate discrimination, with assortative preferences evident in the hybrid zone but not in allopatry. Here we assess the potential of MUPs (major urinary proteins) as candidates for signal divergence by comparing MUP expression in urine samples from the Danish hybrid zone border (contact) and from allopatric populations. Mass spectrometric characterisation identified novel MUPs in both subspecies involving mostly new combinations of amino acid changes previously observed in M.m.domesticus. The subspecies expressed distinct MUP signatures, with most MUPs expressed by only one subspecies. Expression of at least eight MUPs showed significant subspecies divergence both in allopatry and contact zone. Another seven MUPs showed divergence in expression between the subspecies only in the contact zone, consistent with divergence by reinforcement. These proteins are candidates for the semiochemical barrier to hybridisation, providing an opportunity to characterise the nature and evolution of a putative species recognition signal. PMID:28337988

The uncharacterized gene 1700093K21Rik and flanking regions are correlated with reproductive isolation in the house mouse, Mus musculus.

Science.gov (United States)

Kass, David H; Janoušek, Václav; Wang, Liuyang; Tucker, Priscilla K

2014-06-01

Reproductive barriers exist between the house mouse subspecies, Mus musculus musculus and M. m. domesticus, members of the Mus musculus species complex, primarily as a result of hybrid male infertility, and a hybrid zone exists where their ranges intersect in Europe. Using single nucleotide polymorphisms (SNPs) diagnostic for the two taxa, the extent of introgression across the genome was previously compared in these hybrid populations. Sixty-nine of 1316 autosomal SNPs exhibited reduced introgression in two hybrid zone transects suggesting maladaptive interactions among certain loci. One of these markers is within a region on chromosome 11 that, in other studies, has been associated with hybrid male sterility of these subspecies. We assessed sequence variation in a 20 Mb region on chromosome 11 flanking this marker, and observed its inclusion within a roughly 150 kb stretch of DNA showing elevated sequence differentiation between the two subspecies. Four genes are associated with this genomic subregion, with two entirely encompassed. One of the two genes, the uncharacterized 1700093K21Rik gene, displays distinguishing features consistent with a potential role in reproductive isolation between these subspecies. Along with its expression specifically within spermatogenic cells, we present various sequence analyses that demonstrate a high rate of molecular evolution of this gene, as well as identify a subspecies amino acid variant resulting in a structural difference. Taken together, the data suggest a role for this gene in reproductive isolation.

GAMBARAN HEMATOLOGI MENCIT (Mus musculus MODEL TOKSISITAS SUBKRONIS

Directory of Open Access Journals (Sweden)

Ita Nur Eka Pujiastuti

2017-06-01

Full Text Available Garlic commonly is consumed as medicine to prevent or heal illness or to maintain someone's health. Many societies prefer garlic (Allium sativum among other herbal remedies for cholesterol treatment. It consists of several types, and one of them is single bulb garlic used to treat hypertension. There has been, however, no published research reporting the toxicological properties of single bulb garlic. The purpose of this study was to determine subchronic toxic effects of single bulb garlic administered to mice using hematological parameters. The experiment parameters were hemoglobin and hematocrit levels, the number of erythrocytes and leukocytes. Male mice (Mus musculus strain Balb-C were treated with single bulb garlic extract for 28 days with dosage levels of 0% (N , 0.25% (P1 , 0.5% (P2 , 1% (P3 , and 2% (P4 . Single bulb garlic showed no effect on hemoglobin and hematocrit levels but increased the number of erythrocyte and leucocyte. We concluded that single bulb garlic did not cause subchronic toxic effects.

Meiotic synapsis of homogeneously staining regions (HSRs) in chromosome 1 of Mus musculus.

Science.gov (United States)

Winking, H; Reuter, C; Traut, W

1993-05-01

About 50 copies of a long-range repeat DNA family with a repeat size of roughly 100 kb and with sequence homology to mRNAs are clustered in the G-light band D of chromosome 1 of the house mouse, Mus musculus. We studied amplified versions of the cluster which are found in many wild populations of M. musculus. They are cytogenetically conspicuous as one or two C-band positive homogeneously staining regions (single- and double band HSRs) which increase the mitotic length of chromosome 1. The double band HSR was phylogenetically derived from a single band HSR by a paracentric inversion. In homozygous condition, such HSRs contribute, albeit not as much as expected from their mitotic length, to the synaptonemal complex (SC) length of chromosome 1. In HSR heterozygous animals an elongation of the SCs was not noticeable. In single band HSR heterozygous males, synapsis proceeds regularly and continuously from the distal telomere towards the centromeric end without forming buckles. Thus, the single band HSR has no adverse effect on pairing. The same straight pairing behaviour was found in the majority of double band HSR heterozygous spermatocytes. This shows that extensive nonhomologous pairing can take place in the earliest phase of synapsis. Synapsis was discontinuous, leaving the central part of the bivalent 1 asynapsed, in only 14.3% of double band HSR heterozygous cells. In such cells the chromosome 1 SC is completed at a later stage of meiosis. The delay is presumably an effect of the inversion that includes one HSR band and the segment between the two HSR bands.

A candidate subspecies discrimination system involving a vomeronasal receptor gene with different alleles fixed in M. m. domesticus and M. m. musculus.

Directory of Open Access Journals (Sweden)

Robert C Karn

2010-09-01

Full Text Available Assortative mating, a potentially efficient prezygotic reproductive barrier, may prevent loss of genetic potential by avoiding the production of unfit hybrids (i.e., because of hybrid infertility or hybrid breakdown that occur at regions of secondary contact between incipient species. In the case of the mouse hybrid zone, where two subspecies of Mus musculus (M. m. domesticus and M. m. musculus meet and exchange genes to a limited extent, assortative mating requires a means of subspecies recognition. We based the work reported here on the hypothesis that, if there is a pheromone sufficiently diverged between M. m. domesticus and M. m. musculus to mediate subspecies recognition, then that process must also require a specific receptor(s, also sufficiently diverged between the subspecies, to receive the signal and elicit an assortative mating response. We studied the mouse V1R genes, which encode a large family of receptors in the vomeronasal organ (VNO, by screening Perlegen SNP data and identified one, Vmn1r67, with 24 fixed SNP differences most of which (15/24 are nonsynonymous nucleotide substitutions between M. m. domesticus and M. m. musculus. We observed substantial linkage disequilibrium (LD between Vmn1r67 and Abpa27, a mouse salivary androgen-binding protein gene that encodes a proteinaceous pheromone (ABP capable of mediating assortative mating, perhaps in conjunction with its bound small lipophilic ligand. The LD we observed is likely a case of association rather than residual physical linkage from a very recent selective sweep, because an intervening gene, Vmn1r71, shows significant intra(subspecific polymorphism but no inter(subspecific divergence in its nucleotide sequence. We discuss alternative explanations of these observations, for example that Abpa27 and Vmn1r67 are coevolving as signal and receptor to reinforce subspecies hybridization barriers or that the unusually divergent Vmn1r67 allele was not a product of fast positive

The effect of electron beam radiations on testicular damage in mice, Mus musculus

International Nuclear Information System (INIS)

Vikram, S.; Nair, Vijay Mala Grover

2013-01-01

Adult male Swiss albino mice, Mus musculus (8-10 weeks old) weighing 28±2.5 gm were exposed to varying doses (2-12 Gy) of electron beam radiations and maintained in animal house at 26-28 C. The animals were sacrificed following 35 and 60 days following exposure to electron beam radiations. The LD-50 value, change in the weight and histological details of the testis, sperm count, sperm shape abnormalities and sperm motility were recorded. The data suggests that electron beam radiations is a potential inducer to cause reproductive system dysfunctions which probably may be responsible leading to infertility. (author)

Methylation patterns of repetitive DNA sequences in germ cells of Mus musculus.

Science.gov (United States)

Sanford, J; Forrester, L; Chapman, V; Chandley, A; Hastie, N

1984-03-26

The major and the minor satellite sequences of Mus musculus were undermethylated in both sperm and oocyte DNAs relative to the amount of undermethylation observed in adult somatic tissue DNA. This hypomethylation was specific for satellite sequences in sperm DNA. Dispersed repetitive and low copy sequences show a high degree of methylation in sperm DNA; however, a dispersed repetitive sequence was undermethylated in oocyte DNA. This finding suggests a difference in the amount of total genomic DNA methylation between sperm and oocyte DNA. The methylation levels of the minor satellite sequences did not change during spermiogenesis, and were not associated with the onset of meiosis or a specific stage in sperm development.

Evolution of major milk proteins in Mus musculus and Mus spretus mouse species: a genoproteomic analysis

Directory of Open Access Journals (Sweden)

Panthier Jean-Jacques

2011-01-01

Full Text Available Abstract Background Due to their high level of genotypic and phenotypic variability, Mus spretus strains were introduced in laboratories to investigate the genetic determinism of complex phenotypes including quantitative trait loci. Mus spretus diverged from Mus musculus around 2.5 million years ago and exhibits on average a single nucleotide polymorphism (SNP in every 100 base pairs when compared with any of the classical laboratory strains. A genoproteomic approach was used to assess polymorphism of the major milk proteins between SEG/Pas and C57BL/6J, two inbred strains of mice representative of Mus spretus and Mus musculus species, respectively. Results The milk protein concentration was dramatically reduced in the SEG/Pas strain by comparison with the C57BL/6J strain (34 ± 9 g/L vs. 125 ± 12 g/L, respectively. Nine major proteins were identified in both milks using RP-HPLC, bi-dimensional electrophoresis and MALDI-Tof mass spectrometry. Two caseins (β and αs1 and the whey acidic protein (WAP, showed distinct chromatographic and electrophoresis behaviours. These differences were partly explained by the occurrence of amino acid substitutions and splicing variants revealed by cDNA sequencing. A total of 34 SNPs were identified in the coding and 3'untranslated regions of the SEG/Pas Csn1s1 (11, Csn2 (7 and Wap (8 genes. In addition, a 3 nucleotide deletion leading to the loss of a serine residue at position 93 was found in the SEG/Pas Wap gene. Conclusion SNP frequencies found in three milk protein-encoding genes between Mus spretus and Mus musculus is twice the values previously reported at the whole genome level. However, the protein structure and post-translational modifications seem not to be affected by SNPs characterized in our study. Splicing mechanisms (cryptic splice site usage, exon skipping, error-prone junction sequence, already identified in casein genes from other species, likely explain the existence of multiple αs1-casein

Test of Fruit Extract Pare (Momordica charantia L.) to Quality of Ejaculated Spermatozoa Mice (Mus musculus L.)

Science.gov (United States)

Fifendy, M.; Indriati, G.

2018-04-01

Pare (Momordica charantia L.) can be used in the treatment of various diseases, such as influenza, cancer, anti-inflammatory, anti-HIV, antimitotic and antifertilitas. This study aimed to determine the effect of the herbal bitter (Momordica charantia L.) to ejaculated sperm quality mice (Mus musculus L.). This research was conducted using Completely Randomized Design (CRD) with 4 treatments and 6 replications, water and fed adlibitum. First treatment is given solvent extract. Second treatments extract were given 0.2 gram, third treatment were given 0.4 gram of extracts and fourth treatment were treated exstrac 0.6 gram were orally for 30 days. After the mice decapitated, dissected and take sperm from vas deferens. Then, the sperm preparation determined using the improved Neubauer. Data were analyzed by ANOVA (Analysis of Varians). The results shoured at doses of 0,2 gram, the average sperm count was 19.89. decrease significant when compared with the control in which the average number of sperm 29.13. So with this research the effective doses to decrease sperm count and can be used as a contraception medication dosage was 0,2 gram. It can be conclude that the extract of bitter (Momordica charantia L.) can decrease the quality of the ejaculated sperm of mice (Mus musculus L.)

Teratogenic effect of yogurt in mice fetus (Mus musculus

Directory of Open Access Journals (Sweden)

Dwisari Dillasamola

2018-04-01

Full Text Available Yogurt is one of the dairy products made from lactic acid fermentation by using Lactobacillus bulgaricus and Streptococcus thermophilus. A study on teratogenic effects of yogurt on the white female mice fetus (Mus musculus has been carried out. Pregnant mice used were 20 which divided into 4 groups : the control group, D1, D2, and D3. The treatments giveThe mice were Distidelled water (control, 0.52 yogurt (D1, 1.04  yogurt (D2, and 2.08 g yogurt (D3. Data were analyzed using one-way ANOVA followed by Duncan multiple range test. Results showed that administration of yogurt during pregnancy could affect mother body weight of mice (P 0,05. Observations with Alizarin solution did not show skeletal defects in comparison to the control group. Observations with Bouin’s solution showed defective visceral cleft palate in fetal mice yogurt group D3. This study conclude that yogurt is safe to consume in groups D1 and D2. Yogurt has the potential to cause fetal teratogenic in group D3

X-ray structure of a soluble Rieske-type ferredoxin from Mus musculus

International Nuclear Information System (INIS)

Levin, Elena J.; Elsen, Nathaniel L.; Seder, Kory D.; McCoy, Jason G.; Fox, Brian G.; Phillips Jr, George N.

2008-01-01

The X-ray crystal structure of a soluble Rieske ferredoxin from M. musculus was solved at 2.07 Å resolution, revealing an iron–sulfur cluster-binding domain with similar architecture to the Rieske-type domains of bacterial aromatic dioxygenases. The ferredoxin was also shown to be capable of accepting electrons from both eukaryotic and prokaryotic oxidoreductases. The 2.07 Å resolution X-ray crystal structure of a soluble Rieske-type ferredoxin from Mus musculus encoded by the gene Mm.266515 is reported. Although they are present as covalent domains in eukaryotic membrane oxidase complexes, soluble Rieske-type ferredoxins have not previously been observed in eukaryotes. The overall structure of the mouse Rieske-type ferredoxin is typical of this class of iron–sulfur proteins and consists of a larger partial β-barrel domain and a smaller domain containing Cys57, His59, Cys80 and His83 that binds the [2Fe–2S] cluster. The S atoms of the cluster are hydrogen-bonded by six backbone amide N atoms in a pattern typical of membrane-bound high-potential eukaryotic respiratory Rieske ferredoxins. However, phylogenetic analysis suggested that the mouse Rieske-type ferredoxin was more closely related to bacterial Rieske-type ferredoxins. Correspondingly, the structure revealed an extended loop most similar to that seen in Rieske-type ferredoxin subunits of bacterial aromatic dioxygenases, including the positioning of an aromatic side chain (Tyr85) between this loop and the [2Fe–2S] cluster. The mouse Rieske-type ferredoxin was shown to be capable of accepting electrons from both eukaryotic and prokaryotic oxidoreductases, although it was unable to serve as an electron donor for a bacterial monooxygenase complex. The human homolog of mouse Rieske-type ferredoxin was also cloned and purified. It behaved identically to mouse Rieske-type ferredoxin in all biochemical characterizations but did not crystallize. Based on its high sequence identity, the structure of the

Evaluating the functional outcomes of ultrasound-guided botulinum toxin type A injections using the Euro-musculus approach for upper limb spasticity treatment in post-stroke patients; an observational study.

Science.gov (United States)

Buyukavci, Raikan; Akturk, Semra; Ersoy, Yüksel

2018-02-07

Ultrasound-guided botulinum toxin type A injection is an effective treatment for spasticity. Euro-musculus spasticity approach is a new method for administering injections to the correct point of the correct muscle. The clinical outcomes of this practical approach is not yet available in the literature. The purpose of this study was to evaluate the effects on spasticity and the functional outcomes of ultrasound guided botulinum toxin type A injections via the Euro-musculus spasticity approach to treat upper limb spasticity in post-stroke patients. An observational study. Inpatient post-stroke patients. Twenty five post-stroke patients with post-stroke upper limb spasticity were recruited. The ultrasound-guided botulinum toxin type A injections were administered into the spastic target muscles using the Euro-musculus spasticity approach, and all of the patients were enrolled in rehabilitation programmes after the injections. This research included the innervation zone and injection site figures and ultrasound images of each muscle in the upper limb. The degree of spasticity was assessed via the Modified Ashworth Scale and the upper limb motor function via the Fugl Meyer Upper Extremity Scale at the baseline and 4 and 12 weeks after the botulinum toxin type A injection. Significant decreases in the Modified Ashworth Scale scores of the upper limb flexor muscle tone measured 4 and 12 weeks after the botulinum toxin type A injection were found when compared to the baseline scores (pbotulinum toxin type A injection via the Euro- musculus spasticity approach is a practical and effective method for administering injections to the correct point of the correct muscle. Ultrasound-guided botulinum toxin type A injections combined with rehabilitation programmes decrease spasticity and improve the upper extremity motor functions in stroke patients. This new approach for ultrasound- guided botulinum toxin type A injection is very practical and effective method for upper

The Effect of Curry Leaves (Murayya Koenigii L. on Blood Glucose Levels In Alloxan Diabetic Mice (Mus Musculus

Directory of Open Access Journals (Sweden)

Fauziah Fauziah

2014-07-01

Full Text Available This study was conducted to determine the effect of ethanol extract of curry leaves (Murraya koenigii L. on blood glucose levels in alloxan diabetic mice (Mus musculus. The diabetic conditions were made by giving alloxan 75 mg/kg body weight (BW and the hypoglycemic effects of extract of curry leaves given with various doses.   This study used 24 male mice strain Balb/c in four groups of treatment with six replications, namely the negative control group, the ethanol extract of curry leaf tree 50% mL/10g body weight group, 70% mL/10g body weight group and 90% mL/10g body weight group. The treatment was given orally by using a gastric sonde for 14 days. Blood samples were taken through the sinus caudalis using a scissors. Blood glucose level was measured at 1st , the 8th and the 24th of treatment using blood glucose test strips and Nesco® Multicheck apparatus. Blood glucose data were analyzed by one way ANOVA (Analysis of Variants and followed by Tuckey test at significance level of 5%. The result showed that treatment of ethanol extract of curry leaves (Murraya koenigii at various doses significantly affected the decrease on blood glucose levels of mice (Mus musculus alloxan diabetic.

The screening of parasites and viral pathogens of small mammals from a farm in southern Finland, and genetic identification of the Finnish house mouse, Mus musculus

Czech Academy of Sciences Publication Activity Database

Laakkonen, J.; Kallio-Kokko, M.; Vapalahti, O.; Vaheri, A.; Vyskočilová, M.; Munclinger, P.; Macholán, Miloš; Henttonen, H.

2007-01-01

Roč. 44, - (2007), s. 202-208 ISSN 0003-455X EU Projects: European Commission(XE) 10284 - EDEN Institutional research plan: CEZ:AV0Z50450515 Keywords : Mus musculus Subject RIV: EG - Zoology Impact factor: 1.537, year: 2007

Has Phytodetritus Processing by an Abyssal Soft-Sediment Community Recovered 26 Years after an Experimental Disturbance?

Directory of Open Access Journals (Sweden)

Tanja Stratmann

2018-02-01

Full Text Available The potential harvest of polymetallic nodules will heavily impact the abyssal, soft sediment ecosystem by removing sediment, hard substrate, and associated fauna inside mined areas. It is therefore important to know whether the ecosystem can recover from this disturbance and if so at which rate. The first objective of this study was to measure recovery of phytodetritus processing by the benthic food web from a sediment disturbance experiment in 1989. The second objective was to determine the role of holothurians in the uptake of fresh phytodetritus by the benthic food web. To meet both objectives, large benthic incubation chambers (CUBEs; 50 × 50 × 50 cm were deployed inside plow tracks (with and without holothurian presence and at a reference site (holothurian presence, only at 4100 m water depth. Shortly after deployment, 13C- and 15N-labeled phytodetritus was injected in the incubation chambers and during the subsequent 3-day incubation period, water samples were taken five times to measure the production of 13C-dissolved inorganic carbon over time. At the end of the incubation, holothurians and sediment samples were taken to determine biomass, densities and incorporation of 13C and 15N into bacteria, nematodes, macrofauna, and holothurians. For the first objective, the results showed that biomass of bacteria, nematodes and macrofauna did not differ between reference sites and plow track sites when holothurians were present. Additionally, meiofauna and macrofauna taxonomic composition was not significantly different between the sites. In contrast, total 13C uptake by bacteria, nematodes and holothurians was significantly lower at plow track sites compared to reference sites, though the number of replicates was low. This result suggests that important ecosystem functions such as organic matter processing have not fully recovered from the disturbance that occurred 26 years prior to our study. For the second objective, the analysis indicated

Parâmetros morfofisiológicos testiculares de camundongos (Mus musculus suplementados com geleia real Morphophysiological parameters of mice (Mus musculus testicles supplemented with royal jelly

Directory of Open Access Journals (Sweden)

A.C.T. Morais

2009-02-01

Full Text Available Avaliaram-se os efeitos da geleia real sobre os parâmetros morfofisiológicos testiculares de camundongos (Mus musculus. Utilizaram-se 57 machos Swiss, com quatro meses de idade, distribuídos aleatoriamente em seis tratamentos: T1: solução fisiológica, via intraperitoneal; T2: 0,1mg de geleia real, via intraperitoneal; T3: 0,2mg de geleia real, via intraperitoneal; T4: água destilada, via oral; T5: 0,1mg de geleia real, via oral; e T6: 0,2mg de geleia real, via oral. Após 45 dias de suplementação com geleia real, os animais sacrificados e pesados tiveram seus testículos coletados, incluídos em parafina e corados com hematoxilina/eosina. Não houve diferença entre os tratamentos quanto aos: pesos corporal e testicular, índice gonadossomático, diâmetro tubular, altura do epitélio, comprimento total dos túbulos seminíferos, comprimento tubular por grama de testículo, índices tubulossomático e leydigossomático e valores de proporção volumétrica referentes à túnica própria, epitélio seminífero, vaso sanguíneo e vaso linfático. Foi encontrada diferença entre T1 e T3 em relação aos túbulos seminíferos e ao espaço intertubular.The effects of royal jelly on the morphophysiological parameters of mice (Mus musculus testicles were studied. Fifty-eight male Swiss mice were evaluated. They were four-month old and were randomly distributed in six treatments: T1: physiological solution, intraperitonial route; T2: 0.1mg of royal jelly, intraperitonial route; T3: 0.2mg of royal jelly, intraperitonial route; T4: distilled water, orally; T5: 0.1mg of royal jelly, orally; and T6: 0.2mg of royal jelly, orally. After 45 days of supplementation with royal jelly, the animals were weighted, slaughtered, and the testicles collected, included in paraffin, and stained with haematoxylin-eosin. No differences among treatments were observed for: body and testicular weights, gonadossomatic index, tubular diameter, epithelial height, total

Effect of Pasak Bumi (Eurycoma longifolia Jack) Root In Precopulation Stage to the Fertility of Female Mouse (Mus musculus L.)

OpenAIRE

Marlinza, Rosa

2012-01-01

Pasak Bumi (Eurycoma longifolia Jack) have potency to be used to increase bodyendurance, to cure malaria drug, and to act as afrodisiak. However, the effect of pasak bumi onwomen fertility, especially at pre-copulation stage was not widely known. This research seeks toreveal the effect pasak bumi extract treated at pre-copulation phase on fertility. This experimentemploy mice (Mus Musculus L.) and was undertaken at Biology and Cemistry laboratories PMIPA, andVeterinary laboratory of Jambi Uni...

PENGARUH TRITERPEN TOTAL PEGAGAN (Centella asiatica (L Urban TERHADAP FUNGSI KOGNITIF BELAJAR DAN MENGINGAT PADA MENCIT JANTAN ALBINO (Mus musculus YANG DIHAMBAT DENGAN SKOPOLAMIN

Directory of Open Access Journals (Sweden)

Herlina

2010-11-01

Full Text Available Pegagan (Centella asiatica (L Urban has been described to posses CNS effects such as improving cognitive function, learning and memory. The aim of the research was to evaluate the effects of total triterpen’s pegagan extract on cognitive functions as the learning and memory performance in male albino mice (Mus musculus inhibited by scopolamine. The research design was Complete Randomized Design (RAL – factorial on thirty six mice divided into 4 groups. One control group received only aquabidest (negative control. Three treatment groups received total triterpen 16 mg/kg BW, 32 mg/kg BW orally and piracetam 500 mg/kg BW by intra peritoneally (positive control for 21 days. Data indicating learning and memory process of all subjects were obtained from one-trial passive avoidance test. Data were analyzed by two way ANOVA and BNT (p0,05. In conclusion, total triterpen from pegagan (Centella asiatica (L Urban improved learning ability and memory of male albino mice (Mus musculus even though, it was inhibited by scopolamine.

Classical Mus musculus Igκ enhancers support transcription but not high level somatic hypermutation from a V-lambda promoter in chicken DT40 cells.

Directory of Open Access Journals (Sweden)

Naga Rama Kothapalli

2011-04-01

Full Text Available Somatic hypermutation (SHM of immunoglobulin genes is initiated by activation-induced cytidine deaminase (AID in activated B cells. This process is strictly dependent on transcription. Hence, cis-acting transcriptional control elements have been proposed to target SHM to immunoglobulin loci. The Mus musculus Igκ locus is regulated by the intronic enhancer (iE/MAR and the 3' enhancer (3'E, and multiple studies using transgenic and knock-out approaches in mice and cell lines have reported somewhat contradictory results about the function of these enhancers in AID-mediated sequence diversification. Here we show that the M. musculus iE/MAR and 3'E elements are active solely as transcriptional enhancer when placed in the context of the IGL locus in Gallus gallus DT40 cells, but they are very inefficient in targeting AID-mediated mutation events to this locus. This suggests that either key components of the cis-regulatory targeting elements reside outside the murine Igκ transcriptional enhancer sequences, or that the targeting of AID activity to Ig loci occurs by largely species-specific mechanisms.

Sea cucumbers reduce chromophoric dissolved organic matter in aquaculture tanks.

Science.gov (United States)

Sadeghi-Nassaj, Seyed Mohammad; Catalá, Teresa S; Álvarez, Pedro A; Reche, Isabel

2018-01-01

Mono-specific aquaculture effluents contain high concentrations of nutrients and organic matter, which affect negatively the water quality of the recipient ecosystems. A fundamental feature of water quality is its transparency. The fraction of dissolved organic matter that absorbs light is named chromophoric dissolved organic matter (CDOM). A sustainable alternative to mono-specific aquaculture is the multitrophic aquaculture that includes species trophically complementary named "extractive" species that uptake the waste byproducts. Sea cucumbers are recognized as efficient extractive species due to the consumption of particulate organic matter (POM). However, the effects of sea cucumbers on CDOM are still unknown. During more than one year, we monitored CDOM in two big-volume tanks with different trophic structure. One of the tanks (-holothurian) only contained around 810 individuals of Anemonia sulcata , whereas the other tank (+holothurian) also included 90 individuals of Holothuria tubulosa and Holothuria forskali . We routinely analyzed CDOM absorption spectra and determined quantitative (absorption coefficients at 325 nm) and qualitative (spectral slopes) optical parameters in the inlet waters, within the tanks, and in their corresponding effluents. To confirm the time-series results, we also performed three experiments. Each experiment consisted of two treatments: +holothurians (+H) and -holothurians (-H). We set up three +H tanks with 80 individuals of A. sulcata and 10 individuals of H. tubulosa in each tank and four -H tanks that contained only 80 individuals of A. sulcata . In the time-series, absorption coefficients at 325 nm ( a 325 ) and spectral slopes from 275 to 295 nm ( S 275-295 ) were significantly lower in the effluent of the +holothurian tank (average: 0.33 m -1 and 16 µm -1 , respectively) than in the effluent of the -holothurian tank (average: 0.69 m -1 and 34 µm -1 , respectively), the former being similar to those found in the inlet

Sea cucumbers reduce chromophoric dissolved organic matter in aquaculture tanks

Directory of Open Access Journals (Sweden)

Seyed Mohammad Sadeghi-Nassaj

2018-02-01

Full Text Available Background Mono-specific aquaculture effluents contain high concentrations of nutrients and organic matter, which affect negatively the water quality of the recipient ecosystems. A fundamental feature of water quality is its transparency. The fraction of dissolved organic matter that absorbs light is named chromophoric dissolved organic matter (CDOM. A sustainable alternative to mono-specific aquaculture is the multitrophic aquaculture that includes species trophically complementary named “extractive” species that uptake the waste byproducts. Sea cucumbers are recognized as efficient extractive species due to the consumption of particulate organic matter (POM. However, the effects of sea cucumbers on CDOM are still unknown. Methods During more than one year, we monitored CDOM in two big-volume tanks with different trophic structure. One of the tanks (−holothurian only contained around 810 individuals of Anemonia sulcata, whereas the other tank (+holothurian also included 90 individuals of Holothuria tubulosa and Holothuria forskali. We routinely analyzed CDOM absorption spectra and determined quantitative (absorption coefficients at 325 nm and qualitative (spectral slopes optical parameters in the inlet waters, within the tanks, and in their corresponding effluents. To confirm the time-series results, we also performed three experiments. Each experiment consisted of two treatments: +holothurians (+H and –holothurians (−H. We set up three +H tanks with 80 individuals of A. sulcata and 10 individuals of H. tubulosa in each tank and four –H tanks that contained only 80 individuals of A. sulcata. Results In the time-series, absorption coefficients at 325 nm (a325 and spectral slopes from 275 to 295 nm (S275−295 were significantly lower in the effluent of the +holothurian tank (average: 0.33 m−1 and 16 µm−1, respectively than in the effluent of the −holothurian tank (average: 0.69 m−1 and 34 µm−1, respectively, the former

Genome patterns of selection and introgression of haplotypes in natural populations of the house mouse (Mus musculus.

Directory of Open Access Journals (Sweden)

Fabian Staubach

Full Text Available General parameters of selection, such as the frequency and strength of positive selection in natural populations or the role of introgression, are still insufficiently understood. The house mouse (Mus musculus is a particularly well-suited model system to approach such questions, since it has a defined history of splits into subspecies and populations and since extensive genome information is available. We have used high-density single-nucleotide polymorphism (SNP typing arrays to assess genomic patterns of positive selection and introgression of alleles in two natural populations of each of the subspecies M. m. domesticus and M. m. musculus. Applying different statistical procedures, we find a large number of regions subject to apparent selective sweeps, indicating frequent positive selection on rare alleles or novel mutations. Genes in the regions include well-studied imprinted loci (e.g. Plagl1/Zac1, homologues of human genes involved in adaptations (e.g. alpha-amylase genes or in genetic diseases (e.g. Huntingtin and Parkin. Haplotype matching between the two subspecies reveals a large number of haplotypes that show patterns of introgression from specific populations of the respective other subspecies, with at least 10% of the genome being affected by partial or full introgression. Using neutral simulations for comparison, we find that the size and the fraction of introgressed haplotypes are not compatible with a pure migration or incomplete lineage sorting model. Hence, it appears that introgressed haplotypes can rise in frequency due to positive selection and thus can contribute to the adaptive genomic landscape of natural populations. Our data support the notion that natural genomes are subject to complex adaptive processes, including the introgression of haplotypes from other differentiated populations or species at a larger scale than previously assumed for animals. This implies that some of the admixture found in inbred strains of mice

Changes in Sediment Fatty Acid Composition during Passage through the Gut of Deposit Feeding Holothurians: Holothuria atra (Jaeger, 1883 and Holothuria leucospilota (Brandt, 1835

Directory of Open Access Journals (Sweden)

Prosper L. Mfilinge

2016-01-01

Full Text Available Sea cucumbers Holothuria atra and Holothuria leucospilota play an important role in the bioturbation of sediment in coral reef and rocky intertidal ecosystems. This study investigated changes in sediment fatty acid (FA composition during gut passage in H. atra and H. leucospilota. The FA composition did not differ significantly between species. Comparison of FA composition in ambient sediment (AS, foregut (FG, midgut (MG, hindgut (HG, and faecal pellets (FPs indicated that marked changes in FA composition occurred during passage through the gut of H. atra and H. leucospilota. Saturated fatty acids (SAFAs, monounsaturated fatty acids (MUFAs, polyunsaturated fatty acids (PUFAs, and branched fatty acids (BrFAs were significantly higher in FG than in AS, suggesting that both species selectively ingested nutrient rich particles. Significant reduction of SAFAs, MUFAs, PUFAs, and BrFAs occurred in MD and HD, with complete elimination of most PUFAs in FPs. A decrease in PUFAs 20:5ω3, 18:4ω3, 22:5ω3, 22:6ω3, 18:2ω6, 18:3ω3, 18:3ω6, odd-numbered BrFAs, and MUFA 18:1ω7 indicated that algal detritus and bacteria were important part of diet. These results have implications for the fate of specific dietary FAs, especially ω3 and ω6, and the contribution holothurian FPs make to the FA composition of coral reef and rocky intertidal ecosystems.

Changes in Sediment Fatty Acid Composition during Passage through the Gut of Deposit Feeding Holothurians: Holothuria atra (Jaeger, 1883) and Holothuria leucospilota (Brandt, 1835)

Science.gov (United States)

Tsuchiya, Makoto

2016-01-01

Sea cucumbers Holothuria atra and Holothuria leucospilota play an important role in the bioturbation of sediment in coral reef and rocky intertidal ecosystems. This study investigated changes in sediment fatty acid (FA) composition during gut passage in H. atra and H. leucospilota. The FA composition did not differ significantly between species. Comparison of FA composition in ambient sediment (AS), foregut (FG), midgut (MG), hindgut (HG), and faecal pellets (FPs) indicated that marked changes in FA composition occurred during passage through the gut of H. atra and H. leucospilota. Saturated fatty acids (SAFAs), monounsaturated fatty acids (MUFAs), polyunsaturated fatty acids (PUFAs), and branched fatty acids (BrFAs) were significantly higher in FG than in AS, suggesting that both species selectively ingested nutrient rich particles. Significant reduction of SAFAs, MUFAs, PUFAs, and BrFAs occurred in MD and HD, with complete elimination of most PUFAs in FPs. A decrease in PUFAs 20:5ω3, 18:4ω3, 22:5ω3, 22:6ω3, 18:2ω6, 18:3ω3, 18:3ω6, odd-numbered BrFAs, and MUFA 18:1ω7 indicated that algal detritus and bacteria were important part of diet. These results have implications for the fate of specific dietary FAs, especially ω3 and ω6, and the contribution holothurian FPs make to the FA composition of coral reef and rocky intertidal ecosystems. PMID:27042355

Peroral Echinococcus multilocularis egg inoculation in Myodes glareolus, Mesocricetus auratus and Mus musculus (CD-1 IGS and C57BL/6j)

DEFF Research Database (Denmark)

Woolsey, Ian David; Jensen, Per Moestrup; Deplazes, Peter

2016-01-01

Echinococcus multilocularis transmission predominantly occurs in Europe between the red fox (Vulpes vulpes) and various species of rodent intermediate hosts. We infected 3 species of rodent, Myodes glareolus (n = 47), Mesocricetus auratus (n = 11) and outbred Mus musculus (CD-1 IGS) (n = 9...

The Southeastern Asian house mouse (Mus musculus castaneus Linn.) as a new passenger host for Cryptococcus neoformans var. grubii molecular type VNI.

Science.gov (United States)

Singh, Karuna; Rani, Jyoti; Neelabh; Rai, Govind Kumar; Singh, Major

2017-11-01

We describe Mus musculus castaneus as a new mammalian host for Cryptococcus neoformans var. grubii (VNI). Eighteen apparently healthy adults and pups of the rodent were collected from human dwellings in Varanasi, a city of India. Both clinical and behavioral examinations of the rodents did not reveal any sign of the disease. Among visceral organs, histological examination of only liver exhibited the presence of single celled, encapsulated, Southgate's mucicarmine positive fungal structures consistent with C. neoformans. Nevertheless, culture of tissue homogenates of brain, lungs, liver, and kidneys yielded white colonies on Sabouraud's dextrose agar and brown mucoid colonies of C. neoformans on Staib's and Tobacco agar media. The pathogen was isolated from habitat soil as well as fresh faeces of the animals. All isolates were urease positive, nitrate and canavanine-glycine bromothymol blue negative, exhibited phenoloxidase activity and grew at 37°C. The isolates were identified as C. neoformans var. grubii with ITS primers and unique marker (GACA)4. The pathogen when inoculated in immunosuppressed mice showed low pathogenicity. To our knowledge, we for the first time report case cluster of Mus musculus castaneus as new passenger host for C. neoformans var. grubii (VNI). © The Author 2017. Published by Oxford University Press on behalf of The International Society for Human and Animal Mycology. All rights reserved. For permissions, please e-mail: journals.permissions@oup.com.

Metabolic rates are significantly lower in abyssal Holothuroidea than in shallow-water Holothuroidea

Science.gov (United States)

van Oevelen, Dick

2018-01-01

Recent analyses of metabolic rates in fishes, echinoderms, crustaceans and cephalopods have concluded that bathymetric declines in temperature- and mass-normalized metabolic rate do not result from resource-limitation (e.g. oxygen or food/chemical energy), decreasing temperature or increasing hydrostatic pressure. Instead, based on contrasting bathymetric patterns reported in the metabolic rates of visual and non-visual taxa, declining metabolic rate with depth is proposed to result from relaxation of selection for high locomotory capacity in visual predators as light diminishes. Here, we present metabolic rates of Holothuroidea, a non-visual benthic and benthopelagic echinoderm class, determined in situ at abyssal depths (greater than 4000 m depth). Mean temperature- and mass-normalized metabolic rate did not differ significantly between shallow-water (less than 200 m depth) and bathyal (200–4000 m depth) holothurians, but was significantly lower in abyssal (greater than 4000 m depth) holothurians than in shallow-water holothurians. These results support the dominance of the visual interactions hypothesis at bathyal depths, but indicate that ecological or evolutionary pressures other than biotic visual interactions contribute to bathymetric variation in holothurian metabolic rates. Multiple nonlinear regression assuming power or exponential models indicates that in situ hydrostatic pressure and/or food/chemical energy availability are responsible for variation in holothurian metabolic rates. Consequently, these results have implications for modelling deep-sea energetics and processes. PMID:29892403

Hubungan Hiperglikemia dengan Prothrombin Time pada Mencit (Mus musculus yang Diinduksi Aloksan

Directory of Open Access Journals (Sweden)

Muhammad Ibnu Malik

2015-01-01

. Endothelial disfungtion can be detected by activated partial thromboplastin time (APTT and prothrombin time (PT. The objective of this studi was to determine the correlation between hyperglycemia and prothrombin time in mice (Mus musculus induced with aloxan. The design of this research was a post test only control group design conducted in October 2013 until February 2014 in Central Laboratory RS Dr. M. Djamil Padang. The subject were white mice (Mus musculus who have met the inclusion and exclusion criteria. The subject were divided as hyperglycemia group (induced with aloxan and control group. After seven days of adaptation, the aloxan was injected and measurenment of blood glucose and body weight had been done, one time in every four days. Then in day 30th the termination of mice had been done to meassure the prothrombin time. The result showed the prothrombin time between group was shortened with the average prothrombin time of the control group was 7,96 second and the hiperglicemia group was 8,12 second. The result showing no correlation between hyperglycemia and prothrombin time with the degree of signification is (p 0,7 (p > 0,05.Keywords: hyperglycemia, diabetes mellitus, prothrombin time,

Genetic Variation at Exon 2 of the MHC Class II DQB Locus in Blue Whale (Balaenoptera musculus from the Gulf of California.

Directory of Open Access Journals (Sweden)

Diana D Moreno-Santillán

Full Text Available The genes of the Major Histocompatibility Complex (MHC play an important role in the vertebrate immune response and are among the most polymorphic genes known in vertebrates. In some marine mammals, MHC genes have been shown to be characterized by low levels of polymorphism compared to terrestrial taxa; this reduction in variation is often explained as a result of lower pathogen pressures in marine habitats. To determine if this same reduction in variation applies to the migratory population of blue whales (Balaenoptera musculus that occurs in the Gulf of California, we genotyped a 172 bp fragment of exon 2 of the MHC Class II DQB locus for 80 members of this population. Twenty-two putatively functional DQB allotypes were identified, all of which were homologous with DQB sequences from other cetacean species. Up to 5 putative alleles per individual were identified, suggesting that gene duplication has occurred at this locus. Rates of non-synonymous to synonymous substitutions (ω and maximum likelihood analyses of models of nucleotide variation provided potential evidence of ongoing positive selection at this exon. Phylogenetic analyses of DQB alleles from B. musculus and 16 other species of cetaceans revealed trans-specific conservation of MHC variants, suggesting that selection has acted on this locus over prolonged periods of time. Collectively our findings reveal that immunogenic variation in blue whales is comparable to that in terrestrial mammals, thereby providing no evidence that marine taxa are subject to reduced pathogen-induced selective pressures.

Toxicological Evaluation of Essential Oil From the Leaves of Croton argyrophyllus (Euphorbiaceae) on Aedes aegypti (Diptera: Culicidae) and Mus musculus (Rodentia: Muridae).

Science.gov (United States)

Cruz, R C D; Silva, S L C E; Souza, I A; Gualberto, S A; Carvalho, K S; Santos, F R; Carvalho, M G

2017-07-01

Plant-derived essential oils can be used as insecticides for vector control. However, to establish their safety, it is necessary to perform toxicological studies. Herein, we evaluated the chemical composition and insecticidal activity of the essential oil from the leaves of Croton argyrophyllus on the third- and fourth-instar larvae and adult Aedes aegypti (L., 1762). We also evaluated the acute toxicity of the essential oil in adult female Mus musculus. The lethal concentration 50 (LC50) and 90 (LC90) of C. argyrophyllus essential oil on larvae of Ae. aegypti were 0.31 and 0.70 mg ml-1, respectively, and 5.92 and 8.94 mg ml-1, respectively, on Ae. aegypti adults. The major components of the essential oil were spathulenol (22.80%), (E)-caryophyllene (15.41%), α-pinene (14.07%), and bicyclogermacrene (10.43%). It also displayed acute toxicity in adults of Mus musculus; the intraperitoneal and oral lethal dose 50 (LD50) were 2,000 mg kg-1 and 2,500 mg kg-1, respectively. The results showed that the essential oil from C. argyrophyllus leaves has insecticidal activity on Ae. aegypti larvae and adults at an average lethal concentration below the median lethal dose needed to cause acute toxicity in the common mouse. © The Authors 2017. Published by Oxford University Press on behalf of Entomological Society of America. All rights reserved. For Permissions, please email: journals.permissions@oup.com.

Ultrastructural characters of the spermatozoa in Digeneans of the genus Lecithochirium Lühe, 1901 (Digenea, Hemiuridae, parasites of fishes: comparative study of L. microstomum and L. musculus

Directory of Open Access Journals (Sweden)

Ndiaye Papa Ibnou

2014-01-01

Full Text Available This study provides the first ultrastructural data of spermatozoa in the genus Lecithochirium. The spermatozoa of L. microstomum (from Trichiurus lepturus in Senegal and L. musculus (from Anguilla anguilla in Corsica exhibit the general pattern described in the great majority of the Digenea, namely two axonemes with the 9 + “1” pattern typical of the Trepaxonemata, one mitochondrion, a nucleus, parallel cortical microtubules and external ornamentation of the plasma membrane. Spermatozoa of L. microstomum and L. musculus have some specific features such as the presence of a reduced number of cortical microtubules arranged on only one side of the spermatozoon, the lack of spine-like bodies and expansion of the plasma membrane. The external ornamentation of the plasma membrane entirely covers the anterior extremity of the spermatozoa. The ultrastructure of the posterior extremity of the spermatozoa corresponds to the pattern previously described in the Hemiuridae, characterized by only singlets of the second axoneme. A particularity of these spermatozoa is the organization of the microtubule doublets of the second axoneme around the nucleus in the posterior part of the spermatozoon.

Long-term change in the megabenthos of the Porcupine Abyssal Plain (NE Atlantic)

Science.gov (United States)

Billett, D. S. M.; Bett, B. J.; Rice, A. L.; Thurston, M. H.; Galéron, J.; Sibuet, M.; Wolff, G. A.

A radical change in the abundance of invertebrate megafauna on the Porcupine Abyssal Plain is reported over a period of 10 years (1989-1999). Actiniarians, annelids, pycnogonids, tunicates, ophiuroids and holothurians increased significantly in abundance. However, there was no significant change in wet weight biomass. Two holothurian species, Amperima rosea and Ellipinion molle, increased in abundance by more than two orders of magnitude. Samples from the Porcupine Abyssal Plain over a longer period (1977-1999) show that prior to 1996 these holothurian species were always a minor component of the megafauna. From 1996 to 1999 A. rosea was abundant over a wide area of the Porcupine Abyssal Plain indicating that the phenomenon was not a localised event. Several dominant holothurian species show a distinct trend in decreasing body size over the study period. The changes in megafauna abundance may be related to environmental forcing (food supply) rather than to localised stochastic population variations. Inter-annual variability and long-term trends in organic matter supply to the seabed may be responsible for the observed changes in abundance, species dominance and size distributions.

Sexual selection and the rodent baculum: an intraspecific study in the house mouse (Mus musculus domesticus).

Science.gov (United States)

Ramm, Steven A; Khoo, Lin; Stockley, Paula

2010-01-01

The rapid divergence of genitalia is a pervasive trend in animal evolution, thought to be due to the action of sexual selection. To test predictions from the sexual selection hypothesis, we here report data on the allometry, variation, plasticity and condition dependence of baculum morphology in the house mouse (Mus musculus domesticus). We find that that baculum size: (a) exhibits no consistent pattern of allometric scaling (baculum size being in most cases unrelated to body size), (b) exhibits low to moderate levels of phenotypic variation, (c) does not exhibit phenotypic plasticity in response to differences in perceived levels of sexual competition and (d) exhibits limited evidence of condition dependence. These patterns provide only limited evidence in support of the sexual selection hypothesis, and no consistent support for any particular sexual selection mechanism; however, more direct measures of how genital morphology influences male fertilization success are required.

STRUKTUR HISTOLOGI HATI MENCIT(Mus musculus L. SETELAH PEMBERIAN EKSTRAK DAUN EKOR NAGA (Rhapidhophora pinnata Schott

Directory of Open Access Journals (Sweden)

Ni Komang Tia Pramesti

2017-09-01

Full Text Available ABSTRACT Rhapidhophora pinnata, Schott is a traditional medical plant that has been use remedy for treatment of hypertension, stroke. Aims of  this research is to determine the effect of Rhapidhophora pinnata Schott leaf extract toward  mouse (Mus musculus L liverhistological structure. This research used completely randomized  design with 28 female mice that were divide into 4 groups of  P0 (control received 0,9% NaCl, group P1, P2, and P3 received 50, 100 and 150 mg/kg bw respectively by oral administration. The treatment were given daily for 14 days. All of the mice were sacrificed by ether after 15 days. The liver were examined for their histopathological changes, namely fatty degeneration, hydropic degenaration and necrosis. Results were statistically analised by Kruskal-Wallis method. Treatment groups showed no significant differences with regard of liver histopatological changes, however hemorrhage, sinusoid congestion and inflamatory cell infiltration were found in liver.   Keyword : Rhapidhophora pinnata Schott, liver, mice

THE PATTERN OF THE AGGRESSIVE BEHAVIOR IN THE LABORATORY MOUSE (MUS MUSCULUS

Directory of Open Access Journals (Sweden)

Maria BUNEA

2010-01-01

Full Text Available Nature has found solutions for decreasing the aggressive impulse, using various inhibitory mechanisms as means of balancing the forces between two fighting individuals, thus avoiding it to lead to the destruction of their own species. These nature's “ pacifyng” solutions are mostly found in animals which are armed with various potentially lethal “weapons”, while in species that live on large territoires and thus have the possibility to avoid conflict, these mechanisms are poorly developed. The purpose of this research is to study the extent of the inhibitory mechanisms against aggression in the laboratory mouse, species in which these mechanisms of diminishing aggression and of avoiding conflicts don't work the same in artificial conditions, where individuals are forced to live in small areas, and to identify the behavioral chains that form the innate manifestations of the aggressive behavior in Mus musculus sp. The results of this study show that in the circumstance of caged individuals, which are crowded so closely together, the intensity of aggression is increasing. The dominance hierarchy is well established after their first fight, but due to the spatial constraint and the fact that there is no place where to flee, the submissive individual oftenly fights back. In every single interraction the aggressive behavior follows a fixed action pattern.

Cloning, expression, purification, crystallization and X-ray analysis of inositol monophosphatase from Mus musculus and Homo sapiens

International Nuclear Information System (INIS)

Singh, Nisha; Halliday, Amy C.; Knight, Matthew; Lack, Nathan A.; Lowe, Edward; Churchill, Grant C.

2012-01-01

M. musculus and H. sapiens inositol monophosphatase 1 were cloned, expressed, purified and crystallized. Diffraction data were collected and analysed at resolutions of 2.4 and 1.7 Å, respectively, and the structures were compared in order to identify any structural differences. Inositol monophosphatase (IMPase) catalyses the hydrolysis of inositol monophosphate to inositol and is crucial in the phosphatidylinositol (PI) signalling pathway. Lithium, which is the drug of choice for bipolar disorder, inhibits IMPase at therapeutically relevant plasma concentrations. Both mouse IMPase 1 (MmIMPase 1) and human IMPase 1 (HsIMPase 1) were cloned into pRSET5a, expressed in Escherichia coli, purified and crystallized using the sitting-drop method. The structures were solved at resolutions of 2.4 and 1.7 Å, respectively. Comparison of MmIMPase 1 and HsIMPase 1 revealed a core r.m.s. deviation of 0.516 Å

Chromosomal heterozygosity and fertility in house mice (Mus musculus domesticus) from Northern Italy.

Science.gov (United States)

Hauffe, H C; Searle, J B

1998-11-01

Following the discovery of over 40 Robertsonian (Rb) races of Mus musculus domesticus in Europe and North Africa, the house mouse has been studied extensively as an ideal model to determine the chromosomal changes that may cause or accompany speciation. Current models of chromosomal speciation are based on the assumption that heterozygous individuals have a particularly low fertility, although recent studies indicate otherwise. Despite their importance, fertility estimates for the house mouse are incomplete because traditional measurements, such as anaphase I nondisjunction and germ cell death, are rarely estimated in conjunction with litter size. In an attempt to bridge this gap, we have taken advantage of the house mouse hybrid zone in Upper Valtellina (Lombardy, Italy) in which five Rb races interbreed. We present data on the fertility of naturally occurring ("wild-caught") hybrids and of offspring from laboratory crosses of wild-caught mice ("laboratory-reared"), using various measurements. Wild-caught mice heterozygous for one fusion were more infertile than predicted from past studies, possibly due to genic hybridity; laboratory-reared heterozygotes carrying seven or eight trivalents at meiosis I and heterozygotes carrying one pentavalent also had low fertilities. These low fertilities are especially significant given the probable occurrence of a reinforcement event in Upper Valtellina.

Quality characteristics of the Musculus longissimus dorsi from Pecora dell’Amiata reared in Tuscany

Directory of Open Access Journals (Sweden)

Roberto Tocci

2017-07-01

The trial was performed with ewes and lambs deriving from the local breed Pecora dell’Amiata. In this work, the Musculus longissimus dorsi (M. longissimus thoracis + lomborum physical-chemical and nutritional characteristics of 23 ewes and 20 lambs were compared. The ewes of the trial were over 7 years old while the lambs were on average 80 days old. Ewe meat has shown lower drip loss (4.14 vs 2.71% and lightness (L* 38.6 vs 45.3 values, and higher PH (6.15±0.07, shear force (8.4 vs 2.31 kg, fat content (5.9 vs 2.0%. The lamb meat lipids had higher polyunsaturated fatty acid content (PUFA: 14.58 vs 9.25% and higher PUFA/Saturated Fatty Acids (SFA ratio (0.31 vs 0.20. The PCA analysis identified two distinct groups regarding ewe and lamb meat respectively for the fatty acids composition and the health indices. Ewe meat showed dietetic and nutritional characteristics similar to that of lamb meat. These characteristics may allow in the future, to the ewe meat valorisation, now not appreciated by Tuscan and Italian market.

Penelitian Pendahuluan Pengaruh Daun Manggis sebagai Rodentisida Nabati pada Mencit Mus musculus Strain Balepsi

Directory of Open Access Journals (Sweden)

Agus Kardinan

2000-07-01

Full Text Available Research has been conducted at Pest and Disease Laboratory, Research Institute for Spices and Medicinal Crops, Bogor, during 1997-1998. The objective was to evaluate the possibility of Mangosteen (Garcinia mangostana leaves to be used as botanical rodenticide which is tested to reproduction ability of mice Mus musculus. Eight to ten weeks old mice with the average weight of 25 gram were obtained from Research Institute for Livestock, Ciawi. Research was arranged at randomized block design, 8 treatments and 4 replications. Data was analyzed by determining the average value and their standard deviation values. Observations were done to the weight of testis, weight of embryo, number of embryo, volume of extracts drank by mice and mice behavior during experiment. Result revealed that there was no indication that the leaves extract affected the weight of testis, but it affected the number and weight of embryo. There was indication that mangosteen leaves acted as antifertility on mice. Giving leaves extract increased the total volume of extract drink. There was no abnormality at the activity of mice during experiment, included sex activity, poisonous symptoms and others.

A note on the distribution and abundance of blue whales (Balaenoptera musculus in the Central and Northeast North Atlantic

Directory of Open Access Journals (Sweden)

Daniel G Pike

2009-09-01

Full Text Available The distribution and abundance of blue whales (Balaenoptera musculus was assessed from ship surveys conducted in the Central and Northeast Atlantic in 1987, 1989, 1995 and 2001. Blue whales were most commonly sighted off western Iceland, and to a lesser extent northeast of Iceland. They were very rare or absent in the Northeast Atlantic. Sightings were combined over all surveys to estimate the detection function using standard line transect methodology, with the addition of a covariate to account for differences between surveys. Total abundance was highest in 1995 (979, 95% CI 137-2,542 and lowest in 1987 (222, 95% CI 115-440. Uncertainty in species identity had little effect on estimates of abundance. There was a significant positive trend in abundance northeast of Iceland and in the total survey area.

No evidence for punishment in communally nursing female house mice (Mus musculus domesticus).

Science.gov (United States)

Ferrari, Manuela; König, Barbara

2017-01-01

Punishment is claimed as an important mechanism to stabilise costly cooperation in humans, but its importance in social animals has been questioned recently due to both conceptual considerations and a lack of empirical evidence (only few published studies). We empirically tested whether there is evidence for punishment in communally nursing house mice (Mus musculus domesticus, direct descendants of "wild" animals). Communally breeding females pool their litters and raise all offspring together, indiscriminately caring for own and other offspring. Such a situation resembles a public good and provides scope for exploitation if females vary in their relative contributions to the joint nest (offspring number). We allowed two females to communally breed and conducted removal experiments both in the presence and absence of pups. We aimed to test whether reduced investment by one of the females (induced through separation from the partner and their combined offspring for 4 or 12 hours) leads to increased aggression by the other female after the reunion. We found no evidence for punishment, on the contrary, females increased socio-positive behaviours. The costs of losing a partner in a communally breeding species might be too high and hinder the evolution of punishment. Our findings add to a growing list of examples questioning the role of punishment in cooperating non-human animals and emphasise the importance of empirical testing of its assumptions and predictions.

Comparative analysis of Homo sapiens and Mus musculus cyclin-dependent kinase (CDK) inhibitor genes p16 (MTS1) and p15 (MTS2).

Science.gov (United States)

Jiang, P; Stone, S; Wagner, R; Wang, S; Dayananth, P; Kozak, C A; Wold, B; Kamb, A

1995-12-01

Cyclin-dependent kinase inhibitors are a growing family of molecules that regulate important transitions in the cell cycle. At least one of these molecules, p16, has been implicated in human tumorigenesis while its close homolog, p15, is induced by cell contact and transforming growth factor-beta (TGF-beta). To investigate the evolutionary and functional features of p15 and p16, we have isolated mouse (Mus musculus) homologs of each gene. Comparative analysis of these sequences provides evidence that the genes have similar functions in mouse and human. In addition, the comparison suggests that a gene conversion event is part of the evolution of the human p15 and p16 genes.

Laju peningkatan konsentrasi timbal Pb dalam darah hewan uji mencit Mus musculus di bengkel otomotif

Directory of Open Access Journals (Sweden)

Mohammad Razif Sukatma

2012-02-01

Full Text Available This research was conducted in automotive workshop of VEDC Malang and the samples were taken at the automotive machineand automotive electric workshops. The parameters which examined were the Pb concentration in the mouse blood (Mus musculus in2 and 3 months years old. The measurement was run for 5 times every 10 days, and the result was mean value of the increasing rate ofPb concentration in the mouse blood. The aim of this research was to determine the increasing rate of Pb concentration in the mouseblood which has the relation with different working area, different age, and also duration of exposure. Based on the data of laboratorytest, research continued by T-test analysis, Simple regression test, and correlation, and also General Linear Model. By doing statisticanalysis with the different working area, duration of explanation, and different age.Result of this research showed that there were the differences of rapid increasing of Pb concentration in both workshop. Generallythe age which influence so much for that (in the mouse body and have the relation with the body stamina. If the mouse body absorbamount of Pb constantly, so the Pb concentration in it will increase more and more and it cause the decreasing of the body height.

Effect of Physalis peruviana "tomatillo" fruit extract in Mus musculus var. swis with induced hyperlipidemi.

Directory of Open Access Journals (Sweden)

Julio Campos Florián

2011-06-01

Full Text Available The objective of this research was to determine the hypolipidemic activity of the fruit of Physalis peruviana "tomatillo" in a model of acute hyperlipidemia induced by triton. Mus musculus var. swis males as experimental animals. We worked with four groups of mice, the white group received distilled water orally and saline intraperitoneally, the control group received distilled water orally and intraperitoneally triton, the problem group 1 received orally 0.05g/100g Physalis peruviana extract intraperitoneally and triton and the problem group 2 received orally 0.2g/100g extract of Physalis peruviana and triton intraperitoneally. After 24 hours of administering the treatments were performed measurements of serum cholesterol and triglycerides. Mean levels of cholesterol (mg/dL were: 58.87 ± 11.54 (white, 121.71 ± 15.00 (control, 58.08 ± 9.21 (Problem 1 and 66 78 ± 16.77 (Problem 2. Average levels of triglycerides (g /L were: 0.48 ± 0.07 (white, 1.84 ± 0.18 (control, 0.34 ± 0.10 (Problem 1 and 0.94 ± 0.25 (Problem 2. We found significant reductions (p <0.000 concentrations of both cholesterol and triglycerides in relation to those obtained in the group treated only with Triton.

Syphacia obvelata (Nematode, Oxyuridae) infecting laboratory mice Mus musculus (Rodentia, Muridae): phylogeny and host-parasite relationship.

Science.gov (United States)

Abdel-Gaber, Rewaida

2016-03-01

Syphacia obvelata is a pinworm nematode parasite infecting man and laboratory animals in high abundance. This parasitological study was carried out during the period of March 2014-February 2015 to investigate the helminth parasites infecting the laboratory mice Mus musculus in the Animal House at Cairo University, Egypt. The prevalence of S. obvelata in M. musculus was 75.0 %. The extent of infection with S. obvelata is analyzed according to the sex of the host mice. It was shown that the prevalence of male infection was greater than female worms. Morphological characterization revealed that the present Oxyurid species possesses a rounded cephalic end with less developed lips, esophagus divided into cylindrical corpus, and globular bulb supported internally with valvular apparatus; three mamelons are located at the ventral surface with a single chitinized spicule and a gubernaculum provided with an accessory hook in males, and ovijector apparatus opens ventrally by the vulva surrounded by protruded lips in female worms. Body of the male was 0.623-1.130 (0.830 ± 0.11) mm long and 0.092-0.130 (0.110 ± 0.01) mm wide; the esophagus was 0.164-0.280 (0.210 ± 0.01) mm long; the nerve ring and excretory pore are located at 0.035-0.132 (0.073 ± 0.01) and 0.087-0.191 (0.145 ± 0.01) mm from the anterior end, respectively, while the female measured 2.930-4.650 (3.540 ± 0.1) mm long and 0.120-0.232 (0.156 ± 0.001) mm wide; the esophagus was 0.213-0.410 (0.342 ± 0.01) mm long; the nerve ring, excretory pore, and vulval opening are located at 0.026-0.157 (0.121 ± 0.01), 0.134-0.243 (0.195 ± 0.01), and 0.323-0.632 (0.546 ± 0.11) mm from the anterior end, respectively; eggs measured 0.120-0.139 (0.129 ± 0.001) mm long and 0.030-0.052 (0.045 ± 0.001) mm wide. It compared morphometrically with other Syphacia species described previously and showed little differences in

Early gene expression divergence between allopatric populations of the house mouse (Mus musculus domesticus).

Science.gov (United States)

Bryk, Jarosław; Somel, Mehmet; Lorenc, Anna; Teschke, Meike

2013-03-01

Divergence of gene expression is known to contribute to the differentiation and separation of populations and species, although the dynamics of this process in early stages of population divergence remains unclear. We analyzed gene expression differences in three organs (brain, liver, and testis) between two natural populations of Mus musculus domesticus that have been separated for at most 3000 years. We used two different microarray platforms to corroborate the results at a large scale and identified hundreds of genes with significant expression differences between the populations. We find that although the three tissues have similar number of differentially expressed genes, brain and liver have more tissue-specific genes than testis. Most genes show changes in a single tissue only, even when expressed in all tissues, supporting the notion that tissue-specific enhancers act as separable targets of evolution. In terms of functional categories, in brain and to a smaller extent in liver, we find transcription factors and their targets to be particularly variable between populations, similar to previous findings in primates. Testis, however, has a different set of differently expressed genes, both with respect to functional categories and overall correlation with the other tissues, the latter indicating that gene expression divergence of potential importance might be present in other datasets where no differences in fraction of differentially expressed genes were reported. Our results show that a significant amount of gene expression divergence quickly accumulates between allopatric populations.

PENGARUH DOSIS DAN LAMA PERLAKUAN EKSTRAK DAUN KALIANDRA MERAH (Calliandra calothyrsus Meissn. TERHADAP STRUKTUR HISTOLOGI GINJAL MENCIT (Mus musculus L.

Directory of Open Access Journals (Sweden)

Nur Assiam

2014-09-01

Full Text Available This research aims to determine the effect of red calliandra (Calliandra calothyrsusMeissn. leaf extrac on the histological structure of the kidney of mice (Mus musculus L..Treatment was administered orally with varying doses. This research used a CompletelyRandomized Design in factorial pattern of two factors, doses (0 or control, 2, 4, and 6 mg/kgBW and length of treatment (7, 14, and 21 days, so there are 12 combination groups with 3replications of each. Organ was collected on days 8, 15, and 22 to observe histologicalstructure of the kidney. Renal histological observation of edema, Bowman’s spaceconstriction, and protein deposition, showed no correlation between both factors, but a veryreal correlation occurs in the damage of fatty degeneration, hemorrhage, and nucleuspyknotic. Histological observation of glomerular congestion and infiltration of inflammatorycells did not show any correlation between dose and duration of treatment.Keywords: red calliandra, histopathology of kidney, male mice

Pengaruh Lendir Bekicot (Achatina fulica terhadap Jumlah Sel Fibroblas pada Penyembuhan Luka Sayat Studi Eksperimental pada Kulit Mencit (Mus musculus

Directory of Open Access Journals (Sweden)

Perez Wahyu Purnasari

2012-12-01

Design and methods: The study is an experimental research with post test only randomized control group design. The subjects were 18 Mus musculus strain mice that were divided into 3 groups. 1st group as a control group of untreated, 2nd group was given povidone iodine 10%, and 3rd group was given land snails’ mucus during 5th days. On the 6th day the mices were killed for histological study. Results: The data showed that average number of fibroblast in 1st group is 93,85; 2nd group is 126,37; and 3rd is group 217,5. The results of one way anova statistical test showed significant difference among the three groups p = 0,000. The results of post hoc test showed significant difference in all groups (p < 0,05. Conclusion: The mucus of land snail is influence the number of fibroblast in healing cuts (Sains Medika, 4(2:195-203.

FRAKSI ETANOL 96% BIJI KORO BENGUK (Mucuna pruriens L. SEBAGAI PENINGKAT KUALITAS SPERMATOZOA MENCIT (Mus musculus

Directory of Open Access Journals (Sweden)

Sri Winarni

2012-11-01

Full Text Available Background: The examination of sperm quality is the main priority for infertility diagnosis. Based on previous study with mice, active ingredient of Mucuna pruriens L. or koro benguk (Papilionaceae, the L-dopa, may affect the quality of spermatozoa.Objective: Research was to study the effect of 96% ethanol fraction Mucuna pruriens seed on spermatozoaquality of mice exposed to 2-Methoxy ethanol. L-dopa in 96% ethanol fraction of M. pruriens seed was 14.7%.Methode: This was an experimental study using complete randomized design. Subjects were BALB/C mice (Mus musculus. Five groups served as control, 3 groups received subcutaneos injection of 2-ME as muchas 100 mg/kg.bw/day for 12 days, followed with 96% ethanol fraction Mucuna pruriens seed starting from14 mg/kg.bw/day, 28 mg/kg.bw/day, and 56 mg/kg.bw/day for 51 days.Result: The 96% ethanol fraction of Mucuna pruriens seeds are significant increase motility (p<0,01 andthe percentage of normal spermatozoa morphology (p= 0,042.Conclusion: 96% ethanol fraction of Mucuna pruriens seeds are able to increase motility and the percentage of normal spermatozoa morphology in mice exposed to 2-ME. Keywords: Mucuna pruriens L., L-dopa, mouse spermatozoa

Spermatogenic structure and fertility of Mus musculus after exposure of mangosteen (Garcinia mangostana L) pericarp extract

Science.gov (United States)

Hayati, Alfiah; Agustin, Melia Eka; Rokhimaningrum, Farida Ayu; Adro'i, Hasan; Darmanto, Win

2016-03-01

This study aimed to determine the effect of mangosteen (Garcinia mangostana L.) pericarp extract on spermatogenics number, seminiferous tubules sized, profile protein of epididymal and testicular sperm, and fertility of mice (Mus musculus). Fourty two male mice strain BALB/C was divided equally into 7 groups. The control group was given 0.05 ml of 0.05% CMC solution. Three group were given mangosteen pericarp extract at various doses (75, 100 and 150 mg/kg body weight, respectively) for 7 days, while the other three groups were given the same extract dose for 35 days. Parameters evaluated on histological of spermatogonia, spermatocytes, round spermatids, seminiferous tubule diameter, and thickness of germinal epithelium, analysis of testicular and epidydimal protein profile with SDS-Page, and than fertility test on female mice. The results showed that mangosteen pericarp extract at 75 and 100 mg/kg dose for 7 days had no effect on spermatogenics number and seminiferous tubule sizes, but the treatment dose of 150 mg/kg for 7 days and all treatment (doses of 75, 100, and 150 mg/kg) for 35 days led to significant decrease on the number of spermatogenics and seminiferous tubule sizes; effect on protein profiles testicular and epididymal sperm; and lower fertilization.

Mitochondrial Genetic Diversity and Phylogeography of Mus musculus castaneus in Northern Punjab, Pakistan.

Science.gov (United States)

Bibi, Shahnaz; Nadeem, Muhammad Sajid; Wiewel, Andrew Stephen; Beg, Mirza Azhar; Hameed, Khalid; Jabeen, Musarrat; Raja, Ghazala Kaukab

2017-12-01

Regions of Iran, Afghanistan, Pakistan and northwestern India have been proposed as the place of origin of Mus musculus castaneus. But despite the fact that Pakistan encompasses an important part of its range, M. m. castaneus populations in Pakistan have not been the subject of intensive genetic and biogeographic studies, except for a very small number of samples included in past studies. We studied genetic variation in M. m. castaneus (CAS) from northern Punjab Province, Pakistan, by using cytochrome b (Cytb) analysis in a sample of 98 individuals. Median-joining network revealed four well differentiated CAS sub-lineages coexisting within a small geographical region; these had previously been thought to have largely non-overlapping geographic distributions. Moreover, haplotypes from Pakistan occupied a central position in the network and all identified global haplotypes were also present in Pakistan. All identified CAS sub-lineages proved to be highly diverse on the basis of haplotype and nucleotide diversity indices. Tajima's D test and Fu's Fs tests of neutrality suggest recent population expansions in all sub-lineages. Expansion times were estimated as 21,760-134,930, 10,800-64,400 and 4950-30,665 ybp using substitution rates of 2.5%, 5% and 11%, respectively. Our results support the hypothesis that northern Punjab Province in Pakistan is the most likely source area for M. m. castaneus, and that the CAS sub-lineages in this region have undergone rapid population expansion events at different time periods, which appear to have benefitted from human-mediated transport, although one of them clearly predates the establishment of human settlements in this region.

Studies of the reproductive biology of deep-sea megabenthos. V. The Echinoderm species Benthodytes sordida, Psychropotes longicauda and Psychropotes depressa

International Nuclear Information System (INIS)

Tyler, P.A.; Muirhead, A.

1985-09-01

Specimens of the holothurians Benthodytes sordida, Psychropotes longicauda and P. depressa were examined from a number of stations (2300m-4780m) in the Porcupine Seabight and Abyssal Plain. All three species are gonochoric and show marked interspecific differences in gonad morphology. In the females of each species fecundity was low. Maximum oocyte size was 500 μm for Benthodytes sordida, 1.8mm for Psychropotes depressa and a massive 3mm for P. longicauda. In the males of each species spermatogenesis appeared typical of holothurians except where there was evidence of heavy parasitic infestation. There is no evidence of reproductive seasonality. (author)

Efficacy and Palatability of Different Rodenticide Formulations Applied against House Mouse (Mus musculus L. in Plant Storage Facilities

Directory of Open Access Journals (Sweden)

Goran Jokić

2008-01-01

Full Text Available Palatability (daily intake of different rodenticide formulations based on bromadiolone was compared in experiments with house mouse (Mus musculus L. in agricultural storage facilities, and rodent numbers were assessed at the beginning and end of experiment, as well as rodenticide efficacy. The dynamic of bait intake was monitored for ten days in facilities of the Institute of Animal Husbandry in Zemun and the Agricultural Cooperatives at Starčevo and Omoljica. The experiments complied with the relevant standard method of OEPP/EPPO. Agricultural products were stored either as bulk commodities or in sacs laid on pallete racks in the treated facilities. Baits were laid in boxes on mice routes below palletes holding sacs and on places where significant damage had been observed, at 1-3 m spacing and in 10-20 g portions. Mouse abundance was estimated based on the highest and lowest daily intakes of bait by mice over a period of 10 days, which was divided by the mouse daily feed requirement. The presence of house mouse was also monitored over the next 20 days. The efficacy of test products was computed using Abbott’s formula.

Tissue-Specific Contributions of Paternally Expressed Gene 3 in Lactation and Maternal Care of Mus musculus.

Directory of Open Access Journals (Sweden)

Wesley D Frey

Full Text Available Paternally Expressed Gene 3 (Peg3 is an imprinted gene that controls milk letdown and maternal-caring behaviors. In this study, a conditional knockout allele has been developed in Mus musculus to further characterize these known functions of Peg3 in a tissue-specific manner. The mutant line was first crossed with a germline Cre. The progeny of this cross displayed growth retardation phenotypes. This is consistent with those seen in the previous mutant lines of Peg3, confirming the usefulness of the new mutant allele. The mutant line was subsequently crossed individually with MMTV- and Nkx2.1-Cre lines to test Peg3's roles in the mammary gland and hypothalamus, respectively. According to the results, the milk letdown process was impaired in the nursing females with the Peg3 mutation in the mammary gland, but not in the hypothalamus. This suggests that Peg3's roles in the milk letdown process are more critical in the mammary gland than in the hypothalamus. In contrast, one of the maternal-caring behaviors, nest-building, was interrupted in the females with the mutation in both MMTV- and Nkx2.1-driven lines. Overall, this is the first study to introduce a conditional knockout allele of Peg3 and to further dissect its contribution to mammalian reproduction in a tissue-specific manner.

BIOAKTIFITAS BUNGA SEPATU (Hibiscus rosa-sinensis L. TERHADAP KADAR KOLESTEROL DARAH MENCIT (Mus musculus YANG MENGALAMI HIPERKOLESTEROLEMIA DENGAN DIET TINGGI LEMAK

Directory of Open Access Journals (Sweden)

Rinza Rahmawati Samsudin

2017-12-01

  Tujuan penelitian ini adalah untuk mengetahui pengaruh bioaktifitas ekstrak bunga sepatu (Hibiscus rosa-sinensis l. terhadap  kadar kolesterol darah mencit (Mus musculus yang mengalami hiperkolesterolemia dengan diet tinggi lemak. Penelitian ini merupakan penelitian eksperimental murni, dengan menggunakan rancangan randomized post-test only control group design. Bunga sepatu mengandung pigmen antosianin yang termasuk golongan flavonoid yang berperan sebagai antioksidan. Sebanyak dua puluh delapan mencit dibagi menjadi empat kelompok (K1, K2, K3 dan K4. Kelompok K1 adalah kelompok yang mendapat perlakukan pakan tinggi lemak dan aquadest setelah aklimatasi. Kelompok K2, K3, dan K4 adalah kelompok  terapi yang mendapat perlakukan pakan tinggi lemak, ekstrak bunga septum sebanyak 1 ml dan aquadest setelah aklimatasi. Pemberian pakan tinggi lemak berlangsung selama 28 hari. Selama penelitian berlangsung penimbangan berat badan tikus dilakukan sebanyak lima kali. Hasil penelitian menunjukan bahwa pemberian 1 ml ekstrak bunga sepatu selama dua puluh delapan hari dapat menurunkan kadar kolesterol mencit dimana nilai p<0.05.   Kata kunci: ekstrak bunga sepatu, kadar kolesterol, diet tinggi lemak

Aktivitas Penyembuhan Luka Sediaan Topikal Ekstrak Bawang Merah (Allium cepa terhadap Luka Sayat Kulit Mencit (Mus Musculus (THE ACTIVITY OF TOPICAL EXTRACT OF ONIONS (ALLIUM CEPA ON WOUND HEALING PROCESS IN MICE (MUS MUSCULUS

Directory of Open Access Journals (Sweden)

Visa Yunanda

2017-01-01

Full Text Available Wound healing is a physiological response of the body to restore continuity, structure and function ofthe injured tissue. Onion is one of the plants that are empirically used by the community to heal wounds.The purpose of this study was to observe the effect of topical extract of onions (Allium cepa on woundhealing process in mice (Mus musculus strain BalbC. This study used the posttest-only control groupdesign with completely randomized design (CRD. The samples were 12 male mice with weight ranged of22-32 g divided into four treatments; i.e.: Vaseline, topical extract of onion 5%, topical extract of onion30% and topical extract of onion 55% with 3 replications. Wound healing evaluated macroscopically toobserve hyperemia, wound contraction, granulation, crusting and pus production; and microscopically bycounting the number of fibroblasts on day 10. Hyperemia, granulation, crusting and pus production wereanalyzed descriptively. Wound contraction and the number of fibroblasts were analyzed using ANOVA(p<0.05 and followed with Duncan’s test (p<0,05. Descriptive observations obtained hyperemia lasteduntil day 3, granulation in wounds used topical extract of onion 30% and 55% were faster than the other,crusting lasted until day 6 and the production of pus was not found in any treatment. Statistical testresults showed that topical extract of onion 55% significantly affected wound contraction and topicalextract of onion 30% and 55% significantly affected maturation, which characterized by the decreasednumber of fibroblasts. The results of this study showed that topical extract of onion had significant effect(p<0.05 on wound healing and the effect was in line with the increased concentration of the onion extract.

Femoral cartilage thickness measurements in healthy individuals: learning, practicing and publishing with TURK-MUSCULUS.

Science.gov (United States)

Özçakar, Levent; Tunç, Hakan; Öken, Öznur; Ünlü, Zeliha; Durmuş, Bekir; Baysal, Özlem; Altay, Zuhal; Tok, Fatih; Akkaya, Nuray; Doğu, Beril; Çapkın, Erhan; Bardak, Ayşenur; Çarlı, Alparslan Bayram; Buğdaycı, Derya; Toktaş, Hasan; Dıraçoğlu, Demirhan; Gündüz, Berrin; Erhan, Belgin; Kocabaş, Hilal; Erden, Gül; Günendi, Zafer; Kesikburun, Serdar; Omaç, Özlem Köroğlu; Taşkaynatan, Mehmet Ali; Şenel, Kazım; Uğur, Mahir; Yalçınkaya, Ebru Yılmaz; Öneş, Kadriye; Atan, Çiğdem; Akgün, Kenan; Bilgici, Ayhan; Kuru, Ömer; Özgöçmen, Salih

2014-01-01

Measurement of the femoral cartilage thickness by using in-vivo musculoskeletal ultrasonography (MSUS) has been previously shown to be a valid and reliable method in previous studies; however, to our best notice, normative data has not been provided before in the healthy population.The aim of our study was to provide normative data regarding femoral cartilage thicknesses of healthy individuals with collaborative use of MSUS. This is across-sectional study run at Physical and Rehabilitation Medicine Departments of 18 Secondary and Tertiary Centers in Turkey. 1544 healthy volunteers (aged between 25-40 years) were recruited within the collaboration of TURK-MUSCULUS (Turkish Musculoskeletal Ultrasonography Study Group). Subjects who had a body mass index value of less than 30 and who did not have signs and symptoms of any degenerative/inflammatory arthritis or other rheumatic diseases, history of knee trauma and previous knee surgery were enrolled. Ultrasonographic measurements were performed axially from the suprapatellar window by using linear probes while subjects' knees were in maximum flexion. Three (mid-point) measurements were taken from both knees (lateral condyle, intercondylar area, medial condyle). A total of 2876 knees (of 817 M, 621 F subjects) were taken into analysis after exclusion of inappropriate images. Mean cartilage thicknesses were significantly lower in females than males (all p< 0.001). Thickness values negatively correlated with age; negatively (females) and positively (males) correlated with smoking. Men who regularly exercised had thicker cartilage than who did not exercise (all p < 0.05). Increased age (in both sexes) and absence of exercise (males) were found to be risk factors for decreased cartilage thicknesses. Further data pertaining to other countries would be interesting to uncover whether ethnic differences also affect cartilage thickness. Collaborative use of MSUS seems to be promising in this regard.

A survey on helminthic infection in mice (Mus musculus and rats (Rattus norvegicus and Rattus rattus in Kermanshah, Iran

Directory of Open Access Journals (Sweden)

Norollah Pakdel

2013-06-01

Full Text Available Parasitic infections of rodents can compromise scientific research as well as the health of the animals and humans. Based on previous studies, infection rate of parasitic helminths is different in various regions of Iran. The current survey was aimed to determine endoparasitic helminths infection in 138 trapped rodents of Kermanshah county, Iran. Mice and rats were trapped using metal snares from January to October 2011 and euthanized. Rodents included 110 Mus musculus (79.00%, 23 Rattus norvegicus (17.00%, and five Rattus rattus (4.00%. The gastrointestinal and respiratory tracts were removed and examined to identify parasitic helminths. The results indicated that 42.02% of examined rodents were infected with eight helminths species, i.e. Trichuris muris (14.49%, Syphacia obvelata (13.76%, Syphacia muris (2.89%, Aspicularis tetrapetra (5.07%, Heterakis spumosa (5.07%, Capillaria hepatica eggs (3.62%, Hyminolepis diminuta (12.30%, and Cystisercus fasciolaris, the larva of Taenia teanieformis (4.34%. Given the results of this study, we concluded that examined rodents were more infected with nematodes than other helminths. As rodents are usually infected with a number of zoonotic parasites, hence control of these animals has an important role in safeguarding public health.

Utilization of shallow-water seagrass detritus by Caribbean deep-sea macrofauna: delta13C evidence

International Nuclear Information System (INIS)

Suchanek, T.H.; Williams, S.L.; Ogden, J.C.; Hubbard, D.K.; Gill, I.P.

1985-01-01

Three dives were made using the DSRV Alvin in the deep-sea basin north of St. Croix, Virgin Islands. Detrital seagrasses and macrofaunal distributions at 2455 to 3950 m depth were assessed quantitatively. Counts of the manatee grass Syringodium filiforme contrasted sharply with those of the turtle grass Thalassia testudinum, reflecting an abundance proportional to previously reported export rates of the same species from Tague Bay, a nearby shallow source lagoon. Of the macrofaunal consumers that could potentially utilize this detrital nutrient source, three species of holothurians and two species of sea urchins were collected and/or observed. Gut content analyses revealed that all three holothurians deposit-feed on sediment and at least one species of sea urchin feeds almost exclusively on Syringodium. Carbon:nitrogen analyses of naturally occurring abyssal Thalassia detritus showed very low nitrogen content and a high C:N ratio, thus yielding a low nutritional value. Fresh Thalassia blades held in a litter bag experiment at 3950 m changed little in nitrogen content and C:N ratio after four years. A comparison was made of the stable carbon isotope ratios of 13 C: 12 C for abyssal seagrass detritus and other potential carbon sources with those for tissues from the holothurian and urchin consumers. The results are discussed. (author)

KOLONISASI Mus musculus albino DI LABORATORIUM LOKA LITBANG P2B2 BANJARNEGARA

Directory of Open Access Journals (Sweden)

Dewi Marbawati

2012-11-01

Full Text Available The improvement and development of science and technologycal in health area must be followed with improvement of requirement of test animal would especially white mouse (Mus musculus albino/mencit. Usage of white mouse (mencit because of relatively easy in handling, the size relatively small, the price relatively cheap, once birth can reach 16- 18, have similiarity in circulation system of human and doesn't have ability to vomit because having spillway in bouncing up, that is why white mouse used for drug trial research. This research expected to obtain stable white mouse colony in laboratory to fulfill requirement of white mouse as subject for research.Research was started in March-November 2008 in Loka Litbang P2B2 Banjarnegara. This research was elementary research with observational design. Data were collected from white mouse growth observation. Result of observation showed reproduction of white mouse after 5 month, from 6 white mouse increased become 17 (increased 2 times more, with number of deaths 11,76%. This white mouse survive until 12 months, but the average was 6 month. Oldest mencit until research ends (November 2008 ranges from 8 months. Daily observation data showed that white mouse can bear children until 6/pregnance. According to literature study mouse can bear children average 68/pregnance. Generaly baby mouse was around 1 gram, heavily horns depend on type (strain of white mouse. Result of white mouse weight showed increase of white mouse's body weight every 2 weeks was 8,6 grams. Observation data of development white mouse showed after 4 days the white mouse hair was seen, specially moustache that was clearly seen, on 5 day whole body was white. At the age of 10 days ear opened, part of other body like external mamilla and genitals become explains looked to be. At the age of 12 days eye started opens and active walking.

Cross-experimental analysis of coat color variations and morphological characteristics of the japanese wild mouse, Mus musculus.

Science.gov (United States)

Suzuki, Taichi A; Iwasa, Masahiro A

2013-01-01

There are many coat colors in the laboratory mouse, Mus musculus. On the basis of traditional genetics, there are four loci, A-D, related to coat color expressions. As shown by previous studies, Japanese wild mice have gray backs and white bellies and are assumed to carry the A(w) allele at the A (agouti) locus, which is dominant over any other alleles. However, we collected Japanese wild mice from central Honshu with black coats. To understand this black coat expression, we performed cross experiments concerning the four loci using wild-caught mice and DBA/2 laboratory mice from the standpoint of traditional genetics. The offspring of the current crosses showed the wild type, the blackish type, and the intermediate type from some combinations of parents. Considering the coat colors of the offspring, we did not obtain any evidence that the Japanese wild mice always carry the A(w) allele at the A locus. Furthermore, we were not able to explain the current coat color expressions using the traditional logic with regard to the A-D loci and concluded that it is possible for another locus (loci) to be related to the coat color expressions. On the other hand, skull characteristics and external body measurements of the captured wild mice were fundamentally different from those of DBA/2 and offspring from captured wild mice and DBA/2 combinations. Thus, we concluded that the Japanese wild mice had original criteria from a morphological viewpoint.

PRDM9 drives evolutionary erosion of hotspots in Mus musculus through haplotype-specific initiation of meiotic recombination.

Science.gov (United States)

Baker, Christopher L; Kajita, Shimpei; Walker, Michael; Saxl, Ruth L; Raghupathy, Narayanan; Choi, Kwangbom; Petkov, Petko M; Paigen, Kenneth

2015-01-01

Meiotic recombination generates new genetic variation and assures the proper segregation of chromosomes in gametes. PRDM9, a zinc finger protein with histone methyltransferase activity, initiates meiotic recombination by binding DNA at recombination hotspots and directing the position of DNA double-strand breaks (DSB). The DSB repair mechanism suggests that hotspots should eventually self-destruct, yet genome-wide recombination levels remain constant, a conundrum known as the hotspot paradox. To test if PRDM9 drives this evolutionary erosion, we measured activity of the Prdm9Cst allele in two Mus musculus subspecies, M.m. castaneus, in which Prdm9Cst arose, and M.m. domesticus, into which Prdm9Cst was introduced experimentally. Comparing these two strains, we find that haplotype differences at hotspots lead to qualitative and quantitative changes in PRDM9 binding and activity. Using Mus spretus as an outlier, we found most variants affecting PRDM9Cst binding arose and were fixed in M.m. castaneus, suppressing hotspot activity. Furthermore, M.m. castaneus×M.m. domesticus F1 hybrids exhibit novel hotspots, with large haplotype biases in both PRDM9 binding and chromatin modification. These novel hotspots represent sites of historic evolutionary erosion that become activated in hybrids due to crosstalk between one parent's Prdm9 allele and the opposite parent's chromosome. Together these data support a model where haplotype-specific PRDM9 binding directs biased gene conversion at hotspots, ultimately leading to hotspot erosion.

NCBI nr-aa BLAST: CBRC-OLAT-26-0164 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-OLAT-26-0164 ref|NP_031715.1| chondroadherin [Mus musculus] sp|O55226|CHAD_MOUSE Chondroad...herin precursor (Cartilage leucine-rich protein) gb|AAC39963.1| chondroadherin [Mus musculus] gb|AAH12672.1| Chondroad...herin [Mus musculus] emb|CAI25589.1| chondroadherin [Mus musculus] dbj|BAE34451.1| unn...amed protein product [Mus musculus] gb|EDL15934.1| chondroadherin [Mus musculus] NP_031715.1 5e-85 57% ...

Pengaruh Pemberian Ekstrak Etanol Daun Kecapi (Sandoricum koetjape (Burm.f. Merr. Terhadap Penurunan Kadar Kolesterol Total pada Mencit Jantan (Mus musculus

Directory of Open Access Journals (Sweden)

Rudi Kartika

2016-06-01

Full Text Available The research about utilization of ethanol extract form leafkecapi (Sandoricum koetjape (Burm.f.Merr.has been done, it proved could decrease  total cholesterol levels in male mice (Mus musculus. In this research sample macerated with ethanol 96% and then concentrated by rotary evaporator, and gained 15.6% of yield. Based on the results of phytochemical test, secondary metabolites compound that contained in bark kecapi are alkaloid, flavonoid, triterpenoid, steroid, phenolic and saponin. On antihiperkolesterolemia activity test by using male mice, there are several treatments that negative control (-, positive control (+ and three treatment with different doses i.e. a low doses (9.5 mg/kg BB, middle doses (19 mg/kg BB and high doses (38 mg/kg BB. The parameter measured was blood serum of male mice by using a Cholesterol Test Strips. From this test it showed that the effectiveness of decreased total cholesterol level doses of 19 mg/kg BB showed total cholesterol level under 100 mg/dL. Keywords:      Leaf kecapi (Sandoricum koetjape (Burm.f. Merr., Phytochemicals test, Total cholesterol levels, Cholesterol test strips.

Comparison the physicochemical quality indicators of Musculus Longissimus Dorsi from Mangalitsa Breed and their crossbreeds

Directory of Open Access Journals (Sweden)

Ondrej Debreceni

2016-12-01

Full Text Available In recent years, there has been a current trend in the market of pork to create products based on traditional, regional specialities, where is used technology such as drying, smoking and fermentation of products. These products require a specific quality of meat from pure-bred indigenous breeds or their crossbreeds with emphasis on dry matter content, intramuscular fat content in meat and fatty acid composition with higher share of unsaturated fatty acids and essential fatty acids. Due to this fact, indigenous breed such as the Mangalitsa has received attention from the aspect of high meat quality and meat products compared to pig meat breeds. The aim of study was to compare the meat quality of Musculus longissimus dorsi from Mangalitsa breed, the crossbreeds Mangalitsa x Duroc and the pig meat breed Slovak Large White. The experimental material comprised of 28 pcs of pigs, which were reared in the same intensive conditions and they were fed ad libitum by complete feed mixtures for fatteners. The fattening period lasted from 30 kg to 100 kg of body weight. In the presented study was found that the crossbreeds Mangalitsa x Duroc had lighter colour of meat and the Mangalitsa had darker colour than Slovak Large White (P < 0.01. From the point of texture of meat, it was found stiffer meat from Slovak Large White and more tender meat from crossbreeds Mangalitsa x Duroc compared to meat of Mangalitsa (P < 0.01. The crossbreeds Mangalitsa x Duroc had the highest intramuscular fat content and cholesterol content in meat (P < 0.01. The intramuscular fat content and cholesterol content was the lowest in Slovak Large White (P < 0.01. The results indicate that utilization of Mangalitsa breed for crossing with pig meat breeds can improve quality meat traits in their crossbreeds, which are requiring for production of special meat products.

Genotoxic effects in wild rodents (Rattus rattus and Mus musculus) in an open coal mining area.

Science.gov (United States)

León, Grethel; Pérez, Lyda Espitia; Linares, Juan Carlos; Hartmann, Andreas; Quintana, Milton

2007-06-15

Coal is a mixture of a variety of compounds containing mutagenic and carcinogenic polycyclic aromatic hydrocarbons. Exposure to coal is considered as an important non-cellular and cellular source of reactive oxygen species that can induce DNA damage. In addition, spontaneous combustion can occur in coal mining areas, further releasing compounds with detrimental effects on the environment. In this study the comet assay was used to investigate potential genotoxic effects of coal mining activities in peripheral blood cells of the wild rodents Rattus rattus and Mus musculus. The study was conducted in a coal mining area of the Municipio de Puerto Libertador, South West of the Departamento de Cordoba, Colombia. Animals from two areas in the coal mining zone and a control area located in the Municipio de Lorica were investigated. The results showed evidence that exposure to coal results in elevated primary DNA lesions in blood cells of rodents. Three different parameters for DNA damage were assessed, namely, DNA damage index, migration length and percentage damaged cells. All parameters showed statistically significantly higher values in mice and rats from the coal mining area in comparison to the animals from the control area. The parameter "DNA Damage Index" was found to be most sensitive and to best indicate a genotoxic hazard. Both species investigated were shown to be sensitive indicators of environmental genotoxicity caused by coal mining activities. In summary, our study constitutes the first investigation of potential genotoxic effects of open coal mining carried out in Puerto Libertador. The investigations provide a guide for measures to evaluate genotoxic hazards, thereby contributing to the development of appropriate measures and regulations for more careful operations during coal mining.

Effect of eccentric exercise with reduced muscle glycogen on plasma interleukin-6 and neuromuscular responses of musculus quadriceps femoris.

Science.gov (United States)

Gavin, James P; Myers, Stephen D; Willems, Mark E T

2016-07-01

Eccentric exercise can result in muscle damage and interleukin-6 (IL-6) secretion. Glycogen availability is a potent stimulator of IL-6 secretion. We examined effects of eccentric exercise in a low-glycogen state on neuromuscular function and plasma IL-6 secretion. Twelve active men (23 ± 4 yr, 179 ± 5 cm, 77 ± 10 kg, means ± SD) completed two downhill treadmill runs (gradient, -12%, 5 × 8 min; speed, 12.1 ± 1.1 km/h) with normal (NG) and reduced muscle glycogen (RG) in randomized order and at least 6 wk apart. Muscle glycogen was reduced using an established cycling protocol until exhaustion and dietary manipulation the evening before the morning run. Physiological responses were measured up to 48 h after the downhill runs. During recovery, force deficits of musculus quadriceps femoris by maximal isometric contractions were similar. Changes in low-frequency fatigue were larger with RG. Voluntary activation and plasma IL-6 levels were similar in recovery between conditions. It is concluded that unaccustomed, damaging eccentric exercise with low muscle glycogen of the m. quadriceps femoris 1) exacerbated low-frequency fatigue but 2) had no additional effect on IL-6 secretion. Neuromuscular impairment after eccentric exercise with low muscle glycogen appears to have a greater peripheral component in early recovery. Copyright © 2016 the American Physiological Society.

NCBI nr-aa BLAST: CBRC-CJAC-01-1133 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-CJAC-01-1133 ref|NP_068677.2| hairless protein [Mus musculus] sp|Q61645|HAIR_MOUSE Protein hair...less gb|AAH49182.1| Hairless [Mus musculus] gb|EDL35888.1| hairless, isoform CRA_a [Mus musculus] gb|EDL35889.1| hai...rless, isoform CRA_a [Mus musculus] gb|EDL35890.1| hairless, isoform CRA_a [Mus musculus] NP_068677.2 5.1 44% ...

Circumpolar diversity and geographic differentiation of mtDNA in the critically endangered Antarctic blue whale (Balaenoptera musculus intermedia.

Directory of Open Access Journals (Sweden)

Angela L Sremba

Full Text Available The Antarctic blue whale (Balaenoptera musculus intermedia was hunted to near extinction between 1904 and 1972, declining from an estimated initial abundance of more than 250,000 to fewer than 400. Here, we describe mtDNA control region diversity and geographic differentiation in the surviving population of the Antarctic blue whale, using 218 biopsy samples collected under the auspices of the International Whaling Commission (IWC during research cruises from 1990-2009. Microsatellite genotypes and mtDNA sequences identified 166 individuals among the 218 samples and documented movement of a small number of individuals, including a female that traveled at least 6,650 km or 131° longitude over four years. mtDNA sequences from the 166 individuals were aligned with published sequences from 17 additional individuals, resolving 52 unique haplotypes from a consensus length of 410 bp. From this minimum census, a rarefaction analysis predicted that only 72 haplotypes (95% CL, 64, 86 have survived in the contemporary population of Antarctic blue whales. However, haplotype diversity was relatively high (0.968±0.004, perhaps as a result of the longevity of blue whales and the relatively recent timing of the bottleneck. Despite the potential for circumpolar dispersal, we found significant differentiation in mtDNA diversity (F(ST = 0.032, p<0.005 and microsatellite alleles (F(ST = 0.005, p<0.05 among the six Antarctic Areas historically used by the IWC for management of blue whales.

Musculus soleus of rats at physical activity and L-carnitine and creatine phosphate effect

Directory of Open Access Journals (Sweden)

Irina A. Khutorskaya

2017-09-01

Full Text Available Introduction: The study of the effect of metabolic drugs on the histochemical characteristics of soleus muscle is relevant for solving the problem of providing the training process in Russia with non-doping drugs for safe correction of the consequences of intense physical activity in athletes. Materials and Methods: Dynamic physical activity in rats (n = 24 was simulated by swimming “to the limit” with weighting of 10 % of body weight (20 days, 1 time per day. The experimental animals were divided into four groups (6 animals each: № 1 – control, № 2 – swimming + isotonic NaCl solution, № 3 and № 4 – swimming + L-carnitine or creatine phosphate 100.0 mg/kg daily intraperitoneally. The object of the study was musculus soleus. Differentiation of muscle fibers was carried out by the intensity of histochemical activity of succinate dehydrogenase (SDG and alkaline stable adenosine triphosphate (ATP of myosin. The percentage of muscle fibers was evaluated and their diameter was defined by the direct morphometry. The obtained data were treated statistically by Student’s T-test. Results: Swimming of the animals “to the limit” do not affect the ratio of fibers with different phenotypes in the soleus muscle. This indicator is genetically determined and was not modified by L-carnitine and creatine phosphate. Dynamic physical activity promotes the development of hypertrophy of muscle fibers of various types. The investigated medicaments of the metabolic type either do not influence on the formation of exerciseinduced hypertrophy (predominantly creatine phosphate or reduce the intensity of the hypertrophic process (predominantly L-carnitine under dynamic physical activity. Discussion and Conclusions: The obtained data indicate L-carnitine and creatine phosphate do not have an anabolic effect. Taking into account the relevant data on ability of L-carnitine and creatine phosphate to effectively correct a negative effects of intensive

Male meiosis and gametogenesis in wild house mice (Mus musculus domesticus) from a chromosomal hybrid zone; a comparison between "simple" Robertsonian heterozygotes and homozygotes.

Science.gov (United States)

Wallace, B M; Searle, J B; Everett, C A

1992-01-01

Wild male house mice Mus musculus domesticus were collected from the hybrid zone between the John o'Groats race (2n = 32) and the standard race (2n = 40) in northern Scotland. Meiosis in both homozygotes (2n = 32, 36, and 40) and single Robertsonian heterozygotes (2n = 33, 35, and 37) was found to be orderly. At prophase/metaphase I in heterozygotes, a trivalent was formed from the metacentric and two homologous acrocentrics. At pachytene, this trivalent usually had a single side arm at the position of the centromeres, as a result of nonhomologous pairing of the acrocentrics. This side arm persisted into diplotene. Generally only a single chiasma was formed between each acrocentric and the metacentric. Anaphase I nondisjunction frequencies were estimated as 1.5% for the homozygotes and 2.7% for the heterozygotes. The extent of germ cell death between the pachytene and round spermatid stages was 18% greater in heterozygotes than in homozygotes. Our results concur with previous studies which indicate that single Robertsonian heterozygotes in wild house mice have near-normal fertility.

Gene : CBRC-MMUS-06-0104 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-MMUS-06-0104 6 A Pheromone receptors V1A16_RAT 2e-53 39% ref|NP_598931.1| vomeronasa...l 1 receptor, C15 [Mus musculus] gb|AAL47876.1| vomeronasal receptor V1RC15 [Mus musculus] dbj|BAC2634...7.1| unnamed protein product [Mus musculus] gb|AAI19598.1| Vomeronasal 1 receptor, C15 [Mus musculus] gb|AAI19597.1| Vomeronasa...l 1 receptor, C15 [Mus musculus] gb|EDK98787.1| vomeronasal 1 ...l-length enriched library, clone:4831417D05 product:similar to VOMERONASAL RECEPTOR V1RC3 [Mus musculus], fu

NCBI nr-aa BLAST: CBRC-BTAU-01-2652 [SEVENS

Lifescience Database Archive (English)

Full Text Available s musculus] gb|AAH17129.1| Solute carrier family 16 (monocarboxylic acid transporters), member 6 [Mus muscul...us] emb|CAM25213.1| solute carrier family 16 (monocarboxylic acid transporters), member 6 [Mus musculus] gb|...EDL34359.1| solute carrier family 16 (monocarboxylic acid transporters), member 6..., isoform CRA_a [Mus musculus] gb|EDL34361.1| solute carrier family 16 (monocarboxylic acid transporters), member 6, isoform CRA_a [Mus musculus] NP_598799.1 1e-110 76% ...

Embryo quality of mice (“Mus musculus” fed royal jelly Qualidade embrionária de camundongos ("Mus musculus" suplementados com geléia real

Directory of Open Access Journals (Sweden)

Bruno Edésio dos Santos Melo

2009-03-01

Full Text Available The study was carried out to verify the effect of feeding royal jelly associated to follicle growth induction on number and quality of mice (Mus musculus embryos. Sixty Swiss females ageing from eight to ten weeks were distributed into three treatments: the first one, composed by animals fed 0.2 mL of physiological solution intraperitoneal (control group, n=20; the second and third ones, composed by females fed 0.5 and 1.0 mg of royal jelly diluted in 0.2 mL of physiological solution (n=20, respectively. Royal jelly was administered during 15 days, followed by the follicular growth induction process. Embryos were collected 68 hours after mating, by uterine flushing. No treatment effects on the number of females that answered to superovulatory process, the number of total recovery structures, the number of viable and non viable structures and the morphological quality of viable embryos (P>0.05 were observed. Therefore, royal jelly doses used were not efficient to increase the number of embryos and to improve the quality recovery from superovulated mice.Objetivou-se verificar a influência da geléia real, associada ao tratamento de indução de crescimento folicular, no número e na qualidade de embriões de camundongos (Mus musculus. Foram utilizadas 60 fêmeas da linhagem Suíço albino com idade entre oito e dez semanas, distribuídas em três tratamentos: o primeiro, composto por animais que receberam 0,2 mL de solução fisiológica, via intraperitonial (grupo controle, n=20; o segundo e terceiro, compostos de fêmeas que receberam 0,5 e 1 mg de geléia real diluídos em 0,2 mL de solução fisiológica via intraperitonial (n=20, respectivamente. Foi administrada geléia real por um período de 15 dias, segundo o processo de indução do crescimento folicular. As coletas dos embriões ocorreram 68 horas após a cobertura, utilizando-se o método da lavagem uterina. Não houve diferença no número de fêmeas que responderam ao tratamento

Efeitos da música clássica como elemento de enriquecimento ambiental em Mus musculus em cativeiro (Rodentia: Muridae

Directory of Open Access Journals (Sweden)

José Geraldo Pereira da Cruz

2010-04-01

Full Text Available http://dx.doi.org/10.5007/2175-7925.2010v23n2p191 No ambiente selvagem, os animais são submetidos a mudanças constantes nos estímulos sensoriais. Entretanto, o ambiente de cativeiro é muito mais pobre em termos de estímulos fornecidos aos animais alojados no seu interior. Numa tentativa de remediar esta situação e promover um melhor bem estar, camundongos (Mus musculus foram expostos a duas condições: sem estímulos auditivos e com música clássica. Em todos os experimentos foi utilizada uma bateria de testes comportamentais. Os resultados demonstram uma diminuição significativa na imobilidade no nado forçado, aumento de entradas nos braços fechados do labirinto em cruz elevado e diminuição na imobilidade no campo aberto, nos animais que haviam sido pré-expostos anteriormente a 24h de música e sugerem que a música clássica causas mudanças na atividade motora em camundongos. Este estudo leva a conclusão que o enriquecimento do ambiente causa profundos efeitos sobre o comportamento de camundongos nos testes comportamentais e a música clássica é um método relativamente simples de contribuir para o bem estar de camundongos em cativeiro, mas pode comprometer resultados de experimentos como o nado forçado.

NCBI nr-aa BLAST: CBRC-MMUS-07-0085 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-MMUS-07-0085 ref|NP_665841.1| vomeronasal 1 receptor, E9 [Mus musculus] gb|AAM...69674.1|AF394954_1 vomeronasal receptor 1 E2 [Mus musculus] dbj|BAB79222.1| vomeronasal receptor 1 E6 [Mus m...usculus] gb|AAM62399.1| vomeronasal receptor V1RE9 [Mus musculus] gb|AAI41483.1| Vomeronasal 1 receptor, E9 ...[synthetic construct] gb|EDL03620.1| vomeronasal 1 receptor, E9 [Mus musculus] gb|AAI48767.1| Vomeronasa

NCBI nr-aa BLAST: CBRC-RNOR-01-0219 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-RNOR-01-0219 ref|NP_665841.1| vomeronasal 1 receptor, E9 [Mus musculus] gb|AAM...69674.1|AF394954_1 vomeronasal receptor 1 E2 [Mus musculus] dbj|BAB79222.1| vomeronasal receptor 1 E6 [Mus m...usculus] gb|AAM62399.1| vomeronasal receptor V1RE9 [Mus musculus] gb|AAI41483.1| Vomeronasal 1 receptor, E9 ...[synthetic construct] gb|EDL03620.1| vomeronasal 1 receptor, E9 [Mus musculus] gb|AAI48767.1| Vomeronasa

NCBI nr-aa BLAST: CBRC-RNOR-01-0216 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-RNOR-01-0216 ref|NP_665841.1| vomeronasal 1 receptor, E9 [Mus musculus] gb|AAM...69674.1|AF394954_1 vomeronasal receptor 1 E2 [Mus musculus] dbj|BAB79222.1| vomeronasal receptor 1 E6 [Mus m...usculus] gb|AAM62399.1| vomeronasal receptor V1RE9 [Mus musculus] gb|AAI41483.1| Vomeronasal 1 receptor, E9 ...[synthetic construct] gb|EDL03620.1| vomeronasal 1 receptor, E9 [Mus musculus] gb|AAI48767.1| Vomeronasa

Toxicological evaluation of essential oil from the leaves of Croton tetradenius (Euphorbiaceae) on Aedes aegypti and Mus musculus.

Science.gov (United States)

Carvalho, Karine da Silva; E Silva, Sandra Lúcia da Cunha; de Souza, Ivone Antonia; Gualberto, Simone Andrade; da Cruz, Rômulo Carlos Dantas; Dos Santos, Frances Regiane; de Carvalho, Mário Geraldo

2016-09-01

For control of Aedes aegypti, the main vector of dengue, botanical insecticides can be a viable alternative. Herein, we evaluated the chemical composition and insecticidal activity of the essential oils of the leaves of Croton tetradenius on Ae. aegypti larvae and adults. We also evaluated the acute toxicity in Mus musculus. The essential oil chemical analysis was performed using chromatography coupled with mass spectrometry and flame ionization detection. Female mice were used for assessing toxicity according to the Organization for Economic Cooperation and Development's Test Guideline 423/2001. Doses administered to mice orally and intraperitoneally were 5, 50, 300, and 2000 mg kg(-1). There was a greater toxic effect on larvae (LC50 = 0.152 mg mL(-1) and LC90 = 0.297 mg mL(-1)) and on adults (LC50 = 1.842 mg mL(-1) and LC90 = 3.156 mg mL(-1)) of Ae. aegypti after 24 h of exposure, when compared to other periods of exposure. Chemical analysis revealed 26 components, with camphor (25.49 %) as the major component. The acute toxicity via the intraperitoneal route identified an LD50 = 200 mg kg(-1) and by the oral route an LD50 = 500 mg kg(-1). Thus, the essential oil of C. tetradenius presents insecticidal potential for Ae. aegypti and has high safety threshold at the concentrations evaluated in this study.

The radioprotective effects of Noni (Morinda citrifolia L.) juice on the bone marrow of irradiated Mus musculus L

International Nuclear Information System (INIS)

Boquiren, Ryan Albert Leonard N.; Te Tan, Alvin E.

2000-03-01

The radioprotective effects of Noni juice on the bone marrow of irradiated Mus musculus L. (7-week old IRC strain) was studied using the micronucleus test. Five mice were used for each of the six groups; negative and positive control, 25%, 50%, 75%, 100% treatment. Both negative and positive control groups were not treated with Noni juice. However, the negative control was not irradiated. Four different concentrations, a mixture of distilled water and commercial Noni juice, were administered via oral gavage to mice in their specific groups during the 15-day feeding schedule. A day (24H) after the last treatment, the mice were irradiated (6 Gy of gamma radiation). Two days (48H) after irradiation, the mice were sacrifice and the femur were extracted. The bone marrow cells were collected and slides were prepared. One thousand polychromatic erythrocytes (PCE) were screened for the presence of micronucleus per mouse. The mean frequency of micronucleated PCE were as follows: negative control, 15; positive control, 45; 25% treatment, 21; 50% treatment, 18; 75% treatment, 11; 100% treatment, 7. The Kruskal-Wallis test showed that the groups' responses varied (α=0.05). Multiple comparison showed that there were significant differences between: (1) 25% and 100% treatment group; (2) positive control group and 75% treatment group; (3) positive control group and 100% treatment group, thus indicating that Noni juice is effective in inhibiting micronucleus formation at high concentrations. The result also showed that radioprotective potential of Noni juice follows a dose-dependent pattern. (Author)

The radioprotective effects of Noni (Morinda citrifolia L.) juice on the bone marrow of irradiated Mus musculus L

Energy Technology Data Exchange (ETDEWEB)

Boquiren, Ryan Albert Leonard N.; Te Tan, Alvin E

2000-03-01

The radioprotective effects of Noni juice on the bone marrow of irradiated Mus musculus L. (7-week old IRC strain) was studied using the micronucleus test. Five mice were used for each of the six groups; negative and positive control, 25%, 50%, 75%, 100% treatment. Both negative and positive control groups were not treated with Noni juice. However, the negative control was not irradiated. Four different concentrations, a mixture of distilled water and commercial Noni juice, were administered via oral gavage to mice in their specific groups during the 15-day feeding schedule. A day (24H) after the last treatment, the mice were irradiated (6 Gy of gamma radiation). Two days (48H) after irradiation, the mice were sacrifice and the femur were extracted. The bone marrow cells were collected and slides were prepared. One thousand polychromatic erythrocytes (PCE) were screened for the presence of micronucleus per mouse. The mean frequency of micronucleated PCE were as follows: negative control, 15; positive control, 45; 25% treatment, 21; 50% treatment, 18; 75% treatment, 11; 100% treatment, 7. The Kruskal-Wallis test showed that the groups' responses varied ({alpha}=0.05). Multiple comparison showed that there were significant differences between: (1) 25% and 100% treatment group; (2) positive control group and 75% treatment group; (3) positive control group and 100% treatment group, thus indicating that Noni juice is effective in inhibiting micronucleus formation at high concentrations. The result also showed that radioprotective potential of Noni juice follows a dose-dependent pattern. (Author)

Histometría de la glándula sublingual de ratones (Mus musculus machos y hembras infectados con la cepa RAL del parásito de Chagas, Trypanosoma cruzi

Directory of Open Access Journals (Sweden)

Sérgio de Albuquerque

2008-06-01

Full Text Available Analizamos morfológica e histométricamente la glándula sublingual de ratones infectados con la cepa RAL del Trypanosoma cruzi, en machos y hembras. Usamos ratones albinos (Mus musculus, variedad Swiss, inoculados con 2x104 tripomastigotes sanguíneos de la cepa RAL del T. cruzi.. Sacrificamos los animales en el pico de la parasitemia (12º día y fijamos las glándulas sublinguales en ALFAC. Los cortes histológicos teñidos con HE fueron evaluados histométricamente (cariometría y estereología. La parasitemia fue más elevada en las hembras. Histopatológicamente, los "ácinos" (acini de los animales infectados eran menores, con escasa secreción, y conductos estriados menores. Los núcleos de las "medialunas" eran menores y había nidos de amastigotes en el citoplasma. Cariométricamente, los núcleos de los ácinos, medialunas y conductos estriados eran menores en los ratones infectados. Estereológicamente, los volúmenes relativos ocupados por ácinos y conductos estriados fueron menores e, inversamente, fue mayor el volumen para el tejido conjuntivo de los machos infectados. Las densidades de superficie de ácinos y conductos fueron mayores, y el diámetro y el espesor de la pared menores, en este grupo. Por otro lado, la densidad de ácinos fue menor, y las de los conductos estriados y tejido conjuntivo, fueron mayores en las hembras infectadas. Las densidades de superficie de ácinos y conductos estriados fueron mayores, mientras que el diámetro y espesor de la pared de los ácinos fueron menores (y las de los conductos estriados mayores, en este grupo. La cepa RAL del T. cruzi causó un cuadro general de atrofia general en la glándula sublingual, con numerosos nidos de parásitos.Histometry of the sublingual gland in male and female mice (Mus musculus infected with the RAL strain of the Chagas parasite, Trypanosoma cruzi. The aim of this work was to analyze histologically and histometrically the sublingual gland of mice infected

Evidencias empíricas de regularidades estadísticas y leyes de potencia en los genomas de Arabidopsis thaliana, Oriza sativa y Mus musculus Empirical evidences of statistical regularities and power laws in the genomes of Arabidopsis thaliana, Oriza sativa and Mus musculus

Directory of Open Access Journals (Sweden)

Martha I Almanza P.

2010-07-01

Full Text Available La masiva cantidad de datos biológicos provenientes de las disciplinas "ómicas" y su aprovechamiento en el mejoramiento genético vegetal requiere de nuevos abordajes teóricos y estadísticos que describan de forma satisfactoria principios generales en los genomas. El total de secuencias de los genes de los genomas vegetales de Arabidopsis thaliana y Oriza sativa y del genoma animal Mus musculus fueron extraídas y depuradas de la base de datos pública del Genebank mediante el diseño de algoritmos en lenguaje de programación Python. Se analizaron las distribuciones de las variables frecuencia de uso y tamaño de los genes, exones e intrones por cromosoma y entre genomas. Los resultados señalaron que las variables presentan patrones de comportamiento no lineales en forma de ley de potencia que difieren estadísticamente entre los genomas pero no entre los cromosomas de un mismo genoma. Además, el análisis aportó evidencias respecto al tamaño promedio constante de las secuencias de exones y de los genes simples por cromosoma y entre genomas. Los hallazgos sugieren: primero, que el genoma se auto-organiza de la misma manera en los cromosomas independientemente del tamaño o número de genes que estos contengan, y, segundo, que tanto los cromosomas como sus elementos constituyentes: genes, exones e intrones han evolucionado conjuntamente. El estudio señala que las leyes de potencia cumplen un papel amortiguador en las leyes de variación biológica y proporcionan medidas cuantitativas de la organización de las secuencias de ADN que definen la identidad de un genoma. La regularidad estadística de estas medidas genéticas tiene potenciales aplicaciones en el incremento del valor predictivo de los actuales modelos de mejoramiento genético vegetal.The huge quantity of biological data arising from the omics disciplines and their benefit in plant breeding require of new theoretical and statistical approaches in order to get a satisfactory

ORF Alignment: NT_033777 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NT_033777 gi|28571958 >1bor0 1 53 282 342 4e-04 ... ref|NP_083045.3| synoviolin 1 [Mu...s musculus] gb|AAH42199.1| Synoviolin 1 [Mus ... musculus] gb|AAH80722.1| Synoviolin 1 [Mus musculus]... ... gb|AAH57917.1| Synoviolin 1 [Mus musculus] ... Length = 61 ... Query: 280 EELRQSDNICIICREDMV

Determination of muscle microcirculation of the limbs of healthy persons and patients with scleroderma by means of 133Xe clearance. 2

International Nuclear Information System (INIS)

Poenitzsch, I.; Wiemers, U.; Haustein, U.F.; Schneider, G.

1984-01-01

By means of 133 Xe muscle clearance the blood flow of the musculus tibialis anterior and the musculus opponens pollicis was determined during nonischemic work and after 3 minutes ischemia in patients with progressive scleroderma and additionally of the ischemic musculus opponens pollicis following contrast baths. In relation to 53 patients with normal vessels the reactive hyperemia of the musculus tibialis anterior after ischemia and of the musculus opponens pollicis after heat, cold as well as arterial flow decreasing was significantly decreased in patients with scleroderma and was as a disturbance of the microcirculation realized. For scientific problems in progressive scleroderma the 133 Xe muscle clearance is suitable as to the musculus opponens pollicis. (author)

Determination of muscle microcirculation of the limbs of healthy persons and patients with scleroderma by means of /sup 133/Xe clearance. 2. Examination of patients with progressive scleroderma

Energy Technology Data Exchange (ETDEWEB)

Poenitzsch, I.; Wiemers, U.; Haustein, U.F.; Schneider, G. (Karl-Marx-Universitaet, Leipzig (German Democratic Republic). Radiologische Klinik)

1984-01-01

By means of /sup 133/Xe muscle clearance the blood flow of the musculus tibialis anterior and the musculus opponens pollicis was determined during nonischemic work and after 3 minutes ischemia in patients with progressive scleroderma and additionally of the ischemic musculus opponens pollicis following contrast baths. In relation to 53 patients with normal vessels the reactive hyperemia of the musculus tibialis anterior after ischemia and of the musculus opponens pollicis after heat, cold as well as arterial flow decreasing was significantly decreased in patients with scleroderma and was as a disturbance of the microcirculation realized. For scientific problems in progressive scleroderma the /sup 133/Xe muscle clearance is suitable as to the musculus opponens pollicis.

Fraksi Heksan dan Fraksi Metanol Ekstrak Biji Pepaya Muda Menghambat Spermatogonia Mencit (Mus Musculus Jantan

Directory of Open Access Journals (Sweden)

Bagus Komang Satriyasa

2010-03-01

spermatogoniaA decreased significantly (p < 0,01. It is concluded that hexan fraction and methanol fraction ofunripe carica papaya seeds extract can decrease spermatogonia A cell of male mice (mus musculus.

Permanent magnetic field, direct electric field, and infrared to reduce blood glucose level and hepatic function in mus musculus with diabetic mellitus

Science.gov (United States)

Suhariningsih; Basuki Notobroto, Hari; Winarni, Dwi; Achmad Hussein, Saikhu; Anggono Prijo, Tri

2017-05-01

Blood contains several electrolytes with positive (cation) and negative (anion) ion load. Both electrolytes deliver impulse synergistically adjusting body needs. Those electrolytes give specific effect to external disturbance such as electric, magnetic, even infrared field. A study has been conducted to reduce blood glucose level and liver function, in type 2 Diabetes Mellitus patients, using Biophysics concept which uses combination therapy of permanent magnetic field, electric field, and infrared. This study used 48 healthy mice (mus musculus), male, age 3-4 weeks, with approximately 25-30 g in weight. Mice was fed with lard as high fat diet orally, before Streptozotocin (STZ) induction become diabetic mice. Therapy was conducted by putting mice in a chamber that emits the combination of permanent magnetic field, electric field, and infrared, every day for 1 hour for 28 days. There were 4 combinations of therapy/treatment, namely: (1) permanent magnetic field, direct electric field, and infrared; (2) permanent magnetic field, direct electric field, without infrared; (3) permanent magnetic field, alternating electric field, and infrared; and (4) permanent magnetic field, alternating electric field, without infrared. The results of therapy show that every combination is able to reduce blood glucose level, AST, and ALT. However, the best result is by using combination of permanent magnetic field, direct electric field, and infrared.

NCBI nr-aa BLAST: CBRC-PCAP-01-1368 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-PCAP-01-1368 ref|NP_031752.1| cannabinoid receptor 1 (brain) [Mus musculus] sp...|P47746|CNR1_MOUSE RecName: Full=Cannabinoid receptor 1; Short=CB1; Short=CB-R; AltName: Full=Brain-type cann...abinoid receptor gb|AAD34624.1|AF153345_1 CB1 cannabinoid receptor [Mus musculus] gb|AAA64413.1| CB1 cannab...inoid receptor [Mus musculus] gb|AAA91176.1| neuronal cannabinoid receptor [Mus m...usculus] emb|CAB42647.1| cannabinoid CB1 receptor [Mus musculus] gb|AAS91800.1| striatal cannabinoid recepto

NCBI nr-aa BLAST: CBRC-PHAM-01-1594 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-PHAM-01-1594 ref|NP_031752.1| cannabinoid receptor 1 (brain) [Mus musculus] sp...|P47746|CNR1_MOUSE RecName: Full=Cannabinoid receptor 1; Short=CB1; Short=CB-R; AltName: Full=Brain-type cann...abinoid receptor gb|AAD34624.1|AF153345_1 CB1 cannabinoid receptor [Mus musculus] gb|AAA64413.1| CB1 cannab...inoid receptor [Mus musculus] gb|AAA91176.1| neuronal cannabinoid receptor [Mus m...usculus] emb|CAB42647.1| cannabinoid CB1 receptor [Mus musculus] gb|AAS91800.1| striatal cannabinoid recepto

NCBI nr-aa BLAST: CBRC-MLUC-01-1112 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-MLUC-01-1112 ref|NP_031752.1| cannabinoid receptor 1 (brain) [Mus musculus] sp...|P47746|CNR1_MOUSE RecName: Full=Cannabinoid receptor 1; Short=CB1; Short=CB-R; AltName: Full=Brain-type cann...abinoid receptor gb|AAD34624.1|AF153345_1 CB1 cannabinoid receptor [Mus musculus] gb|AAA64413.1| CB1 cannab...inoid receptor [Mus musculus] gb|AAA91176.1| neuronal cannabinoid receptor [Mus m...usculus] emb|CAB42647.1| cannabinoid CB1 receptor [Mus musculus] gb|AAS91800.1| striatal cannabinoid recepto

NCBI nr-aa BLAST: CBRC-OPRI-01-0982 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-OPRI-01-0982 ref|NP_031752.1| cannabinoid receptor 1 (brain) [Mus musculus] sp...|P47746|CNR1_MOUSE RecName: Full=Cannabinoid receptor 1; Short=CB1; Short=CB-R; AltName: Full=Brain-type cann...abinoid receptor gb|AAD34624.1|AF153345_1 CB1 cannabinoid receptor [Mus musculus] gb|AAA64413.1| CB1 cannab...inoid receptor [Mus musculus] gb|AAA91176.1| neuronal cannabinoid receptor [Mus m...usculus] emb|CAB42647.1| cannabinoid CB1 receptor [Mus musculus] gb|AAS91800.1| striatal cannabinoid recepto

NCBI nr-aa BLAST: CBRC-VPAC-01-1554 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-VPAC-01-1554 ref|NP_031752.1| cannabinoid receptor 1 (brain) [Mus musculus] sp...|P47746|CNR1_MOUSE RecName: Full=Cannabinoid receptor 1; Short=CB1; Short=CB-R; AltName: Full=Brain-type cann...abinoid receptor gb|AAD34624.1|AF153345_1 CB1 cannabinoid receptor [Mus musculus] gb|AAA64413.1| CB1 cannab...inoid receptor [Mus musculus] gb|AAA91176.1| neuronal cannabinoid receptor [Mus m...usculus] emb|CAB42647.1| cannabinoid CB1 receptor [Mus musculus] gb|AAS91800.1| striatal cannabinoid recepto

NCBI nr-aa BLAST: CBRC-MMUR-01-1494 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-MMUR-01-1494 ref|NP_031752.1| cannabinoid receptor 1 (brain) [Mus musculus] sp...|P47746|CNR1_MOUSE RecName: Full=Cannabinoid receptor 1; Short=CB1; Short=CB-R; AltName: Full=Brain-type cann...abinoid receptor gb|AAD34624.1|AF153345_1 CB1 cannabinoid receptor [Mus musculus] gb|AAA64413.1| CB1 cannab...inoid receptor [Mus musculus] gb|AAA91176.1| neuronal cannabinoid receptor [Mus m...usculus] emb|CAB42647.1| cannabinoid CB1 receptor [Mus musculus] gb|AAS91800.1| striatal cannabinoid recepto

NCBI nr-aa BLAST: CBRC-TTRU-01-0117 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-TTRU-01-0117 ref|NP_031752.1| cannabinoid receptor 1 (brain) [Mus musculus] sp...|P47746|CNR1_MOUSE RecName: Full=Cannabinoid receptor 1; Short=CB1; Short=CB-R; AltName: Full=Brain-type cann...abinoid receptor gb|AAD34624.1|AF153345_1 CB1 cannabinoid receptor [Mus musculus] gb|AAA64413.1| CB1 cannab...inoid receptor [Mus musculus] gb|AAA91176.1| neuronal cannabinoid receptor [Mus m...usculus] emb|CAB42647.1| cannabinoid CB1 receptor [Mus musculus] gb|AAS91800.1| striatal cannabinoid recepto

NCBI nr-aa BLAST: CBRC-GGOR-01-1297 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-GGOR-01-1297 ref|NP_031752.1| cannabinoid receptor 1 (brain) [Mus musculus] sp...|P47746|CNR1_MOUSE RecName: Full=Cannabinoid receptor 1; Short=CB1; Short=CB-R; AltName: Full=Brain-type cann...abinoid receptor gb|AAD34624.1|AF153345_1 CB1 cannabinoid receptor [Mus musculus] gb|AAA64413.1| CB1 cannab...inoid receptor [Mus musculus] gb|AAA91176.1| neuronal cannabinoid receptor [Mus m...usculus] emb|CAB42647.1| cannabinoid CB1 receptor [Mus musculus] gb|AAS91800.1| striatal cannabinoid recepto

NCBI nr-aa BLAST: CBRC-CINT-01-0186 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-CINT-01-0186 ref|NP_083045.3| synovial apoptosis inhibitor 1, synoviolin [Mus ...musculus] sp|Q9DBY1|SYVN1_MOUSE E3 ubiquitin-protein ligase synoviolin precursor (Synovial apoptosis inhibit...or 1) gb|AAH42199.1| Synovial apoptosis inhibitor 1, synoviolin [Mus musculus] gb|AAH57917.1| Synovial apoptosis inhibitor 1, synovio...lin [Mus musculus] gb|AAH80722.1| Synovial apoptosis inhibitor 1, synoviolin... [Mus musculus] gb|EDL33195.1| synovial apoptosis inhibitor 1, synoviolin, isoform CRA_b [Mus musculus] NP_083045.3 1e-167 51% ...

Micro-evolutionary divergence patterns of mandible shapes in wild house mouse (Mus musculus populations

Directory of Open Access Journals (Sweden)

Tautz Diethard

2011-10-01

Full Text Available Abstract Background Insights into the micro-evolutionary patterns of morphological traits require an assessment of the natural variation of the trait within and between populations and closely related species. The mouse mandible is a particularly suitable morphological trait for such an analysis, since it has long been used as a model to study the quantitative genetics of shape. In addition, many distinct populations, sub-species and closely related species are known for the house mouse. However, morphological comparisons among wild caught animals require an assessment in how far environmental and technical factors could interfere with the shape change measurements. Results Using geometric morphometrics, we have surveyed mandible shapes in 15 natural populations of the genus Mus, with a focus on the subspecies Mus musculus domesticus. In parallel we have carefully assessed possibly confounding technical and biological factors. We find that there are distinct differences on average between populations, subspecies and species, but these differences are smaller than differences between individuals within populations. Populations from summer-dry regions, although more ancestral, are less distinct from each other than are populations from the more recently colonized northern areas. Populations with especially distinct shapes occur in an area of sympatry of M. m. domesticus and M. spretus and on recently colonized sub-antarctic islands. We have also studied a number of inbred strains to assess in how far their mandible shapes resemble those from the wild. We find that they fall indeed into the shape space of natural variation between individuals in populations. Conclusions Although mandible shapes in natural populations can be influenced by environmental variables, these influences are insufficient to explain the average extent of shape differences between populations, such that evolutionary processes must be invoked to explain this level of diversity

A toxin from Holothuria leucospilota (Brandt)

Digital Repository Service at National Institute of Oceanography (India)

Jayasree, V.; SenGupta, R.; Bhavanarayana, P.V.

Holothurians are marine echinoderms. Despite their limited mobility and absence of a protective hard shell, they are seldom preyed upon. Thus, one would expect them to have some type of chemical defence mechanism in the form of toxic compounds...

Effect of Powder Leaf Breadfruit Disposals (Arthocarpus Altilis) in Oil Mandar District and Polman Against Cholesterol and Glucose Mice (Mus Musculus)

Science.gov (United States)

Mu'nisa, A.; Asmawati, A.; Farida, A.; FA, Fressy; Erni

2018-01-01

The purpose of this study was to determine the effect of powdered leaves of breadfruit (Arthocarpus altilis) on oil is mandated origin of the Polman glucose and cholesterol levels in mice (Mus musculus). This study comprised 4 treatments and each treatment consisted of 5 replicates, ie groups of mice were fed a standard (negative control); 2 groups: group of mice fed with standard and cholesterol feed (positive control); Group 3 that mice fed with standard and Selayar oil; and group 4: group of mice fed with standard and Mandar oil that has been given powdered leaves of breadfruit. Measurement of glucose and blood cholesterol levels in mice done 3 times ie 2 weeks after the adaptation period (phase 1), 2 weeks after administration of the oil (phase 2) and 2 weeks after feeding cholesterol (stage 3). Based on the analysis of data both cholesterol and glucose levels showed that in a group of 4 decreased glucose and cholesterol levels in stage 2 but at stage 3 an increase in the group of mice given only the oil while in the group of mice given the oil and powdered leaves of breadfruit indicate glucose levels and normal cholesterol. The conclusion of this study show that the addition of powdered leaves of breadfruit into cooking oil Mandar influential in glucose levels and normalize blood cholesterol levels in mice.

Efecto del extracto del fruto de Physalis peruviana "tomatillo" en Mus musculus var. swis con hiperlipidemia inducida.

Directory of Open Access Journals (Sweden)

Julio Campos Florián

2011-01-01

Full Text Available El objetivo de la presente i nvestigación fue determinar la actividad hipolipidémica del fruto de Physalis peruviana “tomatillo” en un modelo de hiperlipidemia aguda inducida con tritón. Se utilizaron Mus musculus var. swis machos como animales de experimentación. Se trabajó con cuatro grupos de ratones, el grupo blanco recibió agua destilada por vía oral y solución salina fisiológica por vía intraperitoneal, el grupo control recibió agua destilada por vía oral y tritón por vía intraperitoneal, el grupo problema 1 recibió por vía oral 0.05g/100g del extracto de Physalis peruviana y tritón por vía intraperitoneal y el grupo problema 2 recibió por vía oral 0.2g/100g del extracto de Physalis peruviana y tritón por vía intraperitoneal. Luego de 24 horas de administrar los tratamientos se re alizaron las mediciones en suero de las concentraciones de colesterol y triglicéridos. Los niveles promedio de colesterol (mg/dL fueron: 58.87±11.54 (blanco, 121.71±15.00 (control, 58.08±9. 21 (problema 1 y 66.78±16.77 (problema 2. Los niveles promedio de triglicéridos (g/L fueron: 0.48±0.07 (blanco, 1.84±0.18 (control, 0.34±0.10 (problema 1 y 0.94±0.25 (problema 2. Se encontró reducciones significativas (p<0.000, tanto de las concentraciones de colesterol como de triglicéridos en relación a las o btenidas en el grupo tratado sólo con tritón.

Mus musculus bone fluoride concentration as a useful biomarker for risk assessment of skeletal fluorosis in volcanic areas.

Science.gov (United States)

Linhares, Diana; Camarinho, Ricardo; Garcia, Patrícia Ventura; Rodrigues, Armindo Dos Santos

2018-08-01

Fluoride is often found in elevated concentrations in volcanic areas due to the release of magmatic fluorine as hydrogen fluorine through volcanic degassing. The exposure to high levels of fluoride can affect the processes of bone formation and resorption causing skeletal fluorosis, a pathology that can easily be mistaken for other skeletal diseases. In this study, we aimed to determine if fluoride concentration in the femoral bone of wild populations of the house mouse (Mus musculus) is a good biomarker of exposure to active volcanic environments naturally enriched in fluoride, allowing their use in biomonitoring programs. The fluoride concentration of the whole femoral bone of 9 mice from Furnas (5 males and 4 females) and 33 mice from Rabo de Peixe (16 males and 17 females) was measured by the potentiometric method with a fluoride ion selective electrode. Fluoride in bones was significantly higher in the mice from Furnas when compared with the mice from Rabo de Peixe (616.5 ± 129.3 μg F/g vs. 253.8 ± 10.5 μg F/g). Accumulation rates were also significantly higher in the mice collected in Furnas when compared with Rabo de Peixe individuals (3.84 ± 0.52 μg F/day vs. 1.22 ± 0.06 μg F/day). The results demonstrate a significant association between exposure to fluoride in the active volcanic environment and fluoride content in bone, revealing that bone fluoride concentration is a suitable biomarker of chronic environmental exposure to fluoride. Copyright © 2018 Elsevier Ltd. All rights reserved.

NCBI nr-aa BLAST: CBRC-MMUS-06-0135 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-MMUS-06-0135 ref|NP_444455.1| vomeronasal 1 receptor, B1 [Mus musculus] sp|Q9EP51|VN1B1_MOUSE Vomeronas...al type-1 receptor B1 (Vomeronasal type-1 receptor A5) (Vomeronasal receptor 2) (Ph...eromone receptor VN2) gb|AAG42083.1|AF291489_1 vomeronasal receptor V1RB1 [Mus musculus] gb|AAG43248.1| VN2 ...[Mus musculus] gb|AAI07184.1| Vomeronasal 1 receptor, B1 [Mus musculus] gb|EDK99276.1| vomeronasal 1 receptor, B1 [Mus musculus] NP_444455.1 1e-139 80% ...

NCBI nr-aa BLAST: CBRC-MMUS-06-0136 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-MMUS-06-0136 ref|NP_444455.1| vomeronasal 1 receptor, B1 [Mus musculus] sp|Q9EP51|VN1B1_MOUSE Vomeronas...al type-1 receptor B1 (Vomeronasal type-1 receptor A5) (Vomeronasal receptor 2) (Ph...eromone receptor VN2) gb|AAG42083.1|AF291489_1 vomeronasal receptor V1RB1 [Mus musculus] gb|AAG43248.1| VN2 ...[Mus musculus] gb|AAI07184.1| Vomeronasal 1 receptor, B1 [Mus musculus] gb|EDK99276.1| vomeronasal 1 receptor, B1 [Mus musculus] NP_444455.1 1e-175 100% ...

NCBI nr-aa BLAST: CBRC-STRI-01-2632 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-STRI-01-2632 ref|NP_076136.2| non-imprinted in Prader-Willi/Angelman syndrome ...2 [Mus musculus] sp|Q9JJC8|NIPA2_MOUSE RecName: Full=Magnesium transporter NIPA2; AltName: Full=Non-imprinte...tein product [Mus musculus] tpg|DAA01178.1| TPA_exp: non-imprinted in Prader-Willi/Angelman syndrome 2 [Mus ...musculus] dbj|BAE32806.1| unnamed protein product [Mus musculus] gb|EDL21872.1| non imprint...ed in Prader-Willi/Angelman syndrome 2 homolog (human), isoform CRA_a [Mus musculus] gb|EDL21874.1| non imprint

NCBI nr-aa BLAST: CBRC-OCUN-01-0645 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-OCUN-01-0645 ref|NP_444455.1| vomeronasal 1 receptor, B1 [Mus musculus] sp|Q9EP51|VN1B1_MOUSE Vomeronas...al type-1 receptor B1 (Vomeronasal type-1 receptor A5) (Vomeronasal receptor 2) (Ph...eromone receptor VN2) gb|AAG42083.1|AF291489_1 vomeronasal receptor V1RB1 [Mus musculus] gb|AAG43248.1| VN2 ...[Mus musculus] gb|AAI07184.1| Vomeronasal 1 receptor, B1 [Mus musculus] gb|EDK99276.1| vomeronasal 1 receptor, B1 [Mus musculus] NP_444455.1 3e-46 53% ...

NCBI nr-aa BLAST: CBRC-MMUS-06-0141 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-MMUS-06-0141 ref|NP_444455.1| vomeronasal 1 receptor, B1 [Mus musculus] sp|Q9EP51|VN1B1_MOUSE Vomeronas...al type-1 receptor B1 (Vomeronasal type-1 receptor A5) (Vomeronasal receptor 2) (Ph...eromone receptor VN2) gb|AAG42083.1|AF291489_1 vomeronasal receptor V1RB1 [Mus musculus] gb|AAG43248.1| VN2 ...[Mus musculus] gb|AAI07184.1| Vomeronasal 1 receptor, B1 [Mus musculus] gb|EDK99276.1| vomeronasal 1 receptor, B1 [Mus musculus] NP_444455.1 1e-135 78% ...

New Metacentric Populations and Phylogenetic Hypotheses Involving Whole-Arm Reciprocal Translocation in Mus musculus domesticus from Sicily, Southern Italy.

Science.gov (United States)

Castiglia, Riccardo; Capanna, Ernesto; Bezerra, Alexandra M R; Bizzoco, Domenico; Zambigli, Emanuela; Solano, Emanuela

2015-01-01

The house mouse Mus musculus domesticus is characterized by more than 100 metacentric populations, due to the occurrence of Robertsonian (Rb) fusions, together with the standard all-telocentric karyotype (2n = 40). We examined G-banded karyotypes of 18 mice from 10 localities in Sicily and describe 3 new metacentric populations: 'Ragusa Ibla' (IRAG), 2n = 33-36, Rb(2.4), Rb(5.6), Rb(9.16), Rb(13.17); 'Piana degli Albanesi' (IPIA), 2n = 23, Rb(1.18), Rb(2.15), Rb(3.5), Rb(4.12), Rb(6.11), Rb(7.8), Rb(9.16), Rb(10.14), Rb(13.17); 'Trapani' (ITRA), 2n = 22, Rb(1.18), Rb(2.15), Rb(3.7), Rb(4.12), Rb(5.9), Rb(6.11), Rb(8.16), Rb(10.14), Rb(13.17). Three mice belonged to the previously reported 'Castelbuono' race (ICAS), 2n = 24, which is very similar to the nearby 'Palermo' (IPAL) race, 2n = 26. Three Rb fusions not yet observed in wild mouse populations were identified: Rb(3.5), Rb(3.7) and Rb(5.9). Rb fusions shared among 4 races (IPIA, IRAG, ICAS, and IPAL) allowed us to describe their potential phylogenetic relationships. We obtained 2 alternative phylogenetic trees. The differences between them are mainly due to various modes of formation of IPIA and ITRA. In the first hypothesis, the specific Rb fusions occurred independently. In the second, those of IRAG originated from those of IPIA via whole-arm reciprocal translocations. © 2015 S. Karger AG, Basel.

"Pollical palmar interosseous muscle" (musculus adductor pollicis accessorius): attachments, innervation, variations, phylogeny, and implications for human evolution and medicine.

Science.gov (United States)

Bello-Hellegouarch, Gaelle; Aziz, M Ashraf; Ferrero, Eva M; Kern, Michael; Francis, Nadia; Diogo, Rui

2013-03-01

Most atlases and textbooks dealing with human anatomy do not refer to the "pollical palmar interosseous" (PPI) muscle of Henle. In order to undertake a fresh and detailed study of this muscle and to thus better understand human comparative anatomy and evolution, we: 1) analyze the frequency of the PPI in a large sample of human hands; 2) describe the attachments, innervation and varieties of the PPI in these hands; 3) compare the data obtained with the information available in the literature; and 4) discuss the phylogenetic origin of the PPI and the implications of our observations and comparisons for medicine and for the understanding of human evolutionary history. Within the 72 hands dissected by us, the PPI is present in 67 hands (93%), commonly having a single muscular branch, originating from the medial side of the base of metacarpal I only, inserting onto the medial side of the base of the pollical proximal phalanx and/or surrounding structures (e.g., ulnar sesamoid bone, wing tendon of extensor apparatus), and passing at least partially, and usually mainly, medial to the princeps pollicis artery. A careful study of the human PPI, as well as a detailed comparison with other mammals, strongly suggest that the muscle is evolutionarily derived from the adductor pollicis, and namely from its oblique head. Therefore, we propose that PPI should be designated by the name musculus adductor pollicis accessorius, which indicates that the muscle is most likely a de novo structure derived from the adductor pollicis. Copyright © 2012 Wiley Periodicals, Inc.

NCBI nr-aa BLAST: CBRC-SARA-01-1746 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-SARA-01-1746 ref|NP_705806.1| non-imprinted in Prader-Willi/Angelman syndrome ...1 [Mus musculus] sp|Q8BHK1|NIPA1_MOUSE Non-imprinted in Prader-Willi/Angelman syndrome region protein 1 homo...protein product [Mus musculus] gb|AAH55828.1| Non imprinted in Prader-Willi/Angel...man syndrome 1 homolog (human) [Mus musculus] gb|EDL21870.1| non imprinted in Prader-Willi/Angelman syndrome 1 homolog (human) [Mus musculus] NP_705806.1 1e-113 81% ... ...log gb|AAM34534.1| non-imprinted in Prader-Willi/Angelman syndrome 1 [Mus musculus] dbj|BAC32809.1| unnamed

Pengaruh Ekstrak Daun Sambiloto (Andrographis paniculata terhadap Struktur Mikroanatomi Hepar dan Kadar Glutamat Piruvat Transaminase Serum Mencit (Mus musculus yang Terpapar Diazinon

Directory of Open Access Journals (Sweden)

TRI WULANDARI

2007-11-01

Full Text Available Diazinon is a pesticide which is often using by farmer to kill insect as theenemy of the plant. The over using of pesticide may result in the remaining of diazinon residue in farming product. This residue can cause the damage of body tissue, especially liver. The aim of research were to find out the effect of leaves sambiloto (Andrographis paniculata Ness. extract on microanatomic structure of liver and serum glutamate pyruvate transaminase (GPT level of mice (Mus musculus L. exposed to diazinon. The research used Compelete Random Design with five treatments. The treatment of each group were using CMC 1% (placebo control, diazinon solution 40 mg/Kg BW (negative ontrol and the leaves sambiloto extract 12,6; 25,2 and 37,8 mg /kg BW. Diazinon solution was given within 10 days and continued with extract of sambiloto leaves also within 10 days. Parameter observed was the microanatomic structure of liver and serum GPT level. The data was analyzed of Analysis of Varians (Anova and continued with DMRT at significance 5%. The result of the research showed that the giving of the extract of sambiloto leaves in some dose variation degree is significantly influential to repair the microanatomic structure of liver and to decrease the serum GPT level was 37,8 mg/Kg BW.

Permanent magnetic field, direct electric field, and infrared to reduce blood glucose level and hepatic function in mus musculus with diabetic mellitus

International Nuclear Information System (INIS)

Suhariningsih; Prijo, Tri Anggono; Notobroto, Hari Basuki; Winarni, Dwi; Hussein, Saikhu Achmad

2017-01-01

Blood contains several electrolytes with positive (cation) and negative (anion) ion load. Both electrolytes deliver impulse synergistically adjusting body needs. Those electrolytes give specific effect to external disturbance such as electric, magnetic, even infrared field. A study has been conducted to reduce blood glucose level and liver function, in type 2 Diabetes Mellitus patients, using Biophysics concept which uses combination therapy of permanent magnetic field, electric field, and infrared. This study used 48 healthy mice ( mus musculus ), male, age 3-4 weeks, with approximately 25-30 g in weight. Mice was fed with lard as high fat diet orally, before Streptozotocin (STZ) induction become diabetic mice. Therapy was conducted by putting mice in a chamber that emits the combination of permanent magnetic field, electric field, and infrared, every day for 1 hour for 28 days. There were 4 combinations of therapy/treatment, namely: (1) permanent magnetic field, direct electric field, and infrared; (2) permanent magnetic field, direct electric field, without infrared; (3) permanent magnetic field, alternating electric field, and infrared; and (4) permanent magnetic field, alternating electric field, without infrared. The results of therapy show that every combination is able to reduce blood glucose level, AST, and ALT. However, the best result is by using combination of permanent magnetic field, direct electric field, and infrared. (paper)

NCBI nr-aa BLAST: CBRC-STRI-01-2305 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-STRI-01-2305 ref|NP_444455.1| vomeronasal 1 receptor, B1 [Mus musculus] sp|Q9E...P51|VN1B1_MOUSE RecName: Full=Vomeronasal type-1 receptor B1; AltName: Full=Vomeronasal type-1 receptor A5; AltName: Full=Vomeronasa...l receptor 2; AltName: Full=Pheromone receptor VN2 gb|AAG42083.1|AF291489_1 vomeronasa...l receptor V1RB1 [Mus musculus] gb|AAG43248.1| VN2 [Mus musculus] gb|AAI07184.1| Vomeronasa...l 1 receptor, B1 [Mus musculus] gb|EDK99276.1| vomeronasal 1 receptor, B1 [Mus musculus] NP_444455.1 8e-64 55% ...

NCBI nr-aa BLAST: CBRC-STRI-01-1937 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-STRI-01-1937 ref|NP_444455.1| vomeronasal 1 receptor, B1 [Mus musculus] sp|Q9E...P51|VN1B1_MOUSE RecName: Full=Vomeronasal type-1 receptor B1; AltName: Full=Vomeronasal type-1 receptor A5; AltName: Full=Vomeronasa...l receptor 2; AltName: Full=Pheromone receptor VN2 gb|AAG42083.1|AF291489_1 vomeronasa...l receptor V1RB1 [Mus musculus] gb|AAG43248.1| VN2 [Mus musculus] gb|AAI07184.1| Vomeronasa...l 1 receptor, B1 [Mus musculus] gb|EDK99276.1| vomeronasal 1 receptor, B1 [Mus musculus] NP_444455.1 2e-25 41% ...

NCBI nr-aa BLAST: CBRC-OPRI-01-1437 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-OPRI-01-1437 ref|NP_031564.1| opsin 1 (cone pigments), short-wave-sensitive (color blind...Mus musculus] gb|AAH26021.1| Opsin 1 (cone pigments), short-wave-sensitive (color blindness, tritan) [Mus mu...sculus] gb|AAH58267.1| Opsin 1 (cone pigments), short-wave-sensitive (color blind...ness, tritan) [Mus musculus] gb|EDL13781.1| opsin 1 (cone pigments), short-wave-sensitive (color blindness, tritan), isoform CRA_a [Mus musculus] NP_031564.1 1e-162 81% ...

NCBI nr-aa BLAST: CBRC-MDOM-08-0120 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-MDOM-08-0120 ref|NP_031564.1| opsin 1 (cone pigments), short-wave-sensitive (color blindness...Mus musculus] gb|AAH26021.1| Opsin 1 (cone pigments), short-wave-sensitive (color blindness, tritan) [Mus mu...sculus] gb|AAH58267.1| Opsin 1 (cone pigments), short-wave-sensitive (color blindness..., tritan) [Mus musculus] gb|EDL13781.1| opsin 1 (cone pigments), short-wave-sensitive (color blindness, tritan), isoform CRA_a [Mus musculus] NP_031564.1 0.0 87% ...

NCBI nr-aa BLAST: CBRC-VPAC-01-1432 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-VPAC-01-1432 ref|NP_031564.1| opsin 1 (cone pigments), short-wave-sensitive (color blindness...Mus musculus] gb|AAH26021.1| Opsin 1 (cone pigments), short-wave-sensitive (color blindness, tritan) [Mus mu...sculus] gb|AAH58267.1| Opsin 1 (cone pigments), short-wave-sensitive (color blindness..., tritan) [Mus musculus] gb|EDL13781.1| opsin 1 (cone pigments), short-wave-sensitive (color blindness, tritan), isoform CRA_a [Mus musculus] NP_031564.1 0.0 85% ...

NCBI nr-aa BLAST: CBRC-MEUG-01-2797 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-MEUG-01-2797 ref|NP_031564.1| opsin 1 (cone pigments), short-wave-sensitive (color blindness...Mus musculus] gb|AAH26021.1| Opsin 1 (cone pigments), short-wave-sensitive (color blindness, tritan) [Mus mu...sculus] gb|AAH58267.1| Opsin 1 (cone pigments), short-wave-sensitive (color blindness..., tritan) [Mus musculus] gb|EDL13781.1| opsin 1 (cone pigments), short-wave-sensitive (color blindness, tritan), isoform CRA_a [Mus musculus] NP_031564.1 0.0 86% ...

NCBI nr-aa BLAST: CBRC-TTRU-01-0695 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-TTRU-01-0695 ref|NP_031564.1| opsin 1 (cone pigments), short-wave-sensitive (color blindness...Mus musculus] gb|AAH26021.1| Opsin 1 (cone pigments), short-wave-sensitive (color blindness, tritan) [Mus mu...sculus] gb|AAH58267.1| Opsin 1 (cone pigments), short-wave-sensitive (color blindness..., tritan) [Mus musculus] gb|EDL13781.1| opsin 1 (cone pigments), short-wave-sensitive (color blindness, tritan), isoform CRA_a [Mus musculus] NP_031564.1 1e-145 80% ...

On Scambicornus Heegard, 1944, a senior synonym of Preherrmannella Seymour Sewell, 1949 (Copepoda, Cyclopoida)

NARCIS (Netherlands)

Stock, J.H.

1964-01-01

During the preparation of a report dealing with poecilostomes associated with holothurians, it was found desirable to obtain more information concerning a number of genera formerly described. Through the courtesy of Dr. T.Wolff of the Zoologisk Museum of Copenhagen, I was able to reexamine the

Where are the wormy mice? A re-examination of hybrid parasitism in the European house mouse hybrid zone

Czech Academy of Sciences Publication Activity Database

Baird, Stuart J. E.; Ribas, Alexis; Macholán, Miloš; Albrecht, Tomáš; Piálek, Jaroslav; Goüy de Bellocq, Joëlle

2012-01-01

Roč. 66, č. 9 (2012), s. 2757-2772 ISSN 0014-3820 R&D Projects: GA ČR GA206/08/0640 Institutional support : RVO:68081766 ; RVO:67985904 Keywords : helminths * Mus musculus domesticus * Mus musculus musculus * resistance * immune gene transitive compatibility Subject RIV: EG - Zoology Impact factor: 4.864, year: 2012

NCBI nr-aa BLAST: CBRC-MMUS-04-0013 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-MMUS-04-0013 ref|NP_031752.1| cannabinoid receptor 1 (brain) [Mus musculus] sp...|P47746|CNR1_MOUSE Cannabinoid receptor 1 (CB1) (CB-R) (Brain-type cannabinoid receptor) gb|AAD34624.1|AF153345_1 CB1 cann...abinoid receptor [Mus musculus] gb|AAA64413.1| CB1 cannabinoid receptor gb|AAA91176.1| neuronal cann...abinoid receptor emb|CAB42647.1| cannabinoid CB1 receptor [Mus musculus] gb|AAS91800.1| striatal can...nabinoid receptor type 1 protein [Mus musculus] gb|AAS91801.1| striatal cannabinoid

NCBI nr-aa BLAST: CBRC-PTRO-07-0067 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-PTRO-07-0067 ref|NP_031752.1| cannabinoid receptor 1 (brain) [Mus musculus] sp...|P47746|CNR1_MOUSE Cannabinoid receptor 1 (CB1) (CB-R) (Brain-type cannabinoid receptor) gb|AAD34624.1|AF153345_1 CB1 cann...abinoid receptor [Mus musculus] gb|AAA64413.1| CB1 cannabinoid receptor gb|AAA91176.1| neuronal cann...abinoid receptor emb|CAB42647.1| cannabinoid CB1 receptor [Mus musculus] gb|AAS91800.1| striatal can...nabinoid receptor type 1 protein [Mus musculus] gb|AAS91801.1| striatal cannabinoid

NCBI nr-aa BLAST: CBRC-RMAC-04-0050 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-RMAC-04-0050 ref|NP_031752.1| cannabinoid receptor 1 (brain) [Mus musculus] sp...|P47746|CNR1_MOUSE Cannabinoid receptor 1 (CB1) (CB-R) (Brain-type cannabinoid receptor) gb|AAD34624.1|AF153345_1 CB1 cann...abinoid receptor [Mus musculus] gb|AAA64413.1| CB1 cannabinoid receptor gb|AAA91176.1| neuronal cann...abinoid receptor emb|CAB42647.1| cannabinoid CB1 receptor [Mus musculus] gb|AAS91800.1| striatal can...nabinoid receptor type 1 protein [Mus musculus] gb|AAS91801.1| striatal cannabinoid

NCBI nr-aa BLAST: CBRC-CFAM-12-0016 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-CFAM-12-0016 ref|NP_031752.1| cannabinoid receptor 1 (brain) [Mus musculus] sp...|P47746|CNR1_MOUSE Cannabinoid receptor 1 (CB1) (CB-R) (Brain-type cannabinoid receptor) gb|AAD34624.1|AF153345_1 CB1 cann...abinoid receptor [Mus musculus] gb|AAA64413.1| CB1 cannabinoid receptor gb|AAA91176.1| neuronal cann...abinoid receptor emb|CAB42647.1| cannabinoid CB1 receptor [Mus musculus] gb|AAS91800.1| striatal can...nabinoid receptor type 1 protein [Mus musculus] gb|AAS91801.1| striatal cannabinoid

NCBI nr-aa BLAST: CBRC-ACAR-01-0845 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-ACAR-01-0845 ref|NP_031752.1| cannabinoid receptor 1 (brain) [Mus musculus] sp...|P47746|CNR1_MOUSE Cannabinoid receptor 1 (CB1) (CB-R) (Brain-type cannabinoid receptor) gb|AAD34624.1|AF153345_1 CB1 cann...abinoid receptor [Mus musculus] gb|AAA64413.1| CB1 cannabinoid receptor gb|AAA91176.1| neuronal cann...abinoid receptor emb|CAB42647.1| cannabinoid CB1 receptor [Mus musculus] gb|AAS91800.1| striatal can...nabinoid receptor type 1 protein [Mus musculus] gb|AAS91801.1| striatal cannabinoid

NCBI nr-aa BLAST: CBRC-FRUB-02-0074 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-FRUB-02-0074 ref|NP_031752.1| cannabinoid receptor 1 (brain) [Mus musculus] sp...|P47746|CNR1_MOUSE Cannabinoid receptor 1 (CB1) (CB-R) (Brain-type cannabinoid receptor) gb|AAD34624.1|AF153345_1 CB1 cann...abinoid receptor [Mus musculus] gb|AAA64413.1| CB1 cannabinoid receptor gb|AAA91176.1| neuronal cann...abinoid receptor emb|CAB42647.1| cannabinoid CB1 receptor [Mus musculus] gb|AAS91800.1| striatal can...nabinoid receptor type 1 protein [Mus musculus] gb|AAS91801.1| striatal cannabinoid

NCBI nr-aa BLAST: CBRC-TBEL-01-1883 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-TBEL-01-1883 ref|NP_031752.1| cannabinoid receptor 1 (brain) [Mus musculus] sp...|P47746|CNR1_MOUSE Cannabinoid receptor 1 (CB1) (CB-R) (Brain-type cannabinoid receptor) gb|AAD34624.1|AF153345_1 CB1 cann...abinoid receptor [Mus musculus] gb|AAA64413.1| CB1 cannabinoid receptor gb|AAA91176.1| neuronal cann...abinoid receptor emb|CAB42647.1| cannabinoid CB1 receptor [Mus musculus] gb|AAS91800.1| striatal can...nabinoid receptor type 1 protein [Mus musculus] gb|AAS91801.1| striatal cannabinoid

NCBI nr-aa BLAST: CBRC-LAFR-01-1734 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-LAFR-01-1734 ref|NP_031752.1| cannabinoid receptor 1 (brain) [Mus musculus] sp...|P47746|CNR1_MOUSE Cannabinoid receptor 1 (CB1) (CB-R) (Brain-type cannabinoid receptor) gb|AAD34624.1|AF153345_1 CB1 cann...abinoid receptor [Mus musculus] gb|AAA64413.1| CB1 cannabinoid receptor gb|AAA91176.1| neuronal cann...abinoid receptor emb|CAB42647.1| cannabinoid CB1 receptor [Mus musculus] gb|AAS91800.1| striatal can...nabinoid receptor type 1 protein [Mus musculus] gb|AAS91801.1| striatal cannabinoid

NCBI nr-aa BLAST: CBRC-TNIG-10-0006 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-TNIG-10-0006 ref|NP_031752.1| cannabinoid receptor 1 (brain) [Mus musculus] sp...|P47746|CNR1_MOUSE Cannabinoid receptor 1 (CB1) (CB-R) (Brain-type cannabinoid receptor) gb|AAD34624.1|AF153345_1 CB1 cann...abinoid receptor [Mus musculus] gb|AAA64413.1| CB1 cannabinoid receptor gb|AAA91176.1| neuronal cann...abinoid receptor emb|CAB42647.1| cannabinoid CB1 receptor [Mus musculus] gb|AAS91800.1| striatal can...nabinoid receptor type 1 protein [Mus musculus] gb|AAS91801.1| striatal cannabinoid

NCBI nr-aa BLAST: CBRC-OCUN-01-1522 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-OCUN-01-1522 ref|NP_031752.1| cannabinoid receptor 1 (brain) [Mus musculus] sp...|P47746|CNR1_MOUSE Cannabinoid receptor 1 (CB1) (CB-R) (Brain-type cannabinoid receptor) gb|AAD34624.1|AF153345_1 CB1 cann...abinoid receptor [Mus musculus] gb|AAA64413.1| CB1 cannabinoid receptor gb|AAA91176.1| neuronal cann...abinoid receptor emb|CAB42647.1| cannabinoid CB1 receptor [Mus musculus] gb|AAS91800.1| striatal can...nabinoid receptor type 1 protein [Mus musculus] gb|AAS91801.1| striatal cannabinoid

NCBI nr-aa BLAST: CBRC-FCAT-01-1020 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-FCAT-01-1020 ref|NP_031752.1| cannabinoid receptor 1 (brain) [Mus musculus] sp...|P47746|CNR1_MOUSE Cannabinoid receptor 1 (CB1) (CB-R) (Brain-type cannabinoid receptor) gb|AAD34624.1|AF153345_1 CB1 cann...abinoid receptor [Mus musculus] gb|AAA64413.1| CB1 cannabinoid receptor gb|AAA91176.1| neuronal cann...abinoid receptor emb|CAB42647.1| cannabinoid CB1 receptor [Mus musculus] gb|AAS91800.1| striatal can...nabinoid receptor type 1 protein [Mus musculus] gb|AAS91801.1| striatal cannabinoid

NCBI nr-aa BLAST: CBRC-GACU-18-0022 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-GACU-18-0022 ref|NP_031752.1| cannabinoid receptor 1 (brain) [Mus musculus] sp...|P47746|CNR1_MOUSE Cannabinoid receptor 1 (CB1) (CB-R) (Brain-type cannabinoid receptor) gb|AAD34624.1|AF153345_1 CB1 cann...abinoid receptor [Mus musculus] gb|AAA64413.1| CB1 cannabinoid receptor gb|AAA91176.1| neuronal cann...abinoid receptor emb|CAB42647.1| cannabinoid CB1 receptor [Mus musculus] gb|AAS91800.1| striatal can...nabinoid receptor type 1 protein [Mus musculus] gb|AAS91801.1| striatal cannabinoid

NCBI nr-aa BLAST: CBRC-CJAC-01-1332 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-CJAC-01-1332 ref|NP_031752.1| cannabinoid receptor 1 (brain) [Mus musculus] sp...|P47746|CNR1_MOUSE Cannabinoid receptor 1 (CB1) (CB-R) (Brain-type cannabinoid receptor) gb|AAD34624.1|AF153345_1 CB1 cann...abinoid receptor [Mus musculus] gb|AAA64413.1| CB1 cannabinoid receptor gb|AAA91176.1| neuronal cann...abinoid receptor emb|CAB42647.1| cannabinoid CB1 receptor [Mus musculus] gb|AAS91800.1| striatal can...nabinoid receptor type 1 protein [Mus musculus] gb|AAS91801.1| striatal cannabinoid

NCBI nr-aa BLAST: CBRC-TNIG-14-0023 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-TNIG-14-0023 ref|NP_031752.1| cannabinoid receptor 1 (brain) [Mus musculus] sp...|P47746|CNR1_MOUSE Cannabinoid receptor 1 (CB1) (CB-R) (Brain-type cannabinoid receptor) gb|AAD34624.1|AF153345_1 CB1 cann...abinoid receptor [Mus musculus] gb|AAA64413.1| CB1 cannabinoid receptor gb|AAA91176.1| neuronal cann...abinoid receptor emb|CAB42647.1| cannabinoid CB1 receptor [Mus musculus] gb|AAS91800.1| striatal can...nabinoid receptor type 1 protein [Mus musculus] gb|AAS91801.1| striatal cannabinoid

Synaptic vesicles isolated from the electric organ of Torpedo californica and from the central nervous system of Mus musculus contain small ribonucleic acids (sRNAs

Directory of Open Access Journals (Sweden)

Huinan Li

2017-06-01

Full Text Available Synaptic vesicles (SVs are presynaptic organelles that load and release small molecule neurotransmitters at chemical synapses. In addition to classic neurotransmitters, we have demonstrated that SVs isolated from the Peripheral Nervous Systems (PNS of the electric organ of Torpedo californica, a model cholinergic synapse, and SVs isolated from the Central Nervous System (CNS of Mus musculus (mouse contain small ribonucleic acids (sRNAs; ≤50 nucleotides (Scientific Reports, 5:1–14(14918 Li et al. (2015 [1]. Our previous publication provided the five most abundant sequences associated with the T. californica SVs, and the ten most abundant sequences associated with the mouse SVs, representing 59% and 39% of the total sRNA reads sequenced, respectively. We provide here a full repository of the SV sRNAs sequenced from T. californica and the mouse deposited in the NCBI as biosamples. Three data studies are included: SVs isolated from the electric organ of T. californica using standard techniques, SVs isolated from the electric organ of T. californica using standard techniques with an additional affinity purification step, and finally, SVs isolated from the CNS of mouse. The three biosamples are available at https://www.ncbi.nlm.nih.gov/biosample/ SRS1523467, SRS1523466, and SRS1523472 respectively.

Association of marine archaea with the digestive tracts of two marine fish species

NARCIS (Netherlands)

Maarel, Marc J.E.C. van der; Artz, Rebekka R.E.; Haanstra, Rene; Forney, Larry J.

Recent studies have shown that archaea which were always thought to live under strict anoxic or extreme environmental conditions are also present in cold, oxygenated seawater, soils, the digestive tract of a holothurian deep-sea-deposit feeder, and a marine sponge, In this study we show, by using

Influence of Polysaccharide Krestin from Coriolus versicolor Extract on Nitrite and Malondialdehyde Concencentrations of Mus musculus Serum Exposed by Mycobacterium tuberculosis

Directory of Open Access Journals (Sweden)

Sri Puji Astuti Wahyuningsih

2016-03-01

Full Text Available Mycobacterium tuberculosis is a major infection agent of tuberculosis that is controlled by the response of cell-mediated immunity. It is macrophages and cytolytic T lymphocytes. Activated macrophages will produce free radicals. Excessive free radicals cause tissue damage. Polysaccharide krestin contains β-glucan. It is a scavenger of free radicals. This research aimed to identify the influence of polysaccharide krestin from C. versicolor on nitrite and malondialdehyde concentrations of mice serum exposed by M. tuberculosis. Nitrite concentration was determined by nitrite assay. Malondialdehyde concentration was determined by TBARS assay. The result showed that adding polysaccharide krestin before exposure (P1 and adding polysaccharide krestin before-after exposure (P3 had the best potential to decrease nitrite concentration. Nitrite concentrations of P1 and P3 were 1.364 ± 0.523 M and 1.456 ± 0.712 M respectively. Meanwhile, P1 group and adding polysaccharide krestin after exposure (P2 had the best potential to decrease malondialdehyde concentration. Malondialdehyde concentrations of P1 and P2 were 1125.86 ± 97.96 µM and 953.86 ± 328.16 µM respectively. Their nitrite and malondialdehyde concentrations decreased, compared to K and K- groups. The research conclusion was that adding polysaccharide krestin before exposure could decrease both nitrite and malondialdehyde concentrations.How to CiteWahyuningsih, S., Pramudya, M., & Sugiharto, S. (2016. Influence of Polysaccharide Krestin from Coriolus versicolor Extract on Nitrite and Malondialdehyde Concencentrations of Mus musculus Serum Exposed by Mycobacterium tuberculosis. Biosaintifika: Journal of Biology & Biology Education, 8(1, 12-17.

Curcumin Is Efective In Improving Folliculogenesis Profile And Oo-cytes Quality In Vitro In Ectopic Endometriosis Mouse (Mus muscu-lus Models

Directory of Open Access Journals (Sweden)

Aulia Firmawati

2018-02-01

Full Text Available Endometriosis is the presence of ectopic endometrial tissue, such as that outside the uter-ine cavity, which can cause chronic inflammatory reactions. Curcumin is one of traditional herbal med-icines that is widely used. Some experiments have managed to find a mechanism to treat an ectopic endometriosis through the mechanism of suppression of several cytokines such as TNF-alpha, NF-kB and COX-2, this study was an experimental laboratory study, with five treatments and six replications, using female mice (Mus musculus that had reached puberty. The study consisted of three phases: the first phase was the microscopic examination of in vitro oocytes quality, and the second was histopatho-logical examination of folliculogenesis profile using Hematoxillin eosin staining, the results of this study showed significant difference between positive control group (P0 with treatment and negative control (KN groups in folliculogenesis profile (p <0.05. Examination of in vitro oocytes quality showed sig-nificant difference between positive control group with treatment group and negative control group (p <0.05. Curcumin has several roles in cytokines modulation in ectopic endometriosis mouse models. Curcumin may reduce the occurrence of apoptosis of granulosa cells so that it may directly improve oocyte quality and folliculogenesis profile, in conclusion, curcumin effectively overcomes fertility prob-lems through the mechanism of cytokines modulation that plays a role in some cases of endometriosis such as: TNF-alpha, NF-kB and COX-2. Curcumin may improve folliculogenesis profile and in vitro oocytes quality.

WOUND HEALING ACTIVITY OF UNGUENTUM DOSAGE FORM OF ETHANOLIC EXTRACTS OF Areca catechu L. NUT IN Mus musculus albinus

Directory of Open Access Journals (Sweden)

Azizah Vonna

2015-10-01

Full Text Available The activity test of ethanol extract of betel nut ointment (Areca catechu L. in wound healing on mice (Mus musculus albinus has been carried out to determine the ability of the ethanol extract of betel nut ointment in wound healing and determine the concentration which was accelerate the wound healing on mice between 2 concentrations. This experimental research method used completely randomized design (CRD using 20 mices divided into 4 treatment groups ; ointment base, povidone iodine ointment, ethanol extract of betel nut ointment (SEEBP 2% and SEEBP 4%. Each treatment groups was tested in the incision which was made along the 15 mm parallel to the spine (Os. Vetebre with the depth until subcutaneous skin layers. The ointment was applied twice a day for about 21 days and observed changes every day for during the period of observation. The results showed that the average length of time of the scab formation, the scab exfoliation, and the wound healing successively are for the ointment base was 6.6; 10.2 and 18.2 days, povidone iodine ointment was 7; 11.2 and 14.8 days, SEEBP 2% was 5.75; 7.75 and 13.25 days, SEEBP 4% was 4.2; 8.8 and 12.8 days. ANOVA and LSD results of scab formation time showed a significant difference between SEEBP 4% with base ointment and povidone iodine ointment (p <0.05. Results of the exfoliation scab showed a significance difference between SEEBP 2% with base ointment and povidone iodine ointment (p <0.05. The duration of wound healing showed that there was significance difference between SEEBP 2%, SEBP 4% and povidone iodine ointment with ointment base  (p<0.05.Thus, betel nut ointment as an effect on healing process. The concentration which can accelerate wound healing in mice is SEEBP 4%.

Seasonal and Diel Vocalization Patterns of Antarctic Blue Whale (Balaenoptera musculus intermedia in the Southern Indian Ocean: A Multi-Year and Multi-Site Study.

Directory of Open Access Journals (Sweden)

Emmanuelle C Leroy

Full Text Available Passive acoustic monitoring is an efficient way to provide insights on the ecology of large whales. This approach allows for long-term and species-specific monitoring over large areas. In this study, we examined six years (2010 to 2015 of continuous acoustic recordings at up to seven different locations in the Central and Southern Indian Basin to assess the peak periods of presence, seasonality and migration movements of Antarctic blue whales (Balaenoptera musculus intermedia. An automated method is used to detect the Antarctic blue whale stereotyped call, known as Z-call. Detection results are analyzed in terms of distribution, seasonal presence and diel pattern of emission at each site. Z-calls are detected year-round at each site, except for one located in the equatorial Indian Ocean, and display highly seasonal distribution. This seasonality is stable across years for every site, but varies between sites. Z-calls are mainly detected during autumn and spring at the subantarctic locations, suggesting that these sites are on the Antarctic blue whale migration routes, and mostly during winter at the subtropical sites. In addition to these seasonal trends, there is a significant diel pattern in Z-call emission, with more Z-calls in daytime than in nighttime. This diel pattern may be related to the blue whale feeding ecology.

THE ELIMINATION OF FOREIGN PARTICLES INJECTED INTO THE ...

African Journals Online (AJOL)

... particulate matter injected into holothurians has received more attention ... ground, phase-contrast illumination in order to show up individual particles of ... Individuals of C. stephensoni, varying between 10·0 and 13·5 cm in length ..... M. Spencer, undertook repeat experiments on the effect of Thorotrast on the coelomocyte.

Maternal-foetal genomic conflict and speciation: no evidence for hybrid placental dysplasia in crosses between two house mouse subspecies

Czech Academy of Sciences Publication Activity Database

Kropáčková, L.; Piálek, Jaroslav; Gergelits, Václav; Forejt, Jiří; Reifová, R.

2015-01-01

Roč. 28, č. 3 (2015), s. 688-698 ISSN 1010-061X R&D Projects: GA ČR GA13-08078S Institutional support: RVO:68081766 ; RVO:68378050 Keywords : hybrid placental dysplasia * genomic conflicts * speciation * X chromosome * house mouse * Mus musculus musculus * Mus musculus domesticus Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 2.747, year: 2015

The mouse hybrid zone in Central Europe: from morphology to molecules

Czech Academy of Sciences Publication Activity Database

Ďureje, Ľudovít; Macholán, Miloš; Baird, Stuart J. E.; Piálek, Jaroslav

2012-01-01

Roč. 61, 3-4 (2012), s. 308-318 ISSN 0139-7893 R&D Projects: GA ČR GA206/08/0640 Institutional support: RVO:68081766 ; RVO:67985904 Keywords : geography * introgression * mtDNA * Mus musculus musculus * Mus musculus domesticus * X chromosome * Y chromosome Subject RIV: EG - Zoology; EB - Genetics ; Molecular Biology (UZFG-Y) Impact factor: 0.494, year: 2012

Is water really a barrier for the house mouse? A comparative study of two mouse subspecies

Czech Academy of Sciences Publication Activity Database

Hiadlovská, Zuzana; Strnadová, Markéta; Macholán, Miloš; Vošlajerová Bímová, Barbora

2012-01-01

Roč. 61, 3-4 (2012), s. 319-329 ISSN 0139-7893 R&D Projects: GA ČR GA206/08/0640; GA ČR GAP506/11/1792 Institutional support: RVO:68081766 ; RVO:67985904 Keywords : dispersal * Mus musculus domesticus * Mus musculus musculus * swimming * water barrier Subject RIV: EG - Zoology; EB - Genetics ; Molecular Biology (UZFG-Y) Impact factor: 0.494, year: 2012

Migratory movements of pygmy blue whales (Balaenoptera musculus brevicauda between Australia and Indonesia as revealed by satellite telemetry.

Directory of Open Access Journals (Sweden)

Michael C Double

Full Text Available In Australian waters during the austral summer, pygmy blue whales (Balaenoptera musculus brevicauda occur predictably in two distinct feeding areas off western and southern Australia. As with other blue whale subspecies, outside the austral summer their distribution and movements are poorly understood. In order to describe the migratory movements of these whales, we present the satellite telemetry derived movements of eleven individuals tagged off western Australia over two years. Whales were tracked from between 8 and 308 days covering an average distance of 3,009±892 km (mean ± se; range: 832 km-14,101 km at a rate of 21.94±0.74 km per day (0.09 km-455.80 km/day. Whales were tagged during March and April and ultimately migrated northwards post tag deployment with the exception of a single animal which remained in the vicinity of the Perth Canyon/Naturaliste Plateau for its eight day tracking period. The tagged whales travelled relatively near to the Australian coastline (100.0±1.7 km until reaching a prominent peninsula in the north-west of the state of Western Australia (North West Cape after which they travelled offshore (238.0±13.9 km. Whales reached the northern terminus of their migration and potential breeding grounds in Indonesian waters by June. One satellite tag relayed intermittent information to describe aspects of the southern migration from Indonesia with the animal departing around September to arrive in the subtropical frontal zone, south of western Australia in December. Throughout their migratory range, these whales are exposed to impacts associated with industry, fishing and vessel traffic. These movements therefore provide a valuable tool to industry when assessing potential interactions with pygmy blue whales and should be considered by conservation managers and regulators when mitigating impacts of development. This is particularly relevant for this species as it continues to recover from past exploitation.

NCBI nr-aa BLAST: CBRC-MMUS-06-0131 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-MMUS-06-0131 ref|NP_444459.1| vomeronasal 1 receptor, B8 [Mus musculus] sp|Q9EQ45|VN1B8_MOUSE Vomeronas...al type-1 receptor B8 (Vomeronasal type-1 receptor A13) gb|AAG42088.1|AF291494_1 vomeronasa...l receptor V1RB8 [Mus musculus] dbj|BAB79220.1| vomeronasal receptor 1 A13 [Mus musculus] gb|AAI40252.1| Vomeronasa...l 1 receptor, B8 [synthetic construct] gb|EDK99274.1| vomeronasal ...1 receptor, B8 [Mus musculus] gb|AAI46525.1| Vomeronasal 1 receptor, B8 [synthetic construct] NP_444459.1 1e-175 100% ...

Gene : CBRC-MMUS-06-0060 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-MMUS-06-0060 6 A Pheromone receptors V1A16_RAT 2e-54 41% ref|NP_598937.1| vomeronasa...l 1 receptor, C21 [Mus musculus] gb|AAL47882.1| vomeronasal receptor V1RC21 [Mus musculus] gb|AAI32387.1| Vomeronasa...-length enriched library, clone:C230065D10 product:similar to VOMERONASAL RECEPTOR V1RC3 [Mus musculus], ful

Transgressive segregation in a behavioural trait? Explorative strategies in two house mouse subspecies and their hybrids

Czech Academy of Sciences Publication Activity Database

Hiadlovská, Zuzana; Vošlajerová Bímová, Barbora; Mikula, Ondřej; Piálek, Jaroslav; Macholán, Miloš

2013-01-01

Roč. 108, č. 1 (2013), s. 225-235 ISSN 0024-4066 R&D Projects: GA ČR GA206/08/0640; GA ČR GAP506/11/1792; GA AV ČR KJB600930701 Institutional support: RVO:68081766 ; RVO:67985904 Keywords : dispersion * exploration * hybridization * Mus musculus domesticus * Mus musculus musculus * open field test Subject RIV: EG - Zoology; EB - Genetics ; Molecular Biology (UZFG-Y) Impact factor: 2.535, year: 2013

Determination of muscle microcirculation of the limbs of healthy persons and patients with scleroderma by means of /sup 133/Xe clearance. 1. Examination of patients with healthy vessels

Energy Technology Data Exchange (ETDEWEB)

Wiemers, U.; Poenitzsch, I.; Schneider, G. (Karl-Marx-Universitaet, Leipzig (German Democratic Republic). Radiologische Klinik)

1984-01-01

By means of /sup 133/Xe muscle clearance the blood flow of the musculus tibialis anterior and the musculus opponens pollicis was determined during nonischemic work and also after 3 minutes ischemia in 53 patients with healthy vessels. Additionally /sup 133/Xe muscle clearance of the musculus opponens pollicis after influence of heat, cold as well as arterial flow reduction. The flow values after ischemia were higher than during nonischemic work. In relation to the functional test the reactive hyperemia after 3 minutes ischemia proved to be more favorable in realization and standardization. In persons under the age of 30 little increased flow values of the musculus tibialis anterior compared to persons over 30 were determined.

Determination of muscle microcirculation of the limbs of healthy persons and patients with scleroderma by means of 133Xe clearance. 1

International Nuclear Information System (INIS)

Wiemers, U.; Poenitzsch, I.; Schneider, G.

1984-01-01

By means of 133 Xe muscle clearance the blood flow of the musculus tibialis anterior and the musculus opponens pollicis was determined during nonischemic work and also after 3 minutes ischemia in 53 patients with healthy vessels. Additionally 133 Xe muscle clearance of the musculus opponens pollicis after influence of heat, cold as well as arterial flow reduction. The flow values after ischemia were higher than during nonischemic work. In relation to the functional test the reactive hyperemia after 3 minutes ischemia proved to be more favorable in realization and standardization. In persons under the age of 30 little increased flow values of the musculus tibialis anterior compared to persons over 30 were determined. (author)

Genetic structure and invasion history of the house mouse (Mus musculus domesticus) in Senegal, West Africa: a legacy of colonial and contemporary times.

Science.gov (United States)

Lippens, C; Estoup, A; Hima, M K; Loiseau, A; Tatard, C; Dalecky, A; Bâ, K; Kane, M; Diallo, M; Sow, A; Niang, Y; Piry, S; Berthier, K; Leblois, R; Duplantier, J-M; Brouat, C

2017-08-01

Knowledge of the genetic make-up and demographic history of invasive populations is critical to understand invasion mechanisms. Commensal rodents are ideal models to study whether complex invasion histories are typical of introductions involving human activities. The house mouse Mus musculus domesticus is a major invasive synanthropic rodent originating from South-West Asia. It has been largely studied in Europe and on several remote islands, but the genetic structure and invasion history of this taxon have been little investigated in several continental areas, including West Africa. In this study, we focussed on invasive populations of M. m. domesticus in Senegal. In this focal area for European settlers, the distribution area and invasion spread of the house mouse is documented by decades of data on commensal rodent communities. Genetic variation at one mitochondrial locus and 16 nuclear microsatellite markers was analysed from individuals sampled in 36 sites distributed across the country. A combination of phylogeographic and population genetics methods showed that there was a single introduction event on the northern coast of Senegal, from an exogenous (probably West European) source, followed by a secondary introduction from northern Senegal into a coastal site further south. The geographic locations of these introduction sites were consistent with the colonial history of Senegal. Overall, the marked microsatellite genetic structure observed in Senegal, even between sites located close together, revealed a complex interplay of different demographic processes occurring during house mouse spatial expansion, including sequential founder effects and stratified dispersal due to human transport along major roads.

Genetic conflict outweighs heterogametic incompatibility in the mouse hybrid zone?

Directory of Open Access Journals (Sweden)

Dufková Petra

2008-10-01

Full Text Available Abstract Background The Mus musculus musculus/M. m. domesticus contact zone in Europe is characterised by sharp frequency discontinuities for sex chromosome markers at the centre of wider clines in allozyme frequencies. Results We identify a triangular area (approximately 330 km2 where the musculus Y chromosome introgresses across this front for up to 22 km into domesticus territory. Introgression of the Y chromosome is accompanied by a perturbation of the census sex ratio: the sex ratio is significantly female biased in musculus localities and domesticus localities lacking Y chromosome introgression. In contrast, where the musculus Y is detected in domesticus localities, the sex ratio is close to parity, and significantly different from both classes of female biased localities. The geographic position of an abrupt cline in an X chromosome marker, and autosomal clines centred on the same position, seem unaffected by the musculus Y introgression. Conclusion We conclude that sex ratio distortion is playing a role in the geographic separation of speciation genes in this section of the mouse hybrid zone. We suggest that clines for genes involved in sex-ratio distortion have escaped from the centre of the mouse hybrid zone, causing a decay in the barrier to gene flow between the two house mouse taxa.

Holothurian (Echinodermata) Diversity in the Glorieuses Archipelago

African Journals Online (AJOL)

Keywords: Holothuria, Glorieuses Islands, Western Indian Ocean, occurrence, diversity, coral reefs. Abstract—Due to their isolation, ... the Mozambique Channel (Western Indian Ocean). Inventories of several taxa, including the ... associated sandbars that emerge at low tide, complete the archipelago, with a land surface.

Elemental composition of commercial sea cucumbers (holothurians).

Science.gov (United States)

Wen, J; Hu, C

2010-01-01

Toxic and essential elements in 11 different sea cucumber species were determined and compared with daily intake recommendations and maximum allowed levels. The contents of macro-elements contents in dried sea cucumber samples were found to be 25,000-152,000 mg kg(-1) for Na, 4000-8600 mg kg(-1) for Mg, 1100-5200 mg kg(-1) for K, 15,000-68,000 mg kg(-1) and 36,300-251,000 mg kg(-1) for Cl. Trace element concentrations in dried sea cucumber samples were found to be 11-100 mg kg(-1) for Zn, 41-660 mg kg(-1) for Fe, 3-74 mg kg(-1) for Cu, 1.1-16 mg kg(-1) for Mn, 1.4-3.7 mg kg(-1) for Se, 1.1-9.6 mg kg(-1) for Cr, and 0.3-5.1 mg kg(-1) for Ni. All sea cucumber species were rich sources of Na, Cl, Mg, Ca, Fe, Cu, Se and Cr for human consumption. Regarding contaminants, As, Cd and Pb concentrations in dried sea cucumbers were in the ranges of 1.1-6.1, 0.03-0.06 and 0.11-0.69 mg kg(-1), respectively. Moreover, Hg values of 11 sea cucumbers were below the detection limit (0.01 mg kg(-1)).

The regeneration of thermal wound on mice skin (Mus Musculus) after Q-Switch Nd: YAG laser irradiation for cancer therapy candidate

Science.gov (United States)

Apsari, R.; Nahdliyatun, E.; Winarni, D.

2017-09-01

The aims of this study are to investigate the regeneration of mice skin tissue (Mus Musculus) irradiated by Q-Switch Nd: YAG laser and morphological change due to Q-Switch Nd: YAG laser irradiation compared to conventional heating (hairdryer). The 2-3 month of twenty-seven mice were used for experimental animals. Mice were incised in the dorsum by the damage effect of laser energy dose (therapeutic dose) of 29.5 J/cm2 with 10 seconds of exposure time, 10 Hz of repetition rate, and 100 pulses of the given single pulse energy. The mice skin tissue was injuried by hairdryer to get burned effect. Mice were divided into three groups, Group I (control) were not treated by anything, Group II were treated by Q-Switch Nd: YAG laser irradiation and sacrificed on (0, 1, 3, 5) days, and Group III were treated by hairdryer then sacrificed on (0, 1, 3, 5) days. Pathology examination showed that the energy of 29,5 J/cm2 dose produced the hole effect (ablation) through the hypodermic layer caused by optical breakdown and collagen coagulation. Thus, the 60 °C temperature of burn showed coagulation necrosis because piknosis discovered in the injured area. The regeneration process showed that the mice skin tissue's ability to regenerate was irradiated by fast laser because of the focus of Q-Switch Nd: YAG laser. It was showed by the scab releases on third day and completely reepithelialization formation on the fifth day. The collagen fibers distribution was same as normal skin tissue on day 5 and so did angiogenesis. Therefore, Q-Switch Nd: YAG laser can be applied for problems of dermatology medical therapies, especially melasma, nevus of ota and tatto therapy. For skin cancer therapy application, energy dose of unregenerated skin tissue is chosen because the death expected effect is permanent.

Food habits of introduced rodents in high-elevation shrubland of Haleakala National Park, Maui, Hawai'i

Science.gov (United States)

Cole, F. Russell; Loope, Lloyd L.; Medeiros, Arthur C.; Howe, Cameron E.; Anderson, Laurel J.

2000-01-01

Mus musculus and Rattus rattus are ubiquitous consumers in the high-elevation shrubland of Haleakala National Park. Food habits of these two rodent species were determined from stomach samples obtained by snaptrapping along transects located at four different elevations during November 1984 and February, May, and August 1985. Mus musculus fed primarily on fruits, grass seeds, and arthropods. Rattus rattus ate various fruits, dicot leaves, and arthropods. Arthropods, many of which are endemic, were taken frequently by Mus musculus throughout the year at the highest elevation where plant food resources were scarce. Araneida, Lepidoptera (primarily larvae), Coleoptera, and Homoptera were the main arthropod taxa taken. These rodents, particularly Mus musculus, exert strong predation pressure on populations of arthropod species, including locally endemic species on upper Haleakala Volcano.

NCBI nr-aa BLAST: CBRC-MMUS-06-0014 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-MMUS-06-0014 ref|NP_031564.1| opsin 1 (cone pigments), short-wave-sensitive (color blind... pigment gb|AAB53320.1| blue cone pigment [Mus musculus] gb|AAH26021.1| Opsin 1 (cone pigments), short-wave-sensitive (color blind...ness, tritan) [Mus musculus] gb|AAH58267.1| Opsin 1 (cone pigments), short-wave-sensitive (color blind...s), short-wave-sensitive (color blindness, tritan), isoform CRA_a [Mus musculus] NP_031564.1 0.0 100% ...

NCBI nr-aa BLAST: CBRC-BTAU-01-2837 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-BTAU-01-2837 ref|NP_031564.1| opsin 1 (cone pigments), short-wave-sensitive (color blindness... pigment gb|AAB53320.1| blue cone pigment [Mus musculus] gb|AAH26021.1| Opsin 1 (cone pigments), short-wave-sensitive (color blindnes...s, tritan) [Mus musculus] gb|AAH58267.1| Opsin 1 (cone pigments), short-wave-sensitive (color blindness...s), short-wave-sensitive (color blindness, tritan), isoform CRA_a [Mus musculus] NP_031564.1 0.0 86% ...

NCBI nr-aa BLAST: CBRC-OGAR-01-1096 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-OGAR-01-1096 ref|NP_031564.1| opsin 1 (cone pigments), short-wave-sensitive (color blindness... pigment gb|AAB53320.1| blue cone pigment [Mus musculus] gb|AAH26021.1| Opsin 1 (cone pigments), short-wave-sensitive (color blindnes...s, tritan) [Mus musculus] gb|AAH58267.1| Opsin 1 (cone pigments), short-wave-sensitive (color blindness...s), short-wave-sensitive (color blindness, tritan), isoform CRA_a [Mus musculus] NP_031564.1 1e-105 63% ...

NCBI nr-aa BLAST: CBRC-LAFR-01-3136 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-LAFR-01-3136 ref|NP_031564.1| opsin 1 (cone pigments), short-wave-sensitive (color blindness... pigment gb|AAB53320.1| blue cone pigment [Mus musculus] gb|AAH26021.1| Opsin 1 (cone pigments), short-wave-sensitive (color blindnes...s, tritan) [Mus musculus] gb|AAH58267.1| Opsin 1 (cone pigments), short-wave-sensitive (color blindness...s), short-wave-sensitive (color blindness, tritan), isoform CRA_a [Mus musculus] NP_031564.1 1e-152 85% ...

NCBI nr-aa BLAST: CBRC-RNOR-04-0072 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-RNOR-04-0072 ref|NP_031564.1| opsin 1 (cone pigments), short-wave-sensitive (color blindness... pigment gb|AAB53320.1| blue cone pigment [Mus musculus] gb|AAH26021.1| Opsin 1 (cone pigments), short-wave-sensitive (color blindnes...s, tritan) [Mus musculus] gb|AAH58267.1| Opsin 1 (cone pigments), short-wave-sensitive (color blindness...s), short-wave-sensitive (color blindness, tritan), isoform CRA_a [Mus musculus] NP_031564.1 0.0 95% ...

NCBI nr-aa BLAST: CBRC-CPOR-01-1188 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-CPOR-01-1188 ref|NP_031564.1| opsin 1 (cone pigments), short-wave-sensitive (color blindness... pigment gb|AAB53320.1| blue cone pigment [Mus musculus] gb|AAH26021.1| Opsin 1 (cone pigments), short-wave-sensitive (color blindnes...s, tritan) [Mus musculus] gb|AAH58267.1| Opsin 1 (cone pigments), short-wave-sensitive (color blindness...s), short-wave-sensitive (color blindness, tritan), isoform CRA_a [Mus musculus] NP_031564.1 1e-151 75% ...

The Effect of Calcusol™ to the Plasma Free Radical and Serum Creatinin in Mus Musculus Nephrolithiasis Model

Directory of Open Access Journals (Sweden)

A’liyatur Rosyidah

2013-09-01

Full Text Available Calcusol™ is a traditional medicine (jamu made from Tempuyung (Sonchus arvensis extract and is usually used for cure kidney stone disease. However, there has not been any studies which investigate the its mechanism. The aim of this study is to know the effect of Calcusol™ to the plasma free radical and serum creatinin of Mus musculus model for renal calcium-oxalate accumulation. This study is carried out by administration of Porang (Amorphophallus muelleri tuber flour for 3 months with the doses 6 mg/100g BW to induce renal calcium oxalate accumulation and Calcusol™ treatment for 7 days with the doses of 3.3mg/g BW. Group I was used as a control group. Group II was only given porang every day for 3 months. Group III was only given Calcusol™ for 7 days. Group IV were given porang for 3 months then given Calcusol™ for 7 days. Group V were given porang and Calcusol™ simultaneously for 3 months. Porang and CalcusolTM is administrated orally. Blood was collected from the tail of the animal for serum creatinin test and plasma free radical test using TBARS method. The data was analyzed using ANOVA followed by Tukey HSD to compare the means employing SPSS 16.0 for windows. The result of the research shows that the treatment Calcusol™ on mice model for renal calcium oxalate accumulation. The content of MDA at group I, group II, group III, group IV and group V, respectivelyis 0.81±0.5 mg/ml; 2.63±0.8 mg/ml; 0.56±0.5 mg/ml; 2.09±0.9 mg/ml and 0.17±0.17 mg/ml. The content of serum creatinine are 0.15±0.04 mg/dL; 0.13±0.03 mg/dL; 0.12±0.08 mg/dL; 0.11±0.016 mg/dL and 0.14±0.015 mg/dL at group I, group II, group III, Group IV, and group V respectively. This indicates that Calcusol™ decreases plasma free radical production during renal stone formation, while serum creatinin reduced but not significantly changed. Calcusol™ has an effect to decrease free radical during renalstone formation inmice model for calcium oxalate accumulation

Genetic conflict outweighs heterogametic incompatibility in the mouse hybrid zone?

Czech Academy of Sciences Publication Activity Database

Macholán, Miloš; Baird, S. J. E.; Munclinger, P.; Dufková, Petra; Bímová, Barbora; Piálek, Jaroslav

2008-01-01

Roč. 8, - (2008), s. 271-284 ISSN 1471-2148 R&D Projects: GA ČR GA206/06/0707; GA ČR GA206/06/0955; GA AV ČR IAA600930506; GA ČR GA206/08/0640 Grant - others:GA ČR(CZ) GP206/03/D148 Institutional research plan: CEZ:AV0Z50450515; CEZ:AV0Z60930519 Keywords : Mus musculus musculus * Mus musculus domesticus Subject RIV: EG - Zoology Impact factor: 4.050, year: 2008

NCBI nr-aa BLAST: CBRC-RNOR-04-0256 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-RNOR-04-0256 ref|NP_444458.1| vomeronasal 1 receptor, B7 [Mus musculus] sp|Q9EQ46|VN1B7_MOUSE Vomeronas...al type-1 receptor B7 (Vomeronasal type-1 receptor A11) gb|AAG42087.1|AF291493_1 vomeronasa...l receptor V1RB7 [Mus musculus] dbj|BAB79217.1| vomeronasal receptor 1 A11 [Mus musculus] gb|AAI41627.1| Vomeronasa...l 1 receptor, B7 [synthetic construct] gb|AAI40251.1| Vomeronasal

NCBI nr-aa BLAST: CBRC-RNOR-04-0238 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-RNOR-04-0238 ref|NP_444458.1| vomeronasal 1 receptor, B7 [Mus musculus] sp|Q9EQ46|VN1B7_MOUSE Vomeronas...al type-1 receptor B7 (Vomeronasal type-1 receptor A11) gb|AAG42087.1|AF291493_1 vomeronasa...l receptor V1RB7 [Mus musculus] dbj|BAB79217.1| vomeronasal receptor 1 A11 [Mus musculus] gb|AAI41627.1| Vomeronasa...l 1 receptor, B7 [synthetic construct] gb|AAI40251.1| Vomeronasal

NCBI nr-aa BLAST: CBRC-MMUS-06-0122 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-MMUS-06-0122 ref|NP_444458.1| vomeronasal 1 receptor, B7 [Mus musculus] sp|Q9EQ46|VN1B7_MOUSE Vomeronas...al type-1 receptor B7 (Vomeronasal type-1 receptor A11) gb|AAG42087.1|AF291493_1 vomeronasa...l receptor V1RB7 [Mus musculus] dbj|BAB79217.1| vomeronasal receptor 1 A11 [Mus musculus] gb|AAI41627.1| Vomeronasa...l 1 receptor, B7 [synthetic construct] gb|AAI40251.1| Vomeronasal

NCBI nr-aa BLAST: CBRC-OCUN-01-1141 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-OCUN-01-1141 ref|NP_444458.1| vomeronasal 1 receptor, B7 [Mus musculus] sp|Q9EQ46|VN1B7_MOUSE Vomeronas...al type-1 receptor B7 (Vomeronasal type-1 receptor A11) gb|AAG42087.1|AF291493_1 vomeronasa...l receptor V1RB7 [Mus musculus] dbj|BAB79217.1| vomeronasal receptor 1 A11 [Mus musculus] gb|AAI41627.1| Vomeronasa...l 1 receptor, B7 [synthetic construct] gb|AAI40251.1| Vomeronasal

NCBI nr-aa BLAST: CBRC-MMUS-06-0135 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-MMUS-06-0135 ref|NP_444458.1| vomeronasal 1 receptor, B7 [Mus musculus] sp|Q9EQ46|VN1B7_MOUSE Vomeronas...al type-1 receptor B7 (Vomeronasal type-1 receptor A11) gb|AAG42087.1|AF291493_1 vomeronasa...l receptor V1RB7 [Mus musculus] dbj|BAB79217.1| vomeronasal receptor 1 A11 [Mus musculus] gb|AAI41627.1| Vomeronasa...l 1 receptor, B7 [synthetic construct] gb|AAI40251.1| Vomeronasal

NCBI nr-aa BLAST: CBRC-RNOR-04-0259 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-RNOR-04-0259 ref|NP_444458.1| vomeronasal 1 receptor, B7 [Mus musculus] sp|Q9EQ46|VN1B7_MOUSE Vomeronas...al type-1 receptor B7 (Vomeronasal type-1 receptor A11) gb|AAG42087.1|AF291493_1 vomeronasa...l receptor V1RB7 [Mus musculus] dbj|BAB79217.1| vomeronasal receptor 1 A11 [Mus musculus] gb|AAI41627.1| Vomeronasa...l 1 receptor, B7 [synthetic construct] gb|AAI40251.1| Vomeronasal

Preliminary Study On Gonad Maturity Stages of the Sea Cucumber Paracaudina australis from Kenjeran Water, Surabaya, Indonesia

Science.gov (United States)

Widianingsih, Widianingsih; Zaenuri, Muhammad; Anggoro, Sutrisno; Pancasakti Kusumaningrum, Hermin; Hartati, Retno

2018-02-01

The holothurian Paracaudina australis is belong to family Caudinidae, ordo Molpadida and class Holothuroidea. This species is among the most common holothurian widely distributed in the tropical water. The purpose of this reseach is to do preliminary study on maturity stages of sea cucumber Paracaudina australis from Kenjeran Water, Surabaya, Indonesia. This research was conducted on April 2016. Samples were collected randomly on the Kenjeran Water, Surabaya. The result showed that there are five stages of gonad maturity. At the stage of maturity 1, the gonad was not clearly distinguished, there were unbranched small tubule. At the stage of maturity 2, there were small branched of tubules. At this stage, gonad can be differentiated between male and female. At the stage of maturity 3, tubule can been branched not only for male but also female. At the stage of maturity 4, the gonad was good mature, there were clearly branched tubule. At the stage of matury 5, there were generally had empty tubule except for a few relict unreleased spermatozoa. At female gonad, there were shrunken tubule and relict oocytes were presented in the lumen of the tubule.

ORF Alignment: NC_003103 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available s] ref|NP_766317.1| caspase recruitment domain 4 ... [Mus musculus] gb|AAH42670.1| Caspase recruitment... domain ... 4 [Mus musculus] sp|Q8BHB0|CARD4_MOUSE Caspase ... recruitment domain protein 4 d

NCBI nr-aa BLAST: CBRC-STRI-01-1973 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-STRI-01-1973 ref|NP_444458.1| vomeronasal 1 receptor, B7 [Mus musculus] sp|Q9E...Q46|VN1B7_MOUSE RecName: Full=Vomeronasal type-1 receptor B7; AltName: Full=Vomeronasal type-1 receptor A11 ...gb|AAG42087.1|AF291493_1 vomeronasal receptor V1RB7 [Mus musculus] dbj|BAB79217.1| vomeronasal receptor 1 A1...1 [Mus musculus] gb|AAI41627.1| Vomeronasal 1 receptor, B7 [synthetic construct] gb|AAI40251.1| Vomeronasa

NCBI nr-aa BLAST: CBRC-STRI-01-1277 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-STRI-01-1277 ref|NP_444448.1| vomeronasal 1 receptor, A3 [Mus musculus] sp|Q9E...Q52|VN1A3_MOUSE RecName: Full=Vomeronasal type-1 receptor A3; AltName: Full=Vomeronasal type-1 receptor A6 g...b|AAG42076.1|AF291482_1 vomeronasal receptor V1RA3 [Mus musculus] dbj|BAB79212.1| vomeronasal receptor 1 A6 ...[Mus musculus] gb|AAI41612.1| Vomeronasal 1 receptor, A3 [synthetic construct] gb|AAI40226.1| Vomeronasa

NCBI nr-aa BLAST: CBRC-STRI-01-2495 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-STRI-01-2495 ref|NP_444448.1| vomeronasal 1 receptor, A3 [Mus musculus] sp|Q9E...Q52|VN1A3_MOUSE RecName: Full=Vomeronasal type-1 receptor A3; AltName: Full=Vomeronasal type-1 receptor A6 g...b|AAG42076.1|AF291482_1 vomeronasal receptor V1RA3 [Mus musculus] dbj|BAB79212.1| vomeronasal receptor 1 A6 ...[Mus musculus] gb|AAI41612.1| Vomeronasal 1 receptor, A3 [synthetic construct] gb|AAI40226.1| Vomeronasa

NCBI nr-aa BLAST: CBRC-STRI-01-2240 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-STRI-01-2240 ref|NP_444448.1| vomeronasal 1 receptor, A3 [Mus musculus] sp|Q9E...Q52|VN1A3_MOUSE RecName: Full=Vomeronasal type-1 receptor A3; AltName: Full=Vomeronasal type-1 receptor A6 g...b|AAG42076.1|AF291482_1 vomeronasal receptor V1RA3 [Mus musculus] dbj|BAB79212.1| vomeronasal receptor 1 A6 ...[Mus musculus] gb|AAI41612.1| Vomeronasal 1 receptor, A3 [synthetic construct] gb|AAI40226.1| Vomeronasa

NCBI nr-aa BLAST: CBRC-STRI-01-2627 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-STRI-01-2627 ref|NP_444448.1| vomeronasal 1 receptor, A3 [Mus musculus] sp|Q9E...Q52|VN1A3_MOUSE RecName: Full=Vomeronasal type-1 receptor A3; AltName: Full=Vomeronasal type-1 receptor A6 g...b|AAG42076.1|AF291482_1 vomeronasal receptor V1RA3 [Mus musculus] dbj|BAB79212.1| vomeronasal receptor 1 A6 ...[Mus musculus] gb|AAI41612.1| Vomeronasal 1 receptor, A3 [synthetic construct] gb|AAI40226.1| Vomeronasa

Effect of bovine pellucid zone 3 monoclonal antibodies on B cell lymphoma 2 expressions of granulosa cell and mice (Mus musculus follicle diameter

Directory of Open Access Journals (Sweden)

Heti Ira Ayue

2017-01-01

Full Text Available Objective: To evaluate the effects of pellucid zone 3 monoclonal antibodies against B-cell lymphoma 2 (BCL-2 expression and mice follicle diameter at various time periods.Methods: The animal model of this study was 36 Balb/c mice (Mus musculus. A true experimental design was used with a post-test only control group approach. BCL-2 expression was observed using immunohistochemistry, while the follicle diameter was observed by haematoxylin-eosin staining. The data was analyzed using nested ANOVA to compare the results of the mean expression of BCL-2 on the 5th and 20th day of observation in the pre-antral and antral follicle between the control and treatment groups.Results: No significant differences were found in BCL-2 gene expression. There were also no significant differences in BCL-2 expression on the 10th day of pre-antral follicle analysis. Moreover, there were no significant differences between the mean follicle diameter on the 5th, 10th, and 20th day of pre-antral and antral follicle development between the control and treatment groups. The addition of bovine pellucid zone 3 (bZP3 monoclonal antibodies on the 5th and 20th day of observation did not decrease the expression of BCL-2 gene in the pre-antral and antral follicle of mice. Administering bZP3 monoclonal antibodies on the 10th day of observation did not affect BCL-2 expression in the pre-antral follicle but did decrease BCL-2 expression in the antral follicle. Supplying bZP3 monoclonal antibodies on the 5th, 10th and 20th day did not affect the diameter of pre-antral and antral follicles of the mice.Conclusion: The monoclonal antibodies bovine zona pelusida 3 has the potential to be developed as a safe immunocontraception preparation.

NCBI nr-aa BLAST: CBRC-TNIG-03-0019 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-TNIG-03-0019 ref|NP_059087.2| solute carrier family 5 (inositol transporters),... member 3 [Mus musculus] gb|EDL03793.1| solute carrier family 5 (inositol transporters), member 3 [Mus musculus] NP_059087.2 1e-113 51% ...

Effects of neuromuscular joint facilitation on bridging exercises with respect to deep muscle changes.

Science.gov (United States)

Zhou, Bin; Huang, QiuChen; Zheng, Tao; Huo, Ming; Maruyama, Hitoshi

2015-05-01

[Purpose] This study examined the effects of neuromuscular joint facilitation on bridging exercises by assessing the cross-sectional area of the multifidus muscle and thickness of the musculus transversus abdominis. [Subjects] Twelve healthy men. [Methods] Four exercises were evaluated: (a) supine resting, (b) bridging resistance exercise involving posterior pelvic tilting, (c) bridging resistance exercise involving anterior pelvic tilting, and (d) bridging resistance exercise involving neuromuscular joint facilitation. The cross-sectional area of the multifidus muscle and thickness of the musculus transversus abdominis were measured during each exercise. [Results] The cross-sectional area of the multifidus muscle and thickness of the musculus transversus abdominis were significantly greater in the neuromuscular joint facilitation group than the others. [Conclusion] Neuromuscular joint facilitation intervention improves the function of deep muscles such as the multifidus muscle and musculus transversus abdominis. Therefore, it can be recommended for application in clinical treatments such as that for back pain.

NCBI nr-aa BLAST: CBRC-OCUN-01-0928 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-OCUN-01-0928 ref|NP_444448.1| vomeronasal 1 receptor, A3 [Mus musculus] sp|Q9EQ52|VN1A3_MOUSE Vomeronas...al type-1 receptor A3 (Vomeronasal type-1 receptor A6) gb|AAG42076.1|AF291482_1 vomeronasa...l receptor V1RA3 [Mus musculus] dbj|BAB79212.1| vomeronasal receptor 1 A6 [Mus musculus] gb|AAI41612.1| Vomeronasa...l 1 receptor, A3 [synthetic construct] gb|AAI40226.1| Vomeronasal 1 receptor, A3 [synthetic construct] NP_444448.1 1e-81 52% ...

NCBI nr-aa BLAST: CBRC-OCUN-01-0428 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-OCUN-01-0428 ref|NP_444448.1| vomeronasal 1 receptor, A3 [Mus musculus] sp|Q9EQ52|VN1A3_MOUSE Vomeronas...al type-1 receptor A3 (Vomeronasal type-1 receptor A6) gb|AAG42076.1|AF291482_1 vomeronasa...l receptor V1RA3 [Mus musculus] dbj|BAB79212.1| vomeronasal receptor 1 A6 [Mus musculus] gb|AAI41612.1| Vomeronasa...l 1 receptor, A3 [synthetic construct] gb|AAI40226.1| Vomeronasal 1 receptor, A3 [synthetic construct] NP_444448.1 2e-82 51% ...

NCBI nr-aa BLAST: CBRC-CPOR-01-0933 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-CPOR-01-0933 ref|NP_444448.1| vomeronasal 1 receptor, A3 [Mus musculus] sp|Q9EQ52|VN1A3_MOUSE Vomeronas...al type-1 receptor A3 (Vomeronasal type-1 receptor A6) gb|AAG42076.1|AF291482_1 vomeronasa...l receptor V1RA3 [Mus musculus] dbj|BAB79212.1| vomeronasal receptor 1 A6 [Mus musculus] gb|AAI41612.1| Vomeronasa...l 1 receptor, A3 [synthetic construct] gb|AAI40226.1| Vomeronasal 1 receptor, A3 [synthetic construct] NP_444448.1 7e-78 52% ...

NCBI nr-aa BLAST: CBRC-MMUS-06-0143 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-MMUS-06-0143 ref|NP_444448.1| vomeronasal 1 receptor, A3 [Mus musculus] sp|Q9EQ52|VN1A3_MOUSE Vomeronas...al type-1 receptor A3 (Vomeronasal type-1 receptor A6) gb|AAG42076.1|AF291482_1 vomeronasa...l receptor V1RA3 [Mus musculus] dbj|BAB79212.1| vomeronasal receptor 1 A6 [Mus musculus] gb|AAI41612.1| Vomeronasa...l 1 receptor, A3 [synthetic construct] gb|AAI40226.1| Vomeronasal 1 receptor, A3 [synthetic construct] NP_444448.1 4e-85 55% ...

The contribution of the Y chromosome to hybrid male sterility in house mice.

Science.gov (United States)

Campbell, Polly; Good, Jeffrey M; Dean, Matthew D; Tucker, Priscilla K; Nachman, Michael W

2012-08-01

Hybrid sterility in the heterogametic sex is a common feature of speciation in animals. In house mice, the contribution of the Mus musculus musculus X chromosome to hybrid male sterility is large. It is not known, however, whether F1 male sterility is caused by X-Y or X-autosome incompatibilities or a combination of both. We investigated the contribution of the M. musculus domesticus Y chromosome to hybrid male sterility in a cross between wild-derived strains in which males with a M. m. musculus X chromosome and M. m. domesticus Y chromosome are partially sterile, while males from the reciprocal cross are reproductively normal. We used eight X introgression lines to combine different X chromosome genotypes with different Y chromosomes on an F1 autosomal background, and we measured a suite of male reproductive traits. Reproductive deficits were observed in most F1 males, regardless of Y chromosome genotype. Nonetheless, we found evidence for a negative interaction between the M. m. domesticus Y and an interval on the M. m. musculus X that resulted in abnormal sperm morphology. Therefore, although F1 male sterility appears to be caused mainly by X-autosome incompatibilities, X-Y incompatibilities contribute to some aspects of sterility.

The holothurian (Echinodermata) diversity of the Glorieuses Islands ...

African Journals Online (AJOL)

Glorieuses archipelago is one of the Eparses Islands, French islands scattered in the Mozambique Channel (Western Indian Ocean). ... In November 2012, a multidisciplinary team explored the reef slopes of the island by scuba diving down to 20 meters (10 sites), and the reef flats at low tide (12 sites) collecting specimens ...

A Comparison of mucosal surface area and villous histology in small intestines of the Brazilian free-tailed bat (Tadarida brasiliensis) and the mouse (Mus musculus).

Science.gov (United States)

Zhang, Zhi-Qiang; Brun, Antonio; Price, Edwin R; Cruz-Neto, Ariovaldo P; Karasov, William H; Caviedes-Vidal, Enrique

2015-01-01

Studies on birds have led to the hypothesis that increased intestinal absorption between enterocytes (paracellular) evolved as a compensation for smaller intestinal size in fliers, which was perhaps selected to minimize the mass of digesta carried. This hypothesis predicts that bats will also exhibit relatively reduced intestinal size and high paracellular absorption, compared with nonflying mammals. Published studies on three bat species indicate relatively high paracellular absorption. One mechanism for increasing paracellular absorption per cm2 small intestine (SI) is increased number of tight junctions (TJs) across which paracellular absorption occurs. To our knowledge, we provide the first comparative analysis of enterocyte size and number in flying and nonflying mammals. Intestines of insectivorous bats Tadarida brasiliensis were compared with Mus musculus using hematoxylin and eosin staining method. Bats had shorter and narrower SIs than mice, and after correction for body size difference by normalizing to mass3/4, the bats had 40% less nominal surface area than the mouse, as predicted. Villous enhancement of surface area was 90% greater in the bat than in the mouse, mainly because of longer villi and a greater density of villi in bat intestines. Bat and mouse were similar in enterocyte diameter. Bats exceeded mice by 54.4% in villous area per cm length SI and by 95% in number of enterocytes per cm2 of the nominal surface area of the SI. Therefore, an increased density of TJs per cm2 SI may be a mechanistic explanation that helps to understand the high paracellular absorption observed in bats compared to nonflying mammals. © 2014 Wiley Periodicals, Inc.

NCBI nr-aa BLAST: CBRC-MMUS-02-0385 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-MMUS-02-0385 gb|AAK56078.1|AF332049_1 adrenergic receptor alpha 2B [Mus muscul...us] gb|AAA37131.1| alpha-2 adrenergic receptor gb|EDL28187.1| adrenergic receptor, alpha 2b [Mus musculus] AAK56078.1 0.0 99% ...

Mitochondrial DNA in the hybrid zone between Mus musculus musculus and Mus musculus domesticus: a comparison of two transects

Czech Academy of Sciences Publication Activity Database

Božíková, Eva; Munclinger, P.; Teeter, K. C.; Tucker, P. K.; Macholán, Miloš; Piálek, Jaroslav

2005-01-01

Roč. 84, č. 3 (2005), s. 363-378 ISSN 0024-4066. [The genus Mus as a model for evolutionary studies - a symposium in honour of Louis Thaler. Brno, 28.07.2003-30.07.2003] R&D Projects: GA ČR GA206/03/0205; GA ČR GA206/01/0989 Institutional research plan: CEZ:AV0Z6093917 Keywords : allozyme * gene flow * house mouse Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 2.261, year: 2005

NCBI nr-aa BLAST: CBRC-OLAT-12-0001 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-OLAT-12-0001 gb|AAK56078.1|AF332049_1 adrenergic receptor alpha 2B [Mus muscul...us] gb|AAA37131.1| alpha-2 adrenergic receptor gb|EDL28187.1| adrenergic receptor, alpha 2b [Mus musculus] AAK56078.1 1e-102 49% ...

Genetics and evolution of hybrid male sterility in house mice.

Science.gov (United States)

White, Michael A; Stubbings, Maria; Dumont, Beth L; Payseur, Bret A

2012-07-01

Comparative genetic mapping provides insights into the evolution of the reproductive barriers that separate closely related species. This approach has been used to document the accumulation of reproductive incompatibilities over time, but has only been applied to a few taxa. House mice offer a powerful system to reconstruct the evolution of reproductive isolation between multiple subspecies pairs. However, studies of the primary reproductive barrier in house mice-hybrid male sterility-have been restricted to a single subspecies pair: Mus musculus musculus and Mus musculus domesticus. To provide a more complete characterization of reproductive isolation in house mice, we conducted an F(2) intercross between wild-derived inbred strains from Mus musculus castaneus and M. m. domesticus. We identified autosomal and X-linked QTL associated with a range of hybrid male sterility phenotypes, including testis weight, sperm density, and sperm morphology. The pseudoautosomal region (PAR) was strongly associated with hybrid sterility phenotypes when heterozygous. We compared QTL found in this cross with QTL identified in a previous F(2) intercross between M. m. musculus and M. m. domesticus and found three shared autosomal QTL. Most QTL were not shared, demonstrating that the genetic basis of hybrid male sterility largely differs between these closely related subspecies pairs. These results lay the groundwork for identifying genes responsible for the early stages of speciation in house mice.

Image collection: 83 [Togo Picture Gallery[Archive

Lifescience Database Archive (English)

Full Text Available 83 Balaenoptera_musculus_NL.png シロナガスクジラ Blue Whale Balaenoptera musculus 9771 生物アイコン,脊索動物門,脊椎動物亜門,哺乳綱,獣亜綱,真獣下綱,クジラ目

Tooth Morphogenesis and FGF4 Expression During Development of Molar Tooth in Three Muroid Rodents: Calomyscus elburzensis (Calomyscidae), Mesocricetus auratus (Cricetidae) and Mus musculus (Muridae).

Science.gov (United States)

Hamidi, Kordiyeh; Darvish, Jamshid; Matin, Maryam M; Javanmard, Athar Sadat; Kilpatrick, C William

2017-12-01

To date, no studies have examined the tooth formation during developmental stages of brush-tailed mice (Calomyscidae) and true hamsters (Cricetidae). Herein, we compared the timing of tooth morphogenesis and FGF4 expression pattern during development of the first lower molar in Goodwin's brush-tailed mouse, Calomyscus elburzensis with two other muroid rodents; the house mouse, Mus musculus (Muridae), model organism for tooth morphogenesis, and the golden hamster, Mesocricetus auratus which shares great similarities in cusp pattern with brush-tailed mice. All three species were bred in captivity and developing embryos were isolated at different embryonic days (E). Histological evaluation of lower molars was performed and spatiotemporal pattern of FGF4 expression was determined by immunohistochemistry. Results indicated that morphogenesis of the tooth cusps starts at the beginning of the cap stage of the first lower molar (E14 in house mouse, about E11.5 in golden hamster and E22 in Goodwin's brush-tailed mouse). During the cap to bell stage (E15 in house mouse, E12 in golden hamster and at about E24 in Goodwin's brush-tailed mouse), a decrease in the expression of FGF4 was observed in the mesenchyme, except for the cusp tips. According to our observations, the developmental process of the first lower molar formation in Goodwin's brush-tailed mouse began much later as compared with the other two species. Despite the differences in the temporal pattern of molar development between these three members of the same superfamily (Muroidea), the correlation in the expression of FGF4 with specific stages of tooth morphogenesis supported its regulatory function. Anat Rec, 300:2138-2149, 2017. © 2017 Wiley Periodicals, Inc. © 2017 Wiley Periodicals, Inc.

Sperm morphology in two house mouse subspecies: Do wild-derived strains and wild mice tell the same story?

Czech Academy of Sciences Publication Activity Database

Albrechtová, Jana; Albrecht, Tomáš; Ďureje, Ľudovít; Pallazola, V. A.; Piálek, Jaroslav

2014-01-01

Roč. 9, č. 12 (2014), e115669 E-ISSN 1932-6203 R&D Projects: GA ČR GA206/08/0640 Institutional support: RVO:68081766 Keywords : Mus musculus musculus * hybrid zone * multiple paternity * Passerine birds * Swimming velocity * Central Europe * Competition * Speciation * Common * Size Subject RIV: EG - Zoology Impact factor: 3.234, year: 2014

Biometry by ultrasonography of the epaxial and pelvic musculature in equines trained with Pessoa's rein

Directory of Open Access Journals (Sweden)

Kátia de Oliveira

2014-11-01

Full Text Available This study aimed to evaluate the use of Pessoa's rein in training equine, as a support in exercise training, on biometry by ultrasonography of the epaxial (Longíssimus Dorsi, Gluteus Medius e Musculus Multifidus and pelvic musculature (Biceps Femoris e Semitendinosus. Thereby, eight Quarter Horse mares was used, with eight years on average age, 400kg of body weight, trained with the Pessoa's rein twice a week, for two months. Variables were measured before and after training, consisting of assessment thickness (cm of the Longíssimus Dorsi and cross-sectional area (cm2 of muscles, Gluteus Medius, Biceps Femoris, Semitendinosus and Musculus Multifidus. It observed a significant effect of training with Pessoa's rein, on the Biceps Femoris (P<0.01 and Musculus Multifidus (P<0.01, which the average cross-sectional area at the final evaluation were of 28.66cm2 and 14.29cm2, respectively. Thus it can be conclude that training with Pessoa's rein modifies muscular function, promoting hypertrophy Musculus Multifidus and Biceps Femoris of horses

Identification of an active ID-like group of SINEs in the mouse.

Science.gov (United States)

Kass, David H; Jamison, Nicole

2007-09-01

The mouse genome consists of five known families of SINEs: B1, B2, B4/RSINE, ID, and MIR. Using RT-PCR we identified a germ-line transcript that demonstrates 92.7% sequence identity to ID (excluding primer sequence), yet a BLAST search identified numerous matches of 100% sequence identity. We analyzed four of these elements for their presence in orthologous genes in strains and subspecies of Mus musculus as well as other species of Mus using a PCR-based assay. All four analyzed elements were identified either only in M. musculus or exclusively in both M. musculus and M. domesticus, indicative of recent integrations. In conjunction with the identification of transcripts, we present an active ID-like group of elements that is not derived from the proposed BC1 master gene of ID elements. A BLAST of the rat genome indicated that these elements were not in the rat. Therefore, this family of SINEs has recently evolved, and since it has thus far been observed mainly in M. musculus, we refer to this family as MMIDL.

NCBI nr-aa BLAST: CBRC-STRI-01-2691 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-STRI-01-2691 ref|NP_035814.2| vomeronasal 1 receptor, A2 [Mus musculus] sp|Q8V...IC7|VN1A2_MOUSE RecName: Full=Vomeronasal type-1 receptor A2; Short=mV1R2; AltName: Full=Pheromone receptor ...2; AltName: Full=Vomeronasal type-1 receptor A9 dbj|BAB79214.1| vomeronasal receptor 1 A9 [Mus musculus] gb|AAI41637.1| Vomeronasa...l 1 receptor, A2 [synthetic construct] gb|AAI40265.1| Vomeronasa...l 1 receptor, A2 [synthetic construct] gb|EDK99273.1| vomeronasal 1 receptor, A2 [Mus musculus] NP_035814.2 1e-74 49% ...

NCBI nr-aa BLAST: CBRC-STRI-01-2568 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-STRI-01-2568 ref|NP_035814.2| vomeronasal 1 receptor, A2 [Mus musculus] sp|Q8V...IC7|VN1A2_MOUSE RecName: Full=Vomeronasal type-1 receptor A2; Short=mV1R2; AltName: Full=Pheromone receptor ...2; AltName: Full=Vomeronasal type-1 receptor A9 dbj|BAB79214.1| vomeronasal receptor 1 A9 [Mus musculus] gb|AAI41637.1| Vomeronasa...l 1 receptor, A2 [synthetic construct] gb|AAI40265.1| Vomeronasa...l 1 receptor, A2 [synthetic construct] gb|EDK99273.1| vomeronasal 1 receptor, A2 [Mus musculus] NP_035814.2 5e-49 53% ...

NCBI nr-aa BLAST: CBRC-STRI-01-2291 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-STRI-01-2291 ref|NP_035814.2| vomeronasal 1 receptor, A2 [Mus musculus] sp|Q8V...IC7|VN1A2_MOUSE RecName: Full=Vomeronasal type-1 receptor A2; Short=mV1R2; AltName: Full=Pheromone receptor ...2; AltName: Full=Vomeronasal type-1 receptor A9 dbj|BAB79214.1| vomeronasal receptor 1 A9 [Mus musculus] gb|AAI41637.1| Vomeronasa...l 1 receptor, A2 [synthetic construct] gb|AAI40265.1| Vomeronasa...l 1 receptor, A2 [synthetic construct] gb|EDK99273.1| vomeronasal 1 receptor, A2 [Mus musculus] NP_035814.2 1e-79 50% ...

NCBI nr-aa BLAST: CBRC-STRI-01-0474 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-STRI-01-0474 ref|NP_035814.2| vomeronasal 1 receptor, A2 [Mus musculus] sp|Q8V...IC7|VN1A2_MOUSE RecName: Full=Vomeronasal type-1 receptor A2; Short=mV1R2; AltName: Full=Pheromone receptor ...2; AltName: Full=Vomeronasal type-1 receptor A9 dbj|BAB79214.1| vomeronasal receptor 1 A9 [Mus musculus] gb|AAI41637.1| Vomeronasa...l 1 receptor, A2 [synthetic construct] gb|AAI40265.1| Vomeronasa...l 1 receptor, A2 [synthetic construct] gb|EDK99273.1| vomeronasal 1 receptor, A2 [Mus musculus] NP_035814.2 7e-81 53% ...

NCBI nr-aa BLAST: CBRC-STRI-01-0722 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-STRI-01-0722 ref|NP_035814.2| vomeronasal 1 receptor, A2 [Mus musculus] sp|Q8V...IC7|VN1A2_MOUSE RecName: Full=Vomeronasal type-1 receptor A2; Short=mV1R2; AltName: Full=Pheromone receptor ...2; AltName: Full=Vomeronasal type-1 receptor A9 dbj|BAB79214.1| vomeronasal receptor 1 A9 [Mus musculus] gb|AAI41637.1| Vomeronasa...l 1 receptor, A2 [synthetic construct] gb|AAI40265.1| Vomeronasa...l 1 receptor, A2 [synthetic construct] gb|EDK99273.1| vomeronasal 1 receptor, A2 [Mus musculus] NP_035814.2 7e-65 49% ...

NCBI nr-aa BLAST: CBRC-STRI-01-2741 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-STRI-01-2741 ref|NP_035814.2| vomeronasal 1 receptor, A2 [Mus musculus] sp|Q8V...IC7|VN1A2_MOUSE RecName: Full=Vomeronasal type-1 receptor A2; Short=mV1R2; AltName: Full=Pheromone receptor ...2; AltName: Full=Vomeronasal type-1 receptor A9 dbj|BAB79214.1| vomeronasal receptor 1 A9 [Mus musculus] gb|AAI41637.1| Vomeronasa...l 1 receptor, A2 [synthetic construct] gb|AAI40265.1| Vomeronasa...l 1 receptor, A2 [synthetic construct] gb|EDK99273.1| vomeronasal 1 receptor, A2 [Mus musculus] NP_035814.2 7e-83 53% ...

NCBI nr-aa BLAST: CBRC-STRI-01-2574 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-STRI-01-2574 ref|NP_035814.2| vomeronasal 1 receptor, A2 [Mus musculus] sp|Q8V...IC7|VN1A2_MOUSE RecName: Full=Vomeronasal type-1 receptor A2; Short=mV1R2; AltName: Full=Pheromone receptor ...2; AltName: Full=Vomeronasal type-1 receptor A9 dbj|BAB79214.1| vomeronasal receptor 1 A9 [Mus musculus] gb|AAI41637.1| Vomeronasa...l 1 receptor, A2 [synthetic construct] gb|AAI40265.1| Vomeronasa...l 1 receptor, A2 [synthetic construct] gb|EDK99273.1| vomeronasal 1 receptor, A2 [Mus musculus] NP_035814.2 2e-85 52% ...

NCBI nr-aa BLAST: CBRC-STRI-01-0161 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-STRI-01-0161 ref|NP_035814.2| vomeronasal 1 receptor, A2 [Mus musculus] sp|Q8V...IC7|VN1A2_MOUSE RecName: Full=Vomeronasal type-1 receptor A2; Short=mV1R2; AltName: Full=Pheromone receptor ...2; AltName: Full=Vomeronasal type-1 receptor A9 dbj|BAB79214.1| vomeronasal receptor 1 A9 [Mus musculus] gb|AAI41637.1| Vomeronasa...l 1 receptor, A2 [synthetic construct] gb|AAI40265.1| Vomeronasa...l 1 receptor, A2 [synthetic construct] gb|EDK99273.1| vomeronasal 1 receptor, A2 [Mus musculus] NP_035814.2 3e-84 52% ...

NCBI nr-aa BLAST: CBRC-STRI-01-2502 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-STRI-01-2502 ref|NP_035814.2| vomeronasal 1 receptor, A2 [Mus musculus] sp|Q8V...IC7|VN1A2_MOUSE RecName: Full=Vomeronasal type-1 receptor A2; Short=mV1R2; AltName: Full=Pheromone receptor ...2; AltName: Full=Vomeronasal type-1 receptor A9 dbj|BAB79214.1| vomeronasal receptor 1 A9 [Mus musculus] gb|AAI41637.1| Vomeronasa...l 1 receptor, A2 [synthetic construct] gb|AAI40265.1| Vomeronasa...l 1 receptor, A2 [synthetic construct] gb|EDK99273.1| vomeronasal 1 receptor, A2 [Mus musculus] NP_035814.2 5e-70 49% ...

NCBI nr-aa BLAST: CBRC-TGUT-08-0001 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-TGUT-08-0001 ref|NP_067250.2| potassium voltage-gated channel, shaker-related ...assium voltage-gated channel, shaker-related subfamily, member 4 [Mus musculus] emb|CAM23761.1| potassium voltage-gated channel, shak...4.1| potassium voltage-gated channel, shaker-related subfamily, member 4 [Mus musculus] NP_067250.2 0.0 79% ...

NCBI nr-aa BLAST: CBRC-ACAR-01-0365 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-ACAR-01-0365 ref|NP_067250.2| potassium voltage-gated channel, shaker-related ...assium voltage-gated channel, shaker-related subfamily, member 4 [Mus musculus] emb|CAM23761.1| potassium voltage-gated channel, shak...4.1| potassium voltage-gated channel, shaker-related subfamily, member 4 [Mus musculus] NP_067250.2 0.0 79% ...

NCBI nr-aa BLAST: CBRC-MLUC-01-0737 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-MLUC-01-0737 ref|NP_067250.2| potassium voltage-gated channel, shaker-related ...assium voltage-gated channel, shaker-related subfamily, member 4 [Mus musculus] emb|CAM23761.1| potassium voltage-gated channel, shak...4.1| potassium voltage-gated channel, shaker-related subfamily, member 4 [Mus musculus] NP_067250.2 0.0 87% ...

NCBI nr-aa BLAST: CBRC-ETEL-01-1362 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-ETEL-01-1362 ref|NP_067250.2| potassium voltage-gated channel, shaker-related ...assium voltage-gated channel, shaker-related subfamily, member 4 [Mus musculus] emb|CAM23761.1| potassium voltage-gated channel, shak...4.1| potassium voltage-gated channel, shaker-related subfamily, member 4 [Mus musculus] NP_067250.2 0.0 93% ...

NCBI nr-aa BLAST: CBRC-OANA-01-2250 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-OANA-01-2250 ref|NP_067250.2| potassium voltage-gated channel, shaker-related ...assium voltage-gated channel, shaker-related subfamily, member 4 [Mus musculus] emb|CAM23761.1| potassium voltage-gated channel, shak...4.1| potassium voltage-gated channel, shaker-related subfamily, member 4 [Mus musculus] NP_067250.2 0.0 92% ...

Blue Whale (Balaenoptera musculus Behavior and Group Dynamics as Observed from an Aircraft off Southern California

Directory of Open Access Journals (Sweden)

Kate Lomac-MacNair

2016-02-01

Full Text Available Group behavior and interactions of endangered blue whales (Balaenoptera musculus have not been systematically studied. Such behavioral data are often overlooked when assessing anthropogenic effects. Yet behavioral data are necessary to compare “normal” behaviors with behavior affected by anthropogenic factors of concern relative to effective management and recovery of blue whales. For a baseline study, we hypothesized that the response variables sighting rate, group size, calf presence and group cohesion (i.e., spacing between individuals within a group differed according to the spatio-temporal explanatory variables behavioral state, time of day, season, water depth and distance from shore. To address our hypotheses, we flew systematic line transect surveys in southern California and collected focal group data. Two sets of data were separately analyzed using different sampling approaches: (1 point sample data associated with the first sighting of a blue whale(s, and (2 extended all-occurrence focal group behavioral sampling data (i.e., focal follows collected on a subsample of all sightings while the aircraft circled at a radial distance of approximately 0.5-1 km and an altitude of 1,500 m for extended periods of 5 – 60 minutes. Chi-square contingency table and G² analyses were used to assess statistical relationships between response and explanatory variables. We conducted 18 one-week-long aerial surveys spanning October 2008 through May 2013 (at least once during every month except December, totaling 87,555 km of observation effort. Seventy blue whale sightings (117 individuals were seen, ranging in size from 1 – 6 whales, and focal follow was performed on over half (55% of these sightings. Results supported our hypotheses that blue whale group characteristics were related to behavioral state and spatio-temporal variables. Sighting rates were significantly highest during summer followed by spring, fall, and winter. Group type differed

AcEST: DK955384 [AcEST

Lifescience Database Archive (English)

Full Text Available >sp|Q9WVB0|RBPMS_MOUSE RNA-binding protein with multiple splicing OS=Mus musculus GN=Rbpms...OUSE RNA-binding protein with multiple splicing 2 OS=Mus musculus GN=Rbpms2 PE=1 SV=1 Length = 206 Score = 5...XENLA RNA-binding protein with multiple splicing OS=Xenopus laevis GN=rbpms PE=2 SV=1 Length = 196 Score = 5

AcEST: DK953370 [AcEST

Lifescience Database Archive (English)

Full Text Available PS2_MOUSE RNA-binding protein with multiple splicing 2 OS=Mus musculus GN=Rbpms2 PE=1 SV=1 Length = 206 Scor...NA-binding protein with multiple splicing OS=Mus musculus GN=Rbpms PE=2 SV=1 Leng...FDPEIPQTLRLEFAKANTK 104 >sp|Q9YGP5|RBPMS_XENLA RNA-binding protein with multiple splicing OS=Xenopus laevis GN=rbpms

Evidencias empíricas de regularidades estadísticas y leyes de potencia en los genomas de Arabidopsis thaliana, Oriza sativa y Mus musculus

Directory of Open Access Journals (Sweden)

Martha I Almanza P.

2010-07-01

Full Text Available La masiva cantidad de datos biológicos provenientes de las disciplinas "ómicas" y su aprovechamiento en el mejoramiento genético vegetal requiere de nuevos abordajes teóricos y estadísticos que describan de forma satisfactoria principios generales en los genomas. El total de secuencias de los genes de los genomas vegetales de Arabidopsis thaliana y Oriza sativa y del genoma animal Mus musculus fueron extraídas y depuradas de la base de datos pública del Genebank mediante el diseño de algoritmos en lenguaje de programación Python. Se analizaron las distribuciones de las variables frecuencia de uso y tamaño de los genes, exones e intrones por cromosoma y entre genomas. Los resultados señalaron que las variables presentan patrones de comportamiento no lineales en forma de ley de potencia que difieren estadísticamente entre los genomas pero no entre los cromosomas de un mismo genoma. Además, el análisis aportó evidencias respecto al tamaño promedio constante de las secuencias de exones y de los genes simples por cromosoma y entre genomas. Los hallazgos sugieren: primero, que el genoma se auto-organiza de la misma manera en los cromosomas independientemente del tamaño o número de genes que estos contengan, y, segundo, que tanto los cromosomas como sus elementos constituyentes: genes, exones e intrones han evolucionado conjuntamente. El estudio señala que las leyes de potencia cumplen un papel amortiguador en las leyes de variación biológica y proporcionan medidas cuantitativas de la organización de las secuencias de ADN que definen la identidad de un genoma. La regularidad estadística de estas medidas genéticas tiene potenciales aplicaciones en el incremento del valor predictivo de los actuales modelos de mejoramiento genético vegetal.

Thermographic Imaging of the Superficial Temperature in Racing Greyhounds before and after the Race

Directory of Open Access Journals (Sweden)

Mari Vainionpää

2012-01-01

Full Text Available A total of 47 racing greyhounds were enrolled in this study on two race days (in July and September, resp. at a racetrack. Twelve of the dogs participated in the study on both days. Thermographic images were taken before and after each race. From the images, superficial temperature points of selected sites (tendo calcaneus, musculus gastrocnemius, musculus gracilis, and musculus biceps femoris portio caudalis were taken and used to investigate the differences in superficial temperatures before and after the race. The thermographic images were compared between the right and left legs of a dog, between the raced distances, and between the two race days. The theoretical heat capacity of a racing greyhound was calculated. With regard to all distances raced, the superficial temperatures measured from the musculus gastrocnemius were significantly higher after the race than at baseline. No significant differences were found between the left and right legs of a dog after completing any of the distances. Significant difference was found between the two race days. The heat loss mechanisms of racing greyhounds during the race through forced conduction, radiation, evaporation, and panting can be considered adequate when observing the calculated heat capacity of the dogs.

Thermographic imaging of the superficial temperature in racing greyhounds before and after the race.

Science.gov (United States)

Vainionpää, Mari; Tienhaara, Esa-Pekka; Raekallio, Marja; Junnila, Jouni; Snellman, Marjatta; Vainio, Outi

2012-01-01

A total of 47 racing greyhounds were enrolled in this study on two race days (in July and September, resp.) at a racetrack. Twelve of the dogs participated in the study on both days. Thermographic images were taken before and after each race. From the images, superficial temperature points of selected sites (tendo calcaneus, musculus gastrocnemius, musculus gracilis, and musculus biceps femoris portio caudalis) were taken and used to investigate the differences in superficial temperatures before and after the race. The thermographic images were compared between the right and left legs of a dog, between the raced distances, and between the two race days. The theoretical heat capacity of a racing greyhound was calculated. With regard to all distances raced, the superficial temperatures measured from the musculus gastrocnemius were significantly higher after the race than at baseline. No significant differences were found between the left and right legs of a dog after completing any of the distances. Significant difference was found between the two race days. The heat loss mechanisms of racing greyhounds during the race through forced conduction, radiation, evaporation, and panting can be considered adequate when observing the calculated heat capacity of the dogs.

AcEST: DK950322 [AcEST

Lifescience Database Archive (English)

Full Text Available 19 OS=Mus mus... 34 0.62 >sp|Q9WVB0|RBPMS_MOUSE RNA-binding protein with multiple splicing OS=Mus musculus GN=Rbpms...YGP5|RBPMS_XENLA RNA-binding protein with multiple splicing OS=Xenopus laevis GN=rbpms...ith multiple splicing 2 OS=Mus musculus GN=Rbpms2 PE=1 SV=1 Length = 206 Score = 87.0 bits (214), Expect = 8

NCBI nr-aa BLAST: CBRC-PTRO-04-0004 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-PTRO-04-0004 sp|Q8VBS7|VN1A6_MOUSE Vomeronasal type-1 receptor A6 (Vomeronasal... type-1 receptor A3) (Vomeronasal type-1 receptor A1) (Vomeronasal type-1 receptor A10) dbj|BAB79209.1| vomeronasa...l receptor 1 A1 [Mus musculus] dbj|BAB79210.1| vomeronasal receptor 1 A3 [Mus musculus] gb|AAK98772.1| vomeronasa

Dicty_cDB: VHO533 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available producing significant alignments: (bits) Value (Q9NZJ4) RecName: Full=Sacsin; &AL...157766_4( AL157766 |pid:none) 96 2e-18 BC138482_1( BC138482 |pid:none) Mus musculus sacsin, mRNA (cDNA cl...... 94 8e-18 (Q9JLC8) RecName: Full=Sacsin; 94 8e-18 BC171956_1( BC171956 |pid:none) Mus musculus sacsin, mRNA

AcEST: DK950692 [AcEST

Lifescience Database Archive (English)

Full Text Available |Q8VC52|RBPS2_MOUSE RNA-binding protein with multiple splicing 2 OS=Mus musculus GN=Rbpms2 PE=1 SV=1 Length ...ultiple splicing OS=Mus musculus GN=Rbpms PE=2 SV=1 Length = 197 Score = 77.0 bits (188), Expect = 8e-14 Ide...S_XENLA RNA-binding protein with multiple splicing OS=Xenopus laevis GN=rbpms PE=2 SV=1 Length = 196 Score =

AcEST: DK950959 [AcEST

Lifescience Database Archive (English)

Full Text Available XENLA RNA-binding protein with multiple splicing OS=Xenopus laevis GN=rbpms PE=2 SV=1 Length = 196 Score = 4...iple splicing OS=Mus musculus GN=Rbpms PE=2 SV=1 Length = 197 Score = 47.8 bits (112), Expect = 6e-05 Identi...nding protein with multiple splicing 2 OS=Mus musculus GN=Rbpms2 PE=1 SV=1 Length = 206 Score = 46.2 bits (1

AcEST: DK958175 [AcEST

Lifescience Database Archive (English)

Full Text Available USE RNA-binding protein with multiple splicing 2 OS=Mus musculus GN=Rbpms2 PE=1 SV=1 Length = 206 Score = 36...>sp|Q9YGP5|RBPMS_XENLA RNA-binding protein with multiple splicing OS=Xenopus laevis GN=rbpms PE=2 SV=1 Lengt... EEVRTLFVSGLPIDIKPRELYLLFRPFKGYE 47 >sp|Q9WVB0|RBPMS_MOUSE RNA-binding protein with multiple splicing OS=Mus musculus GN=Rbpms

Studies of the reproductive biology of deep-sea megabenthos

International Nuclear Information System (INIS)

Tyler, P.A.

1987-07-01

The final report describes the general biology and ecology of the 15 holothurians, 3 asteroids, 2 zoanthids and 1 crustacea species studied in Reports I-XIII, the sampling methods used and the station data. A summary of the histological, histochemical and biochemical results for the species examined is given. The data suggest that the reproductive processes in the deep-sea species examined are highly unlikely to be part of a pathway for the transfer of radionuclides from the deep-sea back to man. (author)

Physical and sensory characteristics of pork sausages from enzymatically modified blends of lard and rapeseed oil during storage

DEFF Research Database (Denmark)

Cheong, L.Z.; Zhang, H.; Nersting, L.

2010-01-01

Physical and sensory characteristic of pork sausages produced from enzymatic interesterified blends of lard and rapeseed oil during storage were evaluated. All three enzymatic interesterified blends (IE90, IE70 and IE50) had ratios of unsaturated to saturated fatty acids within the range of 1.......47-2.84 which is favourable for cardiovascular disease risk reduction. Blends of IE90 and IE70 were found to have suitable solid fat content, melting and crystallization profile suitable for sausages production. Sausages were produced from blends of IE90 and IE70 with different muscle types (musculus...... longissimus dorsi and musculus sternomandibularis) and processing conditions such as cooling rates and final processing temperature. Cooling rate was found to have no significant (P>0.05) effect on hardness of the sausages throughout storage. Both musculus longissimus dorsi and high final processing...

Dicty_cDB: VHK810 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available g significant alignments: (bits) Value (Q9NZJ4) RecName: Full=Sacsin; &AL157766_4( AL157766 |pid:none) 105 5...e-21 BC138482_1( BC138482 |pid:none) Mus musculus sacsin, mRNA (cDNA cl... 103 2e-20 (Q9JLC8) RecName: Full=Sacsi...n; 103 2e-20 BC171956_1( BC171956 |pid:none) Mus musculus sacsin, mRNA (cDNA

The role of salivary androgen-binding protein in reproductive isolation between two subspecies of house mouse: Mus musculus musculus and Mus musculus domesticus

Czech Academy of Sciences Publication Activity Database

Bímová, Barbora; Karn, R. C.; Piálek, Jaroslav

2005-01-01

Roč. 84, č. 3 (2005), s. 349-361 ISSN 0024-4066. [The genus Mus as a model for evolutionary studies - a symposium in honour of Louis Thaler. Brno, 28.07.2003-30.07.2003] R&D Projects: GA AV ČR IAA6093201; GA AV ČR IAA6045902 Grant - others:National Research Council(US) COBASE Institutional research plan: CEZ:AV0Z6093917 Keywords : assortative mating * hybrid zone * sexual selection Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 2.261, year: 2005

AcEST: BP921475 [AcEST

Lifescience Database Archive (English)

Full Text Available BlastX Result : Swiss-Prot sp_hit_id O35902 Definition sp|O35902|DSG3_MOUSE Desmoglein-3 OS=Mus musculus Al...gnificant alignments: (bits) Value sp|O35902|DSG3_MOUSE Desmoglein-3 OS=Mus musculus GN=Dsg3 PE=2 SV=1 31 2....2 sp|Q29IL2|POMT2_DROPS Protein O-mannosyl-transferase 2 OS=Drosop... 30 4.8 >sp|O35902|DSG3_MOUSE Desmog

A Summary of the Naval Postgraduate School Research Program.

Science.gov (United States)

1981-04-01

compaction achieved in the procedure is very large. Point process methodology is being applied to tnat analysis of sleep-wake behavior in mice (mus musculus...Initial data analysis has indicated that there is no evidence for ultradian rhythms in mice (mus musculus). Further analysis of cir- cadian rhythms...One of these antennas is a 20 foot wire monopole erected in the center of the image plane in order to transmit a high voltage pulse to the test

Dicty_cDB: VHN647 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available ignments: (bits) Value CP001577_292( CP001577 |pid:none) Micromonas sp. RCC299 chromosome... 106 2e-21 (Q9NZJ4) RecName: Full=Sacsi...n; &AL157766_4( AL157766 |pid:none) 105 5e-21 BC138482_1( BC138482 |pid:none) Mus musculus sacsi..... 103 2e-20 (Q9JLC8) RecName: Full=Sacsin; 103 2e-20 BC171956_1( BC171956 |pid:none) Mus musculus sacsi

Dicty_cDB: VHO809 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available e E Sequences producing significant alignments: (bits) Value (Q9NZJ4) RecName: Full=Sacsin; &AL157766_4( AL1...57766 |pid:none) 105 5e-21 BC171956_1( BC171956 |pid:none) Mus musculus sacsin, mRNA (cDNA cl... 103 1e-20 B...C138482_1( BC138482 |pid:none) Mus musculus sacsin, mRNA (cDNA cl... 103 2e-20 (Q9JLC8) RecName: Full=Sacsin

Dicty_cDB: VHD239 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available lignments: (bits) Value BC171956_1( BC171956 |pid:none) Mus musculus sacsin, mRNA (cDNA cl... 112 3e-23 BC13...8482_1( BC138482 |pid:none) Mus musculus sacsin, mRNA (cDNA cl... 112 4e-23 (Q9NZJ4) RecName: Full=Sacsin; &...AL157766_4( AL157766 |pid:none) 112 4e-23 (Q9JLC8) RecName: Full=Sacsin; 112 4e-2

Dicty_cDB: VHD478 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available BC138482_1( BC138482 |pid:none) Mus musculus sacsin, mRNA (cDNA cl... 35 0.63 (Q9NZJ4) RecName: Full=Sacs...in; &AL157766_4( AL157766 |pid:none) 35 0.63 (Q9JLC8) RecName: Full=Sacsin; 35 0.63... BC171956_1( BC171956 |pid:none) Mus musculus sacsin, mRNA (cDNA cl... 35 0.63 AL732351_6( AL732351 |pid:non

Genetic dissection of a key reproductive barrier between nascent species of house mice.

Science.gov (United States)

White, Michael A; Steffy, Brian; Wiltshire, Tim; Payseur, Bret A

2011-09-01

Reproductive isolation between species is often caused by deleterious interactions among loci in hybrids. Finding the genes involved in these incompatibilities provides insight into the mechanisms of speciation. With recently diverged subspecies, house mice provide a powerful system for understanding the genetics of reproductive isolation early in the speciation process. Although previous studies have yielded important clues about the genetics of hybrid male sterility in house mice, they have been restricted to F1 sterility or incompatibilities involving the X chromosome. To provide a more complete characterization of this key reproductive barrier, we conducted an F2 intercross between wild-derived inbred strains from two subspecies of house mice, Mus musculus musculus and Mus musculus domesticus. We identified a suite of autosomal and X-linked QTL that underlie measures of hybrid male sterility, including testis weight, sperm density, and sperm morphology. In many cases, the autosomal loci were unique to a specific sterility trait and exhibited an effect only when homozygous, underscoring the importance of examining reproductive barriers beyond the F1 generation. We also found novel two-locus incompatibilities between the M. m. musculus X chromosome and M. m. domesticus autosomal alleles. Our results reveal a complex genetic architecture for hybrid male sterility and suggest a prominent role for reproductive barriers in advanced generations in maintaining subspecies integrity in house mice.

Genetic Dissection of a Key Reproductive Barrier Between Nascent Species of House Mice

Science.gov (United States)

White, Michael A.; Steffy, Brian; Wiltshire, Tim; Payseur, Bret A.

2011-01-01

Reproductive isolation between species is often caused by deleterious interactions among loci in hybrids. Finding the genes involved in these incompatibilities provides insight into the mechanisms of speciation. With recently diverged subspecies, house mice provide a powerful system for understanding the genetics of reproductive isolation early in the speciation process. Although previous studies have yielded important clues about the genetics of hybrid male sterility in house mice, they have been restricted to F1 sterility or incompatibilities involving the X chromosome. To provide a more complete characterization of this key reproductive barrier, we conducted an F2 intercross between wild-derived inbred strains from two subspecies of house mice, Mus musculus musculus and Mus musculus domesticus. We identified a suite of autosomal and X-linked QTL that underlie measures of hybrid male sterility, including testis weight, sperm density, and sperm morphology. In many cases, the autosomal loci were unique to a specific sterility trait and exhibited an effect only when homozygous, underscoring the importance of examining reproductive barriers beyond the F1 generation. We also found novel two-locus incompatibilities between the M. m. musculus X chromosome and M. m. domesticus autosomal alleles. Our results reveal a complex genetic architecture for hybrid male sterility and suggest a prominent role for reproductive barriers in advanced generations in maintaining subspecies integrity in house mice. PMID:21750261

NCBI nr-aa BLAST: CBRC-RNOR-08-0336 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-RNOR-08-0336 ref|NP_666341.1| dynein cytoplasmic 1 light intermediate chain 1 ...[Mus musculus] sp|Q8R1Q8|DC1L1_MOUSE Cytoplasmic dynein 1 light intermediate chain 1 (Dynein light intermedia...te chain 1, cytosolic) (Dynein light chain A) (DLC-A) gb|AAH23347.1| Dynein cytoplasmic 1 light intermediat...b|EDL09299.1| dynein cytoplasmic 1 light intermediate chain 1 [Mus musculus] NP_666341.1 1e-137 63% ...

Dicty_cDB: VHE271 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available -21 (Q9NZJ4) RecName: Full=Sacsin; &AL157766_4( AL157766 |pid:none) 105 3e-21 BC171956_1( BC171956 |pid:none) Mus musculus sacsi...n, mRNA (cDNA cl... 103 1e-20 BC138482_1( BC138482 |pid:none) Mus musculus sacsi...n, mRNA (cDNA cl... 103 1e-20 (Q9JLC8) RecName: Full=Sacsin; 103 1e-20 AB006708_10( AB006

Dicty_cDB: VHC102 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available ucing significant alignments: (bits) Value (Q9NZJ4) RecName: Full=Sacsin; &AL157766_4( AL157766 |pid:none) 1...05 4e-21 BC138482_1( BC138482 |pid:none) Mus musculus sacsin, mRNA (cDNA cl... 103 2e-20 (Q9JLC8) RecName: Full=Sacsi...n; 103 2e-20 BC171956_1( BC171956 |pid:none) Mus musculus sacsin, mRNA (cDNA cl... 103 2e-20 CP0015

The phyllophorid holothurians of southern Africa with the erection of ...

African Journals Online (AJOL)

this paper Thyone proceracorona Cherbonnier, 1952 and T. turrisolida .... in two clusters of teeth, or reduced or absent; pedicels with curved ... However. in the enigmatic Cladolella virgo Heding & ...... Marine biological research at Inhaca.

NCBI nr-aa BLAST: CBRC-STRI-01-2626 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-STRI-01-2626 sp|Q8VBS7|VN1A6_MOUSE RecName: Full=Vomeronasal type-1 receptor A...6; AltName: Full=Vomeronasal type-1 receptor A3; AltName: Full=Vomeronasal type-1 receptor A1; AltName: Full=Vomeronasa...l type-1 receptor A10 dbj|BAB79209.1| vomeronasal receptor 1 A1 [Mus musculus] dbj|BAB79210.1| vomeronasa...l receptor 1 A3 [Mus musculus] gb|AAK98772.1| vomeronasal receptor V1RA10

Dramatic changes in 67 miRNAs during initiation of first wave of spermatogenesis in Mus musculus testis: global regulatory insights generated by miRNA-mRNA network analysis.

Science.gov (United States)

Sree, Sreesha; Radhakrishnan, Karthika; Indu, Sivankutty; Kumar, Pradeep G

2014-09-01

We mapped global changes in miRNA and mRNA profiles spanning the first wave of spermatogenesis using prepubertal (Postnatal Day 8 [P8]), pubertal (P16), and adolescent (P24) Mus musculus testes and identified the differential expression of 67 miRNAs and 8226 mRNAs. These two data sets were integrated into miRNA-dependent regulatory networks based on miRWalk predictions. In a network representing the P8 to P16 transition, downregulation of four miRNAs and upregulation of 19 miRNAs were linked with 81 upregulated target mRNAs and 228 downregulated target mRNAs, respectively. Furthermore, during the P16 to P24 transition, two miRNAs were downregulated, and eight miRNAs were upregulated, which linked with 64 upregulated mRNAs and 389 downregulated mRNAs, respectively. Only three of the miRNAs present in the network (miR-34b-5p, miR-34c, and miR-449a) showed a progressive increase from P8 through P16 to P24, while the remaining miRNAs in the network showed statistically significant changes in their levels either during the P8 to P16 transition or during the P16 to P24 transition. Analysis of the chromosomal location of these differentially expressed miRNAs showed that 14 out of 25 miRNAs upregulated from P8 to P16, and 18 out of 40 miRNAs upregulated from P8 to P24 were X-linked. This is suggestive of their escape from meiotic sex chromosome inactivation and postmeiotic sex chromatin. This integrated network of miRNA-level and mRNA-level changes in mouse testis during the first wave of spermatogenesis is expected to build a base for evaluating the role of miRNA-mediated gene expression regulation in maturing mammalian testis. © 2014 by the Society for the Study of Reproduction, Inc.

NCBI nr-aa BLAST: CBRC-CPOR-01-1147 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-CPOR-01-1147 ref|NP_035814.2| vomeronasal 1 receptor, A2 [Mus musculus] sp|Q8VIC7|VN1A2_MOUSE Vomeronas...al type-1 receptor A2 (Pheromone receptor 2) (Vomeronasal type-1 receptor A9) (mV1R...2) dbj|BAB79214.1| vomeronasal receptor 1 A9 [Mus musculus] gb|AAI41637.1| Vomeronasal 1 receptor, A2 [synth...etic construct] gb|AAI40265.1| Vomeronasal 1 receptor, A2 [synthetic construct] gb|EDK99273.1| vomeronasa

NCBI nr-aa BLAST: CBRC-CPOR-01-0933 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-CPOR-01-0933 ref|NP_035814.2| vomeronasal 1 receptor, A2 [Mus musculus] sp|Q8VIC7|VN1A2_MOUSE Vomeronas...al type-1 receptor A2 (Pheromone receptor 2) (Vomeronasal type-1 receptor A9) (mV1R...2) dbj|BAB79214.1| vomeronasal receptor 1 A9 [Mus musculus] gb|AAI41637.1| Vomeronasal 1 receptor, A2 [synth...etic construct] gb|AAI40265.1| Vomeronasal 1 receptor, A2 [synthetic construct] gb|EDK99273.1| vomeronasa

NCBI nr-aa BLAST: CBRC-MMUS-06-0130 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-MMUS-06-0130 ref|NP_035814.2| vomeronasal 1 receptor, A2 [Mus musculus] sp|Q8VIC7|VN1A2_MOUSE Vomeronas...al type-1 receptor A2 (Pheromone receptor 2) (Vomeronasal type-1 receptor A9) (mV1R...2) dbj|BAB79214.1| vomeronasal receptor 1 A9 [Mus musculus] gb|AAI41637.1| Vomeronasal 1 receptor, A2 [synth...etic construct] gb|AAI40265.1| Vomeronasal 1 receptor, A2 [synthetic construct] gb|EDK99273.1| vomeronasa

NCBI nr-aa BLAST: CBRC-PABE-04-0003 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-PABE-04-0003 ref|NP_035814.2| vomeronasal 1 receptor, A2 [Mus musculus] sp|Q8VIC7|VN1A2_MOUSE Vomeronas...al type-1 receptor A2 (Pheromone receptor 2) (Vomeronasal type-1 receptor A9) (mV1R...2) dbj|BAB79214.1| vomeronasal receptor 1 A9 [Mus musculus] gb|AAI41637.1| Vomeronasal 1 receptor, A2 [synth...etic construct] gb|AAI40265.1| Vomeronasal 1 receptor, A2 [synthetic construct] gb|EDK99273.1| vomeronasa

NCBI nr-aa BLAST: CBRC-OCUN-01-1001 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-OCUN-01-1001 ref|NP_035814.2| vomeronasal 1 receptor, A2 [Mus musculus] sp|Q8VIC7|VN1A2_MOUSE Vomeronas...al type-1 receptor A2 (Pheromone receptor 2) (Vomeronasal type-1 receptor A9) (mV1R...2) dbj|BAB79214.1| vomeronasal receptor 1 A9 [Mus musculus] gb|AAI41637.1| Vomeronasal 1 receptor, A2 [synth...etic construct] gb|AAI40265.1| Vomeronasal 1 receptor, A2 [synthetic construct] gb|EDK99273.1| vomeronasa

NCBI nr-aa BLAST: CBRC-MMUS-06-0137 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-MMUS-06-0137 ref|NP_035814.2| vomeronasal 1 receptor, A2 [Mus musculus] sp|Q8VIC7|VN1A2_MOUSE Vomeronas...al type-1 receptor A2 (Pheromone receptor 2) (Vomeronasal type-1 receptor A9) (mV1R...2) dbj|BAB79214.1| vomeronasal receptor 1 A9 [Mus musculus] gb|AAI41637.1| Vomeronasal 1 receptor, A2 [synth...etic construct] gb|AAI40265.1| Vomeronasal 1 receptor, A2 [synthetic construct] gb|EDK99273.1| vomeronasa

NCBI nr-aa BLAST: CBRC-RNOR-04-0241 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-RNOR-04-0241 ref|NP_035814.2| vomeronasal 1 receptor, A2 [Mus musculus] sp|Q8VIC7|VN1A2_MOUSE Vomeronas...al type-1 receptor A2 (Pheromone receptor 2) (Vomeronasal type-1 receptor A9) (mV1R...2) dbj|BAB79214.1| vomeronasal receptor 1 A9 [Mus musculus] gb|AAI41637.1| Vomeronasal 1 receptor, A2 [synth...etic construct] gb|AAI40265.1| Vomeronasal 1 receptor, A2 [synthetic construct] gb|EDK99273.1| vomeronasa

NCBI nr-aa BLAST: CBRC-CPOR-01-1167 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-CPOR-01-1167 ref|NP_035814.2| vomeronasal 1 receptor, A2 [Mus musculus] sp|Q8VIC7|VN1A2_MOUSE Vomeronas...al type-1 receptor A2 (Pheromone receptor 2) (Vomeronasal type-1 receptor A9) (mV1R...2) dbj|BAB79214.1| vomeronasal receptor 1 A9 [Mus musculus] gb|AAI41637.1| Vomeronasal 1 receptor, A2 [synth...etic construct] gb|AAI40265.1| Vomeronasal 1 receptor, A2 [synthetic construct] gb|EDK99273.1| vomeronasa

NCBI nr-aa BLAST: CBRC-MMUS-06-0138 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-MMUS-06-0138 ref|NP_035814.2| vomeronasal 1 receptor, A2 [Mus musculus] sp|Q8VIC7|VN1A2_MOUSE Vomeronas...al type-1 receptor A2 (Pheromone receptor 2) (Vomeronasal type-1 receptor A9) (mV1R...2) dbj|BAB79214.1| vomeronasal receptor 1 A9 [Mus musculus] gb|AAI41637.1| Vomeronasal 1 receptor, A2 [synth...etic construct] gb|AAI40265.1| Vomeronasal 1 receptor, A2 [synthetic construct] gb|EDK99273.1| vomeronasa

NCBI nr-aa BLAST: CBRC-MMUS-06-0124 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-MMUS-06-0124 ref|NP_035814.2| vomeronasal 1 receptor, A2 [Mus musculus] sp|Q8VIC7|VN1A2_MOUSE Vomeronas...al type-1 receptor A2 (Pheromone receptor 2) (Vomeronasal type-1 receptor A9) (mV1R...2) dbj|BAB79214.1| vomeronasal receptor 1 A9 [Mus musculus] gb|AAI41637.1| Vomeronasal 1 receptor, A2 [synth...etic construct] gb|AAI40265.1| Vomeronasal 1 receptor, A2 [synthetic construct] gb|EDK99273.1| vomeronasa

Dicty_cDB: VHK791 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available ificant alignments: (bits) Value (Q9NZJ4) RecName: Full=Sacsin; &AL157766_4( AL15...142916_1( BC142916 |pid:none) Danio rerio hypothetical LOC555303... 105 5e-21 BC171956_1( BC171956 |pid:none) Mus musculus sacsi...n, mRNA (cDNA cl... 103 1e-20 BC138482_1( BC138482 |pid:none) Mus musculus sacsin, mRNA ...(cDNA cl... 103 1e-20 (Q9JLC8) RecName: Full=Sacsin; 103 1e-20 AB006708_10( AB006

Dicty_cDB: VHB767 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available vs Protein Score E Sequences producing significant alignments: (bits) Value (Q9NZJ4) RecName: Full=Sacsin; &...AL157766_4( AL157766 |pid:none) 111 7e-23 BC171956_1( BC171956 |pid:none) Mus musculus sacsin, mRNA (cDNA cl...... 109 3e-22 BC138482_1( BC138482 |pid:none) Mus musculus sacsin, mRNA (cDNA cl...... 108 3e-22 (Q9JLC8) RecName: Full=Sacsin; 108 3e-22 BC142916_1( BC142916 |pid:none) Danio rerio hypothetic

Studies of the reproductive biology of deep-sea megabenthos. II. The echinoderm species Deima validum and Oneirophanta mutabilis (Elasipoda: Holothuroidea)

International Nuclear Information System (INIS)

Tyler, P.A.; Muirhead, A.

1984-03-01

Specimens of the holothurians Deima validum and Oneirophanta mutabilis were examined from a number of stations between 2900 and 4785 m in the N.E. Atlantic. Details of the gametogenic biology suggest that both species produce large eggs, the maximum sizes being 700 and 950 μm for Deima and Oneirophanta, respectively. This would suggest direct development in both species, without a planktonic larval stage. No reproductive seasonality was observed. In the males examined, we found no evidence of sperm production, suggesting the males spawn on capture, have rapid, short-term spermatogenesis or have a long spawning periodicity. (author)

Characterization of two forms of mouse salivary androgen-binding protein (ABP): implications for evolutionary relationships and ligand-binding function.

Science.gov (United States)

Karn, Robert C; Laukaitis, Christina M

2003-06-17

Mouse salivary androgen-binding protein (ABP) is a member of the secretoglobin family produced in the submaxillary glands of house mice (Mus musculus). We report the cDNA sequences and amino acid sequences of the beta and gamma subunits of ABP from a mouse cDNA library, identifying the two subunits by their pIs and molecular weights. An anomalously high molecular weight of the alpha subunit is likely due to glycosylation at a single site. A phylogenetic comparison of the three subunits of ABP with the chains of other mammalian secretoglobins shows that ABP is most closely related to mouse lachrymal protein and to the major cat allergen Fel dI. An evaluation of the most conserved residues in ABP and the other secretoglobins, in light of structural data reported by others [Callebaut, I., Poupon, A., Bally, R., Demaret, J.-P., Housset, D., Delettre, J., Hossenlopp, P., and Mornon, J.-P. (2000) Ann. N.Y. Acad. Sci. 923, 90-112; Pattabiraman, N., Matthews, J., Ward, K., Mantile-Selvaggi, G., Miele, L., and Mukherjee, A. (2000) Ann. N.Y. Acad. Sci. 923, 113-127], allows us to draw conclusions about the critical residues important in ligand binding by the two different ABP dimers and to assess the importance of ligand binding in the function of the molecule. In addition to the cDNAs, which represent those of the musculus subspecies of Mus musculus, we also report the coding regions of the beta and gamma subunit cDNAs from two other mouse inbred strains which represent the other two subspecies: M. musculus domesticus and M. musculus castaneus. The high nonsynonymous/synonymous substitution rate ratios (K(a)/K(s)) for both the beta and gamma subunits suggest that these two proteins are evolving under strong directional selection, as has been reported for the alpha subunit [Hwang, J., Hofstetter, J., Bonhomme, F., and Karn, R. (1997) J. Hered. 88, 93-97; Karn, R., and Clements, M. (1999) Biochem. Genet. 37, 187-199].

Asymmetry and polymorphism of hybrid male sterility during the early stages of speciation in house mice.

Science.gov (United States)

Good, Jeffrey M; Handel, Mary Ann; Nachman, Michael W

2008-01-01

House mice offer a powerful system for dissecting the genetic basis of phenotypes that isolate species in the early stages of speciation. We used a series of reciprocal crosses between wild-derived strains of Mus musculus and M. domesticus to examine F(1) hybrid male sterility, one of the primary phenotypes thought to isolate these species. We report four main results. First, we found significantly smaller testes and fewer sperm in hybrid male progeny of most crosses. Second, in some crosses hybrid male sterility was asymmetric and depended on the species origin of the X chromosome. These observations confirm and extend previous findings, underscoring the central role that the M. musculus X chromosome plays in reproductive isolation. Third, comparisons among reciprocal crosses revealed polymorphism at one or more hybrid incompatibilities within M. musculus. Fourth, the spermatogenic phenotype of this polymorphic interaction appears distinct from previously described hybrid incompatibilities between these species. These data build on previous studies of speciation in house mice and show that the genetic basis of hybrid male sterility is fairly complex, even at this early stage of divergence.

Helminth Infections of House Mouse (Mus musulus and Wood Mouse (Apodemus sylvaticus from the Suburban Areas of Hamadan City, Western Iran.

Directory of Open Access Journals (Sweden)

Ali Yousefi

2014-12-01

Full Text Available To determine the prevalence and intensity of helminths and their zoonotic importance in small rodents inhabiting in the suburban areas of Hamadan City, Iran.The present survey was conducted on the helminth infections of two species of rodents Apodemus sylvaticus (n=60 and Mus musculus(n=72 in the suburban areas of Hamadan City during 2010-2012. Rodents were collected and examined for helminth in the different organs. The nematodes were collected in 5% formalin solution and cleared in lactophenol, cestodes and trematodes collected from intestine fixed in AFA solution and stained by acetocarmine, cleared in xylol for identification.Helminths found in A. sylvaticus and M. musculus and their prevalence for the first time in suburban areas of Hamadan City were as follows; In A. sylvaticus: Cysticercus fasciolaris(3.33%, Syphacia fredrici(26.67%, S. stroma(8.33%, Anoplocephalidae sp. (1.67%, Skrjabinotaenia lobata(5%, Plagiorchis muris(1.67% and in M. musculus:Hymenolepis nana (16.67%, H.diminuta (5.55%, S. obvelata(30.56%, S. ohtarom (9.72%, Rodentolepis crassa (1.39%, C. fasciolaris (1.39%. Among 11 species in two rodents 4 species including S. obvelata, H. nana, H.diminuta,and P. muris have zoonotic importance. Statistically the relation between gender and their helminth infections was not significant in either M. musculus or A. sylvaticus (P>0.05.This study reports 11 species of helminths and on the other hand 3 species were identified for the first time in Iran and 5 species of them have potential health importance for public health and cat.

X-y interactions underlie sperm head abnormality in hybrid male house mice.

Science.gov (United States)

Campbell, Polly; Nachman, Michael W

2014-04-01

The genetic basis of hybrid male sterility in house mice is complex, highly polygenic, and strongly X linked. Previous work suggested that there might be interactions between the Mus musculus musculus X and the M. m. domesticus Y with a large negative effect on sperm head morphology in hybrid males with an F1 autosomal background. To test this, we introgressed the M. m. domesticus Y onto a M. m. musculus background and measured the change in sperm morphology, testis weight, and sperm count across early backcross generations and in 11th generation backcross males in which the opportunity for X-autosome incompatibilities is effectively eliminated. We found that abnormality in sperm morphology persists in M. m. domesticus Y introgression males, and that this phenotype is rescued by M. m. domesticus introgressions on the X chromosome. In contrast, the severe reductions in testis weight and sperm count that characterize F1 males were eliminated after one generation of backcrossing. These results indicate that X-Y incompatibilities contribute specifically to sperm morphology. In contrast, X-autosome incompatibilities contribute to low testis weight, low sperm count, and sperm morphology. Restoration of normal testis weight and sperm count in first generation backcross males suggests that a small number of complex incompatibilities between loci on the M. m. musculus X and the M. m. domesticus autosomes underlie F1 male sterility. Together, these results provide insight into the genetic architecture of F1 male sterility and help to explain genome-wide patterns of introgression across the house mouse hybrid zone.

The Evolution of Polymorphic Hybrid Incompatibilities in House Mice.

Science.gov (United States)

Larson, Erica L; Vanderpool, Dan; Sarver, Brice A J; Callahan, Colin; Keeble, Sara; Provencio, Lorraine P; Kessler, Michael D; Stewart, Vanessa; Nordquist, Erin; Dean, Matthew D; Good, Jeffrey M

2018-04-24

Resolving the mechanistic and genetic bases of reproductive barriers between species is essential to understanding the evolutionary forces that shape speciation. Intrinsic hybrid incompatibilities are often treated as fixed between species, yet there can be considerable variation in the strength of reproductive isolation between populations. The extent and causes of this variation remain poorly understood in most systems. We investigated the genetic basis of variable hybrid male sterility (HMS) between two recently diverged subspecies of house mice, Mus musculus domesticus and M. m. musculus We found that polymorphic HMS has a surprisingly complex genetic basis, with contributions from at least five autosomal loci segregating between two closely related wild-derived strains of M. m. musculus One of the HMS-linked regions on Chromosome 4 also showed extensive introgression among inbred laboratory strains and transmission ratio distortion (TRD) in hybrid crosses. Using additional crosses and whole genome sequencing of sperm pools, we showed that TRD was limited to hybrid crosses and was not due to differences in sperm motility between M. m. musculus strains. Based on these results, we argue that TRD likely reflects additional incompatibilities that reduce hybrid embryonic viability. In some common inbred strains of mice, selection against deleterious interactions appears to have unexpectedly driven introgression at loci involved in epistatic hybrid incompatibilities. The highly variable genetic basis to F1 hybrid incompatibilities between closely related mouse lineages argues that a thorough dissection of reproductive isolation will require much more extensive sampling of natural variation than has been commonly utilized in mice and other model systems. Copyright © 2018, Genetics.

Dicty_cDB: VHF491 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available ents: (bits) Value BC142916_1( BC142916 |pid:none) Danio rerio hypothetical LOC555303... 97 6e-19 (Q9NZJ4) RecName: Full=Sacsi...n; &AL157766_4( AL157766 |pid:none) 97 9e-19 BC171956_1( BC171956 |pid:none) Mus musculus sacsi...n, mRNA (cDNA cl... 96 1e-18 BC138482_1( BC138482 |pid:none) Mus musculus sacsi...n, mRNA (cDNA cl... 96 2e-18 (Q9JLC8) RecName: Full=Sacsin; 96 2e-18 CP001577_292( CP001577 |pid:none) Mi

Dicty_cDB: VHE123 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available nificant alignments: (bits) Value (Q9NZJ4) RecName: Full=Sacsin; &AL157766_4( AL157766 |pid:none) 105 4e-21 ...none) Micromonas sp. RCC299 chromosome... 103 1e-20 BC138482_1( BC138482 |pid:none) Mus musculus sacsi...n, mRNA (cDNA cl... 103 1e-20 (Q9JLC8) RecName: Full=Sacsin; 103 1e-20 BC171956_1( BC17...1956 |pid:none) Mus musculus sacsin, mRNA (cDNA cl... 103 1e-20 AB006708_10( AB006708 |pid:none) Arabidopsis

Behavioural characterisation of wild derived male mice (Mus musculus musculus) of the PWD/Ph inbred strain

Czech Academy of Sciences Publication Activity Database

Fernandes, C.; Liu, L.; Paya-Cano, J. L.; Gregorová, Soňa; Forejt, Jiří; Schalkwyk, L. J.

2004-01-01

Roč. 34, č. 6 (2004), s. 621-630 ISSN 0001-8244 R&D Projects: GA MŠk LN00A079; GA ČR GA204/02/1373 Grant - others:EU(XE) QLRI-2000-00233; HHMI(US) 555000306 Institutional research plan: CEZ:AV0Z5052915 Keywords : mouse * behavior Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 2.215, year: 2004

Chromatin preferences of the perichromosomal layer constituent pKi-67.

Science.gov (United States)

Traut, Walther; Endl, Elmar; Garagna, Silvia; Scholzen, Thomas; Schwinger, Eberhard; Gerdes, Johannes; Winking, Heinz

2002-01-01

The proliferation-associated nuclear protein pKi-67 relocates from the nucleolus to the chromosome surface during the G2/M transition of the cell cycle and contributes to the formation of the 'perichromosomal layer'. We investigated the in-vivo binding preferences of pKi-67 for various chromatin blocks of the mitotic chromosomes from the human and two mouse species, Mus musculus and M. caroli. All chromosomes were decorated with pKi-67 but displayed a gap of pKi-67 decoration in the centromere and NOR regions. pKi-67 distribution in a rearranged mouse chromosome showed that the formation of the centromeric gap was controlled by the specific chromatin in that region. While most chromatin served as a substrate for direct or indirect binding of pKi-67, we identified three types of chromatin that bound less or no pKi-67. These were: (1) the centromeric heterochromatin defined by the alpha satellite DNA in the human, by the mouse minor satellite in M. musculus and the 60- and 79-bp satellites in M. caroli; (2) the pericentromeric heterochromatin in M. musculus defined by the mouse major satellite, and (3) NORs in the human and in M. musculus defined by rDNA repeats. In contrast, the conspicuous blocks of pericentromeric heterochromatin in human chromosomes 1, 9 and 16 containing the 5-bp satellite showed intense pKi-67 decoration. The centromeric gap may have a biological significance for the proper attachment of the chromosomes to the mitotic spindle. In this context, our results suggest a new role for centromeric heterochromatin: the control of the centromeric gap in the perichromosomal layer.

Analysis of Copy Number Variation in the Abp Gene Regions of Two House Mouse Subspecies Suggests Divergence during the Gene Family Expansions.

Science.gov (United States)

Pezer, Željka; Chung, Amanda G; Karn, Robert C; Laukaitis, Christina M

2017-06-01

The Androgen-binding protein ( Abp ) gene region of the mouse genome contains 64 genes, some encoding pheromones that influence assortative mating between mice from different subspecies. Using CNVnator and quantitative PCR, we explored copy number variation in this gene family in natural populations of Mus musculus domesticus ( Mmd ) and Mus musculus musculus ( Mmm ), two subspecies of house mice that form a narrow hybrid zone in Central Europe. We found that copy number variation in the center of the Abp gene region is very common in wild Mmd , primarily representing the presence/absence of the final duplications described for the mouse genome. Clustering of Mmd individuals based on this variation did not reflect their geographical origin, suggesting no population divergence in the Abp gene cluster. However, copy number variation patterns differ substantially between Mmd and other mouse taxa. Large blocks of Abp genes are absent in Mmm , Mus musculus castaneus and an outgroup, Mus spretus , although with differences in variation and breakpoint locations. Our analysis calls into question the reliance on a reference genome for interpreting the detailed organization of genes in taxa more distant from the Mmd reference genome. The polymorphic nature of the gene family expansion in all four taxa suggests that the number of Abp genes, especially in the central gene region, is not critical to the survival and reproduction of the mouse. However, Abp haplotypes of variable length may serve as a source of raw genetic material for new signals influencing reproductive communication and thus speciation of mice. © The Author 2017. Published by Oxford University Press on behalf of the Society for Molecular Biology and Evolution.

Meiotic sex chromosome inactivation is disrupted in sterile hybrid male house mice.

Science.gov (United States)

Campbell, Polly; Good, Jeffrey M; Nachman, Michael W

2013-03-01

In male mammals, the X and Y chromosomes are transcriptionally silenced in primary spermatocytes by meiotic sex chromosome inactivation (MSCI) and remain repressed for the duration of spermatogenesis. Here, we test the longstanding hypothesis that disrupted MSCI might contribute to the preferential sterility of heterogametic hybrid males. We studied a cross between wild-derived inbred strains of Mus musculus musculus and M. m. domesticus in which sterility is asymmetric: F1 males with a M. m. musculus mother are sterile or nearly so while F1 males with a M. m. domesticus mother are normal. In previous work, we discovered widespread overexpression of X-linked genes in the testes of sterile but not fertile F1 males. Here, we ask whether this overexpression is specifically a result of disrupted MSCI. To do this, we isolated cells from different stages of spermatogenesis and measured the expression of several genes using quantitative PCR. We found that X overexpression in sterile F1 primary spermatocytes is coincident with the onset of MSCI and persists in postmeiotic spermatids. Using a series of recombinant X genotypes, we then asked whether X overexpression in hybrids is controlled by cis-acting loci across the X chromosome. We found that it is not. Instead, one large interval in the proximal portion of the M. m. musculus X chromosome is associated with both overexpression and the severity of sterility phenotypes in hybrids. These results demonstrate a strong association between X-linked hybrid male sterility and disruption of MSCI and suggest that trans-acting loci on the X are important for the transcriptional regulation of the X chromosome during spermatogenesis.

Inference of historical changes in migration rate from the lengths of migrant tracts

DEFF Research Database (Denmark)

Pool, John E; Nielsen, Rasmus

2009-01-01

After migrant chromosomes enter a population, they are progressively sliced into smaller pieces by recombination. Therefore, the length distribution of "migrant tracts" (chromosome segments with recent migrant ancestry) contains information about historical patterns of migration. Here we introduce...... a theoretical framework describing the migrant tract length distribution and propose a likelihood inference method to test demographic hypotheses and estimate parameters related to a historical change in migration rate. Applying this method to data from the hybridizing subspecies Mus musculus domesticus and M....... m. musculus, we find evidence for an increase in the rate of hybridization. Our findings could indicate an evolutionary trajectory toward fusion rather than speciation in these taxa....

Cryptosporidium tyzzeri and Cryptosporidium muris originated from wild West-European house mice (Mus musculus domesticus) and East-European house mice (Mus musculus musculus) are non-infectious for pigs

Czech Academy of Sciences Publication Activity Database

Kváč, Martin; Kestřánová, M.; Květoňová, Dana; Kotková, M.; Ortega, Y.; McEvoy, J.; Sak, Bohumil

2012-01-01

Roč. 131, č. 1 (2012), s. 107-110 ISSN 0014-4894 R&D Projects: GA MŠk(CZ) LH11061 Grant - others:GA ČR(CZ) GA206/08/0640 Program:GA Institutional support: RVO:60077344 Keywords : Pigs * Cryptosporidium tyzzeri * Cryptosporidium muris * Experimental infection * PCR * Histology Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 2.154, year: 2012 http://www.sciencedirect.com/science/article/pii/S0014489412001105

Computed tomography in Duchenne type muscular dystrophy

International Nuclear Information System (INIS)

Kawai, Mitsuru; Kunimoto, Masanari; Motoyoshi, Yasufumi; Kuwata, Takashi; Nakano, Imaharu

1985-01-01

The computed tomography (CT) scan was performed on 91 Duchenne type muscular dystrophy (DMD) patients on the following four levels; (1) at the level of L3 vertebra, (2) 2-3cm above the symphysis pubica, (3) midposition of the thigh, (4) largest-diameter section of the lower leg. The CT of muscles common to most of the DMD patients were as follows: 1. Muscle atrophy: Muscle atrophy was shown as a reduction in the cross-sectional area of the muscles. Very mild muscle atrophy could be detected either by the clearly identified muscle border or by scattered low-density areas of so-called ''moth-eaten'' appearance within muscles. 2. Fat infiltration: The decrease in radio-density of muscles was interpreted as infiltration of fatty tissue. This type of density change was further classified into diffuse, streaked, cobblestone and salt-and-pepper patterns according to the spacial distribution of low-density areas. 3. Selectivity pattern: As the chronological sequence of DMD muscle degeneration is usually different among individual muscles, it may be seen, in some stages, that some of the synergistic muscles are still only slightly involved, while the others are quite severely atrophied with evident fat infiltration. In certain stages of the disease, most of the patients show relative preservation of particular muscles although they assumed a rounded shape. The most resistent muscle was musculus gracilis, followed by the musculus sartorius, musculus semitendinosus (and/or musculus semimembranosus) in that order. According to the severity of the CT changes, 86 of the 91 patients were classed into five stages from A1 to A5. Morphological stages (A1-A5) were well correlated to the functional disability stages by Ueda with a correlation factor of r=0.88. (J.P.N.)

Genomic networks of hybrid sterility.

Science.gov (United States)

Turner, Leslie M; White, Michael A; Tautz, Diethard; Payseur, Bret A

2014-02-01

Hybrid dysfunction, a common feature of reproductive barriers between species, is often caused by negative epistasis between loci ("Dobzhansky-Muller incompatibilities"). The nature and complexity of hybrid incompatibilities remain poorly understood because identifying interacting loci that affect complex phenotypes is difficult. With subspecies in the early stages of speciation, an array of genetic tools, and detailed knowledge of reproductive biology, house mice (Mus musculus) provide a model system for dissecting hybrid incompatibilities. Male hybrids between M. musculus subspecies often show reduced fertility. Previous studies identified loci and several X chromosome-autosome interactions that contribute to sterility. To characterize the genetic basis of hybrid sterility in detail, we used a systems genetics approach, integrating mapping of gene expression traits with sterility phenotypes and QTL. We measured genome-wide testis expression in 305 male F2s from a cross between wild-derived inbred strains of M. musculus musculus and M. m. domesticus. We identified several thousand cis- and trans-acting QTL contributing to expression variation (eQTL). Many trans eQTL cluster into eleven 'hotspots,' seven of which co-localize with QTL for sterility phenotypes identified in the cross. The number and clustering of trans eQTL-but not cis eQTL-were substantially lower when mapping was restricted to a 'fertile' subset of mice, providing evidence that trans eQTL hotspots are related to sterility. Functional annotation of transcripts with eQTL provides insights into the biological processes disrupted by sterility loci and guides prioritization of candidate genes. Using a conditional mapping approach, we identified eQTL dependent on interactions between loci, revealing a complex system of epistasis. Our results illuminate established patterns, including the role of the X chromosome in hybrid sterility. The integrated mapping approach we employed is applicable in a broad

Extraction, Identification and Biological Activities of Saponins in Sea Cucumber Pearsonothuria graeffei.

Science.gov (United States)

Khattab, Rafat Afifi; Elbandy, Mohamed; Lawrence, Andrew; Paget, Tim; Rae-Rho, Jung; Binnaser, Yaser S; Ali, Imran

2018-01-01

Secondary metabolism in marine organisms produces a diversity of biologically important natural compounds that are not present in terrestrial species. Sea cucumbers belong to the invertebrate Echinodermata and are famous for their nutraceutical, medical and food values. They are known for possession triterpenoid glycosides (saponins) with various ecological roles. The current work aimed to separate, identify and test various biological activities (antibacterial, antifungal, antileishmanial and anticancer properties) of saponins produced by the holothurian Pearsonothuria graeffei from the Red Sea, Egypt. The structures were identified by 1D and 2D NMR (1H, 13C, TOCSY, COSY, HSQC, HMBC, and ROESY) experiments and acid hydrolysis. The crude and purified fractions was analyzed using matrix-assisted laser desorption/ionization mass spectrometry (MALDI-MS)/MS to identify saponins and characterize their molecular structures. Partially purified fraction, mainly containing compounds 1 and 2, was screened for its antifungal activity against three clinical isolates of Candida albicans (Candida 580 (1), Candida 581(2) and Candida MEO47228. Antileishmanial activity against Leishmania major and toxicity on colon cell-line were also evaluated. Two lanostane type sulfated triterpene monoglycosides were isolated from the Holothurian Pearsonothuria graeffei from the Red Sea, Egypt. Holothurin A (1) and echinoside A (2) triterpene saponins were separated by reversed phase semi-preparative HPLC. LC50 values (µg/mL); calculated for the fraction containing saponins 1 and 2 as major constituents; against Candida albicans, Leishmania major and colon cell-line were 10, 20 and 0.50, respectively. Consequently, this study demonstrated the potential use of sea cucumber Pearsonothuria graeffei not only as appreciated functional food or nutraceuticals but also as the source of functional ingredients for pharmaceutical products with antifungal, antileishmanial and anticancer properties

The central nervous system of sea cucumbers (Echinodermata: Holothuroidea shows positive immunostaining for a chordate glial secretion

Directory of Open Access Journals (Sweden)

Grondona Jesus M

2009-06-01

Full Text Available Abstract Background Echinoderms and chordates belong to the same monophyletic taxon, the Deuterostomia. In spite of significant differences in body plan organization, the two phyla may share more common traits than was thought previously. Of particular interest are the common features in the organization of the central nervous system. The present study employs two polyclonal antisera raised against bovine Reissner's substance (RS, a secretory product produced by glial cells of the subcomissural organ, to study RS-like immunoreactivity in the central nervous system of sea cucumbers. Results In the ectoneural division of the nervous system, both antisera recognize the content of secretory vacuoles in the apical cytoplasm of the radial glia-like cells of the neuroepithelium and in the flattened glial cells of the non-neural epineural roof epithelium. The secreted immunopositive material seems to form a thin layer covering the cell apices. There is no accumulation of the immunoreactive material on the apical surface of the hyponeural neuroepithelium or the hyponeural roof epithelium. Besides labelling the supporting cells and flattened glial cells of the epineural roof epithelium, both anti-RS antisera reveal a previously unknown putative glial cell type within the neural parenchyma of the holothurian nervous system. Conclusion Our results show that: a the glial cells of the holothurian tubular nervous system produce a material similar to Reissner's substance known to be synthesized by secretory glial cells in all chordates studied so far; b the nervous system of sea cucumbers shows a previously unrealized complexity of glial organization. Our findings also provide significant clues for interpretation of the evolution of the nervous system in the Deuterostomia. It is suggested that echinoderms and chordates might have inherited the RS-producing radial glial cell type from the central nervous system of their common ancestor, i.e., the last common

Sex Determination in Sea Cucumbers: Holothuria forskali and Stichopus regalis

Directory of Open Access Journals (Sweden)

Filipa Pinheiro Santos

2014-06-01

Full Text Available Sea cucumber aquaculture is underexploited in temperate regions, and it is inexistent in Portugal. However, there are some species with a large potential for this sector, namely Stichopus regalis and Holothuria forskali, as it their nutritional value. S. regalis is a common sea cucumber that is found in a wide depth range and is currently consumed all over the world, majority in Asia, with a high commercial value. On the other hand, H. forskali is the most plentiful specie of the Portuguese coast. The purpose of this study is to evaluate sex ratio on both species through biopsy method, using biopsy needle to collect a piece of gonad. Holothurian specimens were sampled coastwise in Peniche, Portugal (39° 21′ 32″ N, 9° 22′ 40″ W. A total of 45 H. forskali were collected in the low tide and 48 S. regalis were caught by trawl method. Both species were kept in captivity during 8 months, the rearing conditions are maintained close as possible to the natural habitat, and they were placed in a sand bottom. Mortality was evaluated during conditioning period, and it was verified approximately 19% of mortality in S. regalis, although in H. forskali it was not observed. Sex identification was performed with success only in H. forskali, and sexual ratio found was 1:1. All S. regalis specimens arrived eviscerated to the Aquaculture Laboratory and it was caused by the trawl capture method. For that reason, it was not possible to assess the sexual ratio. The possibility to distinguish holothurian genre is essential to realize sexual behavior, and to ease the understanding of reproductive cycle in attempt to introduce these new species for aquaculture rearing.

AcEST: BP916012 [AcEST

Lifescience Database Archive (English)

Full Text Available ne... 29 6.4 sp|P07335|KCRB_RAT Creatine kinase B-type OS=Rattus norvegicus G... 29 6.4 sp|Q04447|KCRB_MOUSE Creatine... kinase B-type OS=Mus musculus GN=C... 29 6.4 sp|P05122|KCRB_CHICK Creatine kinase B-type OS=Gallu...N=ARSH... 29 6.4 sp|O13879|YE1F_SCHPO Uncharacterized transporter C1B3.15C OS=Sch... 29 8.3 sp|P24722|KCRT_ONCMY Creatine...6 LESGFDAQSRTKLSDLS 36 +ES +D +++ D+S Sbjct: 119 IESKYDVHTKSVTVDVS 135 >sp|P07335|KCRB_RAT Creatine...DGDLSGRYYALKSMTEAEQQQLIDDHFLFDKPV 198 >sp|Q04447|KCRB_MOUSE Creatine kinase B-type OS=Mus musculus GN=Ckb PE

AcEST: DK962347 [AcEST

Lifescience Database Archive (English)

Full Text Available ... 33 1.1 sp|Q7TSF1|DSG1B_MOUSE Desmoglein-1-beta OS=Mus musculus GN=Dsg1b... 31... 30 7.4 sp|Q61495|DSG1A_MOUSE Desmoglein-1-alpha OS=Mus musculus GN=Dsg1... 30 7.4 sp|Q9SIB4|WOX3_ARATH WUSC...hia co... 30 9.6 sp|Q01550|TANA_XENLA Tanabin OS=Xenopus laevis PE=2 SV=1 30 9.6 sp|Q7TSF0|DSG1C_MOUSE Desmog...VAEYVTH 428 IVG WDE LP D V E+ E+V+H Sbjct: 322 IVGGNWDEVLPVDVRVPEEIQEFVSH 347 >sp|Q7TSF1|DSG1B_MOUSE Desmogl

PREVALENCE OF SOME HELMINTHS IN RODENTS CAPTURED FROM DIFFERENT CITY STRUCTURES INCLUDING POULTRY FARMS AND HUMAN POPULATION OF FAISALABAD, PAKISTAN

Directory of Open Access Journals (Sweden)

A. RAFIQUE, S. A. RANA, H. A. KHAN AND A. SOHAIL1

2009-07-01

Full Text Available The aim of the present study was to investigate prevalence of zoonotic helminths from human, Rattus rattus (R. rattus, Rattus norvegicus (R. norvegicus and Mus musculus of eight different structures, namely grain shops in grain market, departmental stores, railway godowns, food processing plants (bakeries, poultry farms, houses in kachi-abadies, houses in departmental colonies and posh residences and banglows in Faisalabad city. All the structures were sampled for 2 months each and completed in 16 months. Highest prevalence (70% of Vsmpirolepis spp. was observed in R. rattus sampled from poultry farms, which was significantly higher (P<0.05 than the prevalence of all the helminths recovered from other structures. Hymenolepis nana (H. nana was observed in 60% of the sampled Mus musculus collected from kachi-abadies, which was significantly higher (P<0.05 than all other structures studies for H. nana, except R. rattus from kachi-abadies (55% and R. norvegicus from grain shops in grain market (55%. The rodent’s endo-parasites viz., Hymenolepis nana, Teania taenaeformis, Entrobius spps and Trichuiris spps observed in R. rattus, R. norvegicus and M. musculus at different percentages were also recorded in human stool samples with an incidence of 48, 21, 76 and 10%, respectively.

The genomic ancestry, landscape genetics and invasion history of introduced mice in New Zealand.

Science.gov (United States)

Veale, Andrew J; Russell, James C; King, Carolyn M

2018-01-01

The house mouse ( Mus musculus ) provides a fascinating system for studying both the genomic basis of reproductive isolation, and the patterns of human-mediated dispersal. New Zealand has a complex history of mouse invasions, and the living descendants of these invaders have genetic ancestry from all three subspecies, although most are primarily descended from M. m. domesticus . We used the GigaMUGA genotyping array (approximately 135 000 loci) to describe the genomic ancestry of 161 mice, sampled from 34 locations from across New Zealand (and one Australian city-Sydney). Of these, two populations, one in the south of the South Island, and one on Chatham Island, showed complete mitochondrial lineage capture, featuring two different lineages of M. m. castaneus mitochondrial DNA but with only M. m. domesticus nuclear ancestry detectable. Mice in the northern and southern parts of the North Island had small traces (approx. 2-3%) of M. m. castaneus nuclear ancestry, and mice in the upper South Island had approximately 7-8% M. m. musculus nuclear ancestry including some Y-chromosomal ancestry-though no detectable M. m. musculus mitochondrial ancestry. This is the most thorough genomic study of introduced populations of house mice yet conducted, and will have relevance to studies of the isolation mechanisms separating subspecies of mice.

A complex genetic basis to X-linked hybrid male sterility between two species of house mice.

Science.gov (United States)

Good, Jeffrey M; Dean, Matthew D; Nachman, Michael W

2008-08-01

The X chromosome plays a central role in the evolution of reproductive isolation, but few studies have examined the genetic basis of X-linked incompatibilities during the early stages of speciation. We report the results of a large experiment focused on the reciprocal introgression of the X chromosome between two species of house mice, Mus musculus and M. domesticus. Introgression of the M. musculus X chromosome into a wild-derived M. domesticus genetic background produced male-limited sterility, qualitatively consistent with previous experiments using classic inbred strains to represent M. domesticus. The genetic basis of sterility involved a minimum of four X-linked factors. The phenotypic effects of major sterility QTL were largely additive and resulted in complete sterility when combined. No sterility factors were uncovered on the M. domesticus X chromosome. Overall, these results revealed a complex and asymmetric genetic basis to X-linked hybrid male sterility during the early stages of speciation in mice. Combined with data from previous studies, we identify one relatively narrow interval on the M. musculus X chromosome involved in hybrid male sterility. Only a handful of spermatogenic genes are within this region, including one of the most rapidly evolving genes on the mouse X chromosome.

[Effect of heterozygosity for insertions of homogeneously stained regions in chromosome 1 of the house mouse on synapsis in meiotic prophase].

Science.gov (United States)

Borodin, P M; Ladygina, T Iu; Gorlov, I P

1989-02-01

Electron microscope analysis of surface-spread synaptonemal complexes (SC) in oocytes and spermatocytes from double cis heterozygotes for Is(HSR; 1C5)1Icg and Is(HSR; 1E3)2Icg was carried out. Aberrant chromosomes were isolated from the feral population of Mus musculus musculus of Novosibirsk. They contain homogeneously stained regions of total length of about 30% of Chr 1 mitotic metaphase. Heteromorphic bivalents of Chr1 with different lengths of the lateral elements of SC and the loop in the intermedial position were revealed in 4.4% spermatocytes and 20% oocytes of heterozygous animals. The loop size depends on the stage of meiosis: it is maximal at late zygotene and decreases up to disappearance during pachytene.

Dicty_cDB: Contig-U12567-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available S1) RecName: Full=Protein lava lamp; &AE014298_609(AE01429... 36 4.2 EU708920_1( EU708920 |pid:none) Canine rotavirus...none) Mus musculus B16 F10Y cells cDNA, ... 35 7.1 DQ005106_1( DQ005106 |pid:none) Human rotavirus... Full=Myosin-9; AltName: Full=Myosin heavy chai... 35 7.1 AY787649_1( AY787649 |pid:none) Human rotavirus A ...7211_1( AK147211 |pid:none) Mus musculus 15 days embryo liver ... 35 7.1 EF554090_1( EF554090 |pid:none) Human rotavirus...rotein 3; Short=... 35 7.1 EF672579_1( EF672579 |pid:none) Human rotavirus A strain DS-1 non-... 35 7.1 ( Q6

Phylogenetic relationship and time of divergence of Mus terricolor ...

Indian Academy of Sciences (India)

2016-06-06

Jun 6, 2016 ... ... Developmental Biology, National Heart Lung and Blood Institute, National Institutes of Health, .... matic short arms in homozygous conditions (Sen and Sharma ..... differences in selection pressure between M. musculus and.

Parasitic and fungal infections in synanthropic rodents in an area of urban expansion, Aracaju, Sergipe State, Brazil - doi: 10.4025/actascibiolsci.v36i1.19760

Directory of Open Access Journals (Sweden)

Adriana Oliveira Guimarães

2013-09-01

Full Text Available This study analysed the prevalence of parasitic and fungal infections in rodents in an area of urban expansion, Aracaju, Brazil. Traps were placed in the area from December 2011 to January 2013. Blood samples, faeces and hair were collected from the animals. We collected a total of 47 rodents; 44 were Rattus rattus, and 3 were Mus musculus. Parasitological evaluation revealed the cestode Hymenolepis diminuta infection in both rodent species. The nematodes Aspiculuris tetraptera and Syphacia obvelata were found in M. musculus, and the commensal Entamoeba coli was found in R. rattus. We observed that 69.2% of the R. rattus and 33.3% of the M. musculus were infected with the haemoparasite Babesia sp. The differential leukocyte count revealed normal (72.3%, neutrophilic (15.9% and lymphocytic (11.4% profiles. The evaluation showed the following species of fungi in the rodents: Aspergillus sp. (77.1%, Penicillium sp. (28.6%, Cladosporium sp. (14.3%, Mucor sp. (14.3%, Curvularia sp. (8.6%, Acremonium sp. (8.6%, Chrysosporium sp. (2.9%, Syncephalostrum sp. (2.9%, Alternaria sp. (2.9%, Trichophyton sp. (2.9% and Scopulariopsis sp. (2.9%. The parasites and fungi found in rodents are potentially zoonotic, and the presence of these household animals demonstrates their potential role as reservoirs and disseminators of fungal and parasitic infections.

Serine/threonine-protein phosphatase 1 α levels are paralleling olfactory memory formation in the CD1 mouse.

Science.gov (United States)

Winding, Christiana; Sun, Yanwei; Höger, Harald; Bubna-Littitz, Hermann; Pollak, Arnold; Schmidt, Peter; Lubec, Gert

2011-06-01

Although olfactory discrimination has already been studied in several mouse strains, data on protein levels linked to olfactory memory are limited. Wild mouse strains Mus musculus musculus, Mus musculus domesticus and CD1 laboratory outbred mice were tested in a conditioned odor preference task and trained to discriminate between two odors, Rose and Lemon, by pairing one odor with a sugar reward. Six hours following the final test, mice were sacrificed and olfactory bulbs (OB) were taken for gel-based proteomics analyses and immunoblotting. OB proteins were extracted, separated by 2-DE and quantified using specific software (Proteomweaver). Odor-trained mice showed a preference for the previously rewarded odor suggesting that conditioned odor preference occurred. In CD1 mice levels, one out of 482 protein spots was significantly increased in odor-trained mice as compared with the control group; it was in-gel digested by trypsin and chymotrypsin and analyzed by tandem mass spectrometry (nano-ESI-LC-MS/MS). The spot was unambiguously identified as serine/threonine-protein phosphatase PP1-α catalytic subunit (PP-1A) and differential levels observed in gel-based proteomic studies were verified by immunoblotting. PP-1A is a key signalling element in synaptic plasticity and memory processes and is herein shown to be paralleling olfactory discrimination representing olfactory memory. Copyright © 2011 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

The genomic ancestry, landscape genetics and invasion history of introduced mice in New Zealand

Science.gov (United States)

Russell, James C.; King, Carolyn M.

2018-01-01

The house mouse (Mus musculus) provides a fascinating system for studying both the genomic basis of reproductive isolation, and the patterns of human-mediated dispersal. New Zealand has a complex history of mouse invasions, and the living descendants of these invaders have genetic ancestry from all three subspecies, although most are primarily descended from M. m. domesticus. We used the GigaMUGA genotyping array (approximately 135 000 loci) to describe the genomic ancestry of 161 mice, sampled from 34 locations from across New Zealand (and one Australian city—Sydney). Of these, two populations, one in the south of the South Island, and one on Chatham Island, showed complete mitochondrial lineage capture, featuring two different lineages of M. m. castaneus mitochondrial DNA but with only M. m. domesticus nuclear ancestry detectable. Mice in the northern and southern parts of the North Island had small traces (approx. 2–3%) of M. m. castaneus nuclear ancestry, and mice in the upper South Island had approximately 7–8% M. m. musculus nuclear ancestry including some Y-chromosomal ancestry—though no detectable M. m. musculus mitochondrial ancestry. This is the most thorough genomic study of introduced populations of house mice yet conducted, and will have relevance to studies of the isolation mechanisms separating subspecies of mice. PMID:29410804

Genomic networks of hybrid sterility.

Directory of Open Access Journals (Sweden)

Leslie M Turner

2014-02-01

Full Text Available Hybrid dysfunction, a common feature of reproductive barriers between species, is often caused by negative epistasis between loci ("Dobzhansky-Muller incompatibilities". The nature and complexity of hybrid incompatibilities remain poorly understood because identifying interacting loci that affect complex phenotypes is difficult. With subspecies in the early stages of speciation, an array of genetic tools, and detailed knowledge of reproductive biology, house mice (Mus musculus provide a model system for dissecting hybrid incompatibilities. Male hybrids between M. musculus subspecies often show reduced fertility. Previous studies identified loci and several X chromosome-autosome interactions that contribute to sterility. To characterize the genetic basis of hybrid sterility in detail, we used a systems genetics approach, integrating mapping of gene expression traits with sterility phenotypes and QTL. We measured genome-wide testis expression in 305 male F2s from a cross between wild-derived inbred strains of M. musculus musculus and M. m. domesticus. We identified several thousand cis- and trans-acting QTL contributing to expression variation (eQTL. Many trans eQTL cluster into eleven 'hotspots,' seven of which co-localize with QTL for sterility phenotypes identified in the cross. The number and clustering of trans eQTL-but not cis eQTL-were substantially lower when mapping was restricted to a 'fertile' subset of mice, providing evidence that trans eQTL hotspots are related to sterility. Functional annotation of transcripts with eQTL provides insights into the biological processes disrupted by sterility loci and guides prioritization of candidate genes. Using a conditional mapping approach, we identified eQTL dependent on interactions between loci, revealing a complex system of epistasis. Our results illuminate established patterns, including the role of the X chromosome in hybrid sterility. The integrated mapping approach we employed is

Experiment list: SRX655691 [Chip-atlas[Archive

Lifescience Database Archive (English)

Full Text Available ; Mus musculus; ChIP-Seq source_name=MEFs cells knockout MED23 || cell type=mouse embryonic fibroblast || ge...notype/variation=MED23 knockout || chip antibody=H2Bub http://dbarchive.bioscienc

Experiment list: SRX191071 [Chip-atlas[Archive

Lifescience Database Archive (English)

Full Text Available Mus musculus; ChIP-Seq source_name=Kdm2b knockdown mouse ES cells || chip antibody=Flag || antibody manufact... || cell type=embryonbic stem cells || genotype=Kdm2b knockdown http://dbarchive.

Experiment list: ERX144553 [Chip-atlas[Archive

Lifescience Database Archive (English)

Full Text Available tene piRNA promoters in mammals Organism=Mus musculus || Sex=male || OrganismPart=testis || StrainOrLine=C57...,10.6,612 Illumina Genome Analyzer II sequencing; Ricochet transcription of pachy

Experiment list: ERX144540 [Chip-atlas[Archive

Lifescience Database Archive (English)

Full Text Available tene piRNA promoters in mammals Organism=Mus musculus || Sex=male || OrganismPart=testis || StrainOrLine=C57...,50.4,823 Illumina Genome Analyzer II sequencing; Ricochet transcription of pachy

Experiment list: ERX144550 [Chip-atlas[Archive

Lifescience Database Archive (English)

Full Text Available tene piRNA promoters in mammals Organism=Mus musculus || Sex=male || OrganismPart=testis || StrainOrLine=C57...,36.5,731 Illumina Genome Analyzer II sequencing; Ricochet transcription of pachy

First report of [i]Enterocytozoon[/i] bieneusi and [i]Encephalitozoon intestinalis[/i] infection of wild mice in Slovakia

Directory of Open Access Journals (Sweden)

Oľga Danišová

2015-05-01

Full Text Available Increased risk of zoonotic transmission of the potential human pathogenic species [i]Enterocytozoon bieneusi[/i], [i]Encephalitozoon intestinalis[/i] and [i]Encephalitozoon cuniculi [/i]was detected in wild immunocompetent mice (Mus musculus musculus; n=280. Analysis was conducted with the use of PMP1/PMP2 primers and SYBR Green RT-PCR. Using Real Time PCR and comparing the sequences with sequences in the GenBank, [i]E. bieneusi[/i] was detected in 3 samples (1.07 %, [i]E. cuniculi [/i]in 1 sample (0.35 % and [i]E. intestinalis[/i] in 1 sample (0.35 %. The results of this report document the low host specificity of detected microsporidia species, and imply the importance of synanthropic rodents as a potential source of human microsporidial infection.

Genome-wide mapping in a house mouse hybrid zone reveals hybrid sterility loci and Dobzhansky-Muller interactions.

Science.gov (United States)

Turner, Leslie M; Harr, Bettina

2014-12-09

Mapping hybrid defects in contact zones between incipient species can identify genomic regions contributing to reproductive isolation and reveal genetic mechanisms of speciation. The house mouse features a rare combination of sophisticated genetic tools and natural hybrid zones between subspecies. Male hybrids often show reduced fertility, a common reproductive barrier between incipient species. Laboratory crosses have identified sterility loci, but each encompasses hundreds of genes. We map genetic determinants of testis weight and testis gene expression using offspring of mice captured in a hybrid zone between M. musculus musculus and M. m. domesticus. Many generations of admixture enables high-resolution mapping of loci contributing to these sterility-related phenotypes. We identify complex interactions among sterility loci, suggesting multiple, non-independent genetic incompatibilities contribute to barriers to gene flow in the hybrid zone.

Arabidopsis CDS blastp result: AK105677 [KOME

Lifescience Database Archive (English)

Full Text Available AK105677 001-201-B01 At2g39090.1 tetratricopeptide repeat (TPR)-containing protein low similarity to prediab...etic NOD sera-reactive autoantigen [Mus musculus] GI:6670773, anaphase-promoting co

Arabidopsis CDS blastp result: AK119376 [KOME

Lifescience Database Archive (English)

Full Text Available AK119376 001-132-A09 At2g39090.1 tetratricopeptide repeat (TPR)-containing protein low similarity to prediab...etic NOD sera-reactive autoantigen [Mus musculus] GI:6670773, anaphase-promoting co

Arabidopsis CDS blastp result: AK101105 [KOME

Lifescience Database Archive (English)

Full Text Available AK101105 J033025D11 At2g39090.1 tetratricopeptide repeat (TPR)-containing protein low similarity to prediabe...tic NOD sera-reactive autoantigen [Mus musculus] GI:6670773, anaphase-promoting com

Experiment list: SRX655693 [Chip-atlas[Archive

Lifescience Database Archive (English)

Full Text Available ut KO ChIPSeq; Mus musculus; ChIP-Seq source_name=MEFs cells knockout MED23 || cell type=mouse embryonic fib...roblast || genotype/variation=MED23 knockout http://dbarchive.biosciencedbc.jp/ky

Experiment list: ERX144535 [Chip-atlas[Archive

Lifescience Database Archive (English)

Full Text Available ene piRNA promoters in mammals Organism=Mus musculus || Sex=male || OrganismPart=testis || StrainOrLine=C57B...,4.7,550 Illumina Genome Analyzer II sequencing; Ricochet transcription of pachyt

Experiment list: ERX144534 [Chip-atlas[Archive

Lifescience Database Archive (English)

Full Text Available ene piRNA promoters in mammals Organism=Mus musculus || Sex=male || OrganismPart=testis || StrainOrLine=C57B...,9.7,783 Illumina Genome Analyzer II sequencing; Ricochet transcription of pachyt

Experiment list: ERX144518 [Chip-atlas[Archive

Lifescience Database Archive (English)

Full Text Available ene piRNA promoters in mammals Organism=Mus musculus || Sex=male || OrganismPart=testis || StrainOrLine=C57B...,9.5,922 Illumina Genome Analyzer II sequencing; Ricochet transcription of pachyt

Experiment list: ERX144532 [Chip-atlas[Archive

Lifescience Database Archive (English)

Full Text Available ene piRNA promoters in mammals Organism=Mus musculus || Sex=male || OrganismPart=testis || StrainOrLine=C57B...,5.0,146 Illumina Genome Analyzer II sequencing; Ricochet transcription of pachyt

Experiment list: SRX685873 [Chip-atlas[Archive

Lifescience Database Archive (English)

Full Text Available lance, and learn motor skills. 200858891,0.0,11.0,0 GSM1486386: P14 Cerebellum DNase-seq Rep 3; Mus musculus...cerebellar nuclei. Its function is to coordinate voluntary movements, maintain ba

Experiment list: SRX685868 [Chip-atlas[Archive

Lifescience Database Archive (English)

Full Text Available lance, and learn motor skills. 68545959,0.0,55.7,0 GSM1486381: P7 Cerebellum DNase-seq Rep 1; Mus musculus; ...cerebellar nuclei. Its function is to coordinate voluntary movements, maintain ba

Experiment list: SRX685869 [Chip-atlas[Archive

Lifescience Database Archive (English)

Full Text Available lance, and learn motor skills. 59999511,0.0,67.3,0 GSM1486382: P7 Cerebellum DNase-seq Rep 2; Mus musculus; ...cerebellar nuclei. Its function is to coordinate voluntary movements, maintain ba

Experiment list: SRX685870 [Chip-atlas[Archive

Lifescience Database Archive (English)

Full Text Available lance, and learn motor skills. 64161152,0.0,70.9,0 GSM1486383: P7 Cerebellum DNase-seq Rep 3; Mus musculus; ...cerebellar nuclei. Its function is to coordinate voluntary movements, maintain ba

Experiment list: SRX685875 [Chip-atlas[Archive

Lifescience Database Archive (English)

Full Text Available lance, and learn motor skills. 181337188,0.0,0.0,0 GSM1486388: P60 Cerebellum DNase-seq Rep 2; Mus musculus;...cerebellar nuclei. Its function is to coordinate voluntary movements, maintain ba

Experiment list: SRX685871 [Chip-atlas[Archive

Lifescience Database Archive (English)

Full Text Available lance, and learn motor skills. 160531350,0.0,11.8,0 GSM1486384: P14 Cerebellum DNase-seq Rep 1; Mus musculus...cerebellar nuclei. Its function is to coordinate voluntary movements, maintain ba

Experiment list: SRX286394 [Chip-atlas[Archive

Lifescience Database Archive (English)

Full Text Available 3: AR Cast1 [kidney, castrated+vehicle]; Mus musculus; ChIP-Seq source_name=AR_Cast1 || strain=wild type ICR... || tissue=kidney || age=8-12 weeks old || treatment=castrated+vehicle || chip an

Mouse lipocalins (MUP, OBP, LCN) are co-expressed in tissues involved in chemical communication

Czech Academy of Sciences Publication Activity Database

Stopková, R.; Vinkler, D.; Kuntová, B.; Šedo, O.; Albrecht, T.; Suchan, J.; Dvořáková-Hortová, Kateřina; Zdráhal, Z.; Stopka, P.

2016-01-01

Roč. 47, č. 4 (2016), s. 1-11 ISSN 2296-701X Institutional support: RVO:86652036 Keywords : lipocalin * odorant * chemical communication * Mus musculus * olfaction Subject RIV: EB - Genetics ; Molecular Biology OBOR OECD: Biochemistry and molecular biology

Experiment list: SRX655689 [Chip-atlas[Archive

Lifescience Database Archive (English)

Full Text Available 8698: pol2 KO ChIPSeq; Mus musculus; ChIP-Seq source_name=MEFs cells knockout MED23 || cell type=mouse embry...onic fibroblast || genotype/variation=MED23 knockout || chip antibody=Pol II http

Experiment list: SRX306691 [Chip-atlas[Archive

Lifescience Database Archive (English)

Full Text Available ,1728 GSM1164903: chipseq KO H3K27me3; Mus musculus; ChIP-Seq source_name=neonatal tail tip fibroblasts, Hotair knock...ts || genotype/variation=Hotair knockout http://dbarchive.biosciencedbc.jp/kyushu

Examiner's finger-mounted near-infrared spectroscopy is feasible to analyze cerebral and skeletal muscle oxygenation in conscious Chihuahuas

Science.gov (United States)

Hiwatashi, Keisuke; Doi, Kimiaki; Mizuno, Risuke; Yokosuka, Makoto

2017-02-01

To measure regional saturation of oxygen (rSO2) of hemoglobin and total hemoglobin index (HbI) in the brain (through the molera of the head) and skeletal muscle (musculus gracilis) of conscious Chihuahua dogs using an examiner's finger-mounted near-infrared spectroscopy (NIRS) device, Toccare, we investigated brain and skeletal muscle NIRS in 48 Chihuahuas without severe disease. To measure rSO2 and total HbI, a Toccare probe was placed on the molera of the head and musculus gracilis of each dog for real-time recording. Stable NIRS values were obtained within 10 s. We also examined the effect of anesthesia on rSO2 and total HbI of a Chihuahua. Cerebral rSO2 values (59%±7%) were significantly lower than those obtained at femoral regions (67%±6%), whereas total HbI values in the brain (0.38±0.09) were significantly higher than those of the musculus gracilis (0.20±0.05). Sedation with a combination of medetomidine and ketamine decreased cerebral rSO2 along with a corresponding reduction in heart rate. Sevoflurane anesthesia with 100% O2 maintained rSO2 in the brain with an even lower heart rate. In conclusions, we measured brain and skeletal muscle rSO2 of hemoglobin in conscious Chihuahuas using a newly developed NIRS device, Toccare, and found that changes in cerebral oxygenation levels were associated with administration of anesthetics.

Molecular phylogeny of the bivalve superfamily Galeommatoidea (Heterodonta, Veneroida) reveals dynamic evolution of symbiotic lifestyle and interphylum host switching

Science.gov (United States)

2012-01-01

Background Galeommatoidea is a superfamily of bivalves that exhibits remarkably diverse lifestyles. Many members of this group live attached to the body surface or inside the burrows of other marine invertebrates, including crustaceans, holothurians, echinoids, cnidarians, sipunculans and echiurans. These symbiotic species exhibit high host specificity, commensal interactions with hosts, and extreme morphological and behavioral adaptations to symbiotic life. Host specialization to various animal groups has likely played an important role in the evolution and diversification of this bivalve group. However, the evolutionary pathway that led to their ecological diversity is not well understood, in part because of their reduced and/or highly modified morphologies that have confounded traditional taxonomy. This study elucidates the taxonomy of the Galeommatoidea and their evolutionary history of symbiotic lifestyle based on a molecular phylogenic analysis of 33 galeommatoidean and five putative galeommatoidean species belonging to 27 genera and three families using two nuclear ribosomal genes (18S and 28S ribosomal DNA) and a nuclear (histone H3) and mitochondrial (cytochrome oxidase subunit I) protein-coding genes. Results Molecular phylogeny recovered six well-supported major clades within Galeommatoidea. Symbiotic species were found in all major clades, whereas free-living species were grouped into two major clades. Species symbiotic with crustaceans, holothurians, sipunculans, and echiurans were each found in multiple major clades, suggesting that host specialization to these animal groups occurred repeatedly in Galeommatoidea. Conclusions Our results suggest that the evolutionary history of host association in Galeommatoidea has been remarkably dynamic, involving frequent host switches between different animal phyla. Such an unusual pattern of dynamic host switching is considered to have resulted from their commensalistic lifestyle, in which they maintain filter

Molecular phylogeny of the bivalve superfamily Galeommatoidea (Heterodonta, Veneroida reveals dynamic evolution of symbiotic lifestyle and interphylum host switching

Directory of Open Access Journals (Sweden)

Goto Ryutaro

2012-09-01

Full Text Available Abstract Background Galeommatoidea is a superfamily of bivalves that exhibits remarkably diverse lifestyles. Many members of this group live attached to the body surface or inside the burrows of other marine invertebrates, including crustaceans, holothurians, echinoids, cnidarians, sipunculans and echiurans. These symbiotic species exhibit high host specificity, commensal interactions with hosts, and extreme morphological and behavioral adaptations to symbiotic life. Host specialization to various animal groups has likely played an important role in the evolution and diversification of this bivalve group. However, the evolutionary pathway that led to their ecological diversity is not well understood, in part because of their reduced and/or highly modified morphologies that have confounded traditional taxonomy. This study elucidates the taxonomy of the Galeommatoidea and their evolutionary history of symbiotic lifestyle based on a molecular phylogenic analysis of 33 galeommatoidean and five putative galeommatoidean species belonging to 27 genera and three families using two nuclear ribosomal genes (18S and 28S ribosomal DNA and a nuclear (histone H3 and mitochondrial (cytochrome oxidase subunit I protein-coding genes. Results Molecular phylogeny recovered six well-supported major clades within Galeommatoidea. Symbiotic species were found in all major clades, whereas free-living species were grouped into two major clades. Species symbiotic with crustaceans, holothurians, sipunculans, and echiurans were each found in multiple major clades, suggesting that host specialization to these animal groups occurred repeatedly in Galeommatoidea. Conclusions Our results suggest that the evolutionary history of host association in Galeommatoidea has been remarkably dynamic, involving frequent host switches between different animal phyla. Such an unusual pattern of dynamic host switching is considered to have resulted from their commensalistic lifestyle, in

Experiment list: SRX1121725 [Chip-atlas[Archive

Lifescience Database Archive (English)

Full Text Available ChIPSeq; Mus musculus; ChIP-Seq source_name=MEFs cells knockout MED23 || cell type=mouse embryonic fibroblas...t || genotype/variation=MED23 knockout || chip antibody=H3K4me3 http://dbarchive.

Experiment list: SRX306689 [Chip-atlas[Archive

Lifescience Database Archive (English)

Full Text Available 7,15960 GSM1164901: chipseq KO H3K4me3; Mus musculus; ChIP-Seq source_name=neonatal tail tip fibroblasts, Hotair knock...sts || genotype/variation=Hotair knockout http://dbarchive.biosciencedbc.jp/kyush

Experiment list: SRX186172 [Chip-atlas[Archive

Lifescience Database Archive (English)

Full Text Available 1=YY1 || chip antibody manufacturer 1=Abcam || chip antibody 2=YY1 || chip antibody manufacturer 2=Santa Cru...ip-Seq; Mus musculus; ChIP-Seq source_name=Rag1 -/- pro-B cells || chip antibody

Female partner preferences enhance offspring ability to survive an infection.

Science.gov (United States)

Raveh, Shirley; Sutalo, Sanja; Thonhauser, Kerstin E; Thoß, Michaela; Hettyey, Attila; Winkelser, Friederike; Penn, Dustin J

2014-01-23

It is often suggested that mate choice enhances offspring immune resistance to infectious diseases. To test this hypothesis, we conducted a study with wild-derived house mice (Mus musculus musculus) in which females were experimentally mated either with their preferred or non-preferred male, and their offspring were infected with a mouse pathogen, Salmonella enterica (serovar Typhimurium). We found that offspring sired by preferred males were significantly more likely to survive the experimental infection compared to those sired by non-preferred males. We found no significant differences in the pathogen clearance or infection dynamics between the infected mice, suggesting that offspring from preferred males were better able to cope with infection and had improved tolerance rather than immune resistance. Our results provide the first direct experimental evidence within a single study that partner preferences enhance offspring resistance to infectious diseases.

Mammalian life histories: their evolution and molecular-genetic mechanisms

Energy Technology Data Exchange (ETDEWEB)

Sacher, G.A.

1978-01-01

Survival curves for various species of mammals are discussed and a table is presented to show recorded maximum life spans of about 30 species of mammals. The range of longevities is from one year for shrews and moles up to more than 80 years for the fin whale. The constitutional correlates of longevity are discussed with regard to body size, brain weight,metabolic rates, and body temperature. It is concluded that longevity evolved as a positive trait, associated with the evolution of large body size and brain size. Life table data for man, the thorough-bred horse, beagle dogs, and the laboratory rodents, Mus musculus and Peromyscus leucopus are discussed. The data show a pattern of exponential increase of death rate with age. A laboratory model using Mus musculus and Peromyscus leucopus for the study of the longevity-assurance mechanisms is described. (HLW)

Experiment list: SRX977433 [Chip-atlas[Archive

Lifescience Database Archive (English)

Full Text Available ates NA 65512838,98.3,15.4,34790 GSM1648684: RNAPII ChipSeq day15; Mus musculus; ChIP-Seq source_name=reprogramming... intermediate after 15days of induction || cell type=reprogramming intermediate || genotype=RNAPII-GF

Experiment list: SRX977429 [Chip-atlas[Archive

Lifescience Database Archive (English)

Full Text Available ates NA 57685706,97.8,16.7,27894 GSM1648680: RNAPII ChipSeq day3; Mus musculus; ChIP-Seq source_name=reprogramming... intermediate after 3days of induction || cell type=reprogramming intermediate || genotype=RNAPII-GFP/

Experiment list: SRX977432 [Chip-atlas[Archive

Lifescience Database Archive (English)

Full Text Available ates NA 56429535,98.1,16.9,32459 GSM1648683: RNAPII ChipSeq day11; Mus musculus; ChIP-Seq source_name=reprogramming... intermediate after 11days of induction || cell type=reprogramming intermediate || genotype=RNAPII-GF

Protein: MPA1 [TP Atlas

Lifescience Database Archive (English)

Full Text Available MPA1 TLR signaling molecules Rsad2 Vig1 Radical S-adenosyl methionine domain-containing pr...otein 2 Viperin, Virus inhibitory protein, endoplasmic reticulum-associated, interferon-inducible 10090 Mus musculus 58185 Q8CBB9 21435586 ...

Modified cleaning method for biomineralized components

Science.gov (United States)

Tsutsui, Hideto; Jordan, Richard W.

2018-02-01

The extraction and concentration of biomineralized components from sediment or living materials is time consuming and laborious and often involves steps that remove either the calcareous or siliceous part, in addition to organic matter. However, a relatively quick and easy method using a commercial cleaning fluid for kitchen drains, sometimes combined with a kerosene soaking step, can produce remarkable results. In this study, the method is applied to sediments and living materials bearing calcareous (e.g., coccoliths, foraminiferal tests, holothurian ossicles, ichthyoliths, and fish otoliths) and siliceous (e.g., diatom valves, silicoflagellate skeletons, and sponge spicules) components. The method preserves both components in the same sample, without etching or partial dissolution, but is not applicable to unmineralized components such as dinoflagellate thecae, tintinnid loricae, pollen, or plant fragments.

Avaliação de possível interferência do tabagismo na ovoposição de larvas de Calliphoridae (Díptera em carcaça de Mus musculus L. (Rodentia: Muriade em São Paulo, SP

Directory of Open Access Journals (Sweden)

Thais Souza Guerra

2016-04-01

Full Text Available A estimativa do intervalo post-mortem (IPM é uma das principais utilizações de insetos na perícia, que pode ser fundamentado no ciclo biológico, ecologia e distribuição geográfica de uma determinada espécie, bem como o comportamento de toda fauna presente em um corpo a fim de estimar o menor intervalo possível da ocorrência da morte. Diversos fatores podem interferir no ciclo de vida de um inseto, tais como temperatura, umidade e presença de substâncias nos tecidos de uma carcaça, promovendo, em certos casos, aceleração ou retardo neste ciclo afetando diretamente na estimativa do IPM. O presente estudo teve como objetivo avaliar a possível interferência do tabagismo na ovoposição de larvas de Calliphoridae (Díptera em carcaça de Mus musculus L. (Rodentia: Muridae, na zona leste de São Paulo, SP, correlacionando os estágios de decomposição da carcaça e o desenvolvimento larval de moscas. A captura das larvas foi realizada durante o mês de outubro de 2014, as quais as carcaças foram acondicionadas em aparato adequado para coleta de insetos imaturos e adultos: uma contendo a carcaça tabagista e outra com a carcaça não fumante. No curso da decomposição da carcaça não fumante, foram capturados 37 indivíduos adultos da família Calliphoridae emergidos durante o processo de decomposição, ao passo que, na carcaça com fumígeno, não foi coletado nenhuma espécie emergida deste substrato, porém, a mesma apresentou uma decomposição até a fase de esqueletização em menor tempo comparado á carcaça controle, sugerindo assim, uma possível interferência do ato de tabagismo na estimativa do IPM.

Population genetic structure in a Robertsonian race of house mice: evidence from microsatellite polymorphism

NARCIS (Netherlands)

Dallas, J.F.; Bonhomme, F.; Boursot, P.; Britton-Davidian, J.; Bauchau, V.

1998-01-01

Genetic evidence was assessed for inbreeding and population subdivision in a Robertsonian fusion (Rb) race of the western European form of house mouse, Mus musculus domesticus, in central Belgium. Inbreeding, and the factors responsible for subdivision (genetic drift and extinction-recolonization)

Browse Title Index

African Journals Online (AJOL)

Items 801 - 850 of 1329 ... Vol 18, No 3 (2014), Kinetic Analysis of the Oxidation of Nitrate Ion by ... Vol 10, No 2 (2006), Lead Contamination and Microbial Lead ... Stations and its Biological Effects on Albino Mice, Mus musculus, Abstract PDF.

Protein: FBA7 [TP Atlas

Lifescience Database Archive (English)

Full Text Available FBA7 claudin-zona occluden Tjp1 Zo1 Tight junction protein ZO-1 Tight junction protein 1, Zona occludens pr...otein 1, Zonula occludens protein 1 10090 Mus musculus 21872 P39447 2RRM P39447 21431884 ...

Fellow travellers

DEFF Research Database (Denmark)

Jones, E. P.; Skirnisson, K.; McGovern, T. H.

2012-01-01

Background: House mice (Mus musculus) are commensals of humans and therefore their phylogeography can reflect human colonization and settlement patterns. Previous studies have linked the distribution of house mouse mitochondrial (mt) DNA clades to areas formerly occupied by the Norwegian Vikings ...

Experiment list: SRX286397 [Chip-atlas[Archive

Lifescience Database Archive (English)

Full Text Available 6476: Hnf4a Cast1a [kidney, castrated+vehicle]; Mus musculus; ChIP-Seq source_name=Hnf4a_Cast1a || strain=wi...ld type ICR || tissue=kidney || age=8-12 weeks old || treatment=castrated+vehicle

Experiment list: SRX286398 [Chip-atlas[Archive

Lifescience Database Archive (English)

Full Text Available 6477: Hnf4a Cast1b [kidney, castrated+vehicle]; Mus musculus; ChIP-Seq source_name=Hnf4a_Cast1b || strain=wi...ld type ICR || tissue=kidney || age=8-12 weeks old || treatment=castrated+vehicle

pp. 127-134, December, 2010 Original Article

African Journals Online (AJOL)

Owner

Blood Cells in Albino Mice, Mus musculus Exposed to Radiations from GSM ... Keywords: Bone marrow, GSM Base Station, Haematological effects, Mobile phone, Radiofrequency .... Measurement of Radiofrequency Radiation ... around the base stations based on electric .... stem cell proliferation and differentiation. This.

Dicty_cDB: Contig-U12550-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available e dilute myosin heavy chain gene for novel heav... 52 5e-10 2 ( DD464188 ) Method for screening pharmaceut...ical candidate sub... 52 5e-10 2 ( AY405224 ) Mus musculus MYO5A gene, VIRTUAL TRAN

Genome-wide architecture of reproductive isolation in a naturally occurring hybrid zone between Mus musculus musculus and M. m. domesticus

Czech Academy of Sciences Publication Activity Database

Janoušek, V.; Wang, L.; Luzynski, K.; Dufková, Petra; Mrkvicová Vyskočilová, Martina; Nachman, M. W.; Munclinger, P.; Macholán, Miloš; Piálek, Jaroslav; Tucker, P. K.

2012-01-01

Roč. 21, č. 12 (2012), s. 3032-3047 ISSN 0962-1083 R&D Projects: GA ČR GA206/08/0640 Institutional support: RVO:68081766 ; RVO:67985904 Keywords : genomics * proteomics * hybridization * mammals * speciation Subject RIV: EG - Zoology Impact factor: 6.275, year: 2012

The protective role of honey against cytotoxicity of cadmium chloride ...

African Journals Online (AJOL)

KJ

2016-11-16

Nov 16, 2016 ... central nervous system and DNA or cancer progression appeared as ... In this study, 30 adult Swiss albino mice (MUS musculus) were used, varying from ..... Effect of the type of nutrition and aflatoxin B1 on the structure of the.

Fatty acid profile and cholesterol content of M. longissimus of free ...

African Journals Online (AJOL)

South African Journal of Animal Science ... Abstract. This study investigated the effects of different feeding systems (free-range versus conventional rearing) on carcass characteristics, chemical composition, fatty acid profile and cholesterol content of the musculus longissimus lumborum et thoracis (MLLT) of Mangalitsa pigs.

Experiment list: SRX957819 [Chip-atlas[Archive

Lifescience Database Archive (English)

Full Text Available 34 GSM1635414: Input, proB cells; Mus musculus; ChIP-Seq source_name=Cultured ProB || strain=C57BL/6 || geno...type/variation=Rag1-/- || cell type=Cultured pro-B cells || antibody=none (input) http://dbarchive.bioscienc

Experiment list: SRX545926 [Chip-atlas[Archive

Lifescience Database Archive (English)

Full Text Available rebellar nuclei. Its function is to coordinate voluntary movements, maintain balance, and learn motor skil...ls. 24896655,91.3,3.9,24901 GSM1388141: H3K9/14ac KO P22 B1; Mus musculus; ChIP-Seq

Experiment list: SRX545936 [Chip-atlas[Archive

Lifescience Database Archive (English)

Full Text Available rebellar nuclei. Its function is to coordinate voluntary movements, maintain balance, and learn motor skil...ls. 22069752,95.0,8.6,28357 GSM1388151: H3K9/14ac KO P22 B2; Mus musculus; ChIP-Seq

Experiment list: SRX545930 [Chip-atlas[Archive

Lifescience Database Archive (English)

Full Text Available rebellar nuclei. Its function is to coordinate voluntary movements, maintain balance, and learn motor skil...ls. 21979511,96.3,4.9,20177 GSM1388145: H3K9/14ac WT P6 B1; Mus musculus; ChIP-Seq

Experiment list: SRX545940 [Chip-atlas[Archive

Lifescience Database Archive (English)

Full Text Available rebellar nuclei. Its function is to coordinate voluntary movements, maintain balance, and learn motor skil...ls. 21123206,91.9,6.8,21124 GSM1388155: H3K9/14ac WT P6 B2; Mus musculus; ChIP-Seq

Experiment list: SRX545935 [Chip-atlas[Archive

Lifescience Database Archive (English)

Full Text Available rebellar nuclei. Its function is to coordinate voluntary movements, maintain balance, and learn motor skil...ls. 22126564,95.3,7.1,23193 GSM1388150: H3K9/14ac WT P22 B2; Mus musculus; ChIP-Seq

Experiment list: SRX545925 [Chip-atlas[Archive

Lifescience Database Archive (English)

Full Text Available rebellar nuclei. Its function is to coordinate voluntary movements, maintain balance, and learn motor skil...ls. 24692816,89.7,3.8,22555 GSM1388140: H3K9/14ac WT P22 B1; Mus musculus; ChIP-Seq

AcEST: BP913064 [AcEST

Lifescience Database Archive (English)

Full Text Available _MOUSE Experimental autoimmune prostatitis antige... 31 5.2 sp|Q9NVV0|TM38B_HUMAN...|Q6QR59|EAPA2_MOUSE Experimental autoimmune prostatitis antigen 2 OS=Mus musculus GN=Eapa2 PE=2 SV=1 Length

Experiment list: SRX977378 [Chip-atlas[Archive

Lifescience Database Archive (English)

Full Text Available 23908,98.7,9.6,43208 GSM1648629: total Oct4 ChipSeq day11; Mus musculus; ChIP-Seq source_name=reprogramming ...intermediate after 11days of induction || cell type=reprogramming intermediate || genotype=Oct4-GFP/ Rosa26-

Experiment list: SRX977377 [Chip-atlas[Archive

Lifescience Database Archive (English)

Full Text Available 40719,98.1,13.8,57202 GSM1648628: total Oct4 ChipSeq day7; Mus musculus; ChIP-Seq source_name=reprogramming ...intermediate after 7days of induction || cell type=reprogramming intermediate || genotype=Oct4-GFP/ Rosa26-M

Experiment list: SRX977366 [Chip-atlas[Archive

Lifescience Database Archive (English)

Full Text Available NA 60072229,98.6,9.6,78331 GSM1648617: flag Oct4 ChipSeq day1; Mus musculus; ChIP-Seq source_name=reprogramming... intermediate after 24hour of induction || cell type=reprogramming intermediate || genotype=Oct4-GFP/ Ros

Experiment list: SRX977375 [Chip-atlas[Archive

Lifescience Database Archive (English)

Full Text Available 20178,94.6,10.8,52926 GSM1648626: total Oct4 ChipSeq day3; Mus musculus; ChIP-Seq source_name=reprogramming ...intermediate after 3days of induction || cell type=reprogramming intermediate || genotype=Oct4-GFP/ Rosa26-M

Experiment list: SRX977379 [Chip-atlas[Archive

Lifescience Database Archive (English)

Full Text Available 93532,97.8,13.3,43901 GSM1648630: total Oct4 ChipSeq day15; Mus musculus; ChIP-Seq source_name=reprogramming... intermediate after 15days of induction || cell type=reprogramming intermediate || genotype=Oct4-GFP/ Rosa26

Experiment list: SRX977368 [Chip-atlas[Archive

Lifescience Database Archive (English)

Full Text Available NA 58474287,97.8,9.8,84163 GSM1648619: flag Oct4 ChipSeq day5; Mus musculus; ChIP-Seq source_name=reprogramming... intermediate after 5days of induction || cell type=reprogramming intermediate || genotype=Oct4-GFP/ Rosa

Experiment list: SRX977369 [Chip-atlas[Archive

Lifescience Database Archive (English)

Full Text Available NA 58631406,98.5,10.3,72036 GSM1648620: flag Oct4 ChipSeq day7; Mus musculus; ChIP-Seq source_name=reprogramming... intermediate after 7days of induction || cell type=reprogramming intermediate || genotype=Oct4-GFP/ Ros

Experiment list: SRX684775 [Chip-atlas[Archive

Lifescience Database Archive (English)

Full Text Available ng || cell type=intermediate stage of somatic cell reprogramming || chip antibody=M...,29.2,290321 GSM1483904: pre-iPS.H3.MNase-ChIP-Seq; Mus musculus; ChIP-Seq source_name=intermediate stage of somatic cell reprogrammi

Experiment list: SRX977371 [Chip-atlas[Archive

Lifescience Database Archive (English)

Full Text Available NA 63273752,96.7,14.1,37891 GSM1648622: flag Oct4 ChipSeq day15; Mus musculus; ChIP-Seq source_name=reprogramming... intermediate after 15days of induction || cell type=reprogramming intermediate || genotype=Oct4-GFP/ R

Experiment list: SRX1090864 [Chip-atlas[Archive

Lifescience Database Archive (English)

Full Text Available ming || cell type=intermediate stage of somatic cell reprogramming || chip antibody...5,12.8,491 GSM1816301: pre-iPS rep.H3.MNase-ChIP-Seq; Mus musculus; ChIP-Seq source_name=intermediate stage of somatic cell reprogram

Dynamic imaging of skeletal muscle contraction in three orthogonal directions

NARCIS (Netherlands)

Lopata, R.G.; van Dijk, J.P; Pillen, S.; Nillisen, M.M.; Maas, H.; Thijssen, J.M.; Stegeman, D.F.; Korte, C.L.

2010-01-01

In this study, a multidimensional strain estimation method using biplane ultrasound is presented to assess local relative deformation (i.e., local strain) in three orthogonal directions in skeletal muscles during induced and voluntary contractions. The method was tested in the musculus biceps

Dynamic imaging of skeletal muscle contraction in three orthogonal directions.

NARCIS (Netherlands)

Lopata, R.G.P.; Dijk, J.P. van; Pillen, S.; Nillesen, M.M.; Maas, H.; Thijssen, J.M.; Stegeman, D.F.; Korte, C.L. de

2010-01-01

In this study, a multidimensional strain estimation method using biplane ultrasound is presented to assess local relative deformation (i.e., local strain) in three orthogonal directions in skeletal muscles during induced and voluntary contractions. The method was tested in the musculus biceps

African Zoology - Vol 29, No 2 (1994)

African Journals Online (AJOL)

Population biology of house mice (Mus musculus L.) on sub-Antarctic Marion Island · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. D.C. Matthewson, R.J. van Aarde, J.D. Skinner, 99-106 ...

GenBank blastx search result: AK111983 [KOME

Lifescience Database Archive (English)

Full Text Available ative exons 18 and 18a, and alternative splice products, complete cds.|ROD ROD 4e-34 +3 ... ...AK111983 001-012-H11 AF071946.1 Mus musculus protein tyrosine kinase Tec (Tec) gene, exons 16 and 17, altern

GenBank blastx search result: AK061938 [KOME

Lifescience Database Archive (English)

Full Text Available ative exons 18 and 18a, and alternative splice products, complete cds.|ROD ROD 1e-24 +2 ... ...AK061938 001-042-D07 AF071946.1 Mus musculus protein tyrosine kinase Tec (Tec) gene, exons 16 and 17, altern

GenBank blastx search result: AK060220 [KOME

Lifescience Database Archive (English)

Full Text Available ative exons 18 and 18a, and alternative splice products, complete cds.|ROD ROD 2e-36 +3 ... ...AK060220 001-002-F01 AF071946.1 Mus musculus protein tyrosine kinase Tec (Tec) gene, exons 16 and 17, altern

Experiment list: SRX286381 [Chip-atlas[Archive

Lifescience Database Archive (English)

Full Text Available 7,533 GSM1146460: AR Cast1b [prostate, castrated+vehicle]; Mus musculus; ChIP-Seq source_name=AR_Cast1b || s...train=wild type ICR || tissue=prostate || age=8-12 weeks old || treatment=castrated+vehicle || chip antibody

Experiment list: SRX286404 [Chip-atlas[Archive

Lifescience Database Archive (English)

Full Text Available 2374,91.5,46.7,866 GSM1146483: AR Cast1 [caput epididymis, castrated+vehicle]; Mus musculus; ChIP-Seq source..._name=AR_Cast1 || strain=wild type ICR || tissue=caput epididymis || age=8-12 weeks old || treatment=castrated+vehicle

Experiment list: SRX286380 [Chip-atlas[Archive

Lifescience Database Archive (English)

Full Text Available 2,497 GSM1146459: AR Cast1a [prostate, castrated+vehicle]; Mus musculus; ChIP-Seq source_name=AR_Cast1a || s...train=wild type ICR || tissue=prostate || age=8-12 weeks old || treatment=castrated+vehicle || chip antibody

Experiment list: SRX286386 [Chip-atlas[Archive

Lifescience Database Archive (English)

Full Text Available 60.2,17474 GSM1146465: FoxA1 Cast [prostate, castrated+vehicle]; Mus musculus; ChIP-Seq source_name=FoxA1_Ca...st || strain=wild type ICR || tissue=prostate || age=8-12 weeks old || treatment=castrated+vehicle || chip a

The Sycp1 loci of the mouse genome: successive retropositions of a meiotic gene during the recent evolution of the genus.

Science.gov (United States)

Sage, J; Yuan, L; Martin, L; Mattei, M G; Guénet, J L; Liu, J G; Hoög, C; Rassoulzadegan, M; Cuzin, F

1997-08-15

The murine Sycp1 gene is expressed at the early stages of meiosis. We show that it is composed of a number of small exons and localized on mouse chromosome 3. In the laboratory strains, two retrogenes were also identified. The first one (Sycp1-ps1), on chromosome 7, has accumulated point mutations and deletions and is not transcribed. A second retrogene (Sycp1-ps2), on chromosome 8, is inserted within the continuity of a moderately repeated element, in an intron of another gene (Cad11). The two retroposition events can be dated to distinct periods in the evolution of the Muridae. Sycp1-ps2 has kept features indicative of a relatively recent origin, namely a nearly intact coding region, a poly(A) tail, and 14-bp terminal repeats. Its recent origin was confirmed by the fact that it is found in all the laboratory strains of mice, but neither in a recent isolate from Mus musculus domesticus wild stocks nor in the closely related subspecies M. musculus musculus, M. m. molossinus, M. m. castaneus, and M. m. bactrianus. Appearance of the more ancient Sycp1-ps1 retrogene is concomitant with the radiation of the genus. It is present in various Mus species (M. spretus, M. spicilegus, M. macedonicus, and M. cookii), but neither in the rat nor in the more closely related Pyromis genus. Transposition of retrotranscripts during meiosis and their hereditary establishment thus appear to occur relatively frequently. They may, therefore, play a significant role in the evolutionary process.

NCBI nr-aa BLAST: CBRC-MEUG-01-1506 [SEVENS

Lifescience Database Archive (English)

Full Text Available musculus] sp|Q8BX46|LBXCO_MOUSE RecName: Full=Ladybird homeobox corepressor 1; AltName: Full=Lbx1 corepress...or 1; AltName: Full=Transcriptional corepressor Corl1; AltName: Full=Fussel-15 gb|EDL26034.1| ladybird homeo

Experiment list: SRX957817 [Chip-atlas[Archive

Lifescience Database Archive (English)

Full Text Available 635412: Ikaros ChIP-Seq, preproB cells; Mus musculus; ChIP-Seq source_name=Cultured PreProB || strain=C57BL/...6 || genotype/variation=E2A-/- || cell type=Cultured pre-pro-B cells || antibody=Ikaros (Ik-C, rabbit antibo

Experiment list: SRX471838 [Chip-atlas[Archive

Lifescience Database Archive (English)

Full Text Available : ChIPseq GS WT Bmi1; Mus musculus; ChIP-Seq source_name=Cultured germline stem cells || genotype/variation=...Wild-type || strain=CD1 x C57BL/6 || cell type=Cultured germline stem cells || chip antibody=Mouse anti-Bmi1

Experiment list: SRX957816 [Chip-atlas[Archive

Lifescience Database Archive (English)

Full Text Available M1635411: Ikaros ChIP-Seq, proB cells; Mus musculus; ChIP-Seq source_name=Cultured ProB || strain=C57BL/6 ||... genotype/variation=Rag1-/- || cell type=Cultured pro-B cells || antibody=Ikaros (Ik-C, rabbit antibody (kin

Experiment list: SRX471836 [Chip-atlas[Archive

Lifescience Database Archive (English)

Full Text Available 0: ChIPseq GS WT Scml2; Mus musculus; ChIP-Seq source_name=Cultured germline stem cells || genotype/variatio...n=Wild-type || strain=CD1 x C57BL/6 || cell type=Cultured germline stem cells || chip antibody=Rabbit anti-S

REVIEW - Thermal Physiology of Laboratory Mice: Defining Thermoneutrality

Science.gov (United States)

In terms of total number of publications, the laboratory mouse (Mus musculus) has emerged as the most popular test subject in biomedical research. Mice are used as models to study obesity, diabetes, eNS diseases and variety of other pathologies. Mice are classified as homeotherms...

Experiment list: SRX977374 [Chip-atlas[Archive

Lifescience Database Archive (English)

Full Text Available 16864,98.6,9.4,51198 GSM1648625: total Oct4 ChipSeq day1; Mus musculus; ChIP-Seq source_name=reprogramming i...ntermediate after 24hour of induction || cell type=reprogramming intermediate || genotype=Oct4-GFP/ Rosa26-M

Experiment list: SRX977384 [Chip-atlas[Archive

Lifescience Database Archive (English)

Full Text Available NA 47241296,98.3,15.4,813 GSM1648635: input DNA day3; Mus musculus; ChIP-Seq source_name=reprogramming inter...mediate after 3days of induction || cell type=reprogramming intermediate || genotype=Oct4-GFP/ Rosa26-M2rtTA

Experiment list: SRX977387 [Chip-atlas[Archive

Lifescience Database Archive (English)

Full Text Available NA 56426857,98.7,10.2,674 GSM1648638: input DNA day11; Mus musculus; ChIP-Seq source_name=reprogramming inte...rmediate after 11days of induction || cell type=reprogramming intermediate || genotype=Oct4-GFP/ Rosa26-M2rt

Experiment list: SRX977385 [Chip-atlas[Archive

Lifescience Database Archive (English)

Full Text Available NA 58688448,98.6,12.6,1031 GSM1648636: input DNA day5; Mus musculus; ChIP-Seq source_name=reprogramming inte...rmediate after 5days of induction || cell type=reprogramming intermediate || genotype=Oct4-GFP/ Rosa26-M2rtT

Experiment list: SRX977386 [Chip-atlas[Archive

Lifescience Database Archive (English)

Full Text Available NA 53476648,98.4,14.3,878 GSM1648637: input DNA day7; Mus musculus; ChIP-Seq source_name=reprogramming inter...mediate after 7days of induction || cell type=reprogramming intermediate || genotype=Oct4-GFP/ Rosa26-M2rtTA

Experiment list: SRX977388 [Chip-atlas[Archive

Lifescience Database Archive (English)

Full Text Available NA 56072187,98.6,9.2,704 GSM1648639: input DNA day15; Mus musculus; ChIP-Seq source_name=reprogramming inter...mediate after 15days of induction || cell type=reprogramming intermediate || genotype=Oct4-GFP/ Rosa26-M2rtT

Experiment list: SRX977383 [Chip-atlas[Archive

Lifescience Database Archive (English)

Full Text Available NA 59099899,98.6,14.0,974 GSM1648634: input DNA day1; Mus musculus; ChIP-Seq source_name=reprogramming inter...mediate after 24hour of induction || cell type=reprogramming intermediate || genotype=Oct4-GFP/ Rosa26-M2rtT

Dicty_cDB: Contig-U04628-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available 'e... 44 3.5 1 ( BB649149 ) Mus musculus 16 days embryo head cDNA, RIKEN full... 44 3.5 1 ( GH465909 ) CCUA5...860.b1 CCUA Peromyscus polionotus subgrisieu... 44 3.5 1 ( FG170345 ) AGN_RNC002x

Experiment list: SRX187245 [Chip-atlas[Archive

Lifescience Database Archive (English)

Full Text Available 6 || time_point=48h || application=ChIP-Seq || cell type=Th17 http://dbarchive.biosciencedbc.jp/kyushu-u/mm9...: SL12386; Mus musculus; ChIP-Seq source_name=Th17 in vitro || genotype=wt || control=SL12382 || factor=Jmjd

Experiment list: SRX187226 [Chip-atlas[Archive

Lifescience Database Archive (English)

Full Text Available F4 || time_point=48h || application=ChIP-Seq || cell type=Th0 http://dbarchive.biosciencedbc.jp/kyushu-u/mm9... SL9852; Mus musculus; ChIP-Seq source_name=Th0 in vitro || genotype=Batf +/+ || control=SL9856 || factor=IR

Experiment list: SRX187224 [Chip-atlas[Archive

Lifescience Database Archive (English)

Full Text Available a || time_point=48h || application=ChIP-Seq || cell type=Th17 http://dbarchive.biosciencedbc.jp/kyushu-u/mm9...: SL10572; Mus musculus; ChIP-Seq source_name=Th17 in vitro || genotype=wt || control=SL10566 || factor=Hif1

Experiment list: SRX187244 [Chip-atlas[Archive

Lifescience Database Archive (English)

Full Text Available lication=ChIP-Seq || cell type=Th17 http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/... SL12384; Mus musculus; ChIP-Seq source_name=Th17 in vitro || genotype=wt || control=SL12382 || factor=Jmjd3 || time_point=48h || app

Experiment list: SRX187227 [Chip-atlas[Archive

Lifescience Database Archive (English)

Full Text Available 4 || time_point=48h || application=ChIP-Seq || cell type=Th0 http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/...SL9853; Mus musculus; ChIP-Seq source_name=Th0 in vitro || genotype=Batf -/- || control=SL9857 || factor=IRF

Experiment list: SRX187225 [Chip-atlas[Archive

Lifescience Database Archive (English)

Full Text Available a || time_point=48h || application=ChIP-Seq || cell type=Th17 http://dbarchive.biosciencedbc.jp/kyushu-u/mm9...: SL10575; Mus musculus; ChIP-Seq source_name=Th17 in vitro || genotype=wt || control=SL10569 || factor=Hif1

Experiment list: SRX187198 [Chip-atlas[Archive

Lifescience Database Archive (English)

Full Text Available lication=ChIP-Seq || cell type=Th17 http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/...: SL10570; Mus musculus; ChIP-Seq source_name=Th17 in vitro || genotype=wt || control=SL10564 || factor=BATF || time_point=16h || app

Dicty_cDB: VFD746 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available 0558 LLC cDN... 572 e-162 BC099966_1( BC099966 |pid:none) Mus musculus dyskeratosis congenit... 572 e-161 FJ...236702_1( FJ236702 |pid:none) Sus scrofa dyskeratosis congenita ... 571 e-161 BC123284_1( BC123284 |pid:none

Quadriceps Strength and Executive Functions in Older Women

NARCIS (Netherlands)

Scherder, E. J. A.; Eggermont, L. H. P.; Geuze, R. H.; Vis, J.; Verkerke, G. J.

Objective: The aim of this study is to answer the question whether the strength of the knee extensor musculus quadriceps (m. quadriceps), in particular, is related to specific executive functions and whether this relationship is independent of aerobic fitness. The clinical relevance of this question

Experiment list: SRX192254 [Chip-atlas[Archive

Lifescience Database Archive (English)

Full Text Available f offspring produced at one birth by a viviparous animal. 84324878,97.5,12.5,559 GSM1016423: A INPUT vehicle... donor1024; Mus musculus; ChIP-Seq source_name=whole liver extract || age=29-32 days || chip antibody=INPUT || treament=vehicle

Experiment list: SRX192258 [Chip-atlas[Archive

Lifescience Database Archive (English)

Full Text Available f offspring produced at one birth by a viviparous animal. 20609955,77.1,6.7,117 GSM1016427: B INPUT vehicle ...donor1; Mus musculus; ChIP-Seq source_name=whole liver extract || age=29-32 days || chip antibody=INPUT || treament=vehicle

Experiment list: SRX192259 [Chip-atlas[Archive

Lifescience Database Archive (English)

Full Text Available f offspring produced at one birth by a viviparous animal. 15402183,74.5,5.4,117 GSM1016428: B INPUT vehicle ...donor7; Mus musculus; ChIP-Seq source_name=whole liver extract || age=29-32 days || chip antibody=INPUT || treament=vehicle

Experiment list: SRX192267 [Chip-atlas[Archive

Lifescience Database Archive (English)

Full Text Available f offspring produced at one birth by a viviparous animal. 28874920,80.3,4.9,183 GSM1016436: C INPUT vehicle ...donor10; Mus musculus; ChIP-Seq source_name=whole liver extract || age=29-32 days || chip antibody=INPUT || treament=vehicle

Experiment list: SRX192266 [Chip-atlas[Archive

Lifescience Database Archive (English)

Full Text Available f offspring produced at one birth by a viviparous animal. 25871870,71.5,4.2,143 GSM1016435: C INPUT vehicle ...donor5; Mus musculus; ChIP-Seq source_name=whole liver extract || age=29-32 days || chip antibody=INPUT || treament=vehicle

Experiment list: SRX192253 [Chip-atlas[Archive

Lifescience Database Archive (English)

Full Text Available f offspring produced at one birth by a viviparous animal. 106959657,97.4,12.9,578 GSM1016422: A INPUT vehicle... donor1021; Mus musculus; ChIP-Seq source_name=whole liver extract || age=29-32 days || chip antibody=INPUT || treament=vehicle

Spot 1 Spot 2

Indian Academy of Sciences (India)

2011-08-23

M)[17]. Gel Idx/Pos. 137/F12. Plate [#] Name. [1] T056P10. Rank. Protein Name. Accession No. Protein. Protein. Total Ion. Total Ion. Score. Score. Score. C. I. %. C. I. %. 1. Serum albumin OS=Mus musculus GN=Alb PE=1 SV= ...

Arabidopsis CDS blastp result: AK061637 [KOME

Lifescience Database Archive (English)

Full Text Available AK061637 001-036-A11 At1g77130.1 glycogenin glucosyltransferase (glycogenin)-relate...d contains similarity to glycogenin-1 from Mus musculus [SP|Q9R062], Rattus norvegicus [SP|O08730], Homo sapiens [SP|P46976] 4e-84 ...

Gastrointestinal microbiota of wild and inbred individuals of two house mouse subspecies assessed using high-throughput parallel pyrosequencing

Czech Academy of Sciences Publication Activity Database

Kreisinger, Jakub; Čížková, Dagmar; Vohánka, J.; Piálek, Jaroslav

2014-01-01

Roč. 23, č. 20 (2014), s. 5048-5060 ISSN 0962-1083 R&D Projects: GA ČR GA206/08/0640 Institutional support: RVO:68081766 Keywords : domestication * hybrid zone * metagenomics * microbiome * Mus musculus * symbiosis Subject RIV: EG - Zoology Impact factor: 6.494, year: 2014

Tristania Sumatrana Effect On Female Mus Musculus Fertility

Science.gov (United States)

Syamsurizal, S.

2018-04-01

The use of traditional medicinal plants are generally based on empirical experience, therefore it is necessary scientific approach in order to bring traditional medicine into medical practice and the formal health services. Tristania sumatrana Miq. is one of the traditional medicinal plants are often used as a contraceptive for women in West Sumatra Tristania sumatrana Miq. extract can prolong the estrous cycle in mice to eleven days. This study aimed to influence Tristania sumatrana Miq. extract treatment on fertility of female mice. Experiments conducted a randomized block design 5x2. Five dose groups: control with no treatment, placebo, treatment with doses of 600, 900 and 1200 mg/kgbw and the old two treatment groups: 10 and 20 days. Fertility parameters studied were ovarian weight follicle Graaf number, the corpus luteum and fetal life. The research proves of Tristania sumatrana Miq. extract treatment causes a decrease very significantly the ovarian weight (treatment of 900 mg/kgbw for 10 days), follicles Graaf number (900 mg/kgbw for 20 days), the corpus luteum (600 mg/kgbw for 10 days) and live fetuses (900 mg/kgbw for 10 days). Tristania sumatrana Miq. extract treatment can lead to decreased fertility of female mice.

Blue whales Balaenoptera musculus off Angola: recent sightings ...

African Journals Online (AJOL)

Further survey work is required to better clarify the status of blue whales in Angolan waters, particularly with regard to population structure and potential calving grounds. Keywords: Antarctic blue whale, calving, catch data, pygmy blue whale, South-East Atlantic, stomach contents. African Journal of Marine Science 2014, ...

GoPros™ as an underwater photogrammetry tool for citizen science.

Science.gov (United States)

Raoult, Vincent; David, Peter A; Dupont, Sally F; Mathewson, Ciaran P; O'Neill, Samuel J; Powell, Nicholas N; Williamson, Jane E

2016-01-01

Citizen science can increase the scope of research in the marine environment; however, it suffers from necessitating specialized training and simplified methodologies that reduce research output. This paper presents a simplified, novel survey methodology for citizen scientists, which combines GoPro imagery and structure from motion to construct an ortho-corrected 3D model of habitats for analysis. Results using a coral reef habitat were compared to surveys conducted with traditional snorkelling methods for benthic cover, holothurian counts, and coral health. Results were comparable between the two methods, and structure from motion allows the results to be analysed off-site for any chosen visual analysis. The GoPro method outlined in this study is thus an effective tool for citizen science in the marine environment, especially for comparing changes in coral cover or volume over time.

GoPros™ as an underwater photogrammetry tool for citizen science

Directory of Open Access Journals (Sweden)

Vincent Raoult

2016-04-01

Full Text Available Citizen science can increase the scope of research in the marine environment; however, it suffers from necessitating specialized training and simplified methodologies that reduce research output. This paper presents a simplified, novel survey methodology for citizen scientists, which combines GoPro imagery and structure from motion to construct an ortho-corrected 3D model of habitats for analysis. Results using a coral reef habitat were compared to surveys conducted with traditional snorkelling methods for benthic cover, holothurian counts, and coral health. Results were comparable between the two methods, and structure from motion allows the results to be analysed off-site for any chosen visual analysis. The GoPro method outlined in this study is thus an effective tool for citizen science in the marine environment, especially for comparing changes in coral cover or volume over time.

GoPros™ as an underwater photogrammetry tool for citizen science

Science.gov (United States)

David, Peter A.; Dupont, Sally F.; Mathewson, Ciaran P.; O’Neill, Samuel J.; Powell, Nicholas N.; Williamson, Jane E.

2016-01-01

Citizen science can increase the scope of research in the marine environment; however, it suffers from necessitating specialized training and simplified methodologies that reduce research output. This paper presents a simplified, novel survey methodology for citizen scientists, which combines GoPro imagery and structure from motion to construct an ortho-corrected 3D model of habitats for analysis. Results using a coral reef habitat were compared to surveys conducted with traditional snorkelling methods for benthic cover, holothurian counts, and coral health. Results were comparable between the two methods, and structure from motion allows the results to be analysed off-site for any chosen visual analysis. The GoPro method outlined in this study is thus an effective tool for citizen science in the marine environment, especially for comparing changes in coral cover or volume over time. PMID:27168973

Efecto de las nanopartículas industriales TiO 2 , SiO 2 y ZnO sobre la viabilidad celular y expresión génica en médula ósea roja de mus musculus

Directory of Open Access Journals (Sweden)

Jacquelyne Zarria-Romero

Full Text Available RESUMEN Objetivos Evaluar el efecto de las nanopartículas de ZnO, TiO2 y SiO2 sobre la viabilidad celular y la expresión génica de las interleuquinas 7 y 3 y del factor estimulante de colonias de granulocito - macrófago (GM-CSF en Mus musculus. Materiales y métodos Se extrajo médula ósea roja de cinco roedores (Balb/c para el estudio de viabilidad celular mediante la prueba de MTT. Por otro lado, grupos cinco roedores fueron inoculados vía intraperitoneal con dosis de 0,5; 1; 2,5; 5 y 10 mg/kg de nanopartículas de ZnO y SiO2 y de 5; 10; 15; 20 y 25 mg/kg de nanopartículas de TiO2, 30 h después, se obtuvo el ARN a partir de la médula ósea roja para los análisis de expresión génica empleando las técnicas de PCR y RT-PCR cuantitativa. Resultados Las nanopartículas de ZnO y SiO2 redujeron la viabilidad celular de una manera dosis-dependiente en un 37 y 26%, respectivamente, a partir de una dosis de 1 mg/kg. En cuanto al efecto sobre la expresión génica, a las dosis 5 y 10 mg/kg, las nanopartículas de TiO2 redujeron en mayor porcentaje la expresión de las interleuquinas 7 y 3 (55,3 y 70,2% respectivamente, con respecto a la expresión del GM-CSF, el mayor porcentaje de reducción lo produjo las nanopartículas de SiO2 (91%. Las nanopartículas de ZnO redujeron a partir de las dosis de 20 y 25 mg/kg. Conclusiones Las nanopartículas de ZnO, SiO2 y TiO2 alteran la viabilidad celular y la expresión génica en la médula ósea de ratón.

Systems pharmacology-based drug discovery for marine resources: an example using sea cucumber (Holothurians).

Science.gov (United States)

Guo, Yingying; Ding, Yan; Xu, Feifei; Liu, Baoyue; Kou, Zinong; Xiao, Wei; Zhu, Jingbo

2015-05-13

Sea cucumber, a kind of marine animal, have long been utilized as tonic and traditional remedies in the Middle East and Asia because of its effectiveness against hypertension, asthma, rheumatism, cuts and burns, impotence, and constipation. In this study, an overall study performed on sea cucumber was used as an example to show drug discovery from marine resource by using systems pharmacology model. The value of marine natural resources has been extensively considered because these resources can be potentially used to treat and prevent human diseases. However, the discovery of drugs from oceans is difficult, because of complex environments in terms of composition and active mechanisms. Thus, a comprehensive systems approach which could discover active constituents and their targets from marine resource, understand the biological basis for their pharmacological properties is necessary. In this study, a feasible pharmacological model based on systems pharmacology was established to investigate marine medicine by incorporating active compound screening, target identification, and network and pathway analysis. As a result, 106 candidate components of sea cucumber and 26 potential targets were identified. Furthermore, the functions of sea cucumber in health improvement and disease treatment were elucidated in a holistic way based on the established compound-target and target-disease networks, and incorporated pathways. This study established a novel strategy that could be used to explore specific active mechanisms and discover new drugs from marine sources. Copyright © 2015 Elsevier Ireland Ltd. All rights reserved.

Experiment list: SRX684777 [Chip-atlas[Archive

Lifescience Database Archive (English)

Full Text Available ing || cell type=intermediate stage of somatic cell reprogramming || chip antibody=...,98.5,5.8,239 GSM1483906: pre-iPS.H3K27me3.ChIP-Seq; Mus musculus; ChIP-Seq source_name=intermediate stage of somatic cell reprogramm

Experiment list: SRX957818 [Chip-atlas[Archive

Lifescience Database Archive (English)

Full Text Available SM1635413: Brg1 ChIP-Seq, proB cells; Mus musculus; ChIP-Seq source_name=Cultured ProB || strain=C57BL/6 || ...genotype/variation=Rag1-/- || cell type=Cultured pro-B cells || antibody=Brg1 (Millipore, catalog# 07-478, l

Experiment list: SRX483615 [Chip-atlas[Archive

Lifescience Database Archive (English)

Full Text Available 48 GSM1342523: iPSC SNEL3; Mus musculus; ChIP-Seq source_name=reprogramming from MEF cell || cell line=iPSC ...SNEL3 || passage=15-20 || reprogramming factors=Sall4, Nanog, Esrrb and Lin28 || antibody=H2A.X (Xiao lab) h

Experiment list: SRX1090865 [Chip-atlas[Archive

Lifescience Database Archive (English)

Full Text Available amming || cell type=intermediate stage of somatic cell reprogramming || chip antibo...,95.9,8.5,270 GSM1816302: pre-iPS rep.H3K4me3.ChIP-Seq; Mus musculus; ChIP-Seq source_name=intermediate stage of somatic cell reprogr

Experiment list: SRX483614 [Chip-atlas[Archive

Lifescience Database Archive (English)

Full Text Available 32 GSM1342522: iPSC SNEL1; Mus musculus; ChIP-Seq source_name=reprogramming from MEF cell || cell line=iPSC ...SNEL1 || passage=15-20 || reprogramming factors=Sall4, Nanog, Esrrb and Lin28 || antibody=H2A.X (Xiao lab) h

Experiment list: SRX483618 [Chip-atlas[Archive

Lifescience Database Archive (English)

Full Text Available 40 GSM1342526: iPSC OSKM test; Mus musculus; ChIP-Seq source_name=reprogramming from MEF cell || cell line=i...PSC OSKM_test || passage=15-20 || reprogramming factors=Oct4, Sox2, Klf4 and Myc || antibody=H2A.X (Xiao lab

Experiment list: SRX684776 [Chip-atlas[Archive

Lifescience Database Archive (English)

Full Text Available ng || cell type=intermediate stage of somatic cell reprogramming || chip antibody=a...98.0,10.6,335 GSM1483905: pre-iPS.H3K4me3.ChIP-Seq; Mus musculus; ChIP-Seq source_name=intermediate stage of somatic cell reprogrammi

Experiment list: SRX897943 [Chip-atlas[Archive

Lifescience Database Archive (English)

Full Text Available 153,97.9,13.9,15440 GSM1624628: ChIP seq Renilla Sox2 IP day3; Mus musculus; ChIP-Seq source_name=OKSM reprogramming... intermediates from Mouse Embryonic Fibroblasts || strain=Black6-129X1/SvJ || cell type=OKSM reprogramming

Experiment list: SRX684778 [Chip-atlas[Archive

Lifescience Database Archive (English)

Full Text Available 98.0,9.9,325 GSM1483907: pre-iPS.H3K9me3.ChIP-Seq; Mus musculus; ChIP-Seq source_name=intermediate stage of somatic cell reprogrammin...g || cell type=intermediate stage of somatic cell reprogramming || chip antibody=an

76 FR 30309 - Marine Mammals and Endangered Species; File Nos. 14245, 1596-03, and 14726-01

Science.gov (United States)

2011-05-25

... behavior in the Pacific Ocean between their foraging areas and nesting beaches. The modification is valid... Pacific, Atlantic, and Arctic Oceans on marine mammals including endangered blue (Balaenoptera musculus.... Research activities in the Southern Ocean were withdrawn by NMML after the close of the public comment...

Experiment list: SRX187194 [Chip-atlas[Archive

Lifescience Database Archive (English)

Full Text Available lication=ChIP-Seq || cell type=Th0 http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/e...SL8348; Mus musculus; ChIP-Seq source_name=Th0 in vitro || genotype=IRF4 wt || control=SL8356 || factor=Batf || time_point=48h || app

Experiment list: SRX187263 [Chip-atlas[Archive

Lifescience Database Archive (English)

Full Text Available ication=ChIP-Seq || cell type=Th17 http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/e...: SL9624; Mus musculus; ChIP-Seq source_name=Th17 in vitro || genotype=wt || control=SL9623 || factor=Stat3 || time_point=16h || appl

Experiment list: SRX187195 [Chip-atlas[Archive

Lifescience Database Archive (English)

Full Text Available lication=ChIP-Seq || cell type=Th0 http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/e...SL8350; Mus musculus; ChIP-Seq source_name=Th0 in vitro || genotype=IRF4 ko || control=SL8346 || factor=Batf || time_point=48h || app

Experiment list: SRX187232 [Chip-atlas[Archive

Lifescience Database Archive (English)

Full Text Available : SL9855; Mus musculus; ChIP-Seq source_name=Th17 in vitro || genotype=wt || control=SL9859 || factor=IRF4 || time_point=16h || appli...cation=ChIP-Seq || cell type=Th17 http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/ea

Experiment list: SRX187211 [Chip-atlas[Archive

Lifescience Database Archive (English)

Full Text Available ication=ChIP-Seq || cell type=Th17 http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/e... SL10573; Mus musculus; ChIP-Seq source_name=Th17 in vitro || genotype=wt || control=SL10567 || factor=Etv6 || time_point=48h || appl

Experiment list: SRX187197 [Chip-atlas[Archive

Lifescience Database Archive (English)

Full Text Available lication=ChIP-Seq || cell type=Th0 http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/e...SL9450; Mus musculus; ChIP-Seq source_name=Th0 in vitro || genotype=IRF4 ko || control=SL9446 || factor=Batf || time_point=48h || app

Experiment list: SRX187212 [Chip-atlas[Archive

Lifescience Database Archive (English)

Full Text Available ication=ChIP-Seq || cell type=Th17 http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/e... SL13368; Mus musculus; ChIP-Seq source_name=Th17 in vitro || genotype=wt || control=SL13364 || factor=Etv6 || time_point=48h || appl

Experiment list: SRX187196 [Chip-atlas[Archive

Lifescience Database Archive (English)

Full Text Available f || time_point=48h || application=ChIP-Seq || cell type=Th0 http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/... SL9448; Mus musculus; ChIP-Seq source_name=Th0 in vitro || genotype=IRF4 wt || control=SL9444 || factor=Bat

Experiment list: SRX187264 [Chip-atlas[Archive

Lifescience Database Archive (English)

Full Text Available : SL9626; Mus musculus; ChIP-Seq source_name=Th17 in vitro || genotype=wt || control=SL9625 || factor=Stat3 || time_point=3h || appli...cation=ChIP-Seq || cell type=Th17 http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/ea

Predictive validity of a non-induced mouse model of compulsive-like behavior

NARCIS (Netherlands)

Greene-Schloesser, D. M.; Van der Zee, E. A.; Sheppard, D. K.; Castillo, M. R.; Gregg, K. A.; Burrow, T.; Foltz, H.; Slater, M.; Bult-Ito, A.

2011-01-01

A key to advancing the understanding of obsessive-compulsive disorder (OCD)-like symptoms is the development of spontaneous animal models. Over 55 generations of bidirectional selection for nest-building behavior in house mice, Mus musculus, resulted in a 40-fold difference in the amount of cotton

Dicty_cDB: Contig-U03036-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available DQ379469 ) Concholepas concholepas microsatellite Cc1H2 sequ... 50 0.17 1 ( AF10...e DKEY-65O14 in l... 50 0.17 1 ( AC118018 ) Mus musculus chromosome 17, clone RP23-458D20, co... 50 0.17 1 (

NCBI nr-aa BLAST: CBRC-CINT-01-0064 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-CINT-01-0064 sp|Q9QY96|CASR_MOUSE Extracellular calcium-sensing receptor precu...rsor (CaSR) (Parathyroid Cell calcium-sensing receptor) gb|AAD28371.1|AF110178_1 calcium-sensing receptor [Mus musculus] Q9QY96 0.0 41% ...

Experiment list: SRX286391 [Chip-atlas[Archive

Lifescience Database Archive (English)

Full Text Available 7,47.9,41.3,666 GSM1146470: rIgG1a [prostate, castrated+vehicle]; Mus musculus; ChIP-Seq source_name=rIgG1a ...|| strain=wild type ICR || tissue=prostate || age=8-12 weeks old || treatment=castrated+vehicle || chip anti

Color classification of veal carcasses: Past, present and future

NARCIS (Netherlands)

Lucassen, M.P.; Alferdinck, J.W.A.M.; Megen, R. van

2010-01-01

In The Netherlands, veal carcasses are classified on color, conformation and fatness. In the past 20 years, major efforts have been put into the development of a reliable color classification system. Initially, the color of the musculus rectus abdominis was visually matched to a 10-point scale.

Experiment list: SRX590292 [Chip-atlas[Archive

Lifescience Database Archive (English)

Full Text Available -rep1; Mus musculus; ChIP-Seq source_name=R-Ctrl-Flag ChIP || strain background=C57BL/6 || genotype/variation=Foxd3 conditional knock...out || cell type=embryonic stem cells (ESCs; R cells) || cell line of origin=Foxd3 conditional knock

Dicty_cDB: Contig-U13205-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available |pid:none) Amphimedon queenslandica notch mRN... 50 8e-05 AX805769_1( AX805769 |pid:none) Sequence 1 from P...pid:none) M.musculus mRNA for receptor LR11/gp25... 50 8e-05 EU273942_1( EU273942

Melanoides tuberculata (Mollusca: Thiaridae as an intermediate host of Centrocestus formosanus (Trematoda: Heterophyidae in Brazil Melanoides tuberculata (Mollusca: Thiaridae como hospedeiro intermediário de Centrocestus formosanus (Trematoda: Heterophyidae no Brasil

Directory of Open Access Journals (Sweden)

Hudson Alves Pinto

2010-08-01

Full Text Available Pleurolophocercous cercariae emerged from naturally infected Melanoides tuberculata from Minas Gerais State, Brazil, were used to perform experimental infection of laboratory-reared Poecilia reticulata. Mature metacercariae were obtained from the gills of fishes and force-fed to Mus musculus. The adult parasites which recovered from small intestines of mice were identified as Centrocestus formosanus. This is the first report of M. tuberculata as intermediate host of this heterophyid in Brazil.Cercárias do tipo pleurolofocerca emergidas de Melanoides tuberculata naturalmente infectados coletados na represa da Pampulha, Belo Horizonte, Minas Gerais, Brasil, foram utilizadas para a infecção experimental de Poecilia reticulata criados em laboratório. Metacercárias maduras foram obtidas nas brânquias dos peixes e administradas por via oral a Mus musculus. Parasitos adultos recuperados no intestino delgado dos camundongos foram identificados como Centrocestus formosanus. Este é o primeiro relato de M. tuberculata como hospedeiro intermediário deste parasito no Brasil.

Xenopsylla spp. (Siphonaptera: Pulicidae) in murid rodents from the Canary Islands: an update.

Science.gov (United States)

Sánchez, S; Gómez, M S

2012-11-01

The geographical and host distributions of Xenopsylla fleas parasitizing murid rodents on the Canary Islands have been reported. Three Xenopsylla species, X. cheopis, X. brasiliensis and X. guancha, have been detected on two rodents species, Mus musculus and Rattus rattus. X. guancha has been the most prevalent species detected, specifically on M. musculus, the most abundant rodent, but it has been detected only on three eastern islands, where the species is endemic. X. cheopis has been shown to be the most widely distributed species throughout the archipelago and the species most frequently found on R. rattus. X. brasiliensis has been shown to be the least prevalent Xenopsylla species, with the lowest geographical distribution on the Canary Islands and focused only on R. rattus. The detection of both X. cheopis and X. brasiliensis on the island of Lanzarote, and of X. guancha on the island of Fuerteventura and the islet of La Graciosa represents the first report of these species on those particular Canary Islands.

Xenopsylla spp. (Siphonaptera: Pulicidae in murid rodents from the Canary Islands: An update

Directory of Open Access Journals (Sweden)

Sánchez S.

2012-11-01

Full Text Available The geographical and host distributions of Xenopsylla fleas parasitizing murid rodents on the Canary Islands have been reported. Three Xenopsylla species, X. cheopis, X. brasiliensis and X. guancha, have been detected on two rodents species, Mus musculus and Rattus rattus. X. guancha has been the most prevalent species detected, specifically on M. musculus, the most abundant rodent, but it has been detected only on three eastern islands, where the species is endemic. X. cheopis has been shown to be the most widely distributed species throughout the archipelago and the species most frequently found on R. rattus. X. brasiliensis has been shown to be the least prevalent Xenopsylla species, with the lowest geographical distribution on the Canary Islands and focused only on R. rattus. The detection of both X. cheopis and X. brasiliensis on the island of Lanzarote, and of X. guancha on the island of Fuerteventura and the islet of La Graciosa represents the first report of these species on those particular Canary Islands.

Dicty_cDB: Contig-U14247-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available 22555 ) Zebrafish DNA sequence from clone DKEY-19D21 in l... 44 7.5 1 ( BV440136 ) S237P6107RD7.T0 Portugu...eseWaterDog Canis familiar... 44 7.5 1 ( AC158364 ) Mus musculus BAC clone RP23-187

AcEST: DK950437 [AcEST

Lifescience Database Archive (English)

Full Text Available n Hook homolog 1 OS=Mus musculus GN=... 45 4e-04 sp|Q9UJC3|HOOK1_HUMAN Protein Hook homolog 1 OS=Homo sapien... 483 IVELESQVDSLSARVAELNTERMSSQQ 563 I EL+ Q++ ++ EL TE+ S++ Sbjct: 489 IEELQEQLEQKHRKMNELETEQRLSKE 515 >sp|Q9Y2K

Dicty_cDB: Contig-U11740-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available cds. 46 3.0 1 ( AB016988 ) Mus musculus mRNA for Nibrin, complete cds. 46 3.0 1 ( DL001650 ) Methods for Molecular Toxicology...eling. 46 3.0 1 ( DD040769 ) Molecular Toxicology Modeling. 46 3.0 1 ( AX401127 ) Sequence 803 from Patent W

Unigene BLAST: CBRC-MMUS-14-0020 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-MMUS-14-0020 gnl|UG|Mm#S8040853 Mus musculus opsin 1 (cone pigments), short-wave-sensitive (color blind...ness, tritan) (Opn1sw), mRNA /cds=p(66,1106) /gb=NM_007538 /gi=31543369 /ug=Mm.56987 /len=2521 9e-37 29% ...

Unigene BLAST: CBRC-MMUS-03-0073 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-MMUS-03-0073 gnl|UG|Mm#S8040853 Mus musculus opsin 1 (cone pigments), short-wave-sensitive (color blind...ness, tritan) (Opn1sw), mRNA /cds=p(66,1106) /gb=NM_007538 /gi=31543369 /ug=Mm.56987 /len=2521 2e-27 27% ...

On the determination of Toxoplasma gondii virulence in mice

Science.gov (United States)

Toxoplasma gondii is one of the most successful pathogens on earth, capable of infecting mammals and birds. Numerous papers and reports are published on isolation of T .gondii from various natural sources worldwide. The house mouse (Mus musculus) has been used as the laboratory animal model to deter...

Blue whale sightings in Antarctica west of the Greenwich meridian, Januart 2015

NARCIS (Netherlands)

Geelhoed, S.C.V.; Feij, B.; Franeker, van J.A.; Herr, H.; Janinhoff, N.; McKay, S.J.; Muller, S.; Thomisch, K.; Verdaat, J.P.; Viquerat, S.

2015-01-01

During the RV Polarstern PS 89 (ANT-XXX/2) expedition from Cape Town to Atka Bay and back, 20 sightings of 26 individual blue whales (Balaenoptera musculus) were recorded in Antarctic waters west of the Greenwich Meridian between 16-20 January 2015. These observations suggest a more westerly

QuartetS-DB: A Large-Scale Orthology Database for Prokaryotes and Eukaryotes Inferred by Evolutionary Evidence

Science.gov (United States)

2012-01-01

particular functions and identify species that contain these proteins. For example, if users select two species, Homo sapiens and Mus musculus, and...Kerr AR, McCormack TJ, Riley M: Evolution by leaps: gene duplication in bacteria. Biol Direct 2009, 4:46. 12. Remm M, Storm CE, Sonnhammer EL

Experiment list: SRX648116 [Chip-atlas[Archive

Lifescience Database Archive (English)

Full Text Available 02 GSM1430423: iPSC OSK2; Mus musculus; ChIP-Seq source_name=reprogramming from MEF cell || cell line=iPSC O...SK2 || passage=15-20 || reprogramming factors=Oct4, Sox2, Klf4 || antibody=H2A.X (Xiao lab) http://dbarchive

Experiment list: SRX897941 [Chip-atlas[Archive

Lifescience Database Archive (English)

Full Text Available 081,98.0,12.4,11292 GSM1624626: ChIP seq Chaf1a.166 Sox2 IP day3; Mus musculus; ChIP-Seq source_name=OKSM reprogramming... intermediates from Mouse Embryonic Fibroblasts || strain=Black6-129X1/SvJ || cell type=OKSM reprogramming

Experiment list: SRX648117 [Chip-atlas[Archive

Lifescience Database Archive (English)

Full Text Available 08 GSM1430424: iPSC OSK9; Mus musculus; ChIP-Seq source_name=reprogramming from MEF cell || cell line=iPSC O...SK9 || passage=15-20 || reprogramming factors=Oct4, Sox2, Klf4 || antibody=H2A.X (Xiao lab) http://dbarchive

Experiment list: SRX648115 [Chip-atlas[Archive

Lifescience Database Archive (English)

Full Text Available 37 GSM1430422: iPSC OSK4; Mus musculus; ChIP-Seq source_name=reprogramming from MEF cell || cell line=iPSC O...SK4 || passage=15-20 || reprogramming factors=Oct4, Sox2, Klf4 || antibody=H2A.X (Xiao lab) http://dbarchive

Experiment list: SRX483617 [Chip-atlas[Archive

Lifescience Database Archive (English)

Full Text Available 25 GSM1342525: iPSC OSKM8; Mus musculus; ChIP-Seq source_name=reprogramming from MEF cell || cell line=iPSC ...OSKM8 || passage=15-20 || reprogramming factors=Oct4, Sox2, Klf4 and Myc || antibody=H2A.X (Xiao lab) http:/

Experiment list: SRX1090866 [Chip-atlas[Archive

Lifescience Database Archive (English)

Full Text Available gramming || cell type=intermediate stage of somatic cell reprogramming || chip anti...1,96.8,4.5,197 GSM1816303: pre-iPS rep.H3K27me3.ChIP-Seq; Mus musculus; ChIP-Seq source_name=intermediate stage of somatic cell repro

Experiment list: SRX483616 [Chip-atlas[Archive

Lifescience Database Archive (English)

Full Text Available 54 GSM1342524: iPSC OSKM5; Mus musculus; ChIP-Seq source_name=reprogramming from MEF cell || cell line=iPSC ...OSKM5 || passage=15-20 || reprogramming factors=Oct4, Sox2, Klf4 and Myc || antibody=H2A.X (Xiao lab) http:/

Unigene BLAST: CBRC-MMUS-20-0033 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-MMUS-20-0033 gnl|UG|Mm#S8040853 Mus musculus opsin 1 (cone pigments), short-wave-sensitive (color blind...ness, tritan) (Opn1sw), mRNA /cds=p(66,1106) /gb=NM_007538 /gi=31543369 /ug=Mm.56987 /len=2521 5e-78 42% ...

Unigene BLAST: CBRC-MMUS-01-0101 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-MMUS-01-0101 gnl|UG|Mm#S8040853 Mus musculus opsin 1 (cone pigments), short-wave-sensitive (color blind...ness, tritan) (Opn1sw), mRNA /cds=p(66,1106) /gb=NM_007538 /gi=31543369 /ug=Mm.56987 /len=2521 3e-33 28% ...

Unigene BLAST: CBRC-MMUS-17-0171 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-MMUS-17-0171 gnl|UG|Mm#S8040853 Mus musculus opsin 1 (cone pigments), short-wave-sensitive (color blind...ness, tritan) (Opn1sw), mRNA /cds=p(66,1106) /gb=NM_007538 /gi=31543369 /ug=Mm.56987 /len=2521 2e-22 22% ...

NCBI nr-aa BLAST: CBRC-XTRO-01-3247 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-XTRO-01-3247 sp|P97718|ADA1A_MOUSE Alpha-1A adrenergic receptor (Alpha 1A-adre...noceptor) (Alpha 1A-adrenoreceptor) (Alpha-1C adrenergic receptor) gb|AAC02658.1| alpha 1A-adrenergic receptor [Mus musculus] P97718 0.0 69% ...

NCBI nr-aa BLAST: CBRC-MMUS-14-0085 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-MMUS-14-0085 sp|P97718|ADA1A_MOUSE Alpha-1A adrenergic receptor (Alpha 1A-adre...noceptor) (Alpha 1A-adrenoreceptor) (Alpha-1C adrenergic receptor) gb|AAC02658.1| alpha 1A-adrenergic receptor [Mus musculus] P97718 0.0 99% ...

AcEST: BP917335 [AcEST

Lifescience Database Archive (English)

Full Text Available _MOUSE DNA-binding protein SMUBP-2 OS=Mus musculus GN=Ighmbp2 PE=1 SV=1 Length = 993 Score = 42.4 bits (98),...THGEYTSAAE 635 >tr|Q9EQN5|Q9EQN5_RAT Antifreeze-enhancer binding protein AEP OS=Rattus norvegicus GN=Ighmbp2

Diversifying selection and functional analysis of interleukin-4 suggests antagonism-driven evolution at receptor-binding interfaces

Directory of Open Access Journals (Sweden)

Brown Scott

2010-07-01

Full Text Available Abstract Background Interleukin-4 (IL4 is a secreted immunoregulatory cytokine critically involved in host protection from parasitic helminths 1. Reasoning that helminths may have evolved mechanisms to antagonize IL4 to maximize their dispersal, we explored mammalian IL4 evolution. Results This analysis revealed evidence of diversifying selection at 15 residues, clustered in epitopes responsible for IL4 binding to its Type I and Type II receptors. Such a striking signature of selective pressure suggested either recurrent episodes of pathogen antagonism or ligand/receptor co-evolution. To test the latter possibility, we performed detailed functional analysis of IL4 allotypes expressed by Mus musculus musculus and Mus musculus castaneus, which happen to differ at 5 residues (including three at positively selected sites in and adjacent to the site 1 epitope that binds the IL4Rα subunit shared by the Type I and Type II IL4 receptors. We show that this intra-species variation affects the ability of IL4 neither to bind IL4 receptor alpha (IL4Rα nor to signal biological responses through its Type I receptor. Conclusions Our results -- reminiscent of clustered positively selected sites revealing functionally important residues at host-virus interaction interfaces -- are consistent with IL4 having evolved to avoid recurrent pathogen antagonism, while maintaining the capacity to bind and signal through its cognate receptor. This work exposes what may be a general feature of evolutionary conflicts fought by pathogen antagonists at host protein-protein interaction interfaces involved in immune signaling: the emergence of receptor-binding ligand epitopes capable of buffering amino acid variation.

Presencia de los géneros invasores Mus y Rattus en áreas naturales de Chile: un riesgo ambiental y epidemiológico Presence of the invasive genera Mus and Rattus in natural areas in Chile: an environmental and epidemiological risk

Directory of Open Access Journals (Sweden)

GABRIEL LOBOS

2005-03-01

Full Text Available Realizamos un estudio que incluyó muestreos y prospecciones en un gradiente latitudinal en Chile continental para determinar la presencia y ausencia de roedores murinos introducidos, particularmente Mus musculus, Rattus rattus y R. norvegicus en áreas naturales o silvestres a lo largo de Chile. Además se analizó el riesgo epidemiológico que representan estas especies en el marco de un estudio sobre el virus Hanta. Los resultados mostraron que M. musculus rara vez es recolectado en áreas naturales. Sin embargo, las dos especies de Rattus han invadido ampliamente la región mediterránea chilena. Las regiones desérticas, los ambientes de alturas y las regiones australes, serían biótopos restringidos para estos invasores. Desde una perspectiva epidemiológica, la presencia del virus Hanta (variedades Andes y Seoul en Rattus es un elemento que demuestra que las especies invasoras además de generar impactos ecológicos, pueden ocasionar problemas económicos y de salud pública. La fragilidad de los ecosistemas mediterráneos determina que la presencia de especies exóticas constituya un elemento de alto riesgo para la conservación del patrimonio natural del país. Probablemente, la conservación de áreas naturales constituye la mejor herramienta para enfrentar a estas especies exóticasWe conducted a latitudinal study in natural areas of continental Chile to evaluate the occurrence of the introduced murine rodents Mus musculus, Rattus rattus and R. norvegicus. Furthermore, we evaluated the epidemiological risk of these species as part of an ongoing study on Hantavirus. The results allowed us to conclude that M. musculus occurs rarely in natural environments. However, the two species of Rattus have widely invaded the mediterranean region of Chile. Desert, altitudinal and high latitude regions seem to be restricted areas for these invasive rodents. From an epidemiological perspective, the occurrence of Hantavirus in Rattus (Andes and Seoul

Jenis-Jenis Tikus (Rodentia: Muridae dan Pakan Alaminya di Daerah Pertanian Sekitar Hutan di Kabupaten Banggai, Sulawesi Tengah

Directory of Open Access Journals (Sweden)

Bambang Agus Suripto

2002-07-01

Full Text Available The species diversity of rats (Fam. Muridae differs on each island in Indonesia. There are at least 16 genera of 41 species of rats in Sulawesi Island. Recently it has been reported that rats attack relatively new paddy field surrounding forest, but the identity of the species is still unknown. The objectives of this research are to assess the rat’s diversity and the guilds of rats living around the forest. The research was done in agricultural area surrounding forest in Siuna, foothill of Tompotika Mt, Banggai Regency, Central Sulawesi. Rats in the forest and coconut plantation were captured using Shermann traps, which were randomly situated. Rats in paddy field were captured by trap barrier system (TBS. Habitat condition and the presence of predators were recorded. All rat specimens were identified to their scientific names using Corbert & Hill (1992. Their stomach contents was put in 70% alcohol, taken 5 samples for each stomach, and analyzed under a microscope to determine their feed. The data were interpreted descriptively, which was emphasizing its potency as a pest. The result shows that there are 7 genera i.e. Bunomys, Maxomys, Taeromys, Paruromys, Tateomys, Mus, Rattus and 18 species of rats. Bunomys sp., B. penitus, B. prolatus, Maxomys sp., M. musschenbroekii, M. dollmani, Taeromys sp., T. callitrichus, T. celebensis, T. rhinogradoide, Paruromys ursinus, P. camurus, and P. dominator occupy the forest. B. heinrichi, B. prolatus, M. musschenbroekii, P. camurus, Mus musculus; and Rattus nitidus ocupy coconut plantation. R. argentiventer, R. exulans and R. nitidus occupies the paddy field. The stomach content examination shows that B. prolatus, M. musschenbroekii, R. exulans, R. nitidus, and T. rhinogradoide eat mostly animal materials, especially member of Phylum Arthropoda; R. argentiventer mostly eat plant material, especially member of Family Graminae (grass family. Unfortunately the stomach contents B. heinrichi, B. penitus, M

Environmental Impact Statement. Disposal and Reuse of Wurtsmith Air Force Base, Michigan

Science.gov (United States)

1993-09-01

Mephitis mephitis Meadow vole Microtus pennsy/vanicus House mouse Mus musculus Long-tailed weasel Mustela frenata Mink Mustela vison Little brown bat...fuels, such as coal and oil, are burned. SO2 is the main pollutant involved in the formation of acid rain. SO also can irritate the upper respiratory

Experiment list: SRX977401 [Chip-atlas[Archive

Lifescience Database Archive (English)

Full Text Available 98.9,13.8,95651 GSM1648652: H3K27ac ChipSeq day1; Mus musculus; ChIP-Seq source_name=reprogramming intermedi...ate after 24hour of induction || cell type=reprogramming intermediate || genotype=H3K27ac-GFP/ Rosa26-M2rtTA

Experiment list: SRX977402 [Chip-atlas[Archive

Lifescience Database Archive (English)

Full Text Available 98.8,11.6,43739 GSM1648653: H3K27ac ChipSeq day3; Mus musculus; ChIP-Seq source_name=reprogramming intermedi...ate after 3days of induction || cell type=reprogramming intermediate || genotype=H3K27ac-GFP/ Rosa26-M2rtTA

Experiment list: SRX977406 [Chip-atlas[Archive

Lifescience Database Archive (English)

Full Text Available 98.9,8.3,18501 GSM1648657: H3K27ac ChipSeq day15; Mus musculus; ChIP-Seq source_name=reprogramming intermedi...ate after 15days of induction || cell type=reprogramming intermediate || genotype=H3K27ac-GFP/ Rosa26-M2rtTA

Experiment list: SRX218536 [Chip-atlas[Archive

Lifescience Database Archive (English)

Full Text Available strain=C57Bl/6 || age/gender=2-3 month old males || chip antibody=Santa Cruz Tech. rIgG (sc-2027) http://db....7,16.5,1194 GSM1067409: Rabbit IgG mouse liver ChIP-seq; Mus musculus; ChIP-Seq GEO Accession=GSM1067409 ||