WorldWideScience

Sample records for hm nautical almanac

  1. Development of Nautical Almanac at Korea Astronomy Observatory

    Science.gov (United States)

    Han, In-Woo; Shin, Junho

    1994-12-01

    In Korea Astronomy Observatory, we developed a S/W package to compile the Korean Nautical Almanac. We describe the motivation to develop the S/W and explain the S/W package in general terms. In appendix, we describe the procedure to calculate the polaris table in more detail. When we developed the S/W, we paid much attention to produce accurate data. We also made great effort to automate the compilation of Nautical Almanac as far as possible, since the compilation is time consuming labour extensive. As a result, the S/W we developed turns out to be very accurate and efficient to compile Nautical Almanac. In fact, we could compile a Korean Nautical Almanac in a few days.

  2. 150 Years of the American Nautical Almanac Office

    Science.gov (United States)

    Dick, S. J.

    1999-05-01

    In 1849, 50 years before the founding of the American Astronomical Society, the American Nautical Almanac Office was established in Cambridge, Massachusetts. Although the British had published a Nautical Almanac since 1767, both patriotic and practical reasons lay behind the founding of an American Nautical Almanac Office in the context of the growth of science in the United States. Lt. Charles Henry Davis served as the first Superintendent. In 1866 the Office moved to Washington, D. C., and beginning in 1893 it was physically located at the new (present) site of the U. S. Naval Observatory, of which it became a part over the next few years, and where it has since remained. >From its beginning the work of the Office was much broader than the publication of data for navigation. The Office also sought to improve the theories of motion of the Sun, Moon and planets, and the astronomical constants on which the Almanac was based. Under Simon Newcomb, Superintendent of the Office from 1877 until his retirement in 1897, a consistent system of constants was devised; some of these constants remained unchanged until 1984. The American Nautical Almanac Office was dominated before World War II by its Directors William S. Eichelberger (1910-1929) and A. James Robertson (1929-1939). During the War years Wallace J. Eckert introduced punched card techniques to the Office. Gerald Clemence used these techniques to improve planetary theories during his years as Director (1945-1958), and also ushered in the era of the electronic computer for both research and production. International collaboration was a hallmark of the tenures of Clemence, Edgar Woolard, Raynor Duncombe and P. K. Seidelmann, who also implemented changes necessitated by the Space Age. Since 1990 the Nautical Almanac Office has been part of the Astronomical Applications Department of the Naval Observatory.

  3. Explanatory supplement to the astronomical almanac

    CERN Document Server

    Urban, Sean E

    2013-01-01

    The Explanatory Supplement to the Astronomical Almanac offers explanatory material, supplemental information and detailed descriptions of the computational models and algorithms used to produce The Astronomical Almanac, which is an annual publication prepared jointly by the US Naval Observatory and Her Majesty's Nautical Almanac Office in the UK. Like The Astronomical Almanac, The Explanatory Supplement provides detailed coverage of modern positional astronomy. Chapters are devoted to the celestial and terrestrial reference frames, orbital ephemerides, precession, nutation, Earth rotation, and coordinate transformations. These topics have undergone substantial revisions since the last edition was published. Astronomical positions are intertwined with timescales and relativity in The Astronomical Almanac, so related chapters are provided in The Explanatory Supplement. The Astronomical Almanac also includes information on lunar and solar eclipses, physical ephemerides of solar system bodies, and calendars, so T...

  4. Explanatory Supplement to the Astronomical Almanac, Third Edition

    Science.gov (United States)

    Seidelmann, P. Kenneth; Urban, S. E.

    2010-01-01

    "The Explanatory Supplement to the Astronomical Almanac" (hereafter "The Explanatory Supplement") is a comprehensive reference book on the topic of positional astronomy, covering the theories and algorithms used to produce "The Astronomical Almanac" (AsA), an annual publication produced jointly by the Nautical Almanac Office of the US Naval Observatory (USNO) and Her Majesty's Nautical Almanac Office (HMNAO) of the UK Hydrographic Office. The first edition of The Explanatory Supplement appeared in 1961 and was reprinted with amendments during the 1970s. The second edition was printed in 1992 and reprinted until 2006. Since the second edition, several changes have taken place in positional astronomy regarding reference systems and internationally accepted models, data sets, and computational methods; these have been incorporated into the AsA. Additionally, the data presented in the AsA have been modified over the years, with new tables being added and some being discontinued. Given these changes, a new edition of The Explanatory Supplement is appropriate. The third edition has been in development for the last few years and will be available in 2010. The book is organized similarly to the second (1991) edition, with each chapter written by subject matter experts. Authors from USNO and HMNAO contributed to the majority of the book, but there are authors from Jet Propulsion Laboratory, Technical University of Dresden, National Geospatial-Intelligence Agency, University of Texas Austin, and University of Virginia. This paper will discuss this latest edition of the Explanatory Supplement.

  5. The water almanac 1992

    International Nuclear Information System (INIS)

    Wagner, R.

    1991-01-01

    The Water Almanac 1992 - a yearbook for the entire water field - presents contributions on current topics in water engineering and in water law and environmental law and information on FRG public authorities or institutions responsible for water resources management or water research, as well as on educational facilities in this field in the FRG, Austria and Switzerland, including independent scientific institutions. The contribution on the consequences of the Chernobyl reactor accident for the environment in western Europe has been analysed as a separate document for retrieval from the database. (BBR) [de

  6. The Einstein almanac

    CERN Document Server

    Calaprice, Alice

    2005-01-01

    Albert Einstein was an exceptional human being. Perhaps nothing reflects the breadth and scope of his brilliance, his interests, and his influence better than his publications -- more than six hundred scientific papers, books, essays, reviews, and opinion pieces. Einstein began publishing in March 1901 with a scientific work that appeared in the German journal Annalen der Physik when he was twenty-two; the last publication was an editorial in the journal Common Cause which appeared a few months before his death in 1955. In the fifty-four-year interval, his published work ranged widely over relativity theory and quantum physics, nationalism, Judaism, war, peace, and education. Indeed, Einstein's literary output was so abundant that even many of his most informed admirers are not familiar with all of it. The Einstein Almanac takes a look at Einstein's year-by-year output, explaining his three-hundred most important publications and setting them into the context of his life, science, and world history. Concentr...

  7. Nuclear industry almanac v.1

    International Nuclear Information System (INIS)

    Greenhalgh, G.; Jeffs, E.

    1982-01-01

    Nuclear Industry Almanac. National energy profiles of 17 Western European countries are given, concentrating on electricity supply and the role nuclear power plays in meeting the demand for electric power. The nuclear industries of Austria, Belgium, Finland, France, Germany, Italy, the Netherlands, Spain, Sweden, Switzerland and the United Kingdom are described and addresses of establishments and industries are listed. (U.K.)

  8. Indians in Almanacs (1793-1815)

    Science.gov (United States)

    Wenrick, Jon S.

    1975-01-01

    The American Indian appeared frequently in the almanac literature of 1783-1815 and was used as a source of humor, political comment, romanticism, etc, much of which contributed to the cultural conflict of the times. (JC)

  9. Stars on Local Time: A Personal Almanac

    Science.gov (United States)

    Gottlieb-Roberts, M.

    2016-01-01

    First presented at INSAP VIII, the artwork A Personal Almanac is my interpretation of the familiar seasons-of-life allegory. The booklet's eight pairs of seasonal pages— spring equinox through the cross-quarter Groundhog Day—portray a life in the decades from the 1940s to the 2010s under the stars of rural Georgia, France, Miami, West Africa and the other places I have lived. A Personal Almanac is included in the art book A Durable Tale, the illustrated story of my thirty-year search in the Southeast United States and in West Africa for living memories of old star almanacs. In that odyssey I uncovered some very deep roots for an oral literature of the African desert, the nomadic bard's star story that I believe inspired creation of the first nine tablets of the standard version Babylonian Gilgamesh.

  10. 46 CFR 167.05-25 - Nautical school ship.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 7 2010-10-01 2010-10-01 false Nautical school ship. 167.05-25 Section 167.05-25 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) NAUTICAL SCHOOLS PUBLIC NAUTICAL SCHOOL SHIPS Definitions § 167.05-25 Nautical school ship. The term nautical school ship means a vessel operated by or in connection with a nautical school...

  11. Cartographic Rules and Differences in Nautical Data Visualization on Paper and Electronic Nautical Charts

    Directory of Open Access Journals (Sweden)

    Tea Duplančić Leder

    2013-04-01

    Full Text Available This paper aims to present cartographic rules for the production of paper and electronic navigational charts and main differences in compilation, visualisation and representation of nautical information. Major differences between paper nautical charts and ENC are visualisation of nautical data: colour mixing, resolution of represented nautical objects, human control of display representation and fonts and signatures and chart content are described. It is concluded that electronic navigational charts have many advantages and few shortcomings to paper navigational charts.

  12. Fostering Nautical Tourism in the Balearic Islands

    Directory of Open Access Journals (Sweden)

    María J. Moreno

    2017-11-01

    Full Text Available The aim of this paper is to determine pillars for fostering nautical tourism based on the beliefs and attitudes that professionals in the sector have towards the particularities and difficulties that the market is going through. To achieve these goals, in-depth interviews structured around 37 questions were carried out with agents of associations and nautical firms, public institutions, and the Chamber of Commerce. The qualitative analysis program NVIVO 11 was used to analyze the content of the gathered data. The findings reveal that the main difficulties are related to normative issues and taxation, illegal supply, and a lack of definition of the nautical tourist profile. This absence of definition causes a vagueness when estimating the total number of nautical tourists that visit a destination. Thus, this affects evaluation of the economic, social, and environmental impact of nautical tourism.

  13. Multiyear interactive computer almanac, 1800-2050

    CERN Document Server

    United States. Naval Observatory

    2005-01-01

    The Multiyear Interactive Computer Almanac (MICA Version 2.2.2 ) is a software system that runs on modern versions of Windows and Macintosh computers created by the U.S. Naval Observatory's Astronomical Applications Department, especially for astronomers, surveyors, meteorologists, navigators and others who regularly need accurate information on the positions, motions, and phenomena of celestial objects. MICA produces high-precision astronomical data in tabular form, tailored for the times and locations specified by the user. Unlike traditional almanacs, MICA computes these data in real time, eliminating the need for table look-ups and additional hand calculations. MICA tables can be saved as standard text files, enabling their use in other applications. Several important new features have been added to this edition of MICA, including: extended date coverage from 1800 to 2050; a redesigned user interface; a graphical sky map; a phenomena calculator (eclipses, transits, equinoxes, solstices, conjunctions, oppo...

  14. 46 CFR 167.05-35 - Public nautical school.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 7 2010-10-01 2010-10-01 false Public nautical school. 167.05-35 Section 167.05-35 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) NAUTICAL SCHOOLS PUBLIC NAUTICAL SCHOOL SHIPS Definitions § 167.05-35 Public nautical school. The term public nautical school means any school...

  15. Fostering Nautical Tourism in the Balearic Islands

    OpenAIRE

    María J. Moreno; F. Javier Otamendi

    2017-01-01

    The aim of this paper is to determine pillars for fostering nautical tourism based on the beliefs and attitudes that professionals in the sector have towards the particularities and difficulties that the market is going through. To achieve these goals, in-depth interviews structured around 37 questions were carried out with agents of associations and nautical firms, public institutions, and the Chamber of Commerce. The qualitative analysis program NVIVO 11 was used to analyze the content of t...

  16. 46 CFR 168.10-5 - Civilian nautical school.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 7 2010-10-01 2010-10-01 false Civilian nautical school. 168.10-5 Section 168.10-5 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) NAUTICAL SCHOOLS CIVILIAN NAUTICAL SCHOOL VESSELS Definitions of Terms Used in This Part § 168.10-5 Civilian nautical school. The term civilian...

  17. Progress in the technology of nautical charting

    Digital Repository Service at National Institute of Oceanography (India)

    Joseph, A.

    ". The article skims through the various aspects of safety of navigation such as nautical charts created by the Arabs in the medieval days of stellar navigation in the Indian Ocean; the contributions by the Chinese, the British, and the Portuguese; hydrographic...

  18. 46 CFR 109.565 - Charts and nautical publications.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 4 2010-10-01 2010-10-01 false Charts and nautical publications. 109.565 Section 109... OPERATIONS Miscellaneous § 109.565 Charts and nautical publications. The master or person in charge of a self...) Notices to mariners. (f) Tide Tables. (g) Current Tables. (h) All other nautical publications necessary. 1...

  19. 46 CFR 97.05-5 - Charts and nautical publications.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 4 2010-10-01 2010-10-01 false Charts and nautical publications. 97.05-5 Section 97.05... OPERATIONS Notice to Mariners and Aids to Navigation § 97.05-5 Charts and nautical publications. As... tables; (g) Current tables; and (h) All other nautical publications necessary. 1 1 For United States...

  20. 46 CFR 173.051 - Public nautical school ships.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 7 2010-10-01 2010-10-01 false Public nautical school ships. 173.051 Section 173.051 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) SUBDIVISION AND STABILITY SPECIAL RULES PERTAINING TO VESSEL USE School Ships § 173.051 Public nautical school ships. Each public nautical school...

  1. 46 CFR 78.05-5 - Charts and nautical publications.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 3 2010-10-01 2010-10-01 false Charts and nautical publications. 78.05-5 Section 78.05... Notice to Mariners and Aids to Navigation § 78.05-5 Charts and nautical publications. As appropriate for... publications necessary. 1 1 For United States vessels in or on the navigable waters of the United States, see...

  2. 46 CFR 26.03-4 - Charts and nautical publications.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 1 2010-10-01 2010-10-01 false Charts and nautical publications. 26.03-4 Section 26.03... Operating Requirements § 26.03-4 Charts and nautical publications. (a) As appropriate for the intended... navigation possible; (2) “U.S. Coast Pilot” or similar publication; (3) Coast Guard light list; (4) Tide...

  3. Spatial characteristics of planning and construction of nautical tourism ports

    Directory of Open Access Journals (Sweden)

    Mirjana Kovačić

    2007-01-01

    Full Text Available This paper systematically and clearly definesthesignificanceoftheseaandcoastalareainnauticaltourismactivities’ preformances. Ecological aspect of the area is considered and the need for a systematic and multidiscipline planning of its development and the usage is pointed out. With its specificactivityandtheneedforspacearoundthe coastal line within maritime domain, nautical tourism emphasizes problems of protection of costal and sea environment. Location of nautical tourism ports and spatial planning becomes one of the most important issues. Therefore, spatial plans have to be subordinated to the protection and promotion of the environment, which implies efficient, but sensible managing of the coastal area. Authors have emphasized the importance of integral managing in the function of nautical tourism development and selection of nautical tourism ports locations. The significance of sustained research is pointed out in order to understand its role in development of country’s economy. Respecting areal and ecological aspects of nautical tourism development, a sustainable development model of nautical tourism ports has been completed. The model indicates the selection of scientific methodology using methods of multicriterial analysis and team work of experts from various fields.

  4. hmF2 variability over Havana

    International Nuclear Information System (INIS)

    Lazo, B.; Alazo, K.; Rodriguez, M.; Calzadilla, A.

    2003-01-01

    The hmF2 variability over Havana station (Geo. Latitude 23 deg. N, Geo Longitude 278 deg. E; Dip 54.6 deg. N; Modip: 44.8 deg. N) is presented. In this study different solar and seasonal conditions are considered. The results show that, in general, standard deviation of hmF2 is quite irregular and reaches its values at nighttimes hours. Lower and upper quartiles variability has a similar behaviour to IQ variability, showing its higher values at nighttimes too. (author)

  5. Development of HM12 cyclotron for PET

    International Nuclear Information System (INIS)

    Morita, Takuzo; Kawama, Tetsuo; Fujii, Kazuo

    2000-01-01

    In Japan, there are at present more than 30 PET (Positron Emission Tomography) facilities. The movements of medical insurance application to the PET diagnosis using [ 18 F] FDG (2-[ 18 F]-fluoro-2-deoxy-glucose) by the Ministry of Health and Welfare are being enhanced by PET related people. Therefore, more clinical centers using PET system are expected to be built in the near future. HM12 cyclotron was developed to meet such market demands for PET, and the prototype machine has been rent to Cyclotron Radio Isotope Center (CYRIC) of Tohoku University since Oct. 1998 for their use of clinical research with positron emitters like 11 C, 13 N, 15 O and 18 F. We got many technical data of HM12 Cyclotron on the clinical base. The data was enough to establish the reliability of HM12 system operation under the clinical condition. The first commercial product of HM12 Cyclotron was delivered to National Cancer Center in March 2000. The final performance test will be finished by the end of June 2000. (author)

  6. 46 CFR 130.330 - Charts and nautical publications.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 4 2010-10-01 2010-10-01 false Charts and nautical publications. 130.330 Section 130... publications. (a) Except as provided by paragraph (b) or (c) of this section, as appropriate for the intended... navigation possible; (2) U.S. Coast Pilot or similar publication; (3) Coast Guard Light List; (4) Tide Tables...

  7. 46 CFR 121.420 - Charts and nautical publications.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 4 2010-10-01 2010-10-01 false Charts and nautical publications. 121.420 Section 121... publications. (a) As appropriate for the intended voyage, a vessel must carry adequate and up-to-date: (1... publication; (3) Coast Guard Light List; (4) Tide tables; and (5) Current tables, or a river current...

  8. HM Sagittae - a most remarkable star

    International Nuclear Information System (INIS)

    Kwok, S.

    1982-01-01

    The author summarises recent observations of HM Sagittae, a symbiotic star that displays activity in every spectral band from X-ray to radio. He concludes that it is best described as a binary system consisting of a late M giant and a hot compact object which is similar to central stars of planetary nebulae. The presence of a wind from the M giant implies that Roche-lobe overflow is not a necessary condition for mass transfer. The complex structure of the circumstellar nebula is possibly the result of wind interactions. The ongoing spectral evolution of HM Sge after its recent outburst makes it an ideal candidate to test models of the symbiotic phenomenon. (Auth.)

  9. HM Sagittae as a young planetary nebula

    International Nuclear Information System (INIS)

    Kwok, S.; Purton, C.R.

    1979-01-01

    HM Sagittae is suggested to be a very young planetary nebula recently transformed from a red-giant star through continuous mass loss. The observational data for HM Sge have been analyzed in terms of the interacting stellar wind model of planetary nebula formation. The model is in accord with virtually all the spectral data available--radio, optical, and infrared--as well as with the remarkable brightening of HM Sge observed in 1975. In particular, all three gaseous components predicted by the model are observed in the optical spectrum. The density in the newly formed shell is found to be at least 5 x 10 7 cm -3 , a value considerably higher than that found by the conventional analysis, which assumes a single-component homogeneous nebula. The radio spectrum is dominated by free-free emission from the remnant red-giant wind. The infrared spectrum suggests the presence of two dust components, one consisting of silicate grains left over from the red-giant stage and the other of grains newly formed after the 1975 brightening. The low observed shell mass is consistent with the interacting stellar wind model but is not consistent with the conventional sudden-ejection model of planetary nebula formation

  10. Proceedings of the Nautical Almanac Office Sesquicentennial Symposium Held in Washington, The District of Columbia on March 3-4, 1999

    Science.gov (United States)

    1999-03-01

    This is not quite true, for the fifteenth-century Florentine astrono - mer Paolo Toscanelli recorded the night-to-night positions of several comets on...enormously successful Astrono - mische Nachrichten. Later in the nineteenth century, particularly with the development of telegraphic communication, more rapid

  11. 77 FR 40798 - Safety Zone; Nautical City Festival Air Show, Rogers City MI

    Science.gov (United States)

    2012-07-11

    ...-AA00 Safety Zone; Nautical City Festival Air Show, Rogers City MI AGENCY: Coast Guard, DHS. ACTION...; Nautical City Festival Air Show, Rogers City MI; in the Federal Register (77 FR 29932). We received no... Nautical City Festival will be celebrating Calcite's 100th Anniversary. As part of that celebration, an air...

  12. 46 CFR 167.15-20 - Inspections of nautical school ships.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 7 2010-10-01 2010-10-01 false Inspections of nautical school ships. 167.15-20 Section... NAUTICAL SCHOOL SHIPS Inspections § 167.15-20 Inspections of nautical school ships. (a) At each annual inspection, or oftener if deemed necessary, the inspector will inspect the hull, boilers, machinery...

  13. Ceque System of Cuzco: A Yearly Calendar-Almanac in Space and Time

    Science.gov (United States)

    Zuidema, R. Tom

    The Incas used for the administration of Cuzco, the capital of their empire, and its valley a system of 41 directions, called ceque, as viewed from their central temple of the Sun. This system registered their concerns with space, including ritual space, hierarchy, and time, the latter in the form of a detailed calendar-almanac of weekly, monthly, seasonal, and yearly activities. From Inca times are also preserved some textiles that represent different regular calendars concerning the sun, moon, and stars. Detailed ethnohistoric evidence allows the reconstruction of the Ceque calendar-almanac.

  14. The Legacy of Patient H.M. for Neuroscience

    Science.gov (United States)

    Squire, Larry R.

    2009-01-01

    H.M. is probably the best known single patient in the history of neuroscience. His severe memory impairment, which resulted from experimental neurosurgery to control seizures, was the subject of study for five decades until his death in December 2008. Work with H.M. established fundamental principles about how memory functions are organized in the brain. PMID:19146808

  15. ST-HM not only cranes

    CERN Document Server

    Bertone, C

    2002-01-01

    This period of LEP dismantling and LHC installation is a real challenge for the ST-HM group. The group is now following several projects to cope with the diversity of requests. Although crane design and procurement still constitutes the majority of the workload, more and more of our time is nowadays dedicated to providing alternative handling solutions. In 2001/2002, our main studies concern cranes for LHC, industrial and shielded motorised doors, the upgrade/replacement of 32 lifts and mobile cranes. The years 2002/2003 will concern mainly the study of LHC handling systems such as trailers and heavy-duty tractors, specifically tailored containers and tools. In parallel, the monorail will be extended in the injection tunnel and CNGS tunnels and a new monorail system for TOF will be installed. Since the tunnel monorail infrastructure will be used for power feed and guidance purposes only, this requires that other transport systems be studied, such as forklift trucks, industrial and telescopic hoists.

  16. HM-PAO SPECT in the diagnosis of cerebrovascular disease

    International Nuclear Information System (INIS)

    Cordes, M.; Rummeny, E.; Reissmann, M.; Fox, K.; Panitz, N.; Pfannenstiel, P.

    1987-01-01

    Single photon emission computed tomography (SPECT) after injection of 99m-Tc-HM-PAO was used to examine 34 patients whose clinical findings could not exclude a cerebrovascular disease. In all patients an X-ray computed tomography examination was inconclusive for the clinical-neurological findings. The regional cerebral bloodflow was pathologically disturbed in 10 of 34 patients in the HM-PAO SPECT examination. The detection of the regional cerebral bloodflow with HM-PAO SPECT is helpful in the diagnosis of cerebrovascular disease. (orig.) [de

  17. ICA contribution to the development of international standards of competence for nautical cartographers

    Science.gov (United States)

    Furness, Ron; Tsoulos, Lysandros

    2018-05-01

    All professions face challenges as how best to ensure the achievement and continuance of the highest standards as they seek to determine and promulgate best practices. In the essentially linked professions of hydrographic surveying and nautical cartography these challenges become immediately international in their impacts and require close cooperation between the professional bodies representing surveyors, hydrographers and cartographers. The Standards of Competence for Nautical Cartographers are known in short form as S-8 and they describe the minimum required competencies for nautical cartographers. They indicate the minimum degree of knowledge and experience considered necessary for nautical cartographers and provide a set of programme outlines against which the FIG/IHO/ICA International Board on Standards of Competence for Hydrographic Surveyors and Nautical Cartographers may evaluate programmes submitted for recognition. The Standards recognize two levels of competence: Cate- gory A and Category B. In nautical charting communities, Category A programmes offer levels of comprehensive and broad-based knowledge in all aspects of the theory and practice of nautical cartography. Category B programmes provide a level of practical comprehension, along with the essential theoretical background, necessary for individuals to carry out the various nautical cartography tasks. The Standards have recently undergone complete review and should be ratified during 2017/18. This paper aims to bring the existence and aims of the Standards to the wider notice of ICA members and to describe the philosophy and aims of the review in meeting the professional competency needs of the nautical cartographic community.

  18. A nautical study of towed marine seismic streamer cable configurations

    Energy Technology Data Exchange (ETDEWEB)

    Pedersen, Egil

    1996-12-31

    This study concerns marine seismic surveying and especially the towed in-sea hardware which is dominated by recording cables (streamers) that are extremely long compared to their diameter, neutrally buoyant and depth controlled. The present work aims to examine the operations from a nautical viewpoint, and the final objective is to propose improvements to the overall efficiency of marine seismic operations. Full-scale data were gathered from seismic vessels in order to identify which physical parameters affect the dynamic motion of the towing vessel and its in-sea hardware. Experimental test programmes have been carried out, and data bases with the hydrodynamic characteristics of the test equipment have been established at speeds comparable to those used in seismic operations. A basic analysis tool to provide dynamic simulations of a seismic streamer cable has been developed by tailoring the computer program system Riflex, and the validation and accuracy of this modified Riflex system are evaluated by performing uncertainty analyses of measurements and computations. Unexpected, low-frequency depth motions in towed seismic streamer cables occasionally take place when seismic data are being acquired. The phenomenon is analysed and discussed. 99 refs., 116 figs., 5 tabs.

  19. A nautical study of towed marine seismic streamer cable configurations

    Energy Technology Data Exchange (ETDEWEB)

    Pedersen, Egil

    1997-12-31

    This study concerns marine seismic surveying and especially the towed in-sea hardware which is dominated by recording cables (streamers) that are extremely long compared to their diameter, neutrally buoyant and depth controlled. The present work aims to examine the operations from a nautical viewpoint, and the final objective is to propose improvements to the overall efficiency of marine seismic operations. Full-scale data were gathered from seismic vessels in order to identify which physical parameters affect the dynamic motion of the towing vessel and its in-sea hardware. Experimental test programmes have been carried out, and data bases with the hydrodynamic characteristics of the test equipment have been established at speeds comparable to those used in seismic operations. A basic analysis tool to provide dynamic simulations of a seismic streamer cable has been developed by tailoring the computer program system Riflex, and the validation and accuracy of this modified Riflex system are evaluated by performing uncertainty analyses of measurements and computations. Unexpected, low-frequency depth motions in towed seismic streamer cables occasionally take place when seismic data are being acquired. The phenomenon is analysed and discussed. 99 refs., 116 figs., 5 tabs.

  20. The Cognitive Neuroscience of Human Memory Since H.M

    OpenAIRE

    Squire, Larry R.; Wixted, John T.

    2011-01-01

    Work with patient H.M., beginning in the 1950s, established key principles about the organization of memory that inspired decades of experimental work. Since H.M., the study of human memory and its disorders has continued to yield new insights and to improve understanding of the structure and organization of memory. Here we review this work with emphasis on the neuroanatomy of medial temporal lobe and diencephalic structures important for memory, multiple memory systems, visual perception, im...

  1. The retention mechanism of technetium-99m-HM-PAO

    DEFF Research Database (Denmark)

    Neirinckx, R D; Burke, J F; Harrison, R C

    1988-01-01

    Preparations of d,l- and meso-hexamethylpropyleneamine oxime (HM-PAO) labeled with technetium-99m were added to rat brain homogenates diluted with phosphate buffer (1:10). The conversion of d,l-HM-PAO to hydrophilic forms took place with an initial rate constant of 0.12 min-1. Incubation of the b......Preparations of d,l- and meso-hexamethylpropyleneamine oxime (HM-PAO) labeled with technetium-99m were added to rat brain homogenates diluted with phosphate buffer (1:10). The conversion of d,l-HM-PAO to hydrophilic forms took place with an initial rate constant of 0.12 min-1. Incubation....... This correspondence of values supports the notion that GSH may be important for the in vivo conversion of 99mTc-labeled HM-PAO to hydrophilic forms and may be the mechanism of trapping in brain and other cells. A kinetic model for the trapping of d,l- and meso-HM-PAO in tissue is developed that is based on data...

  2. 77 FR 29932 - Safety Zone; Nautical City Festival Air Show, Rogers City, MI

    Science.gov (United States)

    2012-05-21

    ...-AA00 Safety Zone; Nautical City Festival Air Show, Rogers City, MI AGENCY: Coast Guard, DHS. ACTION... City Festival will be celebrating Calcite's 100th Anniversary. As part of that celebration, an air show... posed by the Nautical City Festival air show near Rogers City, MI, the Captain of the Port Sault Sainte...

  3. Natural characteristics of Croatian littoral area as a comparative advantage for nautical tourism development

    Directory of Open Access Journals (Sweden)

    Srećko Favro

    2007-01-01

    Full Text Available Having in mind Croatian littoral area with its unique attractive coast and islands, it can be said that nautical tourism is absolutely authentic and distinctly recognizable Croatian "tourist product". In spite of numerous comparative advantages, Croatian nautical tourism still has not taken the right place on the market of Mediterranean nautical tourism. Future development of nautical tourism with its complementary activities – nautical economy, should be considered as the driving force for social and economic development of Croatian coastal area and islands, and it should be correctly dimensioned in accordance with carrying capacity of the geographical basis and sustainable development principles. Adequate valorization of Croatia’s most important resources, coast and islands, based on sustainable development principles and long-term systematic actions would improve social and economic position of Croatian Adriatic area.

  4. Improving the Determination of Eastern Elongations of Planetary Satellites in the Astronomical Almanac

    Science.gov (United States)

    Rura, Christopher; Stollberg, Mark

    2018-01-01

    The Astronomical Almanac is an annual publication of the US Naval Observatory (USNO) and contains a wide variety of astronomical data used by astronomers worldwide as a general reference or for planning observations. Included in this almanac are the times of greatest eastern and northern elongations of the natural satellites of the planets, accurate to 0.1 hour UT. The production code currently used to determine elongation times generates X and Y coordinates for each satellite (16 total) in 5 second intervals. This consequentially caused very large data files, and resulted in the program devoted to determining the elongation times to be computationally intensive. To make this program more efficient, we wrote a Python program to fit a cubic spline to data generated with a 6-minute time step. This resulted in elongation times that were found to agree with those determined from the 5 second data currently used in a large number of cases and was tested for 16 satellites between 2017 and 2019. The accuracy of this program is being tested for the years past 2019 and, if no problems are found, the code will be considered for production of this section of The Astronomical Almanac.

  5. hm Reduction in Infinitary Term Graph Rewriting Systems

    DEFF Research Database (Denmark)

    Bahr, Patrick

    2017-01-01

    a corresponding theory of Böhm reduction for term graphs. Our main result is that partial order convergence in a term graph rewriting system can be truthfully and faithfully simulated by metric convergence in the Böhm extension of the system. To prove this result we generalise the notion of residuals...... that `meaningless terms' can be contracted to a fresh constant ⊥. In previous work, we have established that Böhm reduction can be instead characterised by a different mode of convergences of transfinite reductions that is based on a partial order structure instead of a metric space. In this paper, we develop...... and projections to the setting of infinitary term graph rewriting. As ancillary results we prove the infinitary strip lemma and the compression property, both for partial order and metric convergence....

  6. The Cognitive Neuroscience of Human Memory Since H.M

    Science.gov (United States)

    Squire, Larry R.; Wixted, John T.

    2011-01-01

    Work with patient H.M., beginning in the 1950s, established key principles about the organization of memory that inspired decades of experimental work. Since H.M., the study of human memory and its disorders has continued to yield new insights and to improve understanding of the structure and organization of memory. Here we review this work with emphasis on the neuroanatomy of medial temporal lobe and diencephalic structures important for memory, multiple memory systems, visual perception, immediate memory, memory consolidation, the locus of long-term memory storage, the concepts of recollection and familiarity, and the question of how different medial temporal lobe structures may contribute differently to memory functions. PMID:21456960

  7. Strategi Pemasaran Makanan Tradisional Asam Pedas Ikan Patin Khas Pekanbaru pada Restoran Pondok Patin Hm. Yunus

    OpenAIRE

    Gunawan, Dwi Yanda; Sulistyani, Andri

    2017-01-01

    Due of the Pondok Patin HM. Yunus Restaurant in Pekanbaru that capture this opportunity is Pondok Patin HM. Yunus Restaurant. The aims of this sturly are identify the implemented marketing strategy, idendify the determinals of marketing strategy forfulation, formulated new marketing strategy. Pondok Patin HM. Yunus Restaurant uses 4 p marketing mix : 1) Product 2) Price 3) Promotion 4) Place. Pondok Patin HM. Yunus restaurant was one of restaurant who providing the signature main course of Pe...

  8. 153Sm-HM for arthritic knee pain. Estimated dosimetry

    International Nuclear Information System (INIS)

    Hardy-Pérez, Alberto E.; Torres-García, Eugenio; Mitsoura, Eleni; Jiménez-Mancilla, Nallely P.; Arteaga-de-Murphy, Consuelo; Pedraza-López, Martha

    2012-01-01

    Osteoarthritis is the most common type of arthropathy and after cardiovascular diseases is the most disabling disease in developing countries. The dosimetry for the clinical application of 153-samarium-hydroxymacroaggregates ( 153 Sm-HM) for radiation synovectomy (RSV) and palliative treatment for arthritic pain, as far as we know, has not been reported. The aim of this research was to estimate the radiation dose necessary for synovial ablation and pain palliation with minimum risk to the patient. 153 Sm-HM (370 MBq) was administered intra-articularly in a patient with severe knee pain and hindered motility. Regions of interest drawn on sequential, conjugated, anterior and posterior scintigraphy images were used to obtain the respective activity. The data was entered into a knee joint histological-geometric model designed with micrometric dimensions to represent the synovial cell layers. The Monte Carlo code was used to calculate the absorbed dose in each of the 12 model-cells representing the distance from the synovial liquid to the cartilage or bone. The absorbed dose in the synovial cavity was 114 Gy which is sufficient energy for RSV. The treated patient referred little pain and higher motility with no adverse reactions. 153 Sm-HM is a potentially valid radiopharmaceutical for RSV, which effectively palliates knee pain.

  9. Virtual Mission First Results Supporting the WATER HM Satellite Concept

    Science.gov (United States)

    Alsdorf, D.; Andreadis, K.; Lettenmaier, D.; Moller, D.; Rodriguez, E.; Bates, P.; Mognard, N.; Participants, W.

    2007-12-01

    Surface fresh water is essential for life, yet we have surprisingly poor knowledge of its variability in space and time. Similarly, ocean circulation and ocean-atmosphere interactions fundamentally drive weather and climate variability, yet the global ocean current and eddy field (e.g., the Gulf Stream) that affects ocean circulation is poorly known. The Water And Terrestrial Elevation Recovery Hydrosphere Mapper satellite mission concept (WATER HM or SWOT per the NRC Decadal Survey) is a swath-based interferometric-altimeter designed to acquire elevations of ocean and terrestrial water surfaces at unprecedented spatial and temporal resolutions. WATER HM will have tremendous implications for estimation of the global water cycle, water management, ocean and coastal circulation, and assessment of many water-related impacts from climate change (e.g., sea level rise, carbon evasion, etc.). We describe a hydrological "virtual mission" (VM) for WATER HM which consists of: (a) A hydrodynamic-instrument simulation model that maps variations in water levels along river channels and across floodplains. These are then assimilated to estimate discharge and to determine trade-offs between resolutions and mission costs. (b) Measurements from satellites to determine feasibility of existing platforms for measuring storage changes and estimating discharge. First results demonstrate that: (1) Ensemble Kalman filtering of VM simulations recover water depth and discharge, reducing the discharge RMSE from 23.2% to 10.0% over an 84- day simulation period, relative to a simulation without assimilation. The filter also shows that an 8-day overpass frequency produces discharge relative errors of 10.0%, while 16-day and 32-day frequencies result in errors of 12.1% and 16.9%, respectively. (2) SRTM measurements of water surfaces along the Mississippi, Missouri, Ohio, and Amazon rivers, as well as smaller tributaries, show height standard deviations of 5 meters or greater (SRTM is the

  10. On the Bridge to Learn: Analysing the Social Organization of Nautical Instruction in a Ship Simulator

    Science.gov (United States)

    Hontvedt, Magnus; Arnseth, Hans Christian

    2013-01-01

    Research on simulator training has rarely focused on the way simulated contexts are constructed collaboratively. This study sheds light on how structuring role-play and fostering social interactions may prove fruitful for designing simulator training. The article reports on a qualitative study of nautical students training in a ship simulator. The…

  11. 78 FR 59339 - Intracoastal Waterway Route “Magenta Line” on NOAA Nautical Charts

    Science.gov (United States)

    2013-09-26

    ... waterways have been based principally on surveys made from 60 to 80 years ago and, necessarily, are obsolete... found where the charted Intracoastal Waterway Route (``magenta line'') passes on the wrong side of aids... specifically seeks comments regarding: 1. How do you currently access the magenta line? On paper nautical...

  12. Sustainable Fashion Supply Chain: Lessons from H&M

    Directory of Open Access Journals (Sweden)

    Bin Shen

    2014-09-01

    Full Text Available Sustainability is significantly important for fashion business due to consumers’ increasing awareness of environment. When a fashion company aims to promote sustainability, the main linkage is to develop a sustainable supply chain. This paper contributes to current knowledge of sustainable supply chain in the textile and clothing industry. We first depict the structure of sustainable fashion supply chain including eco-material preparation, sustainable manufacturing, green distribution, green retailing, and ethical consumers based on the extant literature. We study the case of the Swedish fast fashion company, H&M, which has constructed its sustainable supply chain in developing eco-materials, providing safety training, monitoring sustainable manufacturing, reducing carbon emission in distribution, and promoting eco-fashion. Moreover, based on the secondary data and analysis, we learn the lessons of H&M’s sustainable fashion supply chain from the country perspective: (1 the H&M’s sourcing managers may be more likely to select suppliers in the countries with lower degrees of human wellbeing; (2 the H&M’s supply chain manager may set a higher level of inventory in a country with a higher human wellbeing; and (3 the H&M CEO may consider the degrees of human wellbeing and economic wellbeing, instead of environmental wellbeing when launching the online shopping channel in a specific country.

  13. The development of 99mTc-d, 1-HM-PAO

    International Nuclear Information System (INIS)

    Bai Lanqin; Huang Jinjie; Fan Li; Bai Suzhen; Li Guoli; Jing Hui; Xiao Lun

    1991-12-01

    The 99m Tc-d,1-HM-PAO is an ideal radiopharmaceutical for regional cerebral blood perfusion imaging. The improvement of synthesis and separation of diastereoisomers leads to obtain high purity (>99%) of d, 1-HM-PAO and meso-HM-PAO. During separation H NMR spectroscopy was used to monitor the relative composition of these two diastereoisomers that can ensure the purity of pligand of d,1-HM-PAO. The intravenous injection of 99m Tc-d,1-HM-PAO was formed by adding fresh 99m Tc washing liquor into a sterile. Pyrogen-free and freeze-dried vial. The radiochemical purity (RCP) of 99m Tc-d,1-HM-PAO was greater than 80%. From the experiments of 99m Tc-d,1-HM-PAO in mice, after two minutes of intravenously (I>V>) administration about 2.24% of injected dose (I.D.)appeared in the brain, and after 24 hours about 72% of radioactivity of injected dose still left in the brain. But for the 99m Tc-meso-HM-PAO after two minutes of i.v. administration, about 1.93% of I.D. appeared in the brain, and 24 hours later, 25% of radioactivity of I.D. was in the brain. This result shows that in the brain the radioactivity of 99m Tc-meso-HM-PAO declines faster than that of 99m Td-d,1-HM-PAO

  14. Highlights of consumption and satisfaction in nautical tourism. A comparative study of visitors to the Canary Islands and Morocco

    Directory of Open Access Journals (Sweden)

    Yen E. Lam González

    2015-06-01

    Full Text Available Nautical tourism is considered to be an under-exploited research area, taking into account its evolution and growth prospects. The present study was conducted with nautical tourists during their visit to the Canary Islands and Morocco between 2013 and 2014. Our aim is to better guide the creation of new joint businesses by determining the most demanded activities among the nautical tourists that visit this part of the world. Some findings indicate that tourists’ consumption and satisfaction vary between a nautical tourist that sails and a tourist motivated by other nautical activities, regardless of the destination they choose. The study also differentiates the nautical tourists’ preferences according to the most popular activities carried out at the destinations they are visiting, highlighting the role that resources such as “sea” and “nature” play as the main tourists’ motivations behind the trip. Finally, the results also reveal which elements of the nautical tourism products and services in offer are the current destinations’ weaknesses, according to the nautical tourists.

  15. Basic and clinical evaluation of regional cerebral perfusion scintigraphy of 99mTc-HM-PAO

    International Nuclear Information System (INIS)

    Tsukatani, Yasushi; Nakamura, Kayoko; Fujii, Hiroshi

    1988-01-01

    Radiochemical purity of 99m Tc-HM-PAO decreased rapidly after preparation. 99m Tc activity of the whole brain increased rapidly after venous injection, and changed very little after 3 minutes later. 99m Tc-HM-PAO scintigram showed the wider abnormal perfusion area than CT scanning did. Hypoperfusion area found by IMP tended to be wider than that by HM-PAO. There were no side effects observed of all cases. (author)

  16. Present Practice of Using Nautical Depth to Manage Navigation Channels in the Presence of Fluid Mud

    Science.gov (United States)

    2017-05-01

    densities ranging from 1,100 to 1,350 grams per liter (g/L). It consists of silt and clay -sized material with clay minerals and organic material in...dynamic viscosity parameters on fluid mud from Zeebrugge, Belgium, it is suggested that the nautical bottom be defined by the transition from • “the...are consequently different from those in pure water.” While density and viscosity are related, that relationship can be complicated by other factors

  17. HM-PAO-SPECT in complicated migraine. Case report

    Energy Technology Data Exchange (ETDEWEB)

    Gruenwald, F.; Ruhlmann, J.; Biersack, H.J.; Durwen, H.; Penin, H.

    1988-10-01

    Three HM-PAO-SPECT investigations have been performed in a female patient with a complicated migraine. 2.5 hours after an attack with right-sided numbness and atonic hemiparesis, at the left side a reduced blood flow was seen parietotemporally and in the subcortical structures. The cerebellum showed crossed diaschisis. During a symptom-free interval the SPECT showed a slightly increased parietotemporal blood blow and a reduced right temporooccipital blood flow. During a seizure with left-sided facial spasm, unsystematic clonic movements in all extremities and a following left-sided hemiparesis, the uptake in the visual cortex was increased by 60%. In the right frontotemporal and left temporal region a slightly increased accumulation was found.

  18. [Expression and clinical significance of 5hmC in bladder urothelial carcinoma].

    Science.gov (United States)

    Li, Jie; Xu, Yuqiao; Zhang, Zhiwen; Zhang, Ming; Zhang, Zhekai; Zhang, Feng; Li, Qing

    2016-02-01

    To investigate the expression of 5-hydroxymethylcytosine (5hmC) in bladder urothelial carcinoma (UC) and its clinical significance. The expression of 5hmC in 21 cases of UC tissues and pericarcinous urinary tract epithelium was detected by immunohistochemical staining. Then the expression of 5hmC in the surgical resection of UC tissues in 92 cases was also surveyed. Non parametric U Mann-Whitney test was used to analyze the correlation between 5hmC expression and clinical data. Single factor survival analysis was performed by Kaplan-Meier test. The expression of 5hmC in normal urinary tract epithelium and UC tissues was significantly different, but there was no significant difference in the expression of 5hmC between low and high grades of UC tissues as well as between different TNM grades. Kaplan-Meier single factor survival analysis showed that there was no significant correlation between the 5hmC expression level and the survival rate or the recurrence-free survival of UC patients. The expression level of 5hmC in UC tissues is significantly lower than that in pericarcinous urinary tract epithelium. There is no correlation between the 5hmC expression and the progression, prognosis and recurrence of UC.

  19. Biosynthesis of gold nanoparticles by actinomycete Streptomyces viridogens strain HM10.

    Science.gov (United States)

    Balagurunathan, R; Radhakrishnan, M; Rajendran, R Babu; Velmurugan, D

    2011-10-01

    Biosynthesis of gold nanoparticles by Streptomycetes from Himalayan Mountain was undertaken for the first time. Out of 10 actinomycete strains tested, four strains (D10, HM10, ANS2 and MSU) showed evidence for the intracellular biosynthesis of gold nanoparticles, among which the strain HM10 showed high potency. Presence of spherical and rod shaped gold nanoparticles in mycelium of the strain HM10 was determined by transmission electron microscopy (TEM) and X-ray diffraction analysis. The average particle size ranged from 18-20 nm. UV spectral analysis indicated that the reduction of chloroauric acid (HAuCl4) occurred within 24 h of reaction period. Further, the strain HM10 showed enhanced growth at 1 and 10 mM concentration of HAuCl4. The gold nanoparticles synthesized by the strain HM10 showed good antibacterial activity against S. aureus and E. coli in well-diffusion method. The potential actinomycete HM10 strain was phenotypically characterized and identified as Streptomyces viridogens (HM10). Thus, actinomycete strain HM10 reported in this study is a newly added source for the biosynthesis of gold nanoparticles.

  20. 46 CFR 167.15-15 - Application for inspection of a new nautical school ship or a conversion of a vessel to a...

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 7 2010-10-01 2010-10-01 false Application for inspection of a new nautical school ship or a conversion of a vessel to a nautical school ship. 167.15-15 Section 167.15-15 Shipping COAST... Inspections § 167.15-15 Application for inspection of a new nautical school ship or a conversion of a vessel...

  1. H11242: NOS Hydrographic Survey , 20 Nautical Miles East Northeast of Cape May, New Jersey, 2005-04-18

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The National Oceanic and Atmospheric Administration (NOAA) has the statutory mandate to collect hydrographic data in support of nautical chart compilation for safe...

  2. Risk Assessment of Nautical Navigational Environment Based on Grey Fixed Weight Cluster

    Directory of Open Access Journals (Sweden)

    Yanfei Tian

    2017-06-01

    Full Text Available In order to set up a mathematical model suitable for nautical navigational environment risk evaluation and systematically master the navigational environment risk characteristics of the Qiongzhou Strait in a quantitative way, a risk assessment model with approach steps is set up based on the grey fixed weight cluster (GFWC. The evaluation index system is structured scientifically through both literature review and expert investigation. The relative weight of each index is designed to be obtained via fuzzy analytic hierarchy process (FAHP; Index membership degree of every grey class is proposed to be achieved by fuzzy statistics (FS to avoid the difficulty of building whiten weight functions. By using the model, nautical navigational environment risk of the Qiongzhou Strait is determined at a “moderate” level according to the principle of maximum membership degree. The comprehensive risk evaluation of the Qiongzhou Strait nautical navigational environment can provide theoretical reference for implementing targeted risk control measures. It shows that the constructed GFWC risk assessment model as well as the presented steps are workable in case of incomplete information. The proposed strategy can excavate the collected experts’ knowledge mathematically, quantify the weight of each index and risk level, and finally lead to a comprehensive risk evaluation result. Besides, the adoptions of probability and statistic theory, fuzzy theory, aiming at solving the bottlenecks in case of uncertainty, will give the model a better adaptability and executability.

  3. Almanac 2013

    DEFF Research Database (Denmark)

    Meier, Pascal; Franzen, Olaf; Lansky, Alexandra J

    2014-01-01

    regurgitation is often associated with comorbidities which make surgery high risk. The MitraClip is a promising percutaneous alternative to surgical valve repair or replacement. Other procedures discussed in this review are the percutaneous left atrial appendage closure as a non-pharmacologic therapy to prevent......, hypertension, etc. One of the most important new treatment options is the percutaneous treatment for aortic valve stenosis (transcatheter aortic valve implantation), since aortic valve disease is a rather common problem in elderly patients, with many of them at high risk for surgery. Similarly, mitral...... strokes, and renal denervation for resistant hypertension. This review explains the basic principles of these procedures, the most important clinical evidence, and also provides additional recent clinical data on each of them....

  4. Synthesis of the d,I-HM-PAO and formulation of nucleo-equipment for the obtention of 99m Tc-(d,I)-HM-PAO

    International Nuclear Information System (INIS)

    Lezama C, J.; Ferro F, G.; Alcazar A, P.

    1991-09-01

    Most brain imaging radiopharmaceuticals are conventional hydrophilic compounds that are excluded from entering the normal brain by an intact blood-brain barrier (BBB). Under pathologic conditions, the barrier is disrupted and radiotracer concentrates in the leisure for positive identification. 99m Tc- hexa methyl propylene amine oxime ( 99 m Tc-HM-PAO) is a newer-type lipophilic agent that enter the normal brain through an intact BBB. Studies with this agent offer the promise of measuring cerebral perfusion in the normal and diseased brain. In this paper we present the synthesis and Tc-99m labelling of d,I-HM-PAO. The synthesis of the ligand was carried out by condensation of two molecular equivalents of butanedione monoxime with one molecular equivalent of 1,3 propanediamine provided a bis imine intermediate, which was reduced with sodium borohydride to get the meso and d,I diastereoisomers of HM-PAO. Separation of these was achieved by fractional crystallization. 99m Tc-(d,I)HM-PAO was obtained by stannous ion reduction of Mo-99/Tc-99m generator eluate in the presence of the ligand. Complex radiochemical purity was determined by instant thin layer chromatography and paper chromatography. Finally, we obtained 99m Tc-(d,I)HM-PAO with a high radiochemical yield, in excess of 90%. However, for subsequent clinical studies the preparation has to be done a few minutes before application because our product has a low stability. (Author)

  5. Effects of Nautical Traffic and Noise on Foraging Patterns of Mediterranean Damselfish (Chromis chromis)

    Science.gov (United States)

    Bracciali, Claudia; Campobello, Daniela; Giacoma, Cristina; Sarà, Gianluca

    2012-01-01

    Chromis chromis is a key species in the Mediterranean marine coastal ecosystems where, in summer, recreational boating and its associated noise overlap. Anthropogenic noise could induce behavioural modifications in marine organisms, thereby affecting population dynamics. In the case of an important species for the ecosystem like C. chromis, this could rebound on the community structure. Here, we measured nautical traffic during the summer of 2007 in a Southern Mediterranean Marine Protected Area (MPA) and simultaneously the feeding behaviour of C. chromis was video-recorded, within both the no-take A-zone and the B-zone where recreational use is allowed. Feeding frequencies, escape reaction and school density were analysed. C. chromis specimens were also collected from 2007 to 2008 to evaluate their physiological state using the Body Condition Index as a proxy of feeding efficiency. The MPA was more exploited by nautical tourism during holidays than on weekdays, particularly in the middle of the day. Greater traffic volume corresponded with lower feeding frequencies. The escape reaction was longer in duration (>1 min) when boat passed nearby, while moored boats did not induce an escape response. We found no differences in density between schools in the A- and B-zones and worse body conditions among those individuals inhabiting the B-zone in one area only. Overall, our findings revealed a significant modification of the daily foraging habits of C. chromis due to boat noise, which was slightly buffered by no-take zones established within the MPA. PMID:22792375

  6. Technetium-labeled HM-PAO studies in patients with cerebrovascular disease

    International Nuclear Information System (INIS)

    Smith, F.W.; Sharp, P.F.; Gemmell, H.; Evans, N.T.; MacDonald, A.F.

    1986-01-01

    Technetium-labeled hexamethyl-propyleneamineoxime (HM-PAO) is a promising radiopharmaceutical for the demonstration of cerebral blood flow. Twenty-four patients who had experienced either acute stroke (AS) or transient ischemic attack (TIA) were studied by x-ray CT and SPECT using technetium-labeled HM-PAO total of 26 studies. HM-PAO has a cerebral distribution similar to that of iodoamphetamine, but labeling with technetium allows good SPECT imaging on demand in any nuclear medicine department. In ten of the 16 patients who had experienced AS, findings on HM-PAO and CT studies correlated well. In six patients reduced cortical perfusion was detected on HM-PAO imaging, but only small infarcts in the internal capsule were seen on CT. In four of the eight patients who had experienced TIA, neither study revealed any abnormality. In the remaining four, areas of cortical underperfusion were seen on HM-PAO imaging, whereas the CT examination was normal. The findings in this study suggest that HM-PAO imaging is a more sensitive method for demonstrating the extent of cerebral underperfusion in cases of cerebrovascular accident

  7. The Dissolution of the Mexican-American Border and Redefinition of Chicano/a /Mexican Identity in Leslie Marmon Silko's Almanac of the Dead

    DEFF Research Database (Denmark)

    Harding, David

    2006-01-01

    In Leslie Marmon Silko's Almanac of the Dead, notions of Mexican identity are deconstructed. This article analyzes how Silko, through a variety of characters and sub-plotlines, brings to the surface hidden tensions in the contsruction of Mexican identity through the melding of the sangre limpia...

  8. 2012-2013 CAUT Almanac of Post-Secondary Education in Canada = 2012-2013 Almanach de l'enseignement postsecondaire au Canada de l'ACPPU

    Science.gov (United States)

    Canadian Association of University Teachers, 2013

    2013-01-01

    In previous editions of the CAUT Almanac, data for provincial postsecondary education expenditures, total expenditures and university and college revenues and expenditures was reported from Statistics Canada's Financial Management System (FMS), which Statistics Canada last published for the 2008-2009 fiscal year. Statistics Canada will be adopting…

  9. Biodegradation of used engine oil by novel strains of Ochrobactrum anthropi HM-1 and Citrobacter freundii HM-2 isolated from oil-contaminated soil.

    Science.gov (United States)

    Ibrahim, Haytham M M

    2016-12-01

    Used engine oil (UEO) constitutes a serious environmental problem due to the difficulty of disposal off or reuse. Ten bacterial strains with biodegradation potential were isolated from UEO-contaminated soil sample using enrichment technique. Two strains which exhibited the highest degradation %, 51 ± 1.2 and 48 ± 1.5, respectively, were selected. Based on the morphological, biochemical characteristics and 16S rRNA sequence analysis, they were identified as Ochrobactrum anthropi HM-1 (accession no: KR360745) and Citrobacter freundii HM-2 (accession no: KR360746). The different conditions which may influence their biodegradation activity, including UEO concentration (1-6 %, v/v), inoculum size (0.5-4 %, v/v), initial pH (6-8), incubation temperature (25-45 °C), and rotation speed (0-200 rpm), were evaluated. The optimum conditions were found to be 2 % UEO, 2 % inoculum size, pH 7.5, incubation temperature 37 °C, and 150 rpm. Under the optimized conditions, strains HM-1, HM-2, and their mixture efficiently degraded UEO, they achieved 65 ± 2.2, 58 ± 2.1, and 80 ± 1.9 %, respectively, after 21 days of incubation. Biodegradation of UEO was confirmed by employing gas chromatography analysis. Gamma radiation (1.5 kGy) enhanced the degradation efficiency of irradiated bacterial mixture (95 ± 2.1 %) as compared to non-irradiated (79 ± 1.6 %). Therefore, strains HM-1 and HM-2 can be employed to develop a cost-effective method for bioremediation of used engine-oil-polluted soil.

  10. HM-PAO-SPECT of the brain in a new-born child

    Energy Technology Data Exchange (ETDEWEB)

    Gruenwald, F.; Biersack, H.J.; Bindl, L.

    1988-08-01

    HM-PAO-SPECT of the brain was performed in a 14 days old new-born child. Diencephalon, brain stem and cerebellum showed a relative high tracer accumulation; there was nearly no accumulation in the neocortex.

  11. Legal status of crew members on pleasure craft and vessels used in nautical tourism

    Directory of Open Access Journals (Sweden)

    Giovanni Marchiafava

    2018-02-01

    Full Text Available The paper aims at examining the issues related to the legal status of crew members of pleasure craft and vessels used in nautical tourism from an Italian perspective. Firstly, the definition of crew and its composition on pleasure craft and vessels is examined. Additionally, the legal regime of crew members together with the crew on-board documentation, is discussed. Furthermore, the main similarities and dissimilarities of the crew regime according to the type of pleasure craft and vessel and their use, as well as, the on-board services, is dealt with. Finally, the issue related to the legal classification of ‘’guests’’, undertaking complementary on-board services of pleasure craft and vessels is considered.

  12. The spectrum of HM Sagittae: a planetary nebula excited by a Wolf--Rayet star

    International Nuclear Information System (INIS)

    Brown, L.W.; Feibelman, W.A.; Hobbs, R.W.; Mccracken, C.W.

    1977-10-01

    Image tube spectrograms of HM Sagittae were obtained. More than 70 emission lines, including several broad emission features, were identified. An analysis of the spectra indicates that HM Sagittae is a planetary nebula excited by a Wolf-Rayet star. The most conspicuous Wolf-Rayet feature is that attributed to a blend of C III at 4650 A and He II at 4686 A

  13. 99mTc HM-PAO brain perfusion SPECT in brain death

    International Nuclear Information System (INIS)

    Bonetti, M.G.; Ciritella, P.; Valle, G.; Perrone, E.

    1995-01-01

    We have easily carried out and interpreted 99m Tc HM-PAO SPECT in a consecutive series of 40 comatose patients with brain damage, without discontinuing therapy. Brain death was diagnosed in 7 patients, by recognising absence of brain perfusion, as shown by no intracranial radionuclide uptake. In patients in whom perfusion was seen on brain scans, HM-PAO SPECT improved assessment of the extent of injury, which in general was larger than suggested by CT. (orig.)

  14. Variable dust obscuration in the symbiotic Mira and very slow Nova, HM Sge

    International Nuclear Information System (INIS)

    Munari, U.; Whitelock, P.A.

    1989-01-01

    New infrared photometry is presented for the symbiotic Mira, HM Sge. Using this and published data a pulsation period of 527 day is derived. In addition to the normal pulsational modulation, the light curve for HM Sge has shown a distinct fading and reddening, starting in 1985. This is interpreted as a dust-obscuration event, and its possible association with the binary orbit is discussed. (author)

  15. The novel immunotoxin HM1.24-ETA′ induces apoptosis in multiple myeloma cells

    International Nuclear Information System (INIS)

    Staudinger, M; Glorius, P; Burger, R; Kellner, C; Klausz, K; Günther, A; Repp, R; Klapper, W; Gramatzki, M; Peipp, M

    2014-01-01

    Despite new treatment modalities, the clinical outcome in a substantial number of patients with multiple myeloma (MM) has yet to be improved. Antibody-based targeted therapies for myeloma patients could make use of the HM1.24 antigen (CD317), a surface molecule overexpressed on malignant plasma cells and efficiently internalized. Here, a novel immunotoxin, HM1.24-ETA′, is described. HM1.24-ETA′ was generated by genetic fusion of a CD317-specific single-chain Fv (scFv) antibody and a truncated variant of Pseudomonas aeruginosa exotoxin A (ETA′). HM1.24-ETA′ inhibited growth of interleukin 6 (IL-6)-dependent and -independent myeloma cell lines. Half-maximal growth inhibition was observed at concentrations as low as 0.3 nM. Target cell killing occurred via induction of apoptosis and was unaffected in co-culture experiments with bone marrow stromal cells. HM1.24-ETA′ efficiently triggered apoptosis of freshly isolated/cryopreserved cells of patients with plasma cell leukemia and MM and was active in a preclinical severe combined immunodeficiency (SCID) mouse xenograft model. Importantly, HM1.24-ETA′ was not cytotoxic against CD317-positive cells from healthy tissue (monocytes, human umbilical vein endothelial cells). These results indicate that CD317 may represent a promising target structure for specific and efficient immunotoxin therapy for patients with plasma cell tumors

  16. Enhancement of arachidonic acid signaling pathway by nicotinic acid receptor HM74A

    International Nuclear Information System (INIS)

    Tang, Yuting; Zhou, Lubing; Gunnet, Joseph W.; Wines, Pamela G.; Cryan, Ellen V.; Demarest, Keith T.

    2006-01-01

    HM74A is a G protein-coupled receptor for nicotinic acid (niacin), which has been used clinically to treat dyslipidemia for decades. The molecular mechanisms whereby niacin exerts its pleiotropic effects on lipid metabolism remain largely unknown. In addition, the most common side effect in niacin therapy is skin flushing that is caused by prostaglandin release, suggesting that the phospholipase A 2 (PLA 2 )/arachidonic acid (AA) pathway is involved. Various eicosanoids have been shown to activate peroxisome-proliferator activated receptors (PPAR) that play a diverse array of roles in lipid metabolism. To further elucidate the potential roles of HM74A in mediating the therapeutic effects and/or side effects of niacin, we sought to explore the signaling events upon HM74A activation. Here we demonstrated that HM74A synergistically enhanced UTP- and bradykinin-mediated AA release in a pertussis toxin-sensitive manner in A431 cells. Activation of HM74A also led to Ca 2+ -mobilization and enhanced bradykinin-promoted Ca 2+ -mobilization through Gi protein. While HM74A increased ERK1/2 activation by the bradykinin receptor, it had no effects on UTP-promoted ERK1/2 activation.Furthermore, UTP- and bradykinin-mediated AA release was significantly decreased in the presence of both MAPK kinase inhibitor PD 098059 and PKC inhibitor GF 109203X. However, the synergistic effects of HM74A were not dramatically affected by co-treatment with both inhibitors, indicating the cross-talk occurred at the receptor level. Finally, stimulation of A431 cells transiently transfected with PPRE-luciferase with AA significantly induced luciferase activity, mimicking the effects of PPARγ agonist rosiglitazone, suggesting that alteration of AA signaling pathway can regulate gene expression via endogenous PPARs

  17. Enhancement of arachidonic acid signaling pathway by nicotinic acid receptor HM74A

    Energy Technology Data Exchange (ETDEWEB)

    Tang, Yuting [Endocrine Therapeutics and Metabolic Disorders, Johnson and Johnson Pharmaceutical Research and Development, L.L.C., 1000 Rt. 202, Raritan, NJ 08869 (United States); Zhou, Lubing [Endocrine Therapeutics and Metabolic Disorders, Johnson and Johnson Pharmaceutical Research and Development, L.L.C., 1000 Rt. 202, Raritan, NJ 08869 (United States); Gunnet, Joseph W [Endocrine Therapeutics and Metabolic Disorders, Johnson and Johnson Pharmaceutical Research and Development, L.L.C., 1000 Rt. 202, Raritan, NJ 08869 (United States); Wines, Pamela G [Endocrine Therapeutics and Metabolic Disorders, Johnson and Johnson Pharmaceutical Research and Development, L.L.C., 1000 Rt. 202, Raritan, NJ 08869 (United States); Cryan, Ellen V [Endocrine Therapeutics and Metabolic Disorders, Johnson and Johnson Pharmaceutical Research and Development, L.L.C., 1000 Rt. 202, Raritan, NJ 08869 (United States); Demarest, Keith T [Endocrine Therapeutics and Metabolic Disorders, Johnson and Johnson Pharmaceutical Research and Development, L.L.C., 1000 Rt. 202, Raritan, NJ 08869 (United States)

    2006-06-23

    HM74A is a G protein-coupled receptor for nicotinic acid (niacin), which has been used clinically to treat dyslipidemia for decades. The molecular mechanisms whereby niacin exerts its pleiotropic effects on lipid metabolism remain largely unknown. In addition, the most common side effect in niacin therapy is skin flushing that is caused by prostaglandin release, suggesting that the phospholipase A{sub 2} (PLA{sub 2})/arachidonic acid (AA) pathway is involved. Various eicosanoids have been shown to activate peroxisome-proliferator activated receptors (PPAR) that play a diverse array of roles in lipid metabolism. To further elucidate the potential roles of HM74A in mediating the therapeutic effects and/or side effects of niacin, we sought to explore the signaling events upon HM74A activation. Here we demonstrated that HM74A synergistically enhanced UTP- and bradykinin-mediated AA release in a pertussis toxin-sensitive manner in A431 cells. Activation of HM74A also led to Ca{sup 2+}-mobilization and enhanced bradykinin-promoted Ca{sup 2+}-mobilization through Gi protein. While HM74A increased ERK1/2 activation by the bradykinin receptor, it had no effects on UTP-promoted ERK1/2 activation.Furthermore, UTP- and bradykinin-mediated AA release was significantly decreased in the presence of both MAPK kinase inhibitor PD 098059 and PKC inhibitor GF 109203X. However, the synergistic effects of HM74A were not dramatically affected by co-treatment with both inhibitors, indicating the cross-talk occurred at the receptor level. Finally, stimulation of A431 cells transiently transfected with PPRE-luciferase with AA significantly induced luciferase activity, mimicking the effects of PPAR{gamma} agonist rosiglitazone, suggesting that alteration of AA signaling pathway can regulate gene expression via endogenous PPARs.

  18. Development of 99mTc-labelled the d,1-diasteroisomer of HM-PAO for cerebral blood flow imaging

    International Nuclear Information System (INIS)

    Lun Xiao.

    1989-10-01

    The d,1-diastereoisomer of hexamethyl propyleneamine oxime (HM-PAO) was selected as the preferred ligand for Tc-99m as a radiotracer for cerebral perfusion imaging. Further improvement of the synthesis and isolation method of HM-PAO resulted in pure d,1-HM-PAO and pure meso-HM-PAO. The neutral, lipophilic Tc-99m complexes of d,1-HM-PAO and meso-HM-PAO were formed in high yield by stannous reduction of Mo-99/Tc-99m generator eluate, respectively. Two minutes following i.v. administration of Tc-99m-d,1-HM-PAO in mice, 2.24% of the injected dose appears in the brain. Little washout of the tracer is observed up to 24-hour post injection. Two minutes following i.v. administration of Tc-99m-meso-HM-PAO in mice, 1.9% of the injected dose appears in the brain. The radioactivity of Tc-99m-meso-HM-PAO declined faster than that of Tc-99m-d,1-HM-PAO did in the brain up to 24-hour post injection. 12 refs, 5 figs, 5 tabs

  19. Experimental study of per-rectal portal scintigraphy using 99mTc-HM-PAO

    International Nuclear Information System (INIS)

    Kubota, Hayato; Shinotsuka, Akira; Takenaka, Hiroki; Tamaki, Satoshi.

    1994-01-01

    Usefulness of per-rectal portal scintigraphy by 123 I-IMP has already been admitted. We assessed whether 99m Tc-HM-PAO, another agent used for cerebral blood flow scintigraphy, could be utilized for scintigraphic evaluation of the portal system. Animal experiments were carried out to evaluate the usefulness of the examination. Shunt indices obtained from per-rectal portal scintigraphy by 123 I-IMP and 99m Tc-HM-PAO in shunt models and shunt rate obtained by direct injection of 99m Tc-MAA into the inferior mesenteric vein under laparotomy were compared. Correlation coefficient of each agent with 99m Tc-MAA was 0.90 for 99m Tc-HM-PAO and 0.80 for 123 I-IMP. It was also noted that as larger quantity of the tracer could be administered in 99m Tc-HM-PAO than in 123 I-IMP, absorption from rectum was optimum and liver extraction fraction was 94.4%. Therefore, we concluded that 99m Tc-HM-PAO was useful for per-rectal portal scintigraphy. (author)

  20. Synthesis of the d,I-HM-PAO and formulation of nucleo-equipment for the obtention of {sup 99m} Tc-(d,I)-HM-PAO; Sintesis del d,I-HM-PAO y formulacion de nucleo-equipos para la obtencion de {sup 99m} Tc-(d,I)-HM-PAO

    Energy Technology Data Exchange (ETDEWEB)

    Lezama C, J; Ferro F, G; Alcazar A, P

    1991-09-15

    Most brain imaging radiopharmaceuticals are conventional hydrophilic compounds that are excluded from entering the normal brain by an intact blood-brain barrier (BBB). Under pathologic conditions, the barrier is disrupted and radiotracer concentrates in the leisure for positive identification. {sup 99m} Tc- hexa methyl propylene amine oxime ({sup 99} {sup m} Tc-HM-PAO) is a newer-type lipophilic agent that enter the normal brain through an intact BBB. Studies with this agent offer the promise of measuring cerebral perfusion in the normal and diseased brain. In this paper we present the synthesis and Tc-99m labelling of d,I-HM-PAO. The synthesis of the ligand was carried out by condensation of two molecular equivalents of butanedione monoxime with one molecular equivalent of 1,3 propanediamine provided a bis imine intermediate, which was reduced with sodium borohydride to get the meso and d,I diastereoisomers of HM-PAO. Separation of these was achieved by fractional crystallization. {sup 99m} Tc-(d,I)HM-PAO was obtained by stannous ion reduction of Mo-99/Tc-99m generator eluate in the presence of the ligand. Complex radiochemical purity was determined by instant thin layer chromatography and paper chromatography. Finally, we obtained {sup 99m} Tc-(d,I)HM-PAO with a high radiochemical yield, in excess of 90%. However, for subsequent clinical studies the preparation has to be done a few minutes before application because our product has a low stability. (Author)

  1. Comparison of acoustic fields produced by the original and upgraded HM-3 lithotripter

    Science.gov (United States)

    Zhou, Yufeng; Zhu, Songlin; Dreyer, Thomas; Liebler, Marko; Zhong, Pei

    2003-10-01

    To reduce tissue injury in shock wave lithotripsy (SWL) while maintaining satisfactory stone comminution, an original HM-3 lithotripter was upgraded by a reflector insert to suppress large intraluminal bubble expansion, which is a primary mechanism of vascular injury in SWL. The pressure waveforms produced by the original and upgraded HM-3 lithotripter were measured by using a fiber optical probe hydrophone (FOPH), which was scanned both along and transverse to the lithotripter axis at 1-mm step using a computer-controlled 3-D positioning system. At F2, the pressure waveform produced by the upgraded HM-3 lithotripter at 22 kV has a distinct dual-pulse structure, with a leading shock wave of ~45 MPa from the reflector insert and a 4-μs delayed second pulse of ~15 MPa reflected from the uncovered bottom surface of the original HM-3 reflector. The beam sizes of the original and upgraded HM-3 lithotripter are comparable in both axial and lateral directions. The pressure waveforms measured at the reflector aperture will be used as input to the KZK equation to predict the lithotripter shock wave at F2. Furthermore, bubble dynamics predicted by the Gilmore model will be compared with experimental observation by high-speed imaging. [Work supported by NIH.

  2. Characterization of biosurfactants produced by novel strains of Ochrobactrum anthropi HM-1 and Citrobacter freundii HM-2 from used engine oil-contaminated soil

    Directory of Open Access Journals (Sweden)

    Haytham M.M. Ibrahim

    2018-03-01

    Full Text Available Microbial surfactants are widely used for industrial, agricultural, food, cosmetics, pharmaceutical, and medical applications. In this study, two bacterial strains namely, Ochrobactrum anthropi HM-1 and Citrobacter freundii HM-2, previously isolated from used engine oil contaminated soil, and capable of producing biosurfactants, were used. Their cell-free culture broth showed positive results toward five screening tests (hemolysis in blood agar, drop collapse, oil displacement, emulsification activity (E24, and surface tension (ST reduction. They reduced the ST of growth medium (70 ± 0.9 to 30.8 ± 0.6 and 32.5 ± 1.3 mN/m, respectively. The biosurfactants were classified as anionic biomolecules. Based on TLC pattern and FT-IR analysis, they were designated as glycolipids (rhamnolipid. Waste frying oil was feasibly used as a cheap and dominant carbon source for biosurfactants production; 4.9 and 4.1 g/l were obtained after 96 h of incubation, respectively. Compared with non-irradiated cells, gamma-irradiated cells (1.5 kGy revealed enhanced biosurfactant production by 56 and 49% for HM-1 and HM-2, respectively. The biosurfactants showed good stability after exposure to extreme conditions [temperatures (50–100 °C for 30 min, pH (2–12 and salinity (2–10% NaCl], they retained 83 and 79.3% of their E24, respectively, after incubation for a month, under extreme conditions. Biosurfactants effectively recovered up to 70 and 67% of the residual oil, respectively, from oil-saturated sand pack columns. These biosurfactants are an interesting biotechnological product for many environmental and industrial applications. Keywords: Ochrobactrum anthropi, Citrobacter freundii, Biosurfactant, Characterization, Stability

  3. New Insights into 5hmC DNA Modification: Generation, Distribution and Function

    Directory of Open Access Journals (Sweden)

    Dong-Qiao Shi

    2017-07-01

    Full Text Available Dynamic DNA modifications, such as methylation/demethylation on cytosine, are major epigenetic mechanisms to modulate gene expression in both eukaryotes and prokaryotes. In addition to the common methylation on the 5th position of the pyrimidine ring of cytosine (5mC, other types of modifications at the same position, such as 5-hydroxymethyl (5hmC, 5-formyl (5fC, and 5-carboxyl (5caC, are also important. Recently, 5hmC, a product of 5mC demethylation by the Ten-Eleven Translocation family proteins, was shown to regulate many cellular and developmental processes, including the pluripotency of embryonic stem cells, neuron development, and tumorigenesis in mammals. Here, we review recent advances on the generation, distribution, and function of 5hmC modification in mammals and discuss its potential roles in plants.

  4. Diagnosis of infected bone and joint diseases with 99mTc-HM-PAO labeled leukocytes

    International Nuclear Information System (INIS)

    Kanegae, Kakuko; Itoh, Kazuo; Tsukamoto, Eriko; Nagao, Kazuhiko; Nakada, Kunihiro; Hurudate, Masayori

    1992-01-01

    The usefulness of 99m Tc-hexamethylpropylene amine oxime (HM-PAO) labeled leukocytes scans was studied in 15 patients with suspected infection of the bone and joints. All spot images of lesions were obtained 4 and 24 hours after injection of 70.3-236.8 MBq (a mean, 149.5 MBq). 99m Tc-HM-PAO leukocytes scans were positive in 5 patients, negative in 8, and equivocal in 2. It had a sensitivity of 83% (5/6), specificity of 100% (6/6), and accuracy of 93% (14/15) for diagnosing infections. Equivocal uptake, seen on the 4-hr image in 2 patients, became negative on the 24-hr image. In view of ready availability and simple labeling procedure, 99m Tc-HM-PAO labeled leukocytes scans can be used as one of the specific diagnostic procedures for infections. (N.K.)

  5. Vendendo saúde! Revisitando os antigos almanaques de farmácia Selling health! A new look at old-time pharmacy almanacs

    Directory of Open Access Journals (Sweden)

    Mario Luiz Gomes

    2006-12-01

    Full Text Available O artigo destaca a importância dos almanaques de farmácia como fonte de pesquisa em relação à história dos medicamentos, apresentando imagens desses impressos relacionadas às estratégias de promoção dos produtos farmacêuticos. A idéia de ciência veiculada pelos almanaques de farmácia também é analisada, indicando a relevância desse tipo de fonte para a história da ciência e da propaganda no Brasil.Offering images of pharmaceutical products and marketing strategies, pharmacy almanacs are a valuable source when researching the history of medications. The article analyzes the idea of science that was presented in these almanacs and demonstrates how this research source is pertinent to the history both of science and of advertising in Brazil.

  6. The importance of strategic management : A case study of H&M

    OpenAIRE

    Ding, Huiru

    2011-01-01

    Hennes & Mauritz (H&M) is a 100 billion Sweden company,engaged in designing and retailing of fashion apparel and accessories. The company offers a range of apparel, cosmetics, footwear and accessories for men, women, children and teenagers. H&M primarily operates in Europe, North America and Asia, and has a presence in over 38 countries. The company is headquartered in Stockholm, Sweden and employs approximately 87,000 people on a full-time basis. This thesis focused on the strategic...

  7. The retention of [99mTc]-d,l-HM-PAO in the human brain after intracarotid bolus injection

    DEFF Research Database (Denmark)

    Lassen, N A; Andersen, A R; Friberg, L

    1988-01-01

    [99mTc]-d,l-HM-PAO (HM-PAO) was injected rapidly into the internal carotid artery and its retention in the brain was recorded by external scintillation cameras in eight human subjects. A model is described based on three compartments: the lipophilic tracer in the blood pool of the brain, the lipo......[99mTc]-d,l-HM-PAO (HM-PAO) was injected rapidly into the internal carotid artery and its retention in the brain was recorded by external scintillation cameras in eight human subjects. A model is described based on three compartments: the lipophilic tracer in the blood pool of the brain...

  8. Low values of 5-hydroxymethylcytosine (5hmC), the "sixth base," are associated with anaplasia in human brain tumors.

    Science.gov (United States)

    Kraus, Theo F J; Globisch, Daniel; Wagner, Mirko; Eigenbrod, Sabina; Widmann, David; Münzel, Martin; Müller, Markus; Pfaffeneder, Toni; Hackner, Benjamin; Feiden, Wolfgang; Schüller, Ulrich; Carell, Thomas; Kretzschmar, Hans A

    2012-10-01

    5-Methylcytosine (5 mC) in genomic DNA has important epigenetic functions in embryonic development and tumor biology. 5-Hydroxymethylcytosine (5 hmC) is generated from 5 mC by the action of the TET (Ten-Eleven-Translocation) enzymes and may be an intermediate to further oxidation and finally demethylation of 5 mC. We have used immunohistochemistry (IHC) and isotope-based liquid chromatography mass spectrometry (LC-MS) to investigate the presence and distribution of 5 hmC in human brain and brain tumors. In the normal adult brain, IHC identified 61.5% 5 hmC positive cells in the cortex and 32.4% 5 hmC in white matter (WM) areas. In tumors, positive staining of cells ranged from 1.1% in glioblastomas (GBMs) (WHO Grade IV) to 8.9% in Grade I gliomas (pilocytic astrocytomas). In the normal adult human brain, LC-MS also showed highest values in cortical areas (1.17% 5 hmC/dG [deoxyguanosine]), in the cerebral WM we measured around 0.70% 5 hmC/dG. levels were related to tumor differentiation, ranging from lowest values of 0.078% 5 hmC/dG in GBMs (WHO Grade IV) to 0.24% 5 hmC/dG in WHO Grade II diffuse astrocytomas. 5 hmC measurements were unrelated to 5 mC values. We find that the number of 5 hmC positive cells and the amount of 5 hmC/dG in the genome that has been proposed to be related to pluripotency and lineage commitment in embryonic stem cells is also associated with brain tumor differentiation and anaplasia. Copyright © 2012 UICC.

  9. Die etiek van HM Kuitert na aanleiding van sy boek Suicide - wat is ...

    African Journals Online (AJOL)

    The ethics of HM Kuitert according to his book entitled. Suicide - wat is er tegen? Selfdoding in moreel perspektief. According to several publications Kuitert is criticised as a humanist. This paper tests his view on suicide to this accusation. It is found that Kuitert accepts teleology and solidarity as norms for his ethics and uses ...

  10. ULTRACAM photometry of the ultracompact binaries V407 Vul and HM Cnc

    NARCIS (Netherlands)

    Barros, S.C.C.; Marsh, T.R.; Dhillon, V.S.; Groot, P.J.; Littlefair, S.; Nelemans, G.A.; Roelofs, G.H.A.; Steeghs, D.; Wheatley, P.J.

    2007-01-01

    V407 Vul (RXJ1914.4+2456) and HM Cnc (RXJ0806.3+1527) are X-ray emitting stars with X-ray light curves that are 100 per cent modulated on periods of 569 and 321 s, respectively. These periods are thought possibly to represent the orbital periods of close pairs of white dwarfs. In this paper we

  11. Causes of the cracks in the pipeline made of the 15HM steel

    Directory of Open Access Journals (Sweden)

    Słania J.

    2017-03-01

    Full Text Available Issues referring to cracks in the pipelines made of the 15HM steel are described. Metallographic specimen of welded joints are provided. The results of impact strength tests, hardness tests and static tensile tests are given. Tests results as well as direct and indirect causes of the pipeline cracks are shown.

  12. The Archaeology of the Nautical Astrolabe: News from a Shipwreck in Namibia

    Science.gov (United States)

    Pereira, José Manuel Malhão

    2015-05-01

    Being a sailor, astronomy has always been present in my life and I confess it has been a love affair, but during the last decades of the 20th century something terrible happened. Satellites invaded our lives, and with Navistar and GPS all the romance has gone! Nowadays what remains is history and historians, and fortunately they are here in great number and quality. If we speak about European maritime expansion we will always find the astrolabe as its symbol. This instrument (the adaptation for use at sea of the well known, planispheric astrolabe), although very simple, demonstrates that what is needed at sea is the simplest way to perform the difficult task of knowing the ship's position, or at least its latitude, with sufficient accuracy. Simple as it is, it has been in use for more than a century and a half, and its physical characteristics were known mainly on account of maritime archaeological findings. When David Waters published his work on the mariner's astrolabe (1966), the Department of Navigation and Astronomy of the National Maritime Museum in Greenwich listed 21 astrolabes. But Waters in fact listed only 19 when he read his paper in Coimbra. Some years later, in 1983, in Lagos, Portugal, Alan Stimson read his important paper during the IVth International Reunion for the History of Nautical Science and Hydrography, entitled "The Mariner's Astrolabe, a Survey of 48 Surviving Examples". Five years later his well known book, (that became a classical reference on the subject) already listed 66 instruments, 23 of them being of Portuguese origin. Captain Estácio dos Reis, an internationally accepted authority for the study of the mariner's astrolabe and other instruments has deeply studied this subject and published a vast number of works on it (see, for example, "Medir Estrelas", 1977). He is the person responsible for Portugal being the country that has the largest number of marine astrolabes in its museums. The purpose of my paper is to summarise the

  13. Real-Time Extraction of Course Track Networks in Confined Waters as Decision Support for Vessel Navigation in 3-D Nautical Chart

    National Research Council Canada - National Science Library

    Porathe, Thomas

    2006-01-01

    In an information design project at Malardalen University in Sweden a computer based 3-D nautical chart system is designed based on human factors principles of more intuitive navigation in high speeds...

  14. Clinical applications of brain perfusion imaging with 99mTc-HM-PAO

    International Nuclear Information System (INIS)

    Lin Xiangtong

    1989-01-01

    200 patients with central nervous system diseases were studied with 99m Tc-HM-PAO and SPECT, including Parkinson's disease (PD) 47, Vascular headache 69, CVD 34, Epilepsy 26, Head truma 10, Brain tumor 5 and other 9 cases. Part of them have been compared with the results of MRI, X-CT and EEG. The positivity of SPECT in PD is 61.7% with decrease perfusion in local area of cerebram and basal ganglia and only 4 cases had lower perfusion in cerebellum; in headache is 46.4%, showing variable perfusion patterns; in CVD is 79.4% with decrease perfusion, luxury perfusion and the phenomenon of 'diaschsis'. In epilepsy, the abnormal foci mostly localize in temporal lobe and have close relation to the results of EEG. In brain tumor it also denotes decreased uptake of tracer. The clinicl singnificance of brain perfusion imaging with 99m Tc-HM-PAO was discussed

  15. Clinical applications of brain perfusion imaging with sup 99m Tc-HM-PAO

    Energy Technology Data Exchange (ETDEWEB)

    Xiangtong, Lin [Shanghai Medical Univ. (China). Huashan Hospital; and others

    1989-11-01

    200 patients with central nervous system diseases were studied with {sup 99m}Tc-HM-PAO and SPECT, including Parkinson's disease (PD) 47, Vascular headache 69, CVD 34, Epilepsy 26, Head truma 10, Brain tumor 5 and other 9 cases. Part of them have been compared with the results of MRI, X-CT and EEG. The positivity of SPECT in PD is 61.7% with decrease perfusion in local area of cerebram and basal ganglia and only 4 cases had lower perfusion in cerebellum; in headache is 46.4%, showing variable perfusion patterns; in CVD is 79.4% with decrease perfusion, luxury perfusion and the phenomenon of 'diaschsis'. In epilepsy, the abnormal foci mostly localize in temporal lobe and have close relation to the results of EEG. In brain tumor it also denotes decreased uptake of tracer. The clinicl singnificance of brain perfusion imaging with {sup 99m}Tc-HM-PAO was discussed.

  16. Batibo, HM

    African Journals Online (AJOL)

    Fighting A Losing Battle: Assessing The Impact Of Mother-Tongue Education Advocacy In A Hostile Environment Abstract · Vol 23 (2013) - Articles The Last Kick of a Dying Horse: Preserving Ethnic Identity in Shisukuma Greeting System Abstract · Vol 26 (2015) - Articles Ten commandments for Setswana to be a resourceful ...

  17. Brain perfusion spect imaging with sup 99m Tc-HM-PAO in Parkinson's disease

    Energy Technology Data Exchange (ETDEWEB)

    Wenzhong, Song; Xiangtong, Lin [Shanghai Medical Univ. (China). Huashan Hospital

    1991-02-01

    Forty patients with Parkinson's disease were studied using {sup 99m}Tc-HM-PAO brain perfusion SPECT. 62.5% (25 cases) showed abnormal blood perfusion. Among them 55% showed local decreased blood perfusion of cerebral cortex, 22% showed asymmetric decreased blood perfusion in basal gaglia, 10% showed decreased uptake of tracer in cerebellum. The pathophysiologic basis of the abnormality of brain blood perfusion were briefly discussed.

  18. Complete genome sequence of probiotic Bacillus coagulans HM-08: A potential lactic acid producer.

    Science.gov (United States)

    Yao, Guoqiang; Gao, Pengfei; Zhang, Wenyi

    2016-06-20

    Bacillus coagulans HM-08 is a commercialized probiotic strain in China. Its genome contains a 3.62Mb circular chromosome with an average GC content of 46.3%. In silico analysis revealed the presence of one xyl operon as well as several other genes that are correlated to xylose utilization. The genetic information provided here may help to expand its future biotechnology potential in lactic acid production. Copyright © 2016 Elsevier B.V. All rights reserved.

  19. Cerebral blood flow imaging by I-123 IMP and Tc-99m HM-PAO

    Energy Technology Data Exchange (ETDEWEB)

    Uno, Koichi; Yoshikawa, Kyosan; Minoshima, Satoshi; Imaseki, Keiko; Arimizu, Noboru; Yamaura, Akira; Uematsu, Sadao

    1988-02-01

    SPECT studies with either N-isopropyl-p-(I-123)iodo- amphetamine (I-123 IMP) or Tc-99m hexamethyl propylene amine oxime (Tc-99m HM-PAO) were cuncurrently performed in 12 patients with brain disorders, comprising cerebral infarction (7), cerebral aneurysm (one), intracranial hemorrhage (3), and subdural hematoma (one). Whereas I-123 IMP was taken up gradually into the brain, the uptake of Tc-99m-HM-PAO in the brain reached the peak immediately after the iv injection, with 90% or more remaining constant by 15 min postinjection. On early SPECT images, a high uptake of I-123 IMP was observed in the lung, and the uptake of Tc-99m HM-PAO was observed as well in the soft tissue of cervical region. In all patients except for one, decreased rCBF was observed in the lesions on both I-123 and Tc-99m SPECT scans. Both of the radiopharmaceuticals were analogous in that decreased blood flow corresponded to cerebral lesions. (Namekawa, K).

  20. MELCOR simulation of steam condensation effect on hydrogen behavior in THAI HM-2 experiment

    Energy Technology Data Exchange (ETDEWEB)

    Lee, Seongnyeon; Lee, Jung-Jae; Cho, Yong-Jin [Korea Institute of Nuclear Safety, Daejeon (Korea, Republic of); Kim, Sung Joong [Hanyang University, Seoul (Korea, Republic of)

    2015-10-15

    In this study, MELCOR simulation was carried out for THAI HM-2 experiment of OECD. As a results, stratification of hydrogen cloud was reasonably captured in MELCOR simulation. Furthermore, the pressure from simulation results in cases where mass transfer coefficient of MELCOR condensation model was modified was good agreement with the experimental results. Containment Filtered Ventilation System (CFVS) has been introduced as facility to prevent containment failure during severe accident. However, possibility of hydrogen risk has been issued due to inflow of hydrogen, condensation and removal of steam and complicated inner structure in CFVS. Preferentially benchmark work for THAI HM-2 experiment of OECD was decided to validate the methodology before detailed assessment of hydrogen risk in CFVS. The objectives of THAI HM-2 experiment were evaluation of hydrogen behavior, verification of numerical analysis tools and so on. In this paper, therefore, MELCOR simulation was carried out in comparison with the experiment results. Additionally, steam condensation effect was considered for detailed simulation. Hydrogen concentration from MELCOR results was underestimated in comparison to the experimental results.

  1. Expression of kenaf mitochondrial chimeric genes HM184 causes male sterility in transgenic tobacco plants.

    Science.gov (United States)

    Zhao, Yanhong; Liao, Xiaofang; Huang, Zhipeng; Chen, Peng; Zhou, Bujin; Liu, Dongmei; Kong, Xiangjun; Zhou, Ruiyang

    2015-08-01

    Chimeric genes resulting from the rearrangement of a mitochondrial genome were generally thought to be a causal factor in the occurrence of cytoplasmic male sterility (CMS). In the study, earlier we reported that identifying a 47 bp deletion at 3'- flanking of atp9 that was linked to male sterile cytoplasm in kenaf. The truncated fragment was fused with atp9, a mitochondrial transit signal (MTS) and/or GFP, comprised two chimeric genes MTS-HM184-GFP and MTS-HM184. The plant expression vector pBI121 containing chimeric genes were then introduced to tobacco plants by Agrobacterium-mediated T-DNA transformation. The result showed that certain transgenic plants were male sterility or semi-sterility, while some were not. The expression analysis further demonstrated that higher level of expression were showed in the sterility plants, while no expression or less expression in fertility plants, the levels of expression of semi-sterility were in between. And the sterile plant (containing MTS-HM184-GFP) had abnormal anther produced malformed/shriveled pollen grains stained negative that failed to germinate (0%), the corresponding fruits was shrunken, the semi-sterile plants having normal anther shape produced about 10-50% normal pollen grains, the corresponding fruits were not full, and the germination rate was 58%. Meanwhile these transgenic plants which altered on fertility were further analyzed in phenotype. As a result, the metamorphosis leaves were observed in the seedling stage, the plant height of transgenic plants was shorter than wild type. The growth duration of transgenic tobacco was delayed 30-45 days compared to the wild type. The copy numbers of target genes of transgenic tobacco were analyzed using the real-time quantitative method. The results showed that these transgenic plants targeting-expression in mitochondrial containing MTS-HM184-GFP had 1 copy and 2 copies, the other two plants containing MTS-HM184 both had 3 copies, but 0 copy in wild type. In

  2. Cerebral uptake and retention of 99Tcsup(m)-hexamethylpropyleneamine oxime (99Tcsup(m)-HM-PAO)

    International Nuclear Information System (INIS)

    Holmes, R.A.; Chaplin, S.B.; Royston, K.G.; Missouri Univ., Columbia

    1985-01-01

    A new radiopharmaceutical, 99 Tcsup(m)-hexamethylpropyleneamine oxime ( 99 Tcsup(m)-HM-PAO) is described. This agent displays considerable promise for imaging cerebral blood flow. In studies in rats and one human volunteer, 99 Tcsup(m)-HM-PAO demonstrates good brain uptake, prolonged retention of activity in the brain, and slow regional redistribution. These properties suggest that this new radiopharmaceutical is ideal for single photon emission tomographic (SPECT) imaging of cerebral blood flow. (author)

  3. Description and advantages of the new and dry total mercury CEM HM 14000 trust

    Energy Technology Data Exchange (ETDEWEB)

    Kasajanow, J.

    2002-07-01

    A series of 24 overheads/slides outline the presentation giving details of the design and operation of the continuous emission monitor - the Total Mercury CEM HM 1400TR produced by the Durag Group. The monitor is suitable for measuring mercury emitted from power plants. The principle components of the monitor, the thermocatalytic reactor, and the dual beam UV detector are described, along with the calibration. Also the Portable Total Mercury CEM and the Total Mercury CEM 1500 for liquids are pictured. The presentation was made by Verewa, part of the Durag Group.

  4. Precision temperature monitoring (PTM) and Humidity monitoring (HM) sensors of the CMS electromagnetic calorimeter

    CERN Multimedia

    2006-01-01

    A major aspect for the ECAL detector control is the monitoring of the system temperature and the verification that the required temperature stability of the crystal volume and the APDs, expected to be (18 ± 0.05)C, is achieved. The PTM is designed to read out thermistors, placed on both the front and back of the crystals, with a relative precision better than 0.01 C. In total there are ten sensors per supermodule. The humidity level in the electronics compartment is monitored by the HM system and consists of one humidity sensor per module.

  5. A study of 99mTc-HM-PAO brain SPECT in the senile parkinson's disease

    International Nuclear Information System (INIS)

    Chen Wenxin; Lin Xiangtong; Song Wenzhong; Liu Yongchang

    1996-01-01

    Thirty-three cases of senile Parkinson's disease (PD) imaged by 99m Tc-HM-PAO brain SPECT were reported. 66.7% of the patients had cortical hypoperfusion and 18.2% showed asymmetrical hypoperfusion in the basal ganglia. Such a finding was not related with the Hoehn-Yahr stage and the laterality of motor symptoms. If complicated with dementia, the SPECT brain imaging showed similar pattern in Alzheimer's disease with diffuse hypoperfusion in cortical area reflecting widespread pathological changes in tremor paralysis

  6. “Controlled and Managed Adventure” – Croatian Approach to the Development of Nautical Tourism in Croatia?

    Directory of Open Access Journals (Sweden)

    Srećko Favro

    2009-06-01

    Full Text Available Ecological preservation of intact nature, of mystical and genuine Mediterranean cultural environment is the most crucial requirement for the development of nautics, but also for upgrading present capacities and complementary activities in the Adriatic. At the same time, preservation of natural beauties, intact bays, but also development of sufficient amenities in marinas for overnight stay, services and entertainment, requires such development strategy that will balance and show consideration for all these aspects. That could be called a “discretely controlled and managed adventure” that will always have the price it has deserved. One has to bear in mind, though, that boaters primarily come in order to be at sea, that a marina is a necessary element of navigation, and that boaters want to spend the major part of their time aboard, in the sphere of “adventure”. The leading part in implementing this decision lies with government bodies that have to be able to adapt the boaters’ desire for high services to local specific aspects. Nautics has to be administered, but administrative and expert entities have not proved to be the best solution. It may be assumed that the development one of the institutions into a body permanently responsible for monitoring, analyses and expert proposals could be a solution that would find place in the current vacant space between performers (mostly private companies and administration (few and inadequately qualified. Also, strict standards have to be determined and controlling system established, so that attractiveness is kept, while sustainable and controlled development of the littoral and islands is enabled.

  7. Extraction of [99mTc]-d,l-HM-PAO across the blood-brain barrier

    DEFF Research Database (Denmark)

    Andersen, A R; Friberg, H; Knudsen, K B

    1988-01-01

    The initial extraction (E) across the blood-brain barrier (BBB) of [99mTc]-d,l-HM-PAO after intracarotid injection was measured in 14 Wistar rats and 6 patients using the double indicator, single injection method with Na-24 as the cotracer. In both series, cerebral blood flow (CBF) was measured...... was increased from 20 to 120 microliters, while using a 120 microliters bolus containing 10% albumin resulted in a decrease in E. This suggests that HM-PAO binding to albumin is not totally and rapidly reversible during a single passage through brain capillaries and that binding to blood elements may reduce...... the apparent extraction across brain capillaries. In patients using a bolus of 1 ml saline, E decreased linearly with increasing CBF (r = -0.81, p less than 0.001). For a CBF of 0.59 ml/g/min and an average apparent E of 0.72, an apparent PS product of 0.76 ml/g/min was calculated.(ABSTRACT TRUNCATED AT 250...

  8. Technetium-99m HM-PAO-SPECT study of regional cerebral perfusion in early Alzheimer's disease

    International Nuclear Information System (INIS)

    Perani, D.; Di Piero, V.; Vallar, G.

    1988-01-01

    Regional cerebral perfusion was evaluated by single photon emission computed tomography (SPECT) using technetium-99m hexamethylpropyleneamine oxime ([/sup 99m/Tc]HM-PAO) in sixteen patients with Alzheimer's disease (AD) in early clinical phase and in 16 healthy elderly controls. In all patients transmission computed tomography (TCT) and/or magnetic resonance imaging (MRI) did not show focal brain abnormalities. Relative to normal subjects, AD patients showed significant reductions in cortical/cerebellar activity ratio: cortical perfusion was globally depressed with the largest reductions in frontal and posterior temporo-parietal cortices. Asymmetries of relative perfusion between cerebral hemispheres were also demonstrated when language was affected or visuospatial functions were unevenly impaired. In patients with early AD, SPECT provides functional information to be compared with clinical and psychometric data

  9. ähm vs. niinku - Verzögerungssignale in deutschen und finnischen Diskussionen

    Directory of Open Access Journals (Sweden)

    Margarethe Olbertz-Siitonen

    2015-05-01

    Full Text Available Dieser Beitrag beschäftigt sich kontrastiv mit dem Gebrauch von Verzögerungssignalen in deutschen und finnischen Seminardiskussionen. Die voranalytische  Durchsicht der Videomitschnitte zeigte, dass die deutschen Studenten unvergleichlich  häufiger die Verzögerungspartikeln äh und ähm  einsetzten als ihre finnischen Kommilitonen, die in ähnlicher Funktion v.a. die Partikel niinku ('sozusagen' benutzten. Diese  Beobachtung ist insofern von Bedeutung, als es meist die finnischen Gesprächsteilnehmer sind, die in deutsch-finnischen Kontaktsituationen auf eine Fremdsprache (Deutsch  zurückgreifen müssen: Möglicherweise steht finnischen Gesprächspartnern in der Interaktion mit deutschen Muttersprachlern keine deutsche Entsprechung für niinku zur Ver- fügung. Gegebenenfalls resultierende Kommunikationsprobleme sollten dementsprechend nicht vornehmlich interkulturell, sondern interlingual bewertet werden.

  10. Use of [/sup 99m/Tc]-HM-PAO in the diagnosis of primary degenerative dementia

    International Nuclear Information System (INIS)

    Testa, H.J.; Snowden, J.S.; Neary, D.; Shields, R.A.; Burjan, A.W.; Prescott, M.C.; Northen, B.; Goulding, P.

    1988-01-01

    The clinical value of single photon emission computed tomography (SPECT) in the differential diagnosis of dementia due to cerebral atrophy was evaluated by comparing the pattern of distribution [/sup 99m/Tc]-HM-PAO in three dementing conditions. Imaging was carried out in 26 patients with suspected Alzheimer's disease, 14 with dementia of the frontal-lobe type, and 13 with progressive supranuclear palsy. Images were evaluated and reported without knowledge of clinical diagnosis with respect to regions of reduced uptake of tracer. Reduced uptake in the posterior cerebral hemispheres was characteristic of Alzheimer's disease, while selective anterior hemisphere abnormalities characterized both dementia of the frontal-lobe type and progressive supranuclear palsy. The latter conditions could be distinguished on the basis of the appearance of integrity of the rim of the frontal cortex. The technique has an important role in the differentiation of degenerative dementias

  11. Radiolabelling of sperm cells with 99mTc-HM-PAO

    International Nuclear Information System (INIS)

    Balogh, L.; Szasz, F.; Janoki, Gy.; Zoldag, L.; Huszenicza, Gy.

    1992-01-01

    The study of the influence of labelling volume on the labelling efficiency showed decreased yield when the volume was increased. The survival rate was unchanged over 0.5 ml of reaction volume. During labelling procedure only a few cells (6%) survived in the incubation volume was less than 0.4 ml. Changing the incubation time the radiolabelling yield increased for 10 minutes, and thereafter practically did not change. The optimum conditions of sperm labelling yielded a high labelling efficiency (70-80%) and survival rate (50-60%). The 99m Tc-HM-PAO labelled sperm cells seem to be suitable to study the in vivo and in vitro sperm transport. (author) 14 refs.; 5 figs.; 2 tabs

  12. The contrast of fast fashion giants Zara, H&M and Uniqlo

    OpenAIRE

    Uriarte Elizaga, Leire

    2016-01-01

    El presente trabajo se centra en la comparación de tres grandes compañías de lo que se conoce como fast fashion o moda rápida. Estas tres compañías son la española Zara, la sueca H&M y la japonesa UNIQLO. Para ello, primero se introduce cada una de las marcas, comentando brevemente su historia para después hablar de la filosofía (misión, visión y valores) y situación financiera de cada una de ellas. A continuación se analiza el modelo de negocio que tiene cada una de las compañ...

  13. 99mTc-HM-PAO SPECT of epileptic patients showing focal paroxysm on electroencephalography

    International Nuclear Information System (INIS)

    Takaishi, Yasuko; Hashimoto, Kiyoshi; Fujino, Osamu; Kamayachi, Satoshi; Fujita, Takehisa; Enokido, Hisashi; Komatsuzaki, Hideki; Kawakami, Yasuhiko; Hirayama, Tsunenori

    1995-01-01

    The usefulness of 99m Tc-HM-PAO SPECT in diagnosing epilepsy was studied. The subjects were 33 epileptic patients, ranging in age from 5 years and 5 months to 28 years and 3 months, who showed focal paroxysm on electroencephalograms. Lowered accumulation site was found on SPECT in 19 patients. Four patients with abnormal findings on X-ray CT or MRI showed lowered accumulation and focal paroxysm at the same site. Of 29 patients with normal X-ray CT or MRI findings, 15 (52%) showed lowered accumulation. Five patients showed a focal paroxysm at the site of lowered accumulation. In 8 patients the focal paroxysm site was partly coincided with the accumulation site. In some patients the focal site predicted by the findings of clinical symptoms and the lowered accumulation site coincided. SPECT is therefore a useful method in diagnosing a focal site in epilepsy and considered to reflect the severity of disease. (Y.S.)

  14. Assessing the Influence of Fashion Clothing Advertising on Women's Consumer Behaviour in Finland; a case study of H&M

    OpenAIRE

    Hamed Abu Adab, Sari

    2012-01-01

    This study will provide a framework for analysing the current advertising and marketing patterns in women’s consumer behaviour in Finland. Swedish clothing retailer Hennes&Mauritz (H&M) was chosen as a case study since it is considered to be well-known in Finland; in 2010 average sales were astonishingly around 243million euros (H&M 2012). As this research is considered to be a broad topic, this study will focus on women in Finland aged 16-35 and above. This study will use various research m...

  15. The Relationship between Ionospheric Slab Thickness and the Peak Density Height, hmF2

    Science.gov (United States)

    Meehan, J.; Sojka, J. J.

    2017-12-01

    The electron density profile is one of the most critical elements in the ionospheric modeling-related applications today. Ionosphere parameters, hmF2, the height of the peak density layer, and slab thickness, the ratio of the total electron content, TEC, to the peak density value, NmF2, are generally obtained from any global sounding observation network and are easily incorporated into models, theoretical or empirical, as numerical representations. Slab thickness is a convenient one-parameter summary of the electron density profile and can relate a variety of elements of interest that effect the overall electron profile shape, such as the neutral and ionospheric temperatures and gradients, the ionospheric composition, and dynamics. Using ISR data from the 2002 Millstone Hill ISR data campaign, we found, for the first time, slab thickness to be correlated to hmF2. For this, we introduce a new ionospheric index, k, which ultimately relates electron density parameters and can be a very useful tool for describing the topside ionosphere shape. Our study is an initial one location, one season, 30-day study, and future work is needed to verify the robustness of our claim. Generally, the ionospheric profile shape, requires knowledge of several ionospheric parameters: electron, ion and neutral temperatures, ion composition, electric fields, and neutral winds, and is dependent upon seasons, local time, location, and the level of solar and geomagnetic activity; however, with this new index, only readily-available, ionospheric density information is needed. Such information, as used in this study, is obtained from a bottomside electron density profile provided by an ionosonde, and TEC data provided by a local, collocated GPS receiver.

  16. Angelita La Escapía e a fotografia viva de Marx: feminismo e passados presentes em Almanac of the Dead

    Directory of Open Access Journals (Sweden)

    VILELA LÚCIA HELENA DE AZEVEDO

    2002-01-01

    Full Text Available Análise de Almanac of the Dead à luz de teorias feministas e de uma perspectiva pós-moderna segundo a qual a noção de passados presentes é enfatizada através da exploração da metáfora da fotografia viva de Marx, mostrada no romance. A paixão da personagem Angelita pela fotografia de Marx é vista como uma forma de síntese entre a percepção indígena do tempo como eternos presentes - que é também resistência à opressão, uma vez que o passado não é jamais esquecido - e os conceitos marxistas de tempo e história.

  17. 75 FR 34117 - Proposed CERCLA Section 122(h) Cost Recovery Settlement for the H.M. Quackenbush, Inc. Superfund...

    Science.gov (United States)

    2010-06-16

    ... and majority shareholder of H.M. Quackenbush, Inc., to pay EPA, in nine annual installments, $225,000.00, plus interest, for EPA's past response costs incurred at the Site. The Settling Party also agrees to pay $75,000.00 pursuant to a settlement with the Village of Herkimer into an interest-bearing...

  18. Geen recht de moed te verliezen. Leven en werken van dr. H.M. de Lange (1919-2001)

    NARCIS (Netherlands)

    Witte-Rang, M.E.

    2008-01-01

    This study deals with the contribution of the Dutch economist Dr. H.M. de Lange to the ecumenical debate on social-ethics. To this end, the first part gives a description of the work of De Lange. Through the individual De Lange the study provides an insight in the worldwide ecumenical movement and

  19. Positive allosteric modulation of the human metabotropic glutamate receptor 4 (hmGluR4) by SIB-1893 and MPEP

    DEFF Research Database (Denmark)

    Mathiesen, Jesper Mosolff; Svendsen, Nannette; Bräuner-Osborne, Hans

    2003-01-01

    We have identified 2-methyl-6-(2-phenylethenyl)pyridine (SIB-1893) and 2-methyl-6-phenylethynyl pyridine hydrochloride (MPEP) as positive allosteric modulators for the hmGluR4. SIB-1893 and MPEP enhanced the potency and efficacy of L-2-amino-4-phophonobutyrate (L-AP4) in guanosine 5'-O-(3-[(35)S...

  20. HM{sup +}–RG complexes (M = group 2 metal; RG = rare gas): Physical vs. chemical interactions

    Energy Technology Data Exchange (ETDEWEB)

    Harris, Joe P.; Dodson, Hannah; Wright, Timothy G., E-mail: Tim.Wright@nottingham.ac.uk [School of Chemistry, University of Nottingham, University Park, Nottingham NG7 2RD (United Kingdom); Breckenridge, W. H. [Department of Chemistry, University of Utah, Salt Lake City, Utah 84112 (United States)

    2015-04-21

    Previous work on the HM{sup +}–He complexes (M = Be–Ra) has been extended to the cases of the heavier rare gas atoms, HM{sup +}–RG (RG = Ne–Rn). Optimized geometries and harmonic vibrational frequencies have been calculated using MP2 theory and quadruple-ζ quality basis sets. Dissociation energies for the loss of the rare gas atom have been calculated at these optimized geometries using coupled cluster with single and double excitations and perturbative triples, CCSD(T)theory, extrapolating interaction energies to the basis set limit. Comparisons are made between the present data and the previously obtained helium results, as well as to those of the bare HM{sup +} molecules; furthermore, comparisons are made to the related M{sup +}–RG and M{sup 2+}–RG complexes. Partial atomic charge analyses have also been undertaken, and these used to test a simple charge-induced dipole model. Molecular orbital diagrams are presented together with contour plots of the natural orbitals from the quadratic configuration with single and double excitations (QCISD) density. The conclusion is that the majority of these complexes are physically bound, with very little sharing of electron density; however, for M = Be, and to a lesser extent M = Mg, some evidence for chemical effects is seen in HM{sup +}–RG complexes involving RG atoms with the higher atomic numbers.

  1. Use of technetium-99m-HM-PAO in the assessment of patients with dementia and other neuropsychiatric conditions

    International Nuclear Information System (INIS)

    Smith, F.W.; Besson, J.A.; Gemmell, H.G.; Sharp, P.F.

    1988-01-01

    One hundred fourteen patients suffering from neuropsychiatric conditions have been studied using 99mTc-labeled hexamethylpropyleneamine oxime (HM-PAO) and single photon emission computed tomography (SPECT). Ninety-one patients had a firm clinical diagnosis while 23 were examined without knowledge of the clinical diagnosis. Of the 91 patients, 51 were suffering from dementia, 25 multi-infarct type and 26 Alzheimer's disease. In 19 of the Alzheimer's patients, a characteristic pattern of decreased perfusion in the parieto-occipital regions was demonstrated while those with multi-infarct type showed varying degrees of irregular uptake in the cerebral cortex. These appearances are similar to those shown with positron emission tomography (PET) and we believe that HM-PAO will provide a widely available method for identifying patients with Alzheimer's disease. Twenty-nine patients were suffering from diseases involving the basal ganglia. Fifteen patients with Parkinson's disease showed no significant abnormality in basal ganglia uptake, while 7 or 8 patients with Huntington's disease who had full examinations showed decreased uptake in the caudate nuclei. Similarly, four of six patients with other basal ganglia diseases showed impaired uptake by basal ganglia, and it is concluded that HM-PAO may be useful for the diagnosis and management of this type of patient. Twenty-three patients received HM-PAO imaging as part of their diagnostic work-up; in 19 of them, detailed follow-up was obtained, which indicated that in 7 cases the result of the HM-PAO scan altered the clinical diagnosis and in 9 cases resulted in a change in management. In the remaining 13 cases, the study was found to be helpful in confirming the diagnosis

  2. Single-cell 5hmC sequencing reveals chromosome-wide cell-to-cell variability and enables lineage reconstruction

    NARCIS (Netherlands)

    Mooijman, Dylan; Dey, Siddharth S; Boisset, Jean-Charles; Crosetto, Nicola; van Oudenaarden, Alexander

    2016-01-01

    The epigenetic DNA modification 5-hydroxymethylcytosine (5hmC) has crucial roles in development and gene regulation. Quantifying the abundance of this epigenetic mark at the single-cell level could enable us to understand its roles. We present a single-cell, genome-wide and strand-specific 5hmC

  3. SPECT with [99mTc]-d,l-hexamethyl-propylene amine oxime (HM-PAO) compared with regional cerebral blood flow measured by PET

    DEFF Research Database (Denmark)

    Yonekura, Y; Nishizawa, S; Mukai, Thomas Søgaard

    1988-01-01

    In order to validate the use of technetium-99m-d,l-hexamethylpropyleneamine oxime (HM-PAO) as a flow tracer, a total of 21 cases were studied with single photon emission computerized tomography (SPECT), and compared to regional cerebral blood flow (rCBF) measured by position emission tomography...... (PET) using the oxygen-15 CO2 inhalation technique. Although HM-PAO SPECT and rCBF PET images showed a similar distribution pattern the HM-PAO SPECT image showed less contrast between high and low activity flow regions than the rCBF image and a nonlinear relationship between HM-PAO activity and r......CBF was shown. Based on the assumption of flow-dependent backdiffusion of HM-PAO from the brain, we applied a "linearization algorithm" to correct the HM-PAO SPECT images. The corrected HM-PAO SPECT images revealed a good linear correlation with rCBF (r = 0.901, p less than 0.001). The results indicated HM-PAO...

  4. Normal Control Study of Cerebral Blood Flow by 99mTc HM-PAO SPECT

    International Nuclear Information System (INIS)

    Koong, Sung Soo; Moon, Dae Hyuk; Lee, Bum Woo; Lee, Kyung Han

    1989-01-01

    Regional cerebral perfusion was evaluated in 15 normal controls by single photon emission computed tomography using 99m Tc HM-PAO. For quantitative analysis, 13 pairs of homologous region of interest (ROI) were drawn on three transverse slices matching the vascular territories and cerebral cortices, and normal values of 3 semiquantitative indices including 'Right to left ratio' (R/L ratio), 'Regional index' (RI), and 'Region to cerebellum ratio (R/cbll ratio) were calculated. Mean values of R/L ratios of homologous regions were ranged from 0.985 to 1.023, and mean ± 2 s.d. of all regions did not exceed 11% of mean. Significant difference of Rls (mean count per voxel of a ROI/mean count per voxel of total ROls) between regions were found (p<0.001) with highest values in occipital cortex and cerebellum. After attenuation correction, Rls in deep gray, cranial portion of anterior cerebral artery and vascular territories in the 2nd slice increased significantly (p<0.05-0.001) hut vise versa in other ROIs. Region to cerebellum ratios also showed regional difference similar to Rls.

  5. [/sup 99m/Tc]-HM-PAO SPECT in Parkinson's disease

    International Nuclear Information System (INIS)

    Pizzolato, G.; Dam, M.; Borsato, N.; Saitta, B.; Da Col, C.; Perlotto, N.; Zanco, P.; Ferlin, G.; Battistin, L.

    1988-01-01

    Thirty-six patients affected by Parkinson's disease were studied using single photon emission computed tomography (SPECT) and [/sup 99m/Tc]-HM-PAO as a tracer. The scanning procedure was performed 16-24 h after discontinuation of specific therapy. Tracer activity ratios were determined in 10 pairs of cerebellar, cortical, and subcortical regions. Data were compared with those of 10 age-matched controls. Most of the regions examined did not show any relevant change between parkinsonian and control subjects. Notably, mean activity in striatal regions were similar in the two groups. Increased activity in caudate-putamen was found in patients who were on chronic DOPA therapy. Side-to-side asymmetries in the basal ganglia increased with the severity of the disease. Significant reductions of tracer uptake, from control values, were observed bilaterally in the parietal cortex. These deficits were more pronounced in patients with mental deterioration and in subjects who had been chronically treated with anticholinergic drugs. Parietal perfusion deficits in parkinsonian patients resemble those described in Alzheimer's dementia. These findings suggest that the heterogeneous alterations of regional cerebral blood flow (rCBF) in parkinsonian patients reflect the multifactorial pathophysiology of the disease

  6. SPET with sup 99m Tc-HM PAO in the study of classic migraine. La SPET con sup 99m Tc-HM PAO nello studio dell'emicrania classica

    Energy Technology Data Exchange (ETDEWEB)

    Stiglich, F; Bonomo, F; Barbonetti, C; Di Lorenzo, I; Bottinelli, G [Ospedale Civile, Sondrio (Italy). Div. di Medicina Nucleare e Radioterapia; Tomaiolo, S [Ospedale Civile, Sondrio (Italy). Div. di Neurologia; Campani, R; Bottinelli, O [Pavia Univ. (Italy). Ist. di Radiologia

    1991-01-01

    Five patients presenting with migraine attacks underwent Electroencephalography (EEC), Computed Tomography (CT) and Single Photon Emission Tomography (SPET) with {sup 99m}Tc-HM PAO. EEG qand SPET were subsequently repeated in the intercritical period. We observed that two patients only showed non-specific abnormalities in EEG; scans were in all patients; all subjects exhibited diffuse cortical hypoperfusion. A strong correlation was always found between clinical presentation and hemispheric impairment. One patient exhibited asymmetrical perfusion between cerebellum hemispheres; intercritical SPET showed homogeneous distrubution of the radio-tracer in 4 patients. In the last one minimal residual hypoperfusion was observed, although less marked than in the acute phase. Therefore SPET with {sup 99m}Tc-HM PAO can be reasonably employed as the examination of choice when a migrain attack is clinically suspected, because of its reproducibility and reliability. It can be easily performed in every nuclear medical center supplied with modern tomographic cameras.

  7. Quantitative measurement of regional cerebral blood flow using {sup 99m}Tc-HM-PAO SPECT

    Energy Technology Data Exchange (ETDEWEB)

    Tanaka, Hisashi; Nakamura, Yusaku; Yagi, Yuji; Miura, Kosuke; Takahashi, Mitsuo [Kinki Univ., Osaka-Sayama, Osaka (Japan)

    1994-10-01

    This study examined a simple method for measuring the regional cerebral blood flow (rCBF) using {sup 99m}Tc-HM-PAO SPECT. The mean CBF (mCBF) was determined by the Patlack plot method and rCBF was calculated with Lassen`s correction algorithm, as reported by Matsuda et al. The cerebral hemisphere was employed as the reference region for Lassen`s correction. The reference RI count rate was calculated from the left cerebral hemisphere at the basal ganglia level and the correction factor {alpha} was fixed at 2.0. As a result, rCBF could be measured more easily than by Matsuda`s method. The contribution of age, laterality and gender to the CBF of normal subjects were studied. The mCBF value of 26 normal subjects was 53.8{+-}6.4 ml/100 g/min and showed a significant correlation with advancing age (R=0.644, p=0.0004, n=26). The mean values for rCBF of the cerebellum, frontal area, temporal area, occipital area and parietal area were 77.3{+-}6.6 ml/100 g/min, 70.2{+-}9.1 ml/100 g/min, 72.3{+-}7.5 ml/100 g/min, 71.8{+-}6.2 ml/100 g/min and 73.8{+-}8.6 ml/100 g/min, respectively. There were no gender or laterality differences in the mCBF or respective rCBF values. Each of the above listed regions, except for the occipital area, demonstrated a significant correlation with advancing age. The most remarkable decrease in rCBF with age was noted in the frontal area (R=0.757, p=0.001, n=26). (author).

  8. Quantitative measurement of regional cerebral blood flow using 99mTc-HM-PAO SPECT

    International Nuclear Information System (INIS)

    Tanaka, Hisashi; Nakamura, Yusaku; Yagi, Yuji; Miura, Kosuke; Takahashi, Mitsuo

    1994-01-01

    This study examined a simple method for measuring the regional cerebral blood flow (rCBF) using 99m Tc-HM-PAO SPECT. The mean CBF (mCBF) was determined by the Patlack plot method and rCBF was calculated with Lassen's correction algorithm, as reported by Matsuda et al. The cerebral hemisphere was employed as the reference region for Lassen's correction. The reference RI count rate was calculated from the left cerebral hemisphere at the basal ganglia level and the correction factor α was fixed at 2.0. As a result, rCBF could be measured more easily than by Matsuda's method. The contribution of age, laterality and gender to the CBF of normal subjects were studied. The mCBF value of 26 normal subjects was 53.8±6.4 ml/100 g/min and showed a significant correlation with advancing age (R=0.644, p=0.0004, n=26). The mean values for rCBF of the cerebellum, frontal area, temporal area, occipital area and parietal area were 77.3±6.6 ml/100 g/min, 70.2±9.1 ml/100 g/min, 72.3±7.5 ml/100 g/min, 71.8±6.2 ml/100 g/min and 73.8±8.6 ml/100 g/min, respectively. There were no gender or laterality differences in the mCBF or respective rCBF values. Each of the above listed regions, except for the occipital area, demonstrated a significant correlation with advancing age. The most remarkable decrease in rCBF with age was noted in the frontal area (R=0.757, p=0.001, n=26). (author)

  9. E072/ST-HM - A dynamic maintenance strategie to meet the requirements of the LHC installation

    OpenAIRE

    Böttcher, O

    2003-01-01

    The new ST-HM contract E072 for the maintenance of transport and handling equipment is designed to obtain the high operating reliability as required for the LHC installation and to respect the situation of limited resources at CERN at the same time. The contract is based on a dynamic maintenance strategy. It contains a flexible maintenance contingent that is essential to prepare the equipment for extremely important and critical utilization phases that will come up during the LHC installation...

  10. Is green the new black? : the impact of sustainability on brand : Conscious Fashion, a case study on H&M

    OpenAIRE

    Ehrsam, Melanie Michelle

    2016-01-01

    The fast-fashion industry has been criticized along the years for its lack of environmental and social ethics. In this frame we find H&M, the world’s second largest fashion retailer. The Swedish fast-fashion retailer has set its goal towards making fashion sustainable and has launched in 2011 its sustainable clothing line “Conscious”. The present dissertation aims to discover the potential of sustainable fashion in changing consumers’ attitude towards the brand. For this matter...

  11. Studies for labelling of leukocytes with sup 99m Tc-HM-PAO in vitro and animal experiments

    Energy Technology Data Exchange (ETDEWEB)

    Zhaoxiang, Gu; Xiangtong, Lin [Shanghai Medical Univ. (China). Huashan Hospital

    1989-05-01

    A technigue for in vitro labelling of human leukocytes with {sup 99m}Tc-HM-PAO is described. The percentage of labelled leukocytes is 43.0 +- 5.0 (mean +- SD, n = 6). Cell function was not impaired by the labelling procedure. Sterility and exclusion of bacterial endotoxins in the final cell suspensions were demonstrated. In experiments on dogs with abscess, scintigraphic imaging showed accumulation of radioactivity in inflammation lesions, indicating the viability of the labelled leukocytes.

  12. The class characteristic mark of the H&M Mul-T-Lock picking tool in toolmarks examination.

    Science.gov (United States)

    Volkov, Nikolai; Finkelstein, Nir; Novoselsky, Yehuda; Tsach, Tsadok

    2014-07-01

    Mul-T-Lock is a high security lock cylinder distinguished by the use of a telescoping "pin-in-pin"-tumbler design. Picking the Mul-T-Lock cylinder with a traditional picking tool is highly complicated because it can get stuck between the inner and outer pins. The H&M Mul-T-Lock picking tool was designed to overcome this problem and facilitate the picking of the "pin-in-pin" cylinder. The purpose of this research is to determine whether H&M Mul-T-Lock picking tool leaves class characteristic mark and whether it can be distinguished from traditional picking tools marks and from regular key marks. It also describes and determines the class characteristic mark left on telescopic pins, its origin, recurrence, and its benefit to the toolmarks examiner. When receiving a Mul-T-Lock from a crime scene, a toolmarks examiner can quickly determine whether or not it was picked by an H&M Mul-T-Lock picking tool by noticing the class characteristic mark which this typical tool leaves. © 2014 American Academy of Forensic Sciences.

  13. Special applications of [sup 99m]Tc-HM-PAO SPECT in the evaluation of cerebral hemodynamics

    Energy Technology Data Exchange (ETDEWEB)

    Kobayashi, Shigeki; Kageyama, Yuhsuke (Chiba Emergency Medical Center (Japan)); Namba, Hiroki (and others)

    1991-12-01

    [sup 99m]Tc-HM-PAO has been widely used as a brain-perfusion tracer. It is known that this lipophilic tracer crosses the blood-brain barrier with a high-pass extraction fraction, is deposited in the brain proportional to the cerebral blood flow, and shows a nearly constant maintenance of the regional distribution over several hours. Taking advantage of these characteristics of the tracer, we evaluated changes in the cerebral blood flow before and after recanalization therapy in the acute stage of stroke. Recent advances in catheterization technique have made it possible to introduce a catheter superselectively into smaller cerebral vessels, such as anterior, middle, and posterior cerebral arteries and external carotid artery branches. We ourselves evaluated the areas and concentrations of anti-cancer agents by injecting HM-PAO through the microcatheter used for superselective intra-arterial chemotherapy. We also visualized the areas supplied by the grafted vessels after bypass surgery for ischemic cerebrovascular diseases by the superselective infusion of HM-PAO. We found these techniques to be useful in clinical neurosurgery. (author).

  14. Benchmark on hydrogen distribution in a containment based on the OECD-NEA THAI HM-2 experiment

    International Nuclear Information System (INIS)

    Schwarz, S.; Fischer, K.; Bentaib, A.

    2009-01-01

    Within the course of a hypothetical severe accident in a nuclear power plant, hydrogen can be generated in the primary circuit and released into the containment. Considering the possibility of a deflagration, the simulation of the hydrogen distribution in the containment by computer codes is of major importance. In order to create a data base for code validation, several distribution experiments using helium and hydrogen have been performed in the German THAI (Thermal-Hydraulics, Hydrogen, Aerosols, Iodine) facility. They started with the ISP-47 test TH13 and were followed by the HM (Hydrogen-Helium Material Scaling Tests) series. The objectives of the HM Tests are to confirm the transferability of existing helium distribution test data to hydrogen distribution problems, to understand the processes that lead to the formation and dissolution of a light cloud stratification. The test HM-2 was chosen for a code benchmark. During the first phase of test HM-2 a light gas cloud consisting of hydrogen and nitrogen was established in the upper half of the facility. In the second phase steam was injected at a lower position inducing a rising steam - nitrogen plume. The plume did not break through the cloud, because its density was higher than the density of the cloud. Therefore the cloud was gradually dissolved from its bottom. Eleven organisations performed 'blind' calculations to the HM-2 experiment. The lumped parameter (LP) codes ASTEC, COCOSYS and MELCOR and the CFD codes FLUENT, GASFLOW and GOTHIC were used. The main phenomena were natural convection, interaction between the rising plume and the light gas cloud, steam condensation on walls, fog behaviour and the heat up of the walls. The experimental data of the first phase had been published and the atmospheric stratification was simulated reasonably well. The data from the second phase stayed concealed until the simulated results were submitted. The thermal-hydraulic phenomena were predicted well by several LP- and

  15. Almanac Songs and Singers

    DEFF Research Database (Denmark)

    Sørensen, Bent

    2015-01-01

    ) effort against Fascism. Issues addressed herein will include assessing strategies in the practices of musical performers who have political agendas, investigating the usefulness of Guy Debord’s terminology of détournement ("turning expressions of the capitalist system and its media culture against itself...

  16. Ton H.M. van Schaik and Karin Strengers-Olde Kalter, Het Arme Roomse Leven. Geschiedenis van de katholieke caritas in de stad Utrecht

    Directory of Open Access Journals (Sweden)

    Joost van Genabeek

    2017-07-01

    Full Text Available Ton H.M. van Schaik and Karin Strengers-Olde Kalter, Het Arme Roomse Leven. Geschiedenis van de katholieke caritas in de stad Utrecht (Hilversum: Verloren, 2016, 276 pp., isbn 978 90 8704 578 4.

  17. Role of SPECT (HM-PAO, Tc99mRc) and ultrasound (TCD) in the instrumental diagnostic approach to the comprehension of reversible ischemic symptoms

    International Nuclear Information System (INIS)

    Liboni, W.; Baggiore, P.; Chianale, G.; Marta, G.; Castellano, G.; Cornaglia, G.

    1989-01-01

    The relation between variations of cerebral and acute neurologic events, followed by partial or total recovery, has been investigated with SPECT HM-PAO and with ultrasound (TRANSCRANIAL DOPPLER). (H.W.). 3 refs.; 2 figs.; 2 tabs

  18. Interaction of HmC1q with leech microglial cells: involvement of C1qBP-related molecule in the induction of cell chemotaxis

    Directory of Open Access Journals (Sweden)

    Tahtouh Muriel

    2012-02-01

    Full Text Available Abstract Background In invertebrates, the medicinal leech is considered to be an interesting and appropriate model to study neuroimmune mechanisms. Indeed, this non-vertebrate animal can restore normal function of its central nervous system (CNS after injury. Microglia accumulation at the damage site has been shown to be required for axon sprouting and for efficient regeneration. We characterized HmC1q as a novel chemotactic factor for leech microglial cell recruitment. In mammals, a C1q-binding protein (C1qBP alias gC1qR, which interacts with the globular head of C1q, has been reported to participate in C1q-mediated chemotaxis of blood immune cells. In this study, we evaluated the chemotactic activities of a recombinant form of HmC1q and its interaction with a newly characterized leech C1qBP that acts as its potential ligand. Methods Recombinant HmC1q (rHmC1q was produced in the yeast Pichia pastoris. Chemotaxis assays were performed to investigate rHmC1q-dependent microglia migration. The involvement of a C1qBP-related molecule in this chemotaxis mechanism was assessed by flow cytometry and with affinity purification experiments. The cellular localization of C1qBP mRNA and protein in leech was investigated using immunohistochemistry and in situ hybridization techniques. Results rHmC1q-stimulated microglia migrate in a dose-dependent manner. This rHmC1q-induced chemotaxis was reduced when cells were preincubated with either anti-HmC1q or anti-human C1qBP antibodies. A C1qBP-related molecule was characterized in leech microglia. Conclusions A previous study showed that recruitment of microglia is observed after HmC1q release at the cut end of axons. Here, we demonstrate that rHmC1q-dependent chemotaxis might be driven via a HmC1q-binding protein located on the microglial cell surface. Taken together, these results highlight the importance of the interaction between C1q and C1qBP in microglial activation leading to nerve repair in the medicinal

  19. Interaction of HmC1q with leech microglial cells: involvement of C1qBP-related molecule in the induction of cell chemotaxis.

    Science.gov (United States)

    Tahtouh, Muriel; Garçon-Bocquet, Annelise; Croq, Françoise; Vizioli, Jacopo; Sautière, Pierre-Eric; Van Camp, Christelle; Salzet, Michel; Nagnan-le Meillour, Patricia; Pestel, Joël; Lefebvre, Christophe

    2012-02-22

    In invertebrates, the medicinal leech is considered to be an interesting and appropriate model to study neuroimmune mechanisms. Indeed, this non-vertebrate animal can restore normal function of its central nervous system (CNS) after injury. Microglia accumulation at the damage site has been shown to be required for axon sprouting and for efficient regeneration. We characterized HmC1q as a novel chemotactic factor for leech microglial cell recruitment. In mammals, a C1q-binding protein (C1qBP alias gC1qR), which interacts with the globular head of C1q, has been reported to participate in C1q-mediated chemotaxis of blood immune cells. In this study, we evaluated the chemotactic activities of a recombinant form of HmC1q and its interaction with a newly characterized leech C1qBP that acts as its potential ligand. Recombinant HmC1q (rHmC1q) was produced in the yeast Pichia pastoris. Chemotaxis assays were performed to investigate rHmC1q-dependent microglia migration. The involvement of a C1qBP-related molecule in this chemotaxis mechanism was assessed by flow cytometry and with affinity purification experiments. The cellular localization of C1qBP mRNA and protein in leech was investigated using immunohistochemistry and in situ hybridization techniques. rHmC1q-stimulated microglia migrate in a dose-dependent manner. This rHmC1q-induced chemotaxis was reduced when cells were preincubated with either anti-HmC1q or anti-human C1qBP antibodies. A C1qBP-related molecule was characterized in leech microglia. A previous study showed that recruitment of microglia is observed after HmC1q release at the cut end of axons. Here, we demonstrate that rHmC1q-dependent chemotaxis might be driven via a HmC1q-binding protein located on the microglial cell surface. Taken together, these results highlight the importance of the interaction between C1q and C1qBP in microglial activation leading to nerve repair in the medicinal leech.

  20. Evaluation of [sup 99m]Tc-HM-PAO thigh accumulation in patients with cerebro-vascular disease

    Energy Technology Data Exchange (ETDEWEB)

    Nishigaki, Hiroshi; Adachi, Itaru; Komori, Tsuyoshi; Tatsu, Yoshimitsu; Hisada, Youichi; Sueyoshi, Kouzou; Narabayashi, Isamu (Osaka Medical College, Takatsuki (Japan))

    1993-06-01

    Technetium-99m d,l-hexamethyl-propyleneamine oxime ([sup 99m]Tc-HM-PAO) cerebral SPECT and whole body scintigraphy (WBS) were performed in 5 patients without cerebro-vascular disease (CVD) (Group 1), 31 patients with CVD but not hemiparesis (Group 2) and 18 patients with CVD and hemiparesis (Group 3). Four ROIs were drawn manually around the whole body (WB), brain (Br), right and left thigh (Th). We calculated some ratios: the total counts in the brain over the total counts in the whole body (Br/WB), the total counts in the thigh over the total counts in the whole body (Th/WB) and the mean counts in the thigh over the mean counts in the brain (Th/Br).The Br/WB was 6.9[+-]1.8%, rt-Th/WB was 4.9[+-]2.1%, lt-Th/WB was 5.1[+-]1.3% and Th/Br was 0.46[+-]0.17 in group 1. Whole body scintigraphies in group 1 revealed clear and similar images between right and left thigh. The Br/WB was 6.7[+-]1.4%, Th/WB of paretic side was 4.6[+-]1.0%, Th/WB of non-paretic side was 5.8[+-]1.2% and Th/Br was 0.47[+-]0.18 in group 3. The Th/WB in non paretic side was significantly higher than that in paretic side (p<0.01). The thigh images in group 3 revealed clear differences between paretic and non-paretic thighes. In conclusion we could acquire the clear thigh images with [sup 99m]Tc-HM-PAO. It was possible that we evaluated not only cerebral perfusion but also muscle atrophy and/or perfusion in patients with CVD using [sup 99m]Tc-HM-PAO. (author).

  1. Evaluation of 99mTc-HM-PAO thigh accumulation in patients with cerebro-vascular disease

    International Nuclear Information System (INIS)

    Nishigaki, Hiroshi; Adachi, Itaru; Komori, Tsuyoshi; Tatsu, Yoshimitsu; Hisada, Youichi; Sueyoshi, Kouzou; Narabayashi, Isamu

    1993-01-01

    Technetium-99m d,l-hexamethyl-propyleneamine oxime ( 99m Tc-HM-PAO) cerebral SPECT and whole body scintigraphy (WBS) were performed in 5 patients without cerebro-vascular disease (CVD) (Group 1), 31 patients with CVD but not hemiparesis (Group 2) and 18 patients with CVD and hemiparesis (Group 3). Four ROIs were drawn manually around the whole body (WB), brain (Br), right and left thigh (Th). We calculated some ratios: the total counts in the brain over the total counts in the whole body (Br/WB), the total counts in the thigh over the total counts in the whole body (Th/WB) and the mean counts in the thigh over the mean counts in the brain (Th/Br). The Br/WB was 6.9±1.8%, rt-Th/WB was 4.9±2.1%, lt-Th/WB was 5.1±1.3% and Th/Br was 0.46±0.17 in group 1. Whole body scintigraphies in group 1 revealed clear and similar images between right and left thigh. The Br/WB was 6.7±1.4%, Th/WB of paretic side was 4.6±1.0%, Th/WB of non-paretic side was 5.8±1.2% and Th/Br was 0.47±0.18 in group 3. The Th/WB in non paretic side was significantly higher than that in paretic side (p 99m Tc-HM-PAO. It was possible that we evaluated not only cerebral perfusion but also muscle atrophy and/or perfusion in patients with CVD using 99m Tc-HM-PAO. (author)

  2. Single photon emission tomography using sup(99m)Tc-HM-PAO in the investigation of dementia

    Energy Technology Data Exchange (ETDEWEB)

    Neary, D; Snowden, J S; Shields, R A; Burjan, A W.I.; Northen, B; Macdermott, N; Prescott, M C; Testa, H J

    1987-09-01

    Single photon emission tomographic imaging of the brain using sup(99m)Tc HM-PAO was carried out in patients with a clinical diagnosis of Alzheimer's disease, non-Alzheimer frontal-lobe dementia, and progressive supranuclear palsy. Independent assessment of reductions in uptake revealed posterior hemisphere abnormalities in the majority of the Alzheimer group, and selective anterior hemisphere abnormalities in both other groups. The findings were consistent with observed patterns of mental impairment. The imaging technique has potential value in the differential diagnosis of primary cerebral atrophy.

  3. Assessment of the arterial input curve for [99mTc]-d,l-HM-PAO by rapid octanol extraction

    DEFF Research Database (Denmark)

    Andersen, A R; Friberg, H; Lassen, N A

    1988-01-01

    The in vitro conversion of the lipophilic molecule [99mTc]-d,l-hexamethylpropyleneamine oxime [( 99mTc]-d,l-HM-PAO) to a hydrophilic form was studied in saline, plasma, and blood at 37 degrees C by paper chromatography and by octanol extraction. The octanol:saline ratio was 79.9. From this value...... and the corresponding octanol: plasma and octanol:blood partitioning values, an estimate of the transport of the lipophilic compound by various components of blood was made: 20% is carried in hemoglobin, 53% by the plasma proteins and 27% by the water phases of the red blood cell and plasma. Octanol extraction provided...

  4. Sandvik's HM 150 roller in action on the world's largest conveyor bridge in the Lusatia region; Sandvik HM 150 auf der weltgroessten Foerderbruecke in der Lausitz im Einsatz

    Energy Technology Data Exchange (ETDEWEB)

    Waliczek, Sven; Raddatz, Ulrich [Sandvik Mining and Construction Central Europe GmbH, Essen (Germany)

    2010-09-15

    Prince Herrmann Ludwig Heinrich von Pueckler-Muskau, a landscape gardening genius, built the Muskau Park in the Lusatia region in 1817 - it is part of a UNESCO world heritage site today. In the same era, 1850, the first lignite was mined in the region and still today, Vattenfall, the Swedish company, extracts lignite without subsidies - in Jaenschwalde among other places, one out of the five opencast mines currently in operation. As one of the largest employers and apprenticing companies in East Germany, Vattenfall currently employs almost 8000 employees and about 800 apprentices. Sandvik Mining and Construction also plays a leading role - in the literal sense. At the Jaenschwalde location there are 320 sets of 5-roller garlands of HM150 formed rollers in action on the overburden conveyor bridge AFB 60m (Figure 1) - on belt five, the main belt conveyor (belt type 3000 ST3000-18:8, idler spacing approx. 800 mm) and on belt eight, the stockpile belt conveyor (belt type 2750 ST2500-18:8, idler spacing approx. 800 mm). It all began in the spring of 2004. Bernhard Hofmayer, Production Manager at Sandvik, introduced the HM150 formed roller to Vattenfall. The engineers were impressed by the completely new design and the innovative assembly technique. The discussion about the advantages and disadvantages of the component optimised formed roller were ready to begin. (orig.)

  5. Analysis Of Factors Causing Delays On Harun Nafsi - Hm Rifadin Street In Samarinda East Kalimantan Maintenance Project

    Directory of Open Access Journals (Sweden)

    Fadli

    2017-12-01

    Full Text Available This study aims to identify analyze and describe the factors that affect the project maintenance delay on Harun Nafsi - HM. Rifadin Street in Samarinda East Kalimantan. This research uses qualitative research method by utilizing questionnaires. The 30 participating respondents consist of 14 project implementers and 16 field implementers. The data are analyzed by descriptive statistical technique factor analysis and linear regression analysis. The results show that the factors influencing the delay of maintenance project of Harun Nafis - HM Rifadin Street include 1 time factor and workmanship factor 2 human resources and natural factors 3 geographical conditions late approval plans change and labor strikes and 4 non-optimal working levels and changes in the scope of the project during the work are still ongoing. Based on multiple linear regression analysis coefficient of determination value of 0.824 is obtained. It means that the four factors studied affect 82.4 of project delays and the rest of 27.6 is influenced by other variables out of this study. The results of this study also indicate that the dominant factor for road maintenance project delays is the fourth factor of the factors mentioned. The effort that the contractor needs to undertake is not to expand the employment contract if the project is underway or the contractor does not have the capability to complete another project.

  6. 99mTc-ECD and 99mTc-HM-PAO SPECT in five patients with MELAS

    International Nuclear Information System (INIS)

    Katagiri, Shinako; Nishimaki, Hiroshi; Kitano, Masashi; Horiike, Shigeharu; Kan, Shinichi; Ishii, Katsumi; Matsubayashi, Takashi; Sakai, Fumihiko

    1998-01-01

    Cerebral perfusion was studied in five patients with mitochondrial encephalomyopathy with lactic acidosis and stroke-like episodes syndrome (MELAS), using single photon emission computed tomography (SPECT) with 99m Tc-ethyl cysteinate dimer ( 99m Tc-ECD) or 99m Tc-hexamethyl propyleneamine oxime ( 99m Tc-HM-PAO). In four cases, regional cerebral blood flow (rCBF) was evaluated by the method reported by Mastuda et al. Immediately after the stroke-like episodes, accumulation of the tracer was relatively increased in the temporooccipital lobe, and also increased rCBF was shown in the same area. However, the region showed decreased radioactivity at the chronic stage, and rCBF decreased also. These findings are consistent with positron emission tomography (PET) at the acute stage and autopsy. 99m Tc-ECD SPECT and 99m Tc-HM-PAO SPECT may be useful in the diagnosis and assessment of the progress of the MELAS. (author)

  7. Comparison of Tc-99m HM-PAO SPECT brain scan and x-ray CT in the detection of brain metastases

    International Nuclear Information System (INIS)

    Abdel-Dayem, H.M.; Sadek, S.; Sahwell, A.; Kubasek, H.; El-Sayed, M.; Ziada, G.; Mobarak, L.; Al-Huda, F.; Omar, Y.T.

    1986-01-01

    Tc-99m HM-PAO imaging was compared with x-ray CT in 14 patients with known or suspected brain metastases. Both studies were done within 3 days of each other. Static and single photon emission CT (SPECT) images were acquired after intravenous injection of 13 mCi of Tc-99m HM-PAO. All 14 patients underwent static and SPECT Tc-99m HM-PAO imaging and x-ray CT. Studies were positive in 7, 12, and 10 patients, respectively, by static, SPECT, and x-ray CT imaging, and negative in 7, 2, and 2. The number of lesions identified was 0 (static imaging), 32 (SPECT), and 26(x-ray CT). There were no ''suspicious'' studies by any modality. This study indicates that Tc-99m HM-PAO SPECT cerebral blood flow imaging is more sensitive than x-ray CT for detecting brain metastases, that biplane imaging is not sensitive and SPECT is essential, and that for Tc-99m HM-PAO SPECT brain imaging to regain its importance with respect to x-ray CT, acquisition time must be 10 minutes or less and determination of percentage brain uptake of the injected dose, and of regional distribution, is necessary

  8. Epigenomic Co-localization and Co-evolution Reveal a Key Role for 5hmC as a Communication Hub in the Chromatin Network of ESCs

    Directory of Open Access Journals (Sweden)

    David Juan

    2016-02-01

    Full Text Available Summary: Epigenetic communication through histone and cytosine modifications is essential for gene regulation and cell identity. Here, we propose a framework that is based on a chromatin communication model to get insight on the function of epigenetic modifications in ESCs. The epigenetic communication network was inferred from genome-wide location data plus extensive manual annotation. Notably, we found that 5-hydroxymethylcytosine (5hmC is the most-influential hub of this network, connecting DNA demethylation to nucleosome remodeling complexes and to key transcription factors of pluripotency. Moreover, an evolutionary analysis revealed a central role of 5hmC in the co-evolution of chromatin-related proteins. Further analysis of regions where 5hmC co-localizes with specific interactors shows that each interaction points to chromatin remodeling, stemness, differentiation, or metabolism. Our results highlight the importance of cytosine modifications in the epigenetic communication of ESCs. : 5-hydroxymethylcytosine (5hmC plays a key role in the epigenomic communication network of embryonic stem cells. Juan et al. build a communication network based in co-localization of epigenomic data and literature. The analysis of the network and its components reveals that proteins reading and editing 5hmC co-evolve and serve as links between diverse molecular processes.

  9. Contributions for Repositioning a Regional Strategy for Healthy Municipalities, Cities and Communities (HM&C): Results of a Pan-American Survey

    Science.gov (United States)

    Rice, Marilyn; Vizzotti, Carlos; Frassia, Romina; Vizzotti, Pablo; Akerman, Marco

    2010-01-01

    This article presents the results of the 1st Regional Survey of Healthy Municipalities, Cities and Communities (HM&C) carried out in 2008 by the Pan American Health Organization (PAHO) and ISALUD University of Argentina. It discusses the responses obtained from 12 countries in the Americas Region. Key informants in Argentina, Brazil, Chile, Colombia, Costa Rica, Cuba, Mexico, Paraguay, Peru, and Uruguay were selected and encouraged to answer the survey, while informants from Canada and Honduras answered voluntarily and were included in this analysis. The discussion of the results of the Survey provides insight into the current status of HM&C in the Region and suggests key topics for repositioning the Regional strategy relative to: (1) the conceptual identity and tools for HM&C; (2) challenging areas in the implementation process (scale, legal framework, and development of capacities); (3) related strategies and participatory processes such as the ways citizen empowerment in governance is supported; (4) the need to monitor and assess the impact of the HM&C strategy on the health and quality of life of the populations involved; and (5) the need for developing a strategic research and training agenda. The analysis and discussion of these results aims to provide useful input for repositioning the strategy in the Region and contributing to the emergence of a second generation of concepts and tools capable of meeting the developing priorities and needs currently faced by the HM&C strategy. PMID:20532989

  10. Coupled HM modelling of the mine-by test at Meuse-Haute-Marne (MHM) URL France

    International Nuclear Information System (INIS)

    Yildizdag, K.; Shao, H.; Hesser, J.; Soennke, J.; Noiret, A.

    2012-01-01

    Document available in extended abstract form only. In order to test the feasibility of disposing High-Level and Long-Lived Wastes (HLW-LL) in Callovo- Oxfordian clay formation (COx), the French National Radioactive Waste Management Agency (ANDRA) has carried out scientific and engineering investigations in the Meuse-Haute-Marne Underground Research Laboratory (URL) since November 1999. The COx (Figure 1) is of a special interest because of its very favourable characteristics for being a possible host rock for the disposal of radioactive waste. The project OHZ (Observation and Monitoring of the EDZ) was initiated in 2008 by ANDRA. In the framework of this project, a Mine-by experiment was performed in the niche GCS. The excavation was started on 29.01.2008. Displacement and pore pressure evolution during the excavation was measured by different sensors. Within the cooperation between BGR and ANDRA numerical calculations have been done using the code RockFlow to understand the hydraulic and mechanical (HM) coupling mechanisms of Callovo-Oxfordian clay-stone observed during the Mine-by experiment. Modelling results: With regard to the bedding of COx a transverse isotropy approach was applied. Thus the anisotropy effects caused by the bedding have been considered in coupled HM models (Massmann, 2009). Intensive parameter studies in comparison with measured deformation and pore pressure data have been conducted to reduce modelling uncertainties. Fully saturated models yield very precise results in the far field wherein excavation effect has its lower impact. Rapid decline of pore pressure and continuously increasing deformation subsequent to excavation in the near field could not be interpreted even taking shrinkage and partially saturation into consideration. During the Mine-by test, overpressures on sidewalls and reduced pressures on roof and floor were measured due to the mechanical effect on pore pressure which is induced by the bedding. Good agreement between

  11. Die etiek van HM Kuitert na aanleiding van sy boek Suicide - wat is er tegen? Selfdoding in moreel perspectief

    Directory of Open Access Journals (Sweden)

    R. M. Naudé

    1988-01-01

    Full Text Available The ethics of HM Kuitert according to his book entitled. Suicide - wat is er tegen? Selfdoding in moreel perspektief According to several publications Kuitert is criticised as a humanist. This paper tests his view on suicide to this accusation. It is found that Kuitert accepts teleology and solidarity as norms for his ethics and uses it as a method for his arguments against suicide. His goal is to offer an ethic which is acceptable for the Christian and the non-Christian. This results in outonomy with less emphasis on the theological argument against suicide. The result of this study is that the ethics of Kuitert cannot be described as mere humanism. Outonomy is judged as a form of theonomy.

  12. FAKTOR- FAKTOR UTAMA PEMBENTUK PREFERENSI MASYARAKAT MENYIKAPI PELEBARAN JALAN H.M. SUWIGNYO TERHADAP PROSPEK ASET PRIBADI

    Directory of Open Access Journals (Sweden)

    Muhammad Hidayat

    2015-07-01

    Full Text Available The broadening of H.M. Suwignyo Street have triggered the street corridor expansion. The property's owners take benefit from the increasing of asset value. They will have choices to manage and determine preferences for the asset. This study was aimed to find out the prominent factors that determine asset's owner preferences toward street broadening consequences. In first phase, analysis is performed qualitatively to construct the quantitative instruments for next research. Data are gathered from observation and semi-structured interview to informans. Data are categorised and codified with the result as initial hypotheses, which indicate community preferences to employ the property asset. The result showed that the social strata of asset's owner; asset tangible and intangible value comprehension; economic motif; gentrification; and the intervening factor/ government role are the prominent factors

  13. LEVERAGE OF THE COMMERCIAL SUCCESS OF FASHION TRADEMARKS ZARA AND H&M ON THE GLOBAL MARKET

    OpenAIRE

    Djakovič, Vesna

    2011-01-01

    Podjetje Zara in H&M sta vsekakor vsem poznani modni blagovni znamki, specializirani predvsem z oblačili, namenjeni v največji meri ženskam, vsekakor pa tudi moškim in otrokom. Glavni kupec ene kot druge znamke je mlajša populacija med 15 in 45 let. Obe znamki veljata za srednje kakovostni in s tem omogočata dosego nakupa širšemu segmentu. Njuni izdelki so primerni za študente, mlade družine, poslovneže ipd. Obe se poslužujeta različnih tržnih poti, tržnega komuniciranja in lastnih inovativni...

  14. Comparison of ionospheric F2 peak parameters foF2 and hmF2 with IRI2001 at Hainan

    Science.gov (United States)

    Wang, X.; Shi, J. K.; Wang, G. J.; Gong, Y.

    2009-06-01

    Monthly median values of foF2, hmF2 and M(3000)F2 parameters, with quarter-hourly time interval resolution for the diurnal variation, obtained with DPS4 digisonde at Hainan (19.5°N, 109.1°E; Geomagnetic coordinates: 178.95°E, 8.1°N) are used to investigate the low-latitude ionospheric variations and comparisons with the International Reference Ionosphere (IRI) model predictions. The data used for the present study covers the period from February 2002 to April 2007, which is characterized by a wide range of solar activity, ranging from high solar activity (2002) to low solar activity (2007). The results show that (1) Generally, IRI predictions follow well the diurnal and seasonal variation patterns of the experimental values of foF2, especially in the summer of 2002. However, there are systematic deviation between experimental values and IRI predictions with either CCIR or URSI coefficients. Generally IRI model greatly underestimate the values of foF2 from about noon to sunrise of next day, especially in the afternoon, and slightly overestimate them from sunrise to about noon. It seems that there are bigger deviations between IRI Model predictions and the experimental observations for the moderate solar activity. (2) Generally the IRI-predicted hmF2 values using CCIR M(3000)F2 option shows a poor agreement with the experimental results, but there is a relatively good agreement in summer at low solar activity. The deviation between the IRI-predicted hmF2 using CCIR M(3000)F2 and observed hmF2 is bigger from noon to sunset and around sunrise especially at high solar activity. The occurrence time of hmF2 peak (about 1200 LT) of the IRI model predictions is earlier than that of observations (around 1500 LT). The agreement between the IRI hmF2 obtained with the measured M(3000)F2 and the observed hmF2 is very good except that IRI overestimates slightly hmF2 in the daytime in summer at high solar activity and underestimates it in the nighttime with lower values near

  15. [Evaluation of the analyzer of hematology Beckman Coulter® HmX™ in the university hospital of Oran].

    Science.gov (United States)

    Zmouli, N; Moulasserdoun, K; Seghier, F

    2013-11-01

    The choice of an automaton of haematology is a determining stage, which has to take into account at the same time the quality of the results and the economic imperatives: workload, structure and organization of the laboratory. [corrected] It is in this spirit that we estimated during a period of 3 months the analyzer of haematology: the HmX™ Coulter with boatman of samples of the company Beckman. This automaton realizes the blood numeration, the formula leukocytic and the reticulocyte count. At first, we estimated the appropriate characteristics of device. Secondly, we estimated the relevance, the sensibility and the specificity of the alarms by comparing with the reference method, which is the optical microscopy. For that purpose, 125 blood smears resulting from service of haematology and from resuscitation were examined in optical microscopy. The technical tests were realized according to the recommendations of the International committee for evaluation of automatons of haematology. The analytical performances were satisfactory in particular the big interval of linearity and the absence of contamination. As regards the evaluation of the alarms system: rate of rejection is 63%, the sensibility 86%, the specificity 70%, the positive predictive value 80%, the negative predictive value 78% and the efficiency 80%. The alarms myelaemia and atypical lymphocytes were never sources of false negatives. The alarms erythroblasts and platelet aggregates did not engendered positive forgery. The blast cell alarm was responsible for a single case of false negative. The faithfulness of automaton is satisfactory: the absence of contamination, the big interval of linearity for the leukocytes, the red blood cells and the platelets as well as a good relevance of the alarms with regard to the anomalies found on the peripheral blood smear. From the user-friendliness and practicability point of view, the HmX™ Coulter was deeply appreciated. Copyright © 2013 Elsevier Masson SAS. All

  16. A Subject-Based Aspect Report on Provision in Scotland's Colleges by HM Inspectors on Behalf of the Scottish Funding Council: Hospitality and Tourism

    Science.gov (United States)

    Her Majesty's Inspectorate of Education, 2010

    2010-01-01

    The HM Inspectorate of Education publication, "External quality arrangements for Scotland's colleges, September 2008," specifies that HMIE will produce a number of subject aspect reports over the four years 2008-12. These reports complement in a subject specific context the generic evaluations of learning and teaching in HMIE's reports…

  17. Comparison of Tc-99m HM-PAO and I-123 IMP cerebral SPECT images in Alzheimer's disease and multi-infarct dementia

    Energy Technology Data Exchange (ETDEWEB)

    Gemmell, H G; Sharp, P F; Besson, J A.O.; Ebmeier, K P; Smith, F W

    1988-10-01

    SPECT images of the brain can be obtained using either /sup 123/I labelled amines or /sup 99m/Tc-hexamethylpropyleneamineoxime (HM-PAO). Both materials produce images which are blood flow dominated and so appear similar in normal subjects, although the respective mechanisms of uptake are not yet finally established. It seems likely, however, that the different mechanisms of uptake are responsible for recent reports of some differences seen in images obtained with the two types of agent in patients with cerebral pathology, mainly cerebrovascular disease. In this study, 12 demented patients, 6 with dementia of the Alzheimer type (DAT) and 6 with multi infarct dementia (MID), were imaged with /sup 123/I-isopropylamphetamine (IMP) and /sup 99m/Tc-HM-PAO and the images compared. Significantly more lesions were seen with IMP than HM-PAO (P < 0.02); out of a possible 120 sites, 41 lesions were seen with IMP compared to 28 with HM-PAO, 23 being seen with both agents. However, it is concluded that either agent can be used for the differential diagnosis of dementia, a task for which the new cerebral blood flow agents seem well suited.

  18. Cumulative vibratory indices and the H/M ratio of the soleus H-reflex: a quantitative study in control and spastic subjects

    NARCIS (Netherlands)

    Ongerboer de Visser, B. W.; Bour, L. J.; Koelman, J. H.; Speelman, J. D.

    1989-01-01

    Suppression of the soleus (Sol) H-reflex recruitment curve by Achilles tendon vibration and the ratio of maximum Sol H-reflex (Hmax) to maximum M-response (H/M ratio) have been studied by means of computer processing on the basis of peak-to-peak (P-P) and area values in 46 controls and in 16 spastic

  19. Array-based assay detects genome-wide 5-mC and 5-hmC in the brains of humans, non-human primates, and mice.

    Science.gov (United States)

    Chopra, Pankaj; Papale, Ligia A; White, Andrew T J; Hatch, Andrea; Brown, Ryan M; Garthwaite, Mark A; Roseboom, Patrick H; Golos, Thaddeus G; Warren, Stephen T; Alisch, Reid S

    2014-02-13

    Methylation on the fifth position of cytosine (5-mC) is an essential epigenetic mark that is linked to both normal neurodevelopment and neurological diseases. The recent identification of another modified form of cytosine, 5-hydroxymethylcytosine (5-hmC), in both stem cells and post-mitotic neurons, raises new questions as to the role of this base in mediating epigenetic effects. Genomic studies of these marks using model systems are limited, particularly with array-based tools, because the standard method of detecting DNA methylation cannot distinguish between 5-mC and 5-hmC and most methods have been developed to only survey the human genome. We show that non-human data generated using the optimization of a widely used human DNA methylation array, designed only to detect 5-mC, reproducibly distinguishes tissue types within and between chimpanzee, rhesus, and mouse, with correlations near the human DNA level (R(2) > 0.99). Genome-wide methylation analysis, using this approach, reveals 6,102 differentially methylated loci between rhesus placental and fetal tissues with pathways analysis significantly overrepresented for developmental processes. Restricting the analysis to oncogenes and tumor suppressor genes finds 76 differentially methylated loci, suggesting that rhesus placental tissue carries a cancer epigenetic signature. Similarly, adapting the assay to detect 5-hmC finds highly reproducible 5-hmC levels within human, rhesus, and mouse brain tissue that is species-specific with a hierarchical abundance among the three species (human > rhesus > mouse). Annotation of 5-hmC with respect to gene structure reveals a significant prevalence in the 3'UTR and an association with chromatin-related ontological terms, suggesting an epigenetic feedback loop mechanism for 5-hmC. Together, these data show that this array-based methylation assay is generalizable to all mammals for the detection of both 5-mC and 5-hmC, greatly improving the utility of mammalian model systems

  20. Genome-Wide Mapping of 5mC and 5hmC Identified Differentially Modified Genomic Regions in Late-Onset Severe Preeclampsia: A Pilot Study.

    Directory of Open Access Journals (Sweden)

    Lisha Zhu

    Full Text Available Preeclampsia (PE is a leading cause of perinatal morbidity and mortality. However, as a common form of PE, the etiology of late-onset PE is elusive. We analyzed 5-methylcytosine (5mC and 5-hydroxymethylcytosine (5hmC levels in the placentas of late-onset severe PE patients (n = 4 and normal controls (n = 4 using a (hydroxymethylated DNA immunoprecipitation approach combined with deep sequencing ([h]MeDIP-seq, and the results were verified by (hMeDIP-qPCR. The most significant differentially methylated regions (DMRs were verified by MassARRAY EppiTYPER in an enlarged sample size (n = 20. Bioinformatics analysis identified 714 peaks of 5mC that were associated with 403 genes and 119 peaks of 5hmC that were associated with 61 genes, thus showing significant differences between the PE patients and the controls (>2-fold, p<0.05. Further, only one gene, PTPRN2, had both 5mC and 5hmC changes in patients. The ErbB signaling pathway was enriched in those 403 genes that had significantly different 5mC level between the groups. This genome-wide mapping of 5mC and 5hmC in late-onset severe PE and normal controls demonstrates that both 5mC and 5hmC play epigenetic roles in the regulation of the disease, but work independently. We reveal the genome-wide mapping of DNA methylation and DNA hydroxymethylation in late-onset PE placentas for the first time, and the identified ErbB signaling pathway and the gene PTPRN2 may be relevant to the epigenetic pathogenesis of late-onset PE.

  1. Almanaque da Dengue: leituras e narrativas de Agentes Comunitários de Saúde Almanaque de Dengue: lecturas y narraciones de Agentes Comunitarios de Salud Dengue Almanac: readings and narratives of Community Health Agents

    Directory of Open Access Journals (Sweden)

    Helena Maria Scherlowski Leal David

    2012-12-01

    Full Text Available Apresenta-se um estudo de leitura e apropriação como metodologia de aproximação ao universo narrativo de Agentes Comunitários de Saúde (ACS, usando um dispositivo de informação e comunicação - o Almanaque da Dengue (AD. O objetivo foi o de perceber as formas de construção e apropriação de saberes sobre dengue e saúde por parte dos ACS, além de avaliar a serventia do AD como um dispositivo info-comunicacional. Foram realizadas oficinas com agentes do Rio de Janeiro, com vistas à desconstrução e leitura relacional do AD. A análise das narrativas gerou três categorias temáticas: abundância informacional nos ciclos epidêmicos; culpabilização da vítima; contradições e ambiguidades no trabalho dos ACS como mediadores. O AD mostrou-se um instrumento útil na discussão e apropriação de informações sobre a saúde, devido ao caráter textual relacional e não linear dos seus conteúdos, e ao seu formato interativo e não impositivo de formulações sobre a dengue e saúde.Presentase un estudio de lectura y apropiación como método de acercamiento al universo narrativo de los agentes comunitarios de salud (ACS, utilizando un dispositivo de información y comunicación, el Almanaque de Dengue (AD. Objetivó-se ampliar la comprensión acerca de las formas de construcción y apropiación de conocimientos sobre dengue y salud, y evaluar el Almanac como un dispositivo info-comunicacional. La metodología cualitativa se desarrolló por medio de talleres con ACS de Río de Janeiro, para la deconstrucción y lectura relacional del AD. Los resultados se clasificaron en tres temas: la abundancia de información en ciclos epidémicos, culpa de la víctima, las contradicciones y ambigüedades en la labor de la ACS. El AD ha demostrado ser una herramienta útil para el debate y la propiedad de la información de salud, debido al carácter relacional y no lineal de su contenido y su formato interactivo, no prescriptivo sobre dengue y

  2. FLUENT calculations of the hydrogen distribution in a containment during the OECD-NEA THAI HM-2 experiment

    International Nuclear Information System (INIS)

    Visser, D.C.; Komen, E.M.J.; Houkema, M.; Siccama, N.B.; Kyttaelae, Juha; Huhtanen, Risto; Takasuo, Eveliina

    2009-01-01

    Hydrogen may be released into the containment atmosphere of a nuclear power plant during a severe accident. Locally, high hydrogen concentrations may be reached that can possibly cause fast deflagration or even detonation and put the integrity of the containment at risk. Therefore, the distribution and mixing of hydrogen is an important safety issue for nuclear power plants. Computer codes can be applied to predict the hydrogen distribution in the containment within the course of a hypothetical severe accident and get an estimate of the local hydrogen concentration in the various zones of the containment. In this way the risk associated with the hydrogen safety issue can be determined, and safety related measurements and procedures could be assessed. In order to validate the existing computer codes in the context of hydrogen distribution in the containment of a nuclear power plant, experimental benchmark studies have been performed in the German Thermal-hydraulics, Hydrogen, Aerosols and Iodine (THAI) facility in the framework of the OECD-NEA THAI project. In order to demonstrate the capabilities of the commercial Computational Fluid Dynamics (CFD) code FLUENT the THAI HM-2 test was simulated independently by NRG and VTT. In the first phase of the HM-2 test a stratified hydrogen rich light gas layer was established in the upper part of the THAI containment. In the second phase steam was injected at a lower position inducing a rising plume that gradually dissolved the stratified hydrogen-rich layer from below. Thermo-dynamic phenomena like natural convection, mixing, condensation, heat transfer and distribution in different zones that are expected in severe accidents are involved. The calculated results by NRG and VTT (on hydrogen concentration, temperature, pressure and flow velocity) are compared to the experimental results. The most important differences between the CFD model of NRG and VTT are the computational mesh, condensation model and treatment of the solid

  3. In Silico Modeling and Functional Interpretations of Cry1Ab15 Toxin from Bacillus thuringiensis BtB-Hm-16

    Directory of Open Access Journals (Sweden)

    Sudhanshu Kashyap

    2013-01-01

    Full Text Available The theoretical homology based structural model of Cry1Ab15 δ-endotoxin produced by Bacillus thuringiensis BtB-Hm-16 was predicted using the Cry1Aa template (resolution 2.25 Å. The Cry1Ab15 resembles the template structure by sharing a common three-domain extending conformation structure responsible for pore-forming and specificity determination. The novel structural differences found are the presence of β0 and α3, and the absence of α7b, β1a, α10a, α10b, β12, and α11a while α9 is located spatially downstream. Validation by SUPERPOSE and with the use of PROCHECK program showed folding of 98% of modeled residues in a favourable and stable orientation with a total energy Z-score of −6.56; the constructed model has an RMSD of only 1.15 Å. These increments of 3D structure information will be helpful in the design of domain swapping experiments aimed at improving toxicity and will help in elucidating the common mechanism of toxin action.

  4. Media Fill Test for validation of autologous leukocytes separation and labelling by (99m)Tc-HmPAO.

    Science.gov (United States)

    Urbano, Nicoletta; Modoni, Sergio; Schillaci, Orazio

    2013-01-01

    Manufacturing of sterile products must be carried out in order to minimize risks of microbiological contamination. White blood cells (WBC) labelled with (99m)Tc-exametazime ((99m)Tc-hexamethylpropyleneamine oxime; (99m)Tc-HMPAO) are being successfully applied in the field of infection/inflammation scintigraphy for many years. In our radiopharmacy lab, separation and labelling of autologous leukocytes with (99m)Tc-HMPAO were performed in a laminar flow cabinet not classified and placed in a controlled area, whereas (99m)Tc-HMPAO radiolabelling procedure was carried out in a hot cell with manipulator gloves. This study was conducted to validate this process using a Media Fill simulation test. The study was performed using sterile Tryptic Soy Broth (TSB) in place of active product, reproducing as closely as possible the routine aseptic production process with all the critical steps, as described in the our internal standard operative procedures (SOP). The final vials containing the media of each processed step were then incubated for 14 days and examined for the evidence of microbial growth. No evidence of turbidity was observed in all the steps assayed by the Media Fill. In the separation and labelling of autologous leukocytes with (99m)Tc-HmPAO, Media-Fill test represents a reliable tool to validate the aseptic process. Copyright © 2013 Elsevier Inc. All rights reserved.

  5. Functional regional cerebral blood flow SPECT using 99mTc-HM-PAO by speech memory tasks

    International Nuclear Information System (INIS)

    Tohyama, Junko

    1993-01-01

    Using single photon emission computed tomography (SPECT) with Tc-99m HA-PAO, changes in regional cerebral blood flow (rCBF) by giving word memory and Miyake's tasks were determined for localizatin of speech memory function. Twice injection method of Tc-99m HM-PAO was used to obtain subtraction SPECT images; and positioning of the 1st and 2nd SPECT was determined by phantom study. To prevent artifacts and changes in rCBF as far as possible, the subjects were informed word fluency and Miyake's tasks sufficiently. When giving word fluency approach, an increase in rCBF was observed in both the operculum and the supratemporal convolution of dominant hemisphere. When giving Miyake's approach, it was observed predominantly in the supratemporal convolution of dominant hemisphere. Although it was also observed in the base of frontal lobe and operculum, there was no bilateral difference. An increased rCBF in the basal nucleus was more clearly observed by Miyake's than word fluency tasks without bilateral differences. There was no definitive increase in rCBF in the Papez's circuit responsible for memory and emotion by either word fluency or Miyake's tasks. In mentally mild disorder patients, an increased rCBF was observed in the same areas as those in normal subjects. In such patients having a decreased rCBF at rest, an increased rCBF was seen in the contralateral hemisphere and the surrounding areas of the lesions, suggesting compensatory mechanism. (N.K.) 65 refs

  6. Nautical Navigation Aids (NAVAID) Locations

    Data.gov (United States)

    Department of Homeland Security — Structures intended to assist a navigator to determine position or safe course, or to warn of dangers or obstructions to navigation. This dataset includes lights,...

  7. Bax/Tubulin/Epithelial-Mesenchymal Pathways Determine the Efficacy of Silybin Analog HM015k in Colorectal Cancer Cell Growth and Metastasis

    Directory of Open Access Journals (Sweden)

    Haneen Amawi

    2018-05-01

    Full Text Available The inhibition of apoptosis, disruption of cellular microtubule dynamics, and over-activation of the epithelial mesenchymal transition (EMT, are involved in the progression, metastasis, and resistance of colorectal cancer (CRC to chemotherapy. Therefore, the design of a molecule that can target these pathways could be an effective strategy to reverse CRC progression and metastasis. In this study, twelve novel silybin derivatives, HM015a-HM015k (15a−15k and compound 17, were screened for cytotoxicity in CRC cell lines. Compounds HM015j and HM015k (15k and 15j significantly decreased cell proliferation, inhibited colony formation, and produced cell cycle arrest in CRC cells. Furthermore, 15k significantly induced the formation of reactive oxygen species and apoptosis. It induced the cleavage of the intrinsic apoptotic protein (Bax p21 to its more efficacious fragment, p18. Compound 15k also inhibited tubulin expression and disrupted its structure. Compound 15k significantly decreased metastatic LOVO cell migration and invasion. Furthermore, 15k reversed mesenchymal morphology in HCT116 and LOVO cells. Additionally, 15k significantly inhibited the expression of the mesenchymal marker N-cadherin and upregulated the expression of the epithelial marker, E-cadherin. Compound 15k inhibited the expression of key proteins known to induce EMT (i.e., DVL3, β-catenin, c-Myc and upregulated the anti-metastatic protein, cyclin B1. Overall, in vitro, 15k significantly inhibited CRC progression and metastasis by inhibiting apoptosis, tubulin activity and the EMT pathways. Overall, these data suggest that compound 15k should be tested in vivo in a CRC animal model for further development.

  8. Agrobacterium tumefaciens-MEDIATED IN-PLANTA TRANSFORMATION OF INDONESIAN MAIZE USING pIG121Hm-Cs PLASMID CONTAINING nptII AND hpt GENES

    Directory of Open Access Journals (Sweden)

    Edy Listanto

    2017-05-01

    Full Text Available Maize (Zea mays L. productivity in Indonesia is challenged to be increased using genetic engineering. Recent advances in Agrobacterium tumefaciens-mediated in-planta transforma-tion makes it possible to transform maize with low cost, and simple method. This study aimed to confirm pIG121Hm-Cs plasmid in A. tumefaciens, and to estimate the efficiency level of  A. tumefaciens-mediated in-planta transformation of Indonesian maize by using pIG121Hm-Cs plasmid containing nptII and hpt genes. A series of studies were conducted including confirmation of gene construct of pIG121Hm-Cs plasmid in A. tumefaciens, transformation of four maize lines through A. tumefaciens-mediated in-planta technique, acclimatization of transformant plants and molecular analysis of selected plants using polymerase chain reaction (PCR. The pIG121Hm-Cs plasmid was confirmed via PCR analysis using specific primers of nptII and hpt genes and resulted 700 bp and 500 bp for fragments of nptII and hpt, respectively. After selection, acclimatization and molecular analysis steps, the efficiency levels of transformation of four maize lines were low, ranging from 3.8% to 12.8%. The level of transformation efficiency of ST-27 line was the highest accounting for 12.8% of 45 planted embryos on selection medium based on PCR analysis using specific primer for nptII gene. Overall, A. tumefaciens-mediated in planta transformation on maize floral pistil in this study proved to be successful and rapid. Therefore, this enhanced transformation method will be beneficial for Indonesian maize genetic engineering.

  9. Performance-oriented packaging: A guide to identifying and designing. Identifying and designing hazardous materials packaging for compliance with post HM-181 DOT Regulations

    International Nuclear Information System (INIS)

    1994-08-01

    With the initial publication of Docket HM-181 (hereafter referred to as HM-181), the U.S. Department of Energy (DOE), Headquarters, Transportation Management Division decided to produce guidance to help the DOE community transition to performance-oriented packagings (POP). As only a few individuals were familiar with the new requirements, elementary guidance was desirable. The decision was to prepare the guidance at a level easily understood by a novice to regulatory requirements. This document identifies design development strategies for use in obtaining performance-oriented packagings that are not readily available commercially. These design development strategies will be part of the methodologies for compliance with post HM-181 U.S. Department of Transportation (DOT) packaging regulations. This information was prepared for use by the DOE and its contractors. The document provides guidance for making decisions associated with designing performance-oriented packaging, and not for identifying specific material or fabrication design details. It does provide some specific design considerations. Having a copy of the regulations handy when reading this document is recommended to permit a fuller understanding of the requirements impacting the design effort. While this document is not written for the packaging specialist, it does contain guidance important to those not familiar with the new POP requirements

  10. Combination with a defucosylated anti-HM1.24 monoclonal antibody plus lenalidomide induces marked ADCC against myeloma cells and their progenitors.

    Directory of Open Access Journals (Sweden)

    Takeshi Harada

    Full Text Available The immunomodulatory drug lenalidomide (Len has drawn attention to potentiate antibody-dependent cellular cytotoxicity (ADCC-mediated immunotherapies. We developed the defucosylated version (YB-AHM of humanized monoclonal antibody against HM1.24 (CD317 overexpressed in multiple myeloma (MM cells. In this study, we evaluated ADCC by YB-AHM and Len in combination against MM cells and their progenitors. YB-AHM was able to selectively kill via ADCC MM cells in bone marrow samples from patients with MM with low effector/target ratios, which was further enhanced by treatment with Len. Interestingly, Len also up-regulated HM1.24 expression on MM cells in an effector-dependent manner. HM1.24 was found to be highly expressed in a drug-resistant clonogenic "side population" in MM cells; and this combinatory treatment successfully reduced SP fractions in RPMI 8226 and KMS-11 cells in the presence of effector cells, and suppressed a clonogenic potential of MM cells in colony-forming assays. Collectively, the present study suggests that YB-AHM and Len in combination may become an effective therapeutic strategy in MM, warranting further study to target drug-resistant MM clonogenic cells.

  11. 2011 HM{sub 102}: DISCOVERY OF A HIGH-INCLINATION L5 NEPTUNE TROJAN IN THE SEARCH FOR A POST-PLUTO NEW HORIZONS TARGET

    Energy Technology Data Exchange (ETDEWEB)

    Parker, Alex H.; Holman, Matthew J.; McLeod, Brian A. [Harvard-Smithsonian Center for Astrophysics, 60 Garden Street, Cambridge, MA 02138 (United States); Buie, Marc W.; Borncamp, David M.; Spencer, John R.; Stern, S. Alan [Southwest Research Institute, 6220 Culebra Road, San Antonio, TX 78238 (United States); Osip, David J. [Carnegie Observatories, Las Campanas Observatory, Casilla 601, La Serena (Chile); Gwyn, Stephen D. J.; Fabbro, Sebastian; Kavelaars, J. J. [Canadian Astronomy Data Centre, National Research Council of Canada, 5071 W. Saanich Road, Victoria, BC V9E 2E7 (Canada); Benecchi, Susan D.; Sheppard, Scott S. [Department of Terrestrial Magnetism, Carnegie Institute of Washington, 5251 Broad Branch Road NW, Washington, DC 20015 (United States); Binzel, Richard P.; DeMeo, Francesca E. [Massachusetts Institute of Technology, 77 Massachusetts Avenue, Cambridge, MA 02139 (United States); Fuentes, Cesar I.; Trilling, David E. [Department of Physics and Astronomy, Northern Arizona University, S San Francisco St, Flagstaff, AZ 86011 (United States); Gay, Pamela L. [Center for Science, Technology, Engineering and Mathematics (STEM) Research, Education, and Outreach, Southern Illinois University, 1220 Lincoln Dr, Carbondale, IL 62901 (United States); Petit, Jean-Marc [CNRS, UTINAM, Universite de Franche Comte, Route de Gray, F-25030 Besancon Cedex, (France); Tholen, David J., E-mail: aparker@cfa.harvard.edu [Institute for Astronomy, University of Hawaii, 2680 Woodlawn Dr, Honolulu, HI 96822 (United States); and others

    2013-04-15

    We present the discovery of a long-term stable L5 (trailing) Neptune Trojan in data acquired to search for candidate trans-Neptunian objects for the New Horizons spacecraft to fly by during an extended post-Pluto mission. This Neptune Trojan, 2011 HM{sub 102}, has the highest inclination (29. Degree-Sign 4) of any known member of this population. It is intrinsically brighter than any single L5 Jupiter Trojan at H{sub V} {approx} 8.18. We have determined its gri colors (a first for any L5 Neptune Trojan), which we find to be similar to the moderately red colors of the L4 Neptune Trojans, suggesting similar surface properties for members of both Trojan clouds. We also present colors derived from archival data for two L4 Neptune Trojans (2006 RJ{sub 103} and 2007 VL{sub 305}), better refining the overall color distribution of the population. In this document we describe the discovery circumstances, our physical characterization of 2011 HM{sub 102}, and this object's implications for the Neptune Trojan population overall. Finally, we discuss the prospects for detecting 2011 HM{sub 102} from the New Horizons spacecraft during its close approach in mid- to late-2013.

  12. The Aorta-Gonad-Mesonephros Organ Culture Recapitulates 5hmC Reorganization and Replication-Dependent and Independent Loss of DNA Methylation in the Germline.

    Science.gov (United States)

    Calvopina, Joseph Hargan; Cook, Helene; Vincent, John J; Nee, Kevin; Clark, Amander T

    2015-07-01

    Removal of cytosine methylation from the genome is critical for reprogramming and transdifferentiation and plays a central role in our understanding of the fundamental principles of embryo lineage development. One of the major models for studying cytosine demethylation is the mammalian germ line during the primordial germ cell (PGC) stage of embryo development. It is now understood that oxidation of 5-methylcytosine (5mC) to 5-hydroxymethylcytosine (5hmC) is required to remove cytosine methylation in a locus-specific manner in PGCs; however, the mechanisms downstream of 5hmC are controversial and hypothesized to involve either active demethylation or replication-coupled loss. In the current study, we used the aorta-gonad-mesonephros (AGM) organ culture model to show that this model recapitulates germ line reprogramming, including 5hmC reorganization and loss of cytosine methylation from Snrpn and H19 imprinting control centers (ICCs). To directly address the hypothesis that cell proliferation is required for cytosine demethylation, we blocked PI3-kinase-dependent PGC proliferation and show that this leads to a G1 and G2/M cell cycle arrest in PGCs, together with retained levels of cytosine methylation at the Snrpn ICC, but not at the H19 ICC. Taken together, the AGM organ culture model is an important tool to evaluate mechanisms of locus-specific demethylation and the role of PI3-kinase-dependent PGC proliferation in the locus-specific removal of cytosine methylation from the genome.

  13. 2011 HM102: DISCOVERY OF A HIGH-INCLINATION L5 NEPTUNE TROJAN IN THE SEARCH FOR A POST-PLUTO NEW HORIZONS TARGET

    International Nuclear Information System (INIS)

    Parker, Alex H.; Holman, Matthew J.; McLeod, Brian A.; Buie, Marc W.; Borncamp, David M.; Spencer, John R.; Stern, S. Alan; Osip, David J.; Gwyn, Stephen D. J.; Fabbro, Sébastian; Kavelaars, J. J.; Benecchi, Susan D.; Sheppard, Scott S.; Binzel, Richard P.; DeMeo, Francesca E.; Fuentes, Cesar I.; Trilling, David E.; Gay, Pamela L.; Petit, Jean-Marc; Tholen, David J.

    2013-01-01

    We present the discovery of a long-term stable L5 (trailing) Neptune Trojan in data acquired to search for candidate trans-Neptunian objects for the New Horizons spacecraft to fly by during an extended post-Pluto mission. This Neptune Trojan, 2011 HM 102 , has the highest inclination (29.°4) of any known member of this population. It is intrinsically brighter than any single L5 Jupiter Trojan at H V ∼ 8.18. We have determined its gri colors (a first for any L5 Neptune Trojan), which we find to be similar to the moderately red colors of the L4 Neptune Trojans, suggesting similar surface properties for members of both Trojan clouds. We also present colors derived from archival data for two L4 Neptune Trojans (2006 RJ 103 and 2007 VL 305 ), better refining the overall color distribution of the population. In this document we describe the discovery circumstances, our physical characterization of 2011 HM 102 , and this object's implications for the Neptune Trojan population overall. Finally, we discuss the prospects for detecting 2011 HM 102 from the New Horizons spacecraft during its close approach in mid- to late-2013.

  14. pH-regulated metal-ligand switching in the HM loop of ATP7A: a new paradigm for metal transfer chemistry.

    Science.gov (United States)

    Kline, Chelsey D; Gambill, Benjamin F; Mayfield, Mary; Lutsenko, Svetlana; Blackburn, Ninian J

    2016-08-01

    Cuproproteins such as PHM and DBM mature in late endosomal vesicles of the mammalian secretory pathway where changes in vesicle pH are employed for sorting and post-translational processing. Colocation with the P1B-type ATPase ATP7A suggests that the latter is the source of copper and supports a mechanism where selectivity in metal transfer is achieved by spatial colocation of partner proteins in their specific organelles or vesicles. In previous work we have suggested that a lumenal loop sequence located between trans-membrane helices TM1 and TM2 of the ATPase, and containing five histidines and four methionines, acts as an organelle-specific chaperone for metallation of the cuproproteins. The hypothesis posits that the pH of the vesicle regulates copper ligation and loop conformation via a mechanism which involves His to Met ligand switching induced by histidine protonation. Here we report the effect of pH on the HM loop copper coordination using X-ray absorption spectroscopy (XAS), and show via selenium substitution of the Met residues that the HM loop undergoes similar conformational switching to that found earlier for its partner PHM. We hypothesize that in the absence of specific chaperones, HM motifs provide a template for building a flexible, pH-sensitive transfer site whose structure and function can be regulated to accommodate the different active site structural elements and pH environments of its partner proteins.

  15. Tour of the stands at the UK@CERN industrial exhibition with the Director-General and H.E. Mr Simon Featherstone, HM Ambassador to Switzerland, hosted by Mrs. Jan Fillingham MBE, Head of Exhibitions, BEAMA

    CERN Multimedia

    Claudia Marcelloni

    2006-01-01

    Tour of the stands at the UK@CERN industrial exhibition with the Director-General and H.E. Mr Simon Featherstone, HM Ambassador to Switzerland, hosted by Mrs. Jan Fillingham MBE, Head of Exhibitions, BEAMA

  16. Opportunistic Infections (OIs) in Patients with Hematologic Malignancies (HM) Treated with Bruton’s Tyrosine Kinase (BTK) and Phosphoinositide 3 Kinase (PI3K) Inhibitors: An 8-Year Retrospective Cohort Study

    OpenAIRE

    Issa, Nicolas; Arbona-Haddad, Esther; Nevett-Fernandez, Alexandra; Prestes, Daniel; Liakos, Alexis; Woolley, Ann; Hammond, Sarah; Brown, Jennifer; Baden, Lindsey; Marty, Francisco

    2017-01-01

    Abstract Background: BTK and PI3K inhibitors are increasingly used for treatment in patients with HM. OIs when these agents were used as first line therapy signaled an increased level of immunosuppression beyond what was expected from the mechanism of action of these drugs. The epidemiology of OIs in the setting of BTK and PI3K inhibitor use has not been characterized. Methods: We retrospectively studied a cohort of patients with HM who received BTK (ibrutinib, acalabrutinib, spebrutinib) or ...

  17. Almanac of the sustainable development

    International Nuclear Information System (INIS)

    2006-01-01

    Climatic change, greenhouse gases, energy, water, wastes, natural and industrial risks, poverty, all theses are debated in this book. The politicians, industrialists and experts point of view and concrete recommendations are illustrated by children drawings. (A.L.B.)

  18. Some Navigation and Almanac Algorithms.

    Science.gov (United States)

    1985-09-01

    angular input ,’ td output is in radians. In the direct rhumb line solution for the spheroid earth, if cosa 12 =0, then A2 = At + and( and (26a) =CC...LDoLT*U :au’CO(LD) EZ󈧭N(LD):XnM6*854(*CB*CL: OGEZ 150: A~UAL-AB/IID * 2550 Y--CB*8L : XuB*X-a*Iz*CL:MGSU 120: AZ’A2/] tD 2560 PUNT :P117 ’ALTITUK a m;AL...31e13) 4BD ) :NMinO:SFUFU(IF) 269 P&M 13IAMTOI a O;STU$(B1) ’l 2700 GO8B 2720:CLB :NEXT N:G070 2090 2710 2720 P1.111 :P~iT mPRZU C TO CONTIuE 2730 C

  19. CBF tomograms with [/sup 99m/Tc-HM-PAO in patients with dementia (Alzheimer type and HIV) and Parkinson's disease--initial results

    International Nuclear Information System (INIS)

    Costa, D.C.; Ell, P.J.; Burns, A.; Philpot, M.; Levy, R.

    1988-01-01

    We present preliminary data on the utility of functional brain imaging with [99mTc]-d,l-HM-PAO and single photon emission computed tomography (SPECT) in the study of patients with dementia of the Alzheimer type (DAT), HIV-related dementia syndrome, and the on-off syndrome of Parkinson's disease. In comparison with a group of age-matched controls, the DAT patients revealed distinctive bilateral temporal and posterior parietal deficits, which correlate with detailed psychometric evaluation. Patients with amnesia as the main symptom (group A) showed bilateral mesial temporal lobe perfusion deficits (p less than 0.02). More severely affected patients (group B) with significant apraxia, aphasia, or agnosia exhibited patterns compatible with bilateral reduced perfusion in the posterior parietal cortex, as well as reduced perfusion to both temporal lobes, different from the patients of the control group (p less than 0.05). SPECT studies of HIV patients with no evidence of intracraneal space occupying pathology showed marked perfusion deficits. Patients with Parkinson's disease and the on-off syndrome studied during an on phase (under levodopa therapy) and on another occasion after withdrawal of levodopa (off) demonstrated a significant change in the uptake of [99mTc]-d,l-HM-PAO in the caudate nucleus (lower on off) and thalamus (higher on off). These findings justify the present interest in the functional evaluation of the brain of patients with dementia. [99mTc]-d,l-HM-PAO and regional cerebral blood flow (rCBF)/SPECT appear useful and highlight individual disorders of flow in a variety of neuropsychiatric conditions

  20. CBF tomograms with (/sup 99m/Tc-HM-PAO in patients with dementia (Alzheimer type and HIV) and Parkinson's disease--initial results

    Energy Technology Data Exchange (ETDEWEB)

    Costa, D.C.; Ell, P.J.; Burns, A.; Philpot, M.; Levy, R.

    1988-12-01

    We present preliminary data on the utility of functional brain imaging with (99mTc)-d,l-HM-PAO and single photon emission computed tomography (SPECT) in the study of patients with dementia of the Alzheimer type (DAT), HIV-related dementia syndrome, and the on-off syndrome of Parkinson's disease. In comparison with a group of age-matched controls, the DAT patients revealed distinctive bilateral temporal and posterior parietal deficits, which correlate with detailed psychometric evaluation. Patients with amnesia as the main symptom (group A) showed bilateral mesial temporal lobe perfusion deficits (p less than 0.02). More severely affected patients (group B) with significant apraxia, aphasia, or agnosia exhibited patterns compatible with bilateral reduced perfusion in the posterior parietal cortex, as well as reduced perfusion to both temporal lobes, different from the patients of the control group (p less than 0.05). SPECT studies of HIV patients with no evidence of intracraneal space occupying pathology showed marked perfusion deficits. Patients with Parkinson's disease and the on-off syndrome studied during an on phase (under levodopa therapy) and on another occasion after withdrawal of levodopa (off) demonstrated a significant change in the uptake of (99mTc)-d,l-HM-PAO in the caudate nucleus (lower on off) and thalamus (higher on off). These findings justify the present interest in the functional evaluation of the brain of patients with dementia. (99mTc)-d,l-HM-PAO and regional cerebral blood flow (rCBF)/SPECT appear useful and highlight individual disorders of flow in a variety of neuropsychiatric conditions.

  1. Empleo de metodos numericos para el ajuste de los coeficientes de difusividad (D) y convectivo de transferencia de masa (hm) en el secado de alimentos

    OpenAIRE

    Arranz Saiz, Francisco Javier; Correa Hernando, Eva Cristina; Jiménez Ariza, Heidi Tatiana; Diezma Iglesias, Belen; Garcia-Herrero, Javier; Robla Villalba, José Ignacio; Barreiro Elorza, Pilar

    2011-01-01

    Los modelos matemáticos de transferencia de humedad desde el alimento al medio circundante durante el proceso de secado dependen de dos parámetros: coeficiente de difusividad efectiva D y coeficiente convectivo de transferencia de masa hm, cuya determinación experimental se basa en la consideración de un sistema difusivo sencillo de solución analítica bien conocida. Para el caso, que aquí nos ocupa, de difusión monodimensional en una lámina infinita de grosor 2l, la solución analítica de ...

  2. Propuesta de un modelo de un sistema de gestión de calidad, basado en la Norma ISO 9001:2008 en el Hotel HM Internacional

    OpenAIRE

    Riera Peralta, Patricia; Naranjo Navarrete, Pierina

    2013-01-01

    El propósito de la presente tesis es diseñar un Modelo de un Sistema de Gestión de Calidad basado en Norma ISO 9001-2008, para que el hotel HM Internacional pueda competir con otros servicios hoteleros en diferentes partes del mundo, ofreciendo un servicio de calidad que aumente la satisfacción del cliente, incremente la rentabilidad del negocio y disminuya los costos. La tesis comienza planteando el problema del área de recepción, describiendo la metodología de la investigación a seguir pa...

  3. Purificación y caracterización parcial de una toxina (Hm3 del veneno de Hadruroides mauryi (Francke y Soleglad, 1980 (Scorpiones, Iuridae

    Directory of Open Access Journals (Sweden)

    Luz Velásquez

    2013-06-01

    Full Text Available Se ha purificado una toxina (Hm3 del veneno del escorpión Hadruroides mauryi, por cromatografía de intercambio iónico en CM-Sephadex C-25 con buffer acetato de amonio 0,05M, pH 7. La toxina produce contracción y parálisis en la extremidad inoculada de ratones albinos y se caracteriza por ser de naturaleza básica y tener un peso molecular de 4,5 kDa. Después de 45 minutos de ser inoculada en el músculo gastrocnemius de ratones albinos, Hm3 (30,4 µg aumenta los niveles plasmáticos de creatina kinasa desde 252,6 UI/L hasta 3779,3 UI/L y de lactato deshidrogenasa, desde 142,7 UI/L hasta 248,2 UI/L; igualmente incrementa los niveles de calcio intramuscular desde 34,1 nmoles hasta 69,3 nmoles. Esta toxina carece de actividad proteolítica y fosfolipásica.

  4. Bioethanol Production from Sugarcane Bagasse by a Novel Brazilian Pentose Fermenting Yeast Scheffersomyces shehatae UFMG-HM 52.2: Evaluation of Fermentation Medium

    Directory of Open Access Journals (Sweden)

    F. A. F. Antunes

    2014-01-01

    Full Text Available Bioconversion of hemicellulosic sugars into second generation (2G ethanol plays a pivotal role in the overall success of biorefineries. In this study, ethanol production performance of a novel xylose-fermenting yeast, Scheffersomyces shehatae UFMG-HM 52.2, was evaluated under batch fermentation conditions using sugarcane bagasse (SB hemicellulosic hydrolysate as carbon source. Dilute acid hydrolysis of SB was performed to obtain sugarcane bagasse hemicellulosic hydrolysate (SBHH. It was concentrated, detoxified, and supplemented with nutrients in different formulations to prepare the fermentation medium to the yeast evaluation performance. S. shehatae UFMG-HM 52.2 (isolated from Brazilian Atlantic rain forest ecosystem was used in fermentations carried out in Erlenmeyer flasks maintained in a rotator shaker at 30°C and 200 rpm for 72 h. The use of a fermentation medium composed of SBHH supplemented with 5 g/L ammonium sulfate, 3 g/L yeast extract, and 3 g/L malt extract resulted in 0.38 g/g of ethanol yield and 0.19 g L.h of volumetric productivity after 48 h of incubation time.

  5. On the condition of UO{sub 2} nuclear fuel irradiated in a PWR to a burn-up in excess of 110 MWd/kgHM

    Energy Technology Data Exchange (ETDEWEB)

    Restani, R.; Horvath, M. [Paul Scherrer Institut, CH-5232, Villigen PSI (Switzerland); Goll, W. [AREVA GmbH, P.O. Box 1109, DE-91001 Erlangen (Germany); Bertsch, J.; Gavillet, D.; Hermann, A. [Paul Scherrer Institut, CH-5232, Villigen PSI (Switzerland); Martin, M., E-mail: matthias.martin@psi.ch [Paul Scherrer Institut, CH-5232, Villigen PSI (Switzerland); Walker, C.T. [The Grange, 66 High Street, Swinderby, Lincoln LN6 9LU (United Kingdom)

    2016-12-01

    Post-irradiation examination results are presented for UO{sub 2} fuel from a PWR fuel rod that had been irradiated to an average burn-up of 105 MWd/kgHM and showed high fission gas release of 42%. The radial distribution of xenon and the partitioning of fission gas between bubbles and the fuel matrix was investigated using laser ablation inductively coupled plasma mass spectrometry (LA-ICP-MS) and electron probe microanalysis. It is concluded that release from the fuel at intermediate radial positions was mainly responsible for the high fission gas release. In this region thermal release had occurred from the high burn-up structure (HBS) at some point after the sixth irradiation cycle. The LA-ICP-MS results indicate that gas release had also occurred from the HBS in the vicinity of the pellet periphery. It is shown that the gas pressure in the HBS pores is well below the pressure that the fuel can sustain. - Highlights: • Gas retention measured by laser ablation induction coupled plasma mass spectrometry. • Thermal release from the high burn structure responsible for high gas release. • At a pellet burn-up of 115 MWd/kgHM the high burn-up structure is still evolving. • The gas pressure in HBS pores is well below the pressure that the fuel can sustain.

  6. Variation of hmF2 and NmF2 deduced from DPS-4 over Multan (Pakistan) and their comparisons with IRI-2012 & IRI-2016 during the deep solar minimum between cycles 23 & 24

    Science.gov (United States)

    Ameen, Muhammad Ayyaz; Khursheed, Haqqa; Jabbar, Mehak Abdul; Ali, Muneeza Salman; Chishtie, Farrukh

    2018-04-01

    We report the results of ionospheric measurements from DPS-4 installed at Multan (Geog coord. 30.18°N, 71.48°E, dip 47.4°). The variations in F2-layer maximum electron density NmF2 and its peak height hmF2 are studied during the deep solar minimum between cycles 23 & 24 i.e 2008-2009 with comparisons conducted with the International Reference Ionosphere (IRI) versions 2012 & 2016. We find that the hmF2 observations peak around the pre-sunrise and sunrise hours depending on the month. Seasonally, the daytime variation of NmF2 is higher in the Equinox and Summer, while daytime hmF2 are slightly higher in the Equinox and Winter. High values of hmF2 around midnight are caused by an increase of upward drifts produced by meridional winds. The ionosphere over Multan, which lies at the verge of low and mid latitude, is affected by both E × B drifts and thermospheric winds as evident from mid-night peaks and near-sunrise dips in hmF2. The results of the comparison of the observed NmF2 and hmF2 for the year 2008-2009 with the IRI-2012 (both NmF2 and hmF2) and IRI-2016 (only hmF2) estimates indicate that for NmF2, IRI-2012 with Consultative Committee International Radio (CCIR) option produces values in better agreement with observed data. Whereas, for hmF2, IRI-2016 with both International Union of Radio Science (URSI) and CCIR SHU-2015 options, predicts well for nighttime hours throughout the year. However, the IRI-2012 with CCIR option produces better agreement with data during daytime hours. Furthermore, IRI-2012 with CCIR option gives better results during Equinox months, whereas, IRI-2016 with both URSI and CCIR SHU-2015 options predict well for Winter and Summer.

  7. Propaganda e crítica social nas cronologias dos almanaques astrológicos durante a Guerra Civil inglesa no século XVII Propaganda and social criticism in the chronologies of the astrological almanacs during the English Civil War in 17 th century

    Directory of Open Access Journals (Sweden)

    Juliana Mesquita Hidalgo Ferreira

    2007-12-01

    Full Text Available Este artigo é parte de uma ampla investigação sobre a utilização dos almanaques astrológicos durante a Guerra Civil inglesa no século XVII como veículo de propaganda e crítica social. Durante esse conflito, havia astrólogos partidários das forças parlamentaristas, como John Booker, e outros partidários das forças realistas, como George Wharton. O presente trabalho analisa algumas dessas publicações, mostrando como o envolvimento político dos autores se manifestava de forma explícita (e, algumas vezes, não tão direta nos referidos almanaques.This article is part of an extensive investigation carried out concerning the use of astrological almanacs during the English Civil War in the 17th century as a medium for propaganda and social criticism. During that conflict there were astrologers who were partisans of the Parliament, such as John Booker, and other who supported the King, such as George Wharton. This work analyses some of those publications, showing that the political commitment of the authors was noticeable in an explicit form (and sometimes in an indirect way in those almanacs.

  8. Cranial MR imaging and cerebral 99mTc HM-PAO-SPECT in patients with subacute or chronic severe closed head injury and normal CT examinations

    International Nuclear Information System (INIS)

    Prayer, L.; Wimberger, D.; Oder, W.; Kramer, J.; Schindler, E.; Podreka, I.; Imhof, H.

    1993-01-01

    Eighteen patients in the subacute or chronic state following severe closed head injury with normal cranial CT scans were examined by MR and 99m Tc HM-PAO SPECT. Correlations were sought between these 2 imaging modalities and the clinical outcome, as defined by the Glasgow Outcome Scale (GOX) score. Both MR and SPECT revealed cerebral damage in all patients examined but structural and functional alterations did not coincide topographically in 64.9% of lesions. Nevertheless, complementary injury patterns suggesting poor recovery were found; cortical contusions and diffuse axonal injury (MR) in conjunction with cortical and thalamic hypoperfusion (SPECT) were noticed in 8 out of 12 patients with unfavorable outcome (GOS = III and IV). The synthesis of MR and SPECT information clearly enhanced the ability both to accurately assess posttraumatic brain damage and to improve patients' outcome prediction. (au) (18 refs.)

  9. Cranial MR imaging and cerebral 99mTc HM-PAO-SPECT in patients with subacute or chronic severe closed head injury and normal CT examinations

    International Nuclear Information System (INIS)

    Prayer, L.; Wimberger, D.; Oder, W.; Kramer, J.; Schindler, E.; Podreka, I.; Imhof, H.

    1993-01-01

    Eighteen patients in the subacute or chronic state following severe closed head injury with normal cranial CT scans were examined by MR and 99m Tc HM-PAO SPECT. Correlations were sought between these 2 imaging modalities and the clinical outcome, as defined by the Glasgow Outcome Scale (GOS) score. Both MR and SPECT revealed cerebral damage in all patients examined but structural and functional alterations did not coincide topographically in 64.9% of lesions. Nevertheless, complementary injury patterns suggesting poor recovery were found; cortical contusions and diffuse axonal injury (MR) in conjunction with cortical and thalamic hypoperfusion (SPECT) were noticed in 8 out of 12 patients with unfavorable outcome (GOS=III and IV). The synthesis of MR and SPECT information clearly enhanced the ability both to accurately assess posttraumatic brain damage and to improve patients' outcome prediction. (orig.)

  10. On the thermal conductivity of UO2 nuclear fuel at a high burn-up of around 100 MWd/kgHM

    International Nuclear Information System (INIS)

    Walker, C.T.; Staicu, D.; Sheindlin, M.; Papaioannou, D.; Goll, W.; Sontheimer, F.

    2006-01-01

    A study of the thermal conductivity of a commercial PWR fuel with an average pellet burn-up of 102 MWd/kgHM is described. The thermal conductivity data reported were derived from the thermal diffusivity measured by the laser flash method. The factors determining the fuel thermal conductivity at high burn-up were elucidated by investigating the recovery that occurred during thermal annealing. It was found that the thermal conductivity in the outer region of the fuel was much higher than it would have been if the high burn-up structure were not present. The increase in thermal conductivity is a consequence of the removal of fission products and radiation defects from the fuel lattice during recrystallisation of the fuel grains (an integral part of the formation process of the high burn-up structure). The gas porosity in the high burn-up structure lowers the increase in thermal conductivity caused by recrystallisation

  11. Cranial MR imaging and cerebral [sup 99m]Tc HM-PAO-SPECT in patients with subacute or chronic severe closed head injury and normal CT examinations

    Energy Technology Data Exchange (ETDEWEB)

    Prayer, L.; Wimberger, D.; Oder, W.; Kramer, J.; Schindler, E.; Podreka, I.; Imhof, H.

    1993-11-01

    Eighteen patients in the subacute or chronic state following severe closed head injury with normal cranial CT scans were examined by MR and [sup 99m]Tc HM-PAO SPECT. Correlations were sought between these 2 imaging modalities and the clinical outcome, as defined by the Glasgow Outcome Scale (GOX) score. Both MR and SPECT revealed cerebral damage in all patients examined but structural and functional alterations did not coincide topographically in 64.9% of lesions. Nevertheless, complementary injury patterns suggesting poor recovery were found; cortical contusions and diffuse axonal injury (MR) in conjunction with cortical and thalamic hypoperfusion (SPECT) were noticed in 8 out of 12 patients with unfavorable outcome (GOS = III and IV). The synthesis of MR and SPECT information clearly enhanced the ability both to accurately assess posttraumatic brain damage and to improve patients' outcome prediction. (au) (18 refs.).

  12. Fission gas release behaviour of a 103 GWd/t{sub HM} fuel disc during a 1200 °C annealing test

    Energy Technology Data Exchange (ETDEWEB)

    Noirot, J., E-mail: jean.noirot@cea.fr [CEA, DEN, DEC, Cadarache, F-13108 St. Paul Lez Durance (France); Pontillon, Y. [CEA, DEN, DEC, Cadarache, F-13108 St. Paul Lez Durance (France); Yagnik, S. [EPRI, P.O. Box 10412, Palo Alto, CA 94303-0813 (United States); Turnbull, J.A. [Independent Consultant (United Kingdom); Tverberg, T. [IFE, P.O. Box 173, NO-1751 Halden (Norway)

    2014-03-15

    Within the Nuclear Fuel Industry Research (NFIR) program, several fuel variants, in the form of thin circular discs, were irradiated in the Halden Boiling Water Reactor (HBWR) to a range of burn-ups ∼100 GWd/t{sub HM}. The design of the assembly was similar to that used in other HBWR programs: the assembly contained several rods with fuel discs sandwiched between Mo discs, which limited temperature gradients within the fuel discs. One such rod contained standard grain UO{sub 2} discs (3D grain size = 18 μm) reaching a burn-up of 103 GWd/t{sub HM}. After the irradiation, the gas release upon rod puncturing was measured to be 2.9%. Detailed characterizations of one of these irradiated UO{sub 2} discs, using electron probe microanalysis (EPMA), scanning electron microscopy (SEM) and secondary ion mass spectrometry (SIMS), were performed in a CEA Cadarache hot laboratory. Examination revealed the high burn-up structure (HBS) formation throughout the whole of the disc, also the fission gas distribution within this HBS, with a very high proportion of the gas in the HBS bubbles. A sibling disc was submitted to a temperature transient up to 1200 °C in the out-of-pile (OOP) annealing test device “Merarg” at a relatively low temperature ramp rate (0.2 °C/s). In addition to the total gas release during this annealing test, the release peaks throughout the temperature range were monitored. The fuel was then characterized with the same microanalysis techniques as before the annealing test to investigate the effects of this test on the microstructure of the fuel and on the fission gases. It provided valuable insights into fission gas localization and the release behaviour in UO{sub 2} fuel with high burn-up structure (HBS)

  13. Efficacy of second generation lithotriptors: a multicenter comparative study of 2,206 extracorporeal shock wave lithotripsy treatments with the Siemens Lithostar, Dornier HM4, Wolf Piezolith 2300, Direx Tripter X-1 and Breakstone lithotriptors

    NARCIS (Netherlands)

    Bierkens, A. F.; Hendrikx, A. J.; de Kort, V. J.; de Reyke, T.; Bruynen, C. A.; Bouve, E. R.; Beek, T. V.; Vos, P.; Berkel, H. V.

    1992-01-01

    Extracorporeal shock wave lithotripsy (ESWL) has become the treatment of choice for urinary calculi. The good results of the first generation Dornier HM3 lithotriptor stimulated the development of second generation machines. A multicenter trial is presented involving the Siemens Lithostar, Dornier

  14. Review of the Contribution of the Scottish Science Centres Network to Formal and Informal Science Education: Report of Follow-Through Visits by HM Inspectorate of Education--June 2009

    Science.gov (United States)

    Her Majesty's Inspectorate of Education, 2009

    2009-01-01

    In 2006, the Scottish Executive's Enterprise, Transport and Lifelong Learning Department (SEETLLD) asked HM Inspectorate of Education (HMIE) to carry out a review of the four Scottish science centres--Glasgow Science Centre (GSC), Our Dynamic Earth (ODE) in Edinburgh, Satrosphere Science Centre in Aberdeen, and Sensation Science Centre in Dundee.…

  15. Perfil bioquímico do soro de frangos de corte alimentados com dieta suplementada com alfa-amilase de Cryptococcus flavus e Aspergillus niger HM2003 Biochemichal serum profile of broilers fed diets suplemented with alfa-amylase from Cryptococcus flavus and Aspergillus niger HM2003

    Directory of Open Access Journals (Sweden)

    Cibele Silva Minafra

    2010-12-01

    Full Text Available Avaliou-se o perfil bioquímico do soro de frangos de corte alimentados com a enzima α-amilase produzida por dois microrganismos. Produziram-se dois extratos, um com a-amilase obtida a partir de Cryptococcus flavus em meio de levedura comercial e outro com Aspergillus niger HM2003 em meio de proteína de soja e amido comercial, com atividade de 9,58 U/mL e 10,0 U/mL, respectivamente. Utilizaram-se 360 pintos de corte Cobb 500 de 1 dia de idade e com 49,72 ± 0,68 g de peso vivo inicial. As aves foram alojadas em baterias e foram criadas até os 21 dias de idade. Foram utilizados três dietas, cada uma com cinco repetições de 12 aves, em delineamento inteiramente casualizado. A primeira dieta (basal foi formulada sem adição de enzima e as outras duas receberam a suplementação de a-amilase produzida por cultivo de Cryptococcus flavus e Aspergillus niger HM2003. Dietas à base de milho e soja foram formuladas em duas fases: pré-inicial (1-7 dias e inicial (8-21 dias. Na fase pré-inicial, foram observados os seguintes valores médios para cálcio (6,90 e 5,99 mg/dL, proteína plasmática (2,0 e 2,50 g/dL e fosfatase alcalina (979,98 e 974,66 UI/L, respectivamente para Cryptococcus flavus e Aspergillus niger HM2003. A dieta acrescida de a-amilase obtida a partir de Aspergillus niger HM2003 determinou maior concentração sérica de fósforo. Na fase inicial, os resultados significativos relacionaram-se a potássio quando avaliadas dietas com adição de a-amilase pelas duas fontes. A incorporação das enzimas testadas não proporciona alterações metabólicas ou toxicidade nos animais.It was evaluated the biochemical serum profile of broilers fed rations supplemented with α-amylase produced by two microorganisms. Two extracts were produced, one was produced with a-amylase obtained from Cryptococcus flavus in a commercial yeast-based medium and the other with Aspergillus niger HM2003 produced in soybean protein and commercial starch medium

  16. Improved regional-scale groundwater representation by the coupling of the mesoscale Hydrologic Model (mHM v5.7) to the groundwater model OpenGeoSys (OGS)

    Science.gov (United States)

    Jing, Miao; Heße, Falk; Kumar, Rohini; Wang, Wenqing; Fischer, Thomas; Walther, Marc; Zink, Matthias; Zech, Alraune; Samaniego, Luis; Kolditz, Olaf; Attinger, Sabine

    2018-06-01

    Most large-scale hydrologic models fall short in reproducing groundwater head dynamics and simulating transport process due to their oversimplified representation of groundwater flow. In this study, we aim to extend the applicability of the mesoscale Hydrologic Model (mHM v5.7) to subsurface hydrology by coupling it with the porous media simulator OpenGeoSys (OGS). The two models are one-way coupled through model interfaces GIS2FEM and RIV2FEM, by which the grid-based fluxes of groundwater recharge and the river-groundwater exchange generated by mHM are converted to fixed-flux boundary conditions of the groundwater model OGS. Specifically, the grid-based vertical reservoirs in mHM are completely preserved for the estimation of land-surface fluxes, while OGS acts as a plug-in to the original mHM modeling framework for groundwater flow and transport modeling. The applicability of the coupled model (mHM-OGS v1.0) is evaluated by a case study in the central European mesoscale river basin - Nägelstedt. Different time steps, i.e., daily in mHM and monthly in OGS, are used to account for fast surface flow and slow groundwater flow. Model calibration is conducted following a two-step procedure using discharge for mHM and long-term mean of groundwater head measurements for OGS. Based on the model summary statistics, namely the Nash-Sutcliffe model efficiency (NSE), the mean absolute error (MAE), and the interquartile range error (QRE), the coupled model is able to satisfactorily represent the dynamics of discharge and groundwater heads at several locations across the study basin. Our exemplary calculations show that the one-way coupled model can take advantage of the spatially explicit modeling capabilities of surface and groundwater hydrologic models and provide an adequate representation of the spatiotemporal behaviors of groundwater storage and heads, thus making it a valuable tool for addressing water resources and management problems.

  17. Modification of the Assessment of Life Habits (LIFE-Hm) to consider personalized satisfaction with participation in activities and roles: results from a construct validity study with older adults.

    Science.gov (United States)

    Roy-Bouthot, Kathleen; Filiatrault, Patrick; Caron, Cyndi; Gagnon, Maxime; Prémont, Stéphanie; Levasseur, Mélanie

    2014-01-01

    Participation, defined as a person's involvement in activities and roles, is a primary intervention goal in rehabilitation. To achieve client-centered practice, rehabilitation professionals need to go beyond objective accomplishment criteria and consider satisfaction with and the importance of participation in activities and roles. To our knowledge, no instrument considers accomplishment, satisfaction and importance of activities and roles, and allows numerical scoring and comparison. The objectives of this study were to modify the Assessment of Life Habits questionnaire (LIFE-Hm) to consider personalized satisfaction (satisfaction weighted by importance) with participation in activities and roles, and to: (1) examine its convergent validity with quality of life (QOL) and (2) compare the associations between QOL on the one hand and, satisfaction (LIFE-H) and personalized satisfaction (LIFE-Hm) with participation on the other. A descriptive cross-sectional study was conducted with 84 older adults, average age 76 years, with different functional autonomy levels. Quality of life was associated with personalized satisfaction for all categories of activities and roles (r = 0.45 to 0.75; p study found good construct validity of the LIFE-Hm with QOL. Personalization can add value in achieving client-centered practice. Implications for Rehabilitation The LIFE-Hm becomes the first instrument available in English and French that allows comparison between individuals and informs rehabilitation professionals about the level of accomplishment, satisfaction and personalized satisfaction with participation in activities and roles. Personalized satisfaction can add value in achieving client-centered practice as it considers not only how satisfying activities and roles are for the person, but also the importance that these activities and roles have for her/him. The LIFE-Hm offers the advantage of systematically identifying activities and roles which are not satisfactory but

  18. NmF2 and hmF2 measurements at 95° E and 127° E around the EIA northern crest during 2010-2014

    Science.gov (United States)

    Kalita, Bitap Raj; Bhuyan, Pradip Kumar; Yoshikawa, Akimasa

    2015-11-01

    The characteristics of the F2 layer parameters NmF2 and hmF2 over Dibrugarh (27.5° N, 95° E, 17° N geomagnetic, 43° dip) measured by a Canadian Advanced Digital Ionosonde (CADI) for the period of August 2010 to July 2014 are reported for the first time from this low mid-latitude station lying within the daytime peak of the longitudinal wave number 4 structure of equatorial anomaly (EIA) around the northern edge of anomaly crest. Equinoctial asymmetry is clearly observed at all solar activity levels whereas the midday winter anomaly is observed only during high solar activity years and disappears during the temporary dip in solar activity in 2013 but forenoon winter anomaly can be observed even at moderate solar activity. The NmF2/hmF2 variations over Dibrugarh are compared with that of Okinawa (26.5° N, 127° E, 17° N geomagnetic), and the eastward propagation speed of the wave number 4 longitudinal structure from 95° E to 127° E is estimated. The speed is found to be close to the theoretical speed of the wave number 4 (WN4) structure. The correlation of daily NmF2 over Dibrugarh and Okinawa with solar activity exhibits diurnal and seasonal variations. The highest correlation in daytime is observed during the forenoon hours in equinox. The correlation of daily NmF2 (linear or non-linear) with solar activity exhibits diurnal variation. A tendency for amplification with solar activity is observed in the forenoon and late evening period of March equinox and the postsunset period of December solstice. NmF2 saturation effect is observed only in the midday period of equinox. Non-linear variation of neutral composition at higher altitudes and variation of recombination rates with solar activity via temperature dependence may be related to the non-linear trend. The noon time maximum NmF2 over Dibrugarh exhibits better correlation with equatorial electrojet (EEJ) than with solar activity and, therefore, new low-latitude NmF2 index is proposed taking both solar

  19. Progress in the technology of nautical charting

    Digital Repository Service at National Institute of Oceanography (India)

    Joseph, A.

    This article describes the various methodologies used from time to time for portraying the geographical details of the earth's surface pertaining to the seas, coastal areas, and features of the seabed for general marine applications. For a long time...

  20. Nautical Publication Information Areas - USACE IENC

    Data.gov (United States)

    Department of Homeland Security — These inland electronic Navigational charts (IENCs) were developed from available data used in maintenance of Navigation channels. Users of these IENCs should be...

  1. Novel elastic, lattice dynamics and thermodynamic properties of metallic single-layer transition metal phosphides: 2H-M 2P (Mo2P, W2P, Nb2P and Ta2P)

    Science.gov (United States)

    Yin, Jiuren; Wu, Bozhao; Wang, Yanggang; Li, Zhimi; Yao, Yuanpeng; Jiang, Yong; Ding, Yanhuai; Xu, Fu; Zhang, Ping

    2018-04-01

    Recently, there has been a surge of interest in the research of two-dimensional (2D) phosphides due to their unique physical properties and wide applications. Transition metal phosphides 2H-M 2Ps (Mo2P, W2P, Nb2P and Ta2P) show considerable catalytic activity and energy storage potential. However, the electronic structure and mechanical properties of 2D 2H-M 2Ps are still unrevealed. Here, first-principles calculations are employed to investigate the lattice dynamics, elasticity and thermodynamic properties of 2H-M 2Ps. Results show that M 2Ps with lower stiffness exhibit remarkable lateral deformation under unidirectional loads. Due to the largest average Grüneisen parameter, single-layer Nb2P has the strongest anharmonic vibrations, resulting in the highest thermal expansion coefficient. The lattice thermal conductivities of Ta2P, W2P and Nb2P contradict classical theory, which would predict a smaller thermal conductivity due to the much heavier atom mass. Moreover, the calculations also demonstrate that the thermal conductivity of Ta2P is the highest as well as the lowest thermal expansion, owing to its weak anharmonic phonon scattering and the lowest average Grüneisen parameter. The insight provided by this study may be useful for future experimental and theoretical studies concerning 2D transition metal phosphide materials.

  2. Simulación con Monte Carlo para dosimetría de 153Samario-HM en un modelo anatómico geométrico de rodilla humana

    Directory of Open Access Journals (Sweden)

    Hardy Pérez Alberto Ernesto

    2010-01-01

    Full Text Available El 153Sm-hm es una nueva opción para realizar sinovectomía por radiación, que actualmente se encuentra en valoración. Este trabajo tiene como objetivo calcular la dosis absorbida en tejidos articulares proporcionada por la administración de 153Sm-hm intraarticular, utilizando la simulación de Monte Carlo, en una propuesta de un modelo simplificado anatómico geométrico de la articulación de la rodilla. Esto con el propósito de aportar datos que apoyen la administración segura y eficaz del radiofármaco en estudio a pacientes con enfermedad reumática de la articulación de la rodilla. Se concluye que la actividad administrada de 153Sm-hm por vía intra-articular es de 370 MBq para conseguir una dosis absorbida en membrana sinovial de 110 Gy, considerada como la dosis de ablación de la mencionada membrana.

  3. Eckert, Wallace John (1902-71)

    Science.gov (United States)

    Murdin, P.

    2000-11-01

    Computer scientist and astronomer. Born in Pittsburgh, PA, Eckert was a pioneer of the use of IBM punched card equipment for astronomical calculations. As director of the US Nautical Almanac Office he introduced computer methods to calculate and print tables instead of relying on human `computers'. When, later, he became director of the Watson Scientific Computing Laboratory at Columbia Universit...

  4. La calidad percibida de los servicios deportivos: diferencias según instalación, género, edad y tipo de usuario en servicios náuticos. (The perception of service quality in sport services: differences according to sport facility, gender, age and user type in nautical services.

    Directory of Open Access Journals (Sweden)

    Javier Mundina Gómez

    2008-01-01

    Full Text Available ResumenEn el ámbito de la gestión deportiva, la calidad de los servicios deportivos y la satisfacción de los usuarios es un área de gran desarrollo. Este trabajo pretende determinar el grado de calidad percibida en unos servicios deportivos de carácter público como son unas escuelas de actividades náuticas. Para ello se analizaron 2375usuarios de estas escuelas que contestaron un cuestionario sobre calidad de servicio percibida y satisfacción con el servicio recibido. La escala de calidad percibida utilizada determinó diez dimensiones de calidad: las clases, el tiempo libre, el entorno náutico, los horarios, la comida, el material náutico, la comida completaría, la conserjería, la limpieza y la teoría. Las dimensiones mejor valoradas fueron las clases, el tiempo libre y el material náutico. Las peor valoradas fueron la comida complementaria y el entorno náutico. Se observan diferencias en la valoración en función del género, la edad, la instalación y el nivel de implicación del usuario.AbstractThe quality of sports services and user satisfaction is a developing area in the field of Sports Management. This paper intends to determine the degree of perceived quality in public sports services such as those provided on nautical schools. An analysis was carried out in which 2,375 users of these schools completed a questionnaire about perceived service quality and satisfaction. The perceived quality scale used determined ten quality dimensions: lessons, spare time, nautical environment, timetables, main meals, nautical equipment, complementary meals, reception services, cleanliness and theory lessons. The dimensions with higher scores were lessons, spare time and nautical equipment. Complementary meals and nautical environment registered the lowest scores. Scoring differences were found according to gender, age, sport facility and the kind of involvement of the user.

  5. Single photon emission computed tomography with [[sup 99]Tc]-HM-PAO and [[sup 123]I]-IBZM in Alzheimer's disease and dementia of frontal type; Preliminary results

    Energy Technology Data Exchange (ETDEWEB)

    Frisoni, G.B.; Bianchetti, A.; Trabucchi, M. (Alzheimer' s Disease Care Unit, Ist. S. Cuore-FBF, Brescia (Italy)); Pizzolato, G.; Battistin, L. (Neurology Clinic, University Padua, Padua (Italy)); Chierichetti, F.; Ferlin, G. (Nuclear Medicine, Castelfranco Veneto Hospital, Treviso (Italy))

    1994-03-01

    Dementia of frontal type (DFT) is a fairly common degenerative disease distinct from Alzheimer's disease (AD), whose reportedly distinctive instrumental feature is frontal lobe hypoperfusion on SPECT. We evaluated the cortical dopaminergic system in 6AD, 5 DFT, and 6 control subjects with SPECT and both [[sup 99]Tc]-HM-PAO, a perfusion tracer, and [[sup 123]I]-IBZM, a D2 postsynaptic ligand. Both in AD and DFT patients, [[sup 99]Tc]-HM-PAO SPECT showed a relative frontal hypoperfusion. On the contrary, [[sup 123]I]-IBZM SPECT showed significantly reduced ligand uptake in superior frontal regions of DFT (0.89 [+-] 0.08 relative to control subjects) as compared to AD patients (0.97 [+-] 0.02; difference of means: 0.08, 95% confidence Interval 0.004 to 0.156; p = 0.041). Results suggest more marked involvement of the frontal cortical dopaminergic system in DFT than in AD patients. (au) (24 refs.).

  6. UO2 fuel behaviour at rod burn-ups up to 105 MWd/kgHM. A review of 10 years of high burn-up examinations commissioned by AREVA NP

    International Nuclear Information System (INIS)

    Goll, W.; Hoffmann, P.B.; Hellwig, C.; Sauser, W.; Spino, J.; Walker, C.T.

    2007-01-01

    Irradiation experience gained on fuel rods with burn-ups greater than 60 MWd/kgHM irradiated in the Nuclear Power Plant Goesgen, Switzerland, is described. Emphasis is placed on the fuel behaviour, which has been analysed by hot cell examinations at the Institute for Transuranium Elements and the Paul-Scherrer-Institute. Above 60 MWd/kgHM, the so-called high burn-up structure (HBS) forms and the fission gas release increases with burn-up and rod power. Examinations performed in the outer region of the fuel revealed that most if not all of the fission gas created was retained in the HBS, even at 25% porosity. Furthermore, the HBS has a relatively low swelling rate, greatly increased plasticity, and its thermal conductivity is higher than expected from the porosity. The post-irradiation examinations showed that the HBS has no detrimental effects on the performance of stationary irradiated PWR fuel irradiated to the high burn-ups that can be achieved with 5 wt% U-235 enrichment. On the contrary, the HBS results in fuel performance that is generally better than it would have been if the HBS had not formed. (orig.)

  7. 78 FR 65453 - Hazardous Materials: Corrections and Response to Administrative Appeals (HM-215K, HM-215L, HM...

    Science.gov (United States)

    2013-10-31

    ... energy storage capacity less than or equal to 10 Wh, provided in special provision of A186 of the ICAO TI... Division 4.1 (Flammable Solid) material for transportation by motor vehicle, rail car, vessel, or cargo... transportation by motor vehicle, rail car, vessel, or cargo-only aircraft, subject to the following conditions...

  8. Eesti Kunstnikkude Rühm / Reet Mark

    Index Scriptorium Estoniae

    Mark, Reet, 1965-

    2010-01-01

    Kubism enne rühma. Valga-Pensa taustaga sõbrad. Rakvere-Tallinna taustaga sõbrad. EKR kõrgaeg 1924-25. Lahkumised. Tallinlaste kõrghetked. Vaated kunstile. Tegevuse vaibumine pärast 1928. aastat

  9. Electric micro-generation system for nautical applications

    International Nuclear Information System (INIS)

    Giordana, A; Ponzinibbio, P

    2005-01-01

    Application specific requirements are studied in first part of this work.As well possible wind turbines and the switched reluctance generator choice fundaments are analyzed.In a second part, a Savonius helical turbine, switched reluctance generator and control system designs are reviewed. Finally, prototype test results are presented

  10. Almanac of the sustainable development; Almanach du developpement durable

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2006-07-01

    Climatic change, greenhouse gases, energy, water, wastes, natural and industrial risks, poverty, all theses are debated in this book. The politicians, industrialists and experts point of view and concrete recommendations are illustrated by children drawings. (A.L.B.)

  11. Digital Learning Compass: Distance Education State Almanac 2017. Nebraska

    Science.gov (United States)

    Seaman, Julia E.; Seaman, Jeff

    2017-01-01

    This brief report uses data collected under the U.S. Department of Education's National Center for Educational Statistics (NCES) Integrated Postsecondary Education Data System (IPEDS) Fall Enrollment survey to highlight distance education data in the state of Nebraska. The sample for this analysis is comprised of all active, degree-granting…

  12. Digital Learning Compass: Distance Education State Almanac 2017. Massachusetts

    Science.gov (United States)

    Seaman, Julia E.; Seaman, Jeff

    2017-01-01

    This brief report uses data collected under the U.S. Department of Education's National Center for Educational Statistics (NCES) Integrated Postsecondary Education Data System (IPEDS) Fall Enrollment survey to highlight distance education data in the state of Massachusetts. The sample for this analysis is comprised of all active, degree-granting…

  13. Digital Learning Compass: Distance Education State Almanac 2017. Georgia

    Science.gov (United States)

    Seaman, Julia E.; Seaman, Jeff

    2017-01-01

    This brief report uses data collected under the U.S. Department of Education's National Center for Educational Statistics (NCES) Integrated Postsecondary Education Data System (IPEDS) Fall Enrollment survey to highlight distance education data in the state of Georgia. The sample for this analysis is comprised of all active, degree-granting…

  14. Digital Learning Compass: Distance Education State Almanac 2017. Wyoming

    Science.gov (United States)

    Seaman, Julia E.; Seaman, Jeff

    2017-01-01

    This brief report uses data collected under the U.S. Department of Education's National Center for Educational Statistics (NCES) Integrated Postsecondary Education Data System (IPEDS) Fall Enrollment survey to highlight distance education data in the state of Wyoming. The sample for this analysis is comprised of all active, degree-granting…

  15. Digital Learning Compass: Distance Education State Almanac 2017. Tennessee

    Science.gov (United States)

    Seaman, Julia E.; Seaman, Jeff

    2017-01-01

    This brief report uses data collected under the U.S. Department of Education's National Center for Educational Statistics (NCES) Integrated Postsecondary Education Data System (IPEDS) Fall Enrollment survey to highlight distance education data in the state of Tennessee. The sample for this analysis is comprised of all active, degree-granting…

  16. Digital Learning Compass: Distance Education State Almanac 2017. South Carolina

    Science.gov (United States)

    Seaman, Julia E.; Seaman, Jeff

    2017-01-01

    This brief report uses data collected under the U.S. Department of Education's National Center for Educational Statistics (NCES) Integrated Postsecondary Education Data System (IPEDS) Fall Enrollment survey to highlight distance education data in the state of South Carolina. The sample for this analysis is comprised of all active, degree-granting…

  17. Digital Learning Compass: Distance Education State Almanac 2017. New Mexico

    Science.gov (United States)

    Seaman, Julia E.; Seaman, Jeff

    2017-01-01

    This brief report uses data collected under the U.S. Department of Education's National Center for Educational Statistics (NCES) Integrated Postsecondary Education Data System (IPEDS) Fall Enrollment survey to highlight distance education data in the state of New Mexico. The sample for this analysis is comprised of all active, degree-granting…

  18. Digital Learning Compass: Distance Education State Almanac 2017. Oklahoma

    Science.gov (United States)

    Seaman, Julia E.; Seaman, Jeff

    2017-01-01

    This brief report uses data collected under the U.S. Department of Education's National Center for Educational Statistics (NCES) Integrated Postsecondary Education Data System (IPEDS) Fall Enrollment survey to highlight distance education data in the state of Oklahoma. The sample for this analysis is comprised of all active, degree-granting…

  19. Digital Learning Compass: Distance Education State Almanac 2017. Texas

    Science.gov (United States)

    Seaman, Julia E.; Seaman, Jeff

    2017-01-01

    This brief report uses data collected under the U.S. Department of Education's National Center for Educational Statistics (NCES) Integrated Postsecondary Education Data System (IPEDS) Fall Enrollment survey to highlight distance education data in the state of Texas. The sample for this analysis is comprised of all active, degree-granting…

  20. Digital Learning Compass: Distance Education State Almanac 2017. Montana

    Science.gov (United States)

    Seaman, Julia E.; Seaman, Jeff

    2017-01-01

    This brief report uses data collected under the U.S. Department of Education's National Center for Educational Statistics (NCES) Integrated Postsecondary Education Data System (IPEDS) Fall Enrollment survey to highlight distance education data in the state of Montana. The sample for this analysis is comprised of all active, degree-granting…

  1. Digital Learning Compass: Distance Education State Almanac 2017. Kentucky

    Science.gov (United States)

    Seaman, Julia E.; Seaman, Jeff

    2017-01-01

    This brief report uses data collected under the U.S. Department of Education's National Center for Educational Statistics (NCES) Integrated Postsecondary Education Data System (IPEDS) Fall Enrollment survey to highlight distance education data in the state of Kentucky. The sample for this analysis is comprised of all active, degree-granting…

  2. Digital Learning Compass: Distance Education State Almanac 2017. New York

    Science.gov (United States)

    Seaman, Julia E.; Seaman, Jeff

    2017-01-01

    This brief report uses data collected under the U.S. Department of Education's National Center for Educational Statistics (NCES) Integrated Postsecondary Education Data System (IPEDS) Fall Enrollment survey to highlight distance education data in the state of New York. The sample for this analysis is comprised of all active, degree-granting…

  3. Digital Learning Compass: Distance Education State Almanac 2017. Vermont

    Science.gov (United States)

    Seaman, Julia E.; Seaman, Jeff

    2017-01-01

    This brief report uses data collected under the U.S. Department of Education's National Center for Educational Statistics (NCES) Integrated Postsecondary Education Data System (IPEDS) Fall Enrollment survey to highlight distance education data in the state of Vermont. The sample for this analysis is comprised of all active, degree-granting…

  4. Digital Learning Compass: Distance Education State Almanac 2017. Illinois

    Science.gov (United States)

    Seaman, Julia E.; Seaman, Jeff

    2017-01-01

    This brief report uses data collected under the U.S. Department of Education's National Center for Educational Statistics (NCES) Integrated Postsecondary Education Data System (IPEDS) Fall Enrollment survey to highlight distance education data in the state of Illinois. The sample for this analysis is comprised of all active, degree-granting…

  5. Digital Learning Compass: Distance Education State Almanac 2017. Virginia

    Science.gov (United States)

    Seaman, Julia E.; Seaman, Jeff

    2017-01-01

    This brief report uses data collected under the U.S. Department of Education's National Center for Educational Statistics (NCES) Integrated Postsecondary Education Data System (IPEDS) Fall Enrollment survey to highlight distance education data in the state of Virginia. The sample for this analysis is comprised of all active, degree-granting…

  6. Digital Learning Compass: Distance Education State Almanac 2017. North Dakota

    Science.gov (United States)

    Seaman, Julia E.; Seaman, Jeff

    2017-01-01

    This brief report uses data collected under the U.S. Department of Education's National Center for Educational Statistics (NCES) Integrated Postsecondary Education Data System (IPEDS) Fall Enrollment survey to highlight distance education data in the state of North Dakota. The sample for this analysis is comprised of all active, degree-granting…

  7. Digital Learning Compass: Distance Education State Almanac 2017. Arkansas

    Science.gov (United States)

    Seaman, Julia E.; Seaman, Jeff

    2017-01-01

    This brief report uses data collected under the U.S. Department of Education's National Center for Educational Statistics (NCES) Integrated Postsecondary Education Data System (IPEDS) Fall Enrollment survey to highlight distance education data in the state of Arkansas . The sample for this analysis is comprised of all active, degree-granting…

  8. Digital Learning Compass: Distance Education State Almanac 2017. Washington

    Science.gov (United States)

    Seaman, Julia E.; Seaman, Jeff

    2017-01-01

    This brief report uses data collected under the U.S. Department of Education's National Center for Educational Statistics (NCES) Integrated Postsecondary Education Data System (IPEDS) Fall Enrollment survey to highlight distance education data in the state of Washington. The sample for this analysis is comprised of all active, degree-granting…

  9. Digital Learning Compass: Distance Education State Almanac 2017. Colorado

    Science.gov (United States)

    Seaman, Julia E.; Seaman, Jeff

    2017-01-01

    This brief report uses data collected under the U.S. Department of Education's National Center for Educational Statistics (NCES) Integrated Postsecondary Education Data System (IPEDS) Fall Enrollment survey to highlight distance education data in the state of Colorado. The sample for this analysis is comprised of all active, degree-granting…

  10. Digital Learning Compass: Distance Education State Almanac 2017. Louisiana

    Science.gov (United States)

    Seaman, Julia E.; Seaman, Jeff

    2017-01-01

    This brief report uses data collected under the U.S. Department of Education's National Center for Educational Statistics (NCES) Integrated Postsecondary Education Data System (IPEDS) Fall Enrollment survey to highlight distance education data in the state of Louisiana. The sample for this analysis is comprised of all active, degree-granting…

  11. Digital Learning Compass: Distance Education State Almanac 2017. West Virginia

    Science.gov (United States)

    Seaman, Julia E.; Seaman, Jeff

    2017-01-01

    This brief report uses data collected under the U.S. Department of Education's National Center for Educational Statistics (NCES) Integrated Postsecondary Education Data System (IPEDS) Fall Enrollment survey to highlight distance education data in the state of West Virginia. The sample for this analysis is comprised of all active, degree-granting…

  12. Digital Learning Compass: Distance Education State Almanac 2017. Oregon

    Science.gov (United States)

    Seaman, Julia E.; Seaman, Jeff

    2017-01-01

    This brief report uses data collected under the U.S. Department of Education's National Center for Educational Statistics (NCES) Integrated Postsecondary Education Data System (IPEDS) Fall Enrollment survey to highlight distance education data in the state of Oregon. The sample for this analysis is comprised of all active, degree-granting…

  13. Digital Learning Compass: Distance Education State Almanac 2017. Pennsylvania

    Science.gov (United States)

    Seaman, Julia E.; Seaman, Jeff

    2017-01-01

    This brief report uses data collected under the U.S. Department of Education's National Center for Educational Statistics (NCES) Integrated Postsecondary Education Data System (IPEDS) Fall Enrollment survey to highlight distance education data in the state of Pennsylvania. The sample for this analysis is comprised of all active, degree-granting…

  14. Digital Learning Compass: Distance Education State Almanac 2017. Maryland

    Science.gov (United States)

    Seaman, Julia E.; Seaman, Jeff

    2017-01-01

    This brief report uses data collected under the U.S. Department of Education's National Center for Educational Statistics (NCES) Integrated Postsecondary Education Data System (IPEDS) Fall Enrollment survey to highlight distance education data in the state of Maryland. The sample for this analysis is comprised of all active, degree-granting…

  15. Digital Learning Compass: Distance Education State Almanac 2017. Alabama

    Science.gov (United States)

    Seaman, Julia E.; Seaman, Jeff

    2017-01-01

    This brief report uses data collected under the U.S. Department of Education's National Center for Educational Statistics (NCES) Integrated Postsecondary Education Data System (IPEDS) Fall Enrollment survey to highlight distance education data in the state of Alabama. The sample for this analysis is comprised of all active, degree-granting…

  16. Digital Learning Compass: Distance Education State Almanac 2017. Indiana

    Science.gov (United States)

    Seaman, Julia E.; Seaman, Jeff

    2017-01-01

    This brief report uses data collected under the U.S. Department of Education's National Center for Educational Statistics (NCES) Integrated Postsecondary Education Data System (IPEDS) Fall Enrollment survey to highlight distance education data in the state of Indiana. The sample for this analysis is comprised of all active, degree-granting…

  17. Digital Learning Compass: Distance Education State Almanac 2017. Mississippi

    Science.gov (United States)

    Seaman, Julia E.; Seaman, Jeff

    2017-01-01

    This brief report uses data collected under the U.S. Department of Education's National Center for Educational Statistics (NCES) Integrated Postsecondary Education Data System (IPEDS) Fall Enrollment survey to highlight distance education data in the state of Mississippi. The sample for this analysis is comprised of all active, degree-granting…

  18. Digital Learning Compass: Distance Education State Almanac 2017. California

    Science.gov (United States)

    Seaman, Julia A.; Seaman, Jeff

    2017-01-01

    This brief report uses data collected under the U.S. Department of Education's National Center for Educational Statistics (NCES) Integrated Postsecondary Education Data System (IPEDS) Fall Enrollment survey to highlight distance education data in the state of California. The sample for this analysis is comprised of all active, degree-granting…

  19. Digital Learning Compass: Distance Education State Almanac 2017. Ohio

    Science.gov (United States)

    Seaman, Julia E.; Seaman, Jeff

    2017-01-01

    This brief report uses data collected under the U.S. Department of Education's National Center for Educational Statistics (NCES) Integrated Postsecondary Education Data System (IPEDS) Fall Enrollment survey to highlight distance education data in the state of Ohio. The sample for this analysis is comprised of all active, degree-granting…

  20. Digital Learning Compass: Distance Education State Almanac 2017. New Jersey

    Science.gov (United States)

    Seaman, Julia E.; Seaman, Jeff

    2017-01-01

    This brief report uses data collected under the U.S. Department of Education's National Center for Educational Statistics (NCES) Integrated Postsecondary Education Data System (IPEDS) Fall Enrollment survey to highlight distance education data in the state of New Jersey. The sample for this analysis is comprised of all active, degree-granting…

  1. Digital Learning Compass: Distance Education State Almanac 2017. Minnesota

    Science.gov (United States)

    Seaman, Julia E.; Seaman, Jeff

    2017-01-01

    This brief report uses data collected under the U.S. Department of Education's National Center for Educational Statistics (NCES) Integrated Postsecondary Education Data System (IPEDS) Fall Enrollment survey to highlight distance education data in the state of Minnesota. The sample for this analysis is comprised of all active, degree-granting…

  2. Digital Learning Compass: Distance Education State Almanac 2017. New Hampshire

    Science.gov (United States)

    Seaman, Julia E.; Seaman, Jeff

    2017-01-01

    This brief report uses data collected under the U.S. Department of Education's National Center for Educational Statistics (NCES) Integrated Postsecondary Education Data System (IPEDS) Fall Enrollment survey to highlight distance education data in the state of New Hampshire. The sample for this analysis is comprised of all active, degree-granting…

  3. Digital Learning Compass: Distance Education State Almanac 2017. Florida

    Science.gov (United States)

    Seaman, Julia E.; Seaman, Jeff

    2017-01-01

    This brief report uses data collected under the U.S. Department of Education's National Center for Educational Statistics (NCES) Integrated Postsecondary Education Data System (IPEDS) Fall Enrollment survey to highlight distance education data in the state of Florida. The sample for this analysis is comprised of all active, degree-granting…

  4. Digital Learning Compass: Distance Education State Almanac 2017. Connecticut

    Science.gov (United States)

    Seaman, Julia E.; Seaman, Jeff

    2017-01-01

    This brief report uses data collected under the U.S. Department of Education's National Center for Educational Statistics (NCES) Integrated Postsecondary Education Data System (IPEDS) Fall Enrollment survey to highlight distance education data in the state of Connecticut. The sample for this analysis is comprised of all active, degree-granting…

  5. Digital Learning Compass: Distance Education State Almanac 2017. South Dakota

    Science.gov (United States)

    Seaman, Julia E.; Seaman, Jeff

    2017-01-01

    This brief report uses data collected under the U.S. Department of Education's National Center for Educational Statistics (NCES) Integrated Postsecondary Education Data System (IPEDS) Fall Enrollment survey to highlight distance education data in the state of South Dakota. The sample for this analysis is comprised of all active, degree-granting…

  6. Digital Learning Compass: Distance Education State Almanac 2017. Rhode Island

    Science.gov (United States)

    Seaman, Julia E.; Seaman, Jeff

    2017-01-01

    This brief report uses data collected under the U.S. Department of Education's National Center for Educational Statistics (NCES) Integrated Postsecondary Education Data System (IPEDS) Fall Enrollment survey to highlight distance education data in the state of Rhode Island. The sample for this analysis is comprised of all active, degree-granting…

  7. Digital Learning Compass: Distance Education State Almanac 2017. Maine

    Science.gov (United States)

    Seaman, Julia E.; Seaman, Jeff

    2017-01-01

    This brief report uses data collected under the U.S. Department of Education's National Center for Educational Statistics (NCES) Integrated Postsecondary Education Data System (IPEDS) Fall Enrollment survey to highlight distance education data in the state of Maine. The sample for this analysis is comprised of all active, degree-granting…

  8. Digital Learning Compass: Distance Education State Almanac 2017. North Carolina

    Science.gov (United States)

    Seaman, Julia E.; Seaman, Jeff

    2017-01-01

    This brief report uses data collected under the U.S. Department of Education's National Center for Educational Statistics (NCES) Integrated Postsecondary Education Data System (IPEDS) Fall Enrollment survey to highlight distance education data in the state of North Carolina. The sample for this analysis is comprised of all active, degree-granting…

  9. Digital Learning Compass: Distance Education State Almanac 2017. Iowa

    Science.gov (United States)

    Seaman, Julia E.; Seaman, Jeff

    2017-01-01

    This brief report uses data collected under the U.S. Department of Education's National Center for Educational Statistics (NCES) Integrated Postsecondary Education Data System (IPEDS) Fall Enrollment survey to highlight distance education data in the state of Iowa. The sample for this analysis is comprised of all active, degree-granting…

  10. Digital Learning Compass: Distance Education State Almanac 2017. Hawaii

    Science.gov (United States)

    Seaman, Julia E.; Seaman, Jeff

    2017-01-01

    This brief report uses data collected under the U.S. Department of Education's National Center for Educational Statistics (NCES) Integrated Postsecondary Education Data System (IPEDS) Fall Enrollment survey to highlight distance education data in the state of Hawaii. The sample for this analysis is comprised of all active, degree-granting…

  11. Digital Learning Compass: Distance Education State Almanac 2017. Missouri

    Science.gov (United States)

    Seaman, Julia E.; Seaman, Jeff

    2017-01-01

    This brief report uses data collected under the U.S. Department of Education's National Center for Educational Statistics (NCES) Integrated Postsecondary Education Data System (IPEDS) Fall Enrollment survey to highlight distance education data in the state of Missouri. The sample for this analysis is comprised of all active, degree-granting…

  12. Digital Learning Compass: Distance Education State Almanac 2017. Arizona

    Science.gov (United States)

    Seaman, Julia E.; Seaman, Jeff

    2017-01-01

    This brief report uses data collected under the U.S. Department of Education's National Center for Educational Statistics (NCES) Integrated Postsecondary Education Data System (IPEDS) Fall Enrollment survey to highlight distance education data in the state of Arizona . The sample for this analysis is comprised of all active, degree-granting…

  13. Digital Learning Compass: Distance Education State Almanac 2017. Nevada

    Science.gov (United States)

    Seaman, Julia E.; Seaman, Jeff

    2017-01-01

    This brief report uses data collected under the U.S. Department of Education's National Center for Educational Statistics (NCES) Integrated Postsecondary Education Data System (IPEDS) Fall Enrollment survey to highlight distance education data in the state of Nevada. The sample for this analysis is comprised of all active, degree-granting…

  14. Digital Learning Compass: Distance Education State Almanac 2017. Utah

    Science.gov (United States)

    Seaman, Julia E.; Seaman, Jeff

    2017-01-01

    This brief report uses data collected under the U.S. Department of Education's National Center for Educational Statistics (NCES) Integrated Postsecondary Education Data System (IPEDS) Fall Enrollment survey to highlight distance education data in the state of Utah. The sample for this analysis is comprised of all active, degree-granting…

  15. Digital Learning Compass: Distance Education State Almanac 2017. Alaska

    Science.gov (United States)

    Seaman, Julia E.; Seaman, Jeff

    2017-01-01

    This brief report uses data collected under the U.S. Department of Education's National Center for Educational Statistics (NCES) Integrated Postsecondary Education Data System (IPEDS) Fall Enrollment survey to highlight distance education data in the state of Alaska. The sample for this analysis is comprised of all active, degree-granting…

  16. Digital Learning Compass: Distance Education State Almanac 2017. Michigan

    Science.gov (United States)

    Seaman, Julia E.; Seaman, Jeff

    2017-01-01

    This brief report uses data collected under the U.S. Department of Education's National Center for Educational Statistics (NCES) Integrated Postsecondary Education Data System (IPEDS) Fall Enrollment survey to highlight distance education data in the state of Michigan. The sample for this analysis is comprised of all active, degree-granting…

  17. Digital Learning Compass: Distance Education State Almanac 2017. Idaho

    Science.gov (United States)

    Seaman, Julia E.; Seaman, Jeff

    2017-01-01

    This brief report uses data collected under the U.S. Department of Education's National Center for Educational Statistics (NCES) Integrated Postsecondary Education Data System (IPEDS) Fall Enrollment survey to highlight distance education data in the state of Idaho. The sample for this analysis is comprised of all active, degree-granting…

  18. Digital Learning Compass: Distance Education State Almanac 2017. Wisconsin

    Science.gov (United States)

    Seaman, Julia E.; Seaman, Jeff

    2017-01-01

    This brief report uses data collected under the U.S. Department of Education's National Center for Educational Statistics (NCES) Integrated Postsecondary Education Data System (IPEDS) Fall Enrollment survey to highlight distance education data in the state of Wisconsin. The sample for this analysis is comprised of all active, degree-granting…

  19. Digital Learning Compass: Distance Education State Almanac 2017. Delaware

    Science.gov (United States)

    Seaman, Julia E.; Seaman, Jeff

    2017-01-01

    This brief report uses data collected under the U.S. Department of Education's National Center for Educational Statistics (NCES) Integrated Postsecondary Education Data System (IPEDS) Fall Enrollment survey to highlight distance education data in the state of Delaware. The sample for this analysis is comprised of all active, degree-granting…

  20. Digital Learning Compass: Distance Education State Almanac 2017. Kansas

    Science.gov (United States)

    Seaman, Julia E.; Seaman, Jeff

    2017-01-01

    This brief report uses data collected under the U.S. Department of Education's National Center for Educational Statistics (NCES) Integrated Postsecondary Education Data System (IPEDS) Fall Enrollment survey to highlight distance education data in the state of Kansas. The sample for this analysis is comprised of all active, degree-granting…

  1. H, HM, and THM-C processes in natural barriers

    Energy Technology Data Exchange (ETDEWEB)

    Javeri, V.; Le, T.T.; Cui, Y.J.; Delage, P.; Li, X.J.; Wieczorek, K.; Jockwer, N.; Romero, E.; Lima, A.; Gens, A.; Li, X.L.; Francois, B.; Nuth, M.; Laloui, L.; Chen, W.; Jia, S.; Yu, H.; Wu, G.; Li, X.; Bernier, F.; Tan, X.; Wu, G.; Jia, S.; Giot, R.; Hoxha, D.; Giraud, A.; Homand, F.; Su, K.; Chavant, C.; Duveau, G.; Jia, Y.; Shao, J.F.; Peron, H.; Laloui, L.; Hueckel, T.; Hu, L.B.; Auvray, C.; Lequiller, B.; Cuisinier, O.; Ferber, V.; Cui, Y.J.; Deneele, D.; Uhlig, L.; Jobmann, M.; Polster, M.; Vaunat, J.; Garrite, B.; Wileveau, Y.; Sato, H.; Jacinto, A.; Sanchez, M.; Ledesma, A.; Morel, J.; Balland, C.; Armand, G.; Nguyen Minh, D.; Vales, F.; Pham, Q.T.; Gharbi, H.; Mokni, N.; Olivella, S.; Li, X.; Smets, St.; Valcke, E.; Karnland, O.; Nilsson, U.; Olsson, S.; Sellin, P.; Fernandez, A.M.; Melon, A.M.; Villar, M.V.; Turrero, M.J.; Garitte, B.; Guimaraes, L.D.N.; Gens, A.; Mayor, J.C.; Koliji, A.; Laloui, L.; Vulliet, L.; Hamdi, N.; Marzouki, A.; Srasra, E.; Cuss, R.J.; Harrington, J.F.; Noy, D.J.; Birchall, D.J.; Marschall, P.; Mallet, A.; Ababou, R.; Matray, J.M.; Renaud, V.; Maison, T.; Enachescu, C.; Frieg, B.; Rohs, St.; Paris, B.; Robinet, J.C.; Bui, T.D.; Barnichon, J.D.; Plas, F.; Klubertanz, G.; Folly, M.; Hufschmied, P.; Frank, E

    2007-07-01

    This session gathers 30 articles (posters) dealing with: the three Dimensional analyses of combined gas, heat and nuclide transport in a repository considering coupled thermo-hydro geomechanical processes; the experimental study on the thermo-hydro-mechanical behaviour of boom clay; hydraulic in-situ measurements in the Opalinus clay in the frame of a heater test performed at the Mont Terri URL; the hydro-mechanical behaviour of natural boom clay in controlled-suction tests; a constitutive approach to address the thermal and hydric impacts in the concept of deep radioactive waste repositories; the numerical analysis on stability of boom clay tunnel by shield construction; a thermo-hydro-mechanical model for clay in unsaturated conditions; the 3D modelling of TER experiment accounting for fully anisotropic thermo-poro-elastic behaviour; the hydro-mechanical modeling of shaft excavation in Meuse/Haute-Marne laboratory; the modelling of drying damage in engineered and natural clay barriers for nuclear waste disposal; the elasto-viscoplastic behaviour of Meuse/Haute-Marne argillite: laboratory tests and modelling; the long-term behaviour of a lime treated soil under percolation conditions; the stress redistribution and hydro-mechanical effects due to excavation and drilling operations in TER experiment; a thermodynamic model on swelling of bentonite buffer and backfill materials; the 3D analysis of a heating test in the Opalinus clay; the THM analysis of a 'mock-up' laboratory experiment using a double-structure expansive model; the measurement of the effect of re-confinement on rock properties around a slot; a laboratory Study of desaturation - re-saturation effects on a clay-stone; the deformation induced by dissolution of salts in porous media; the bentonite swelling pressure in pure water and saline solutions; the mineralogy and sealing properties of various bentonites and smectite-rich clay materials; the evaluation of the geochemical processes occurring in the Opalinus clay formation subjected to a ventilation test; a Soil structure considerations in description of compacted and natural clay behaviour; the hydro-mechanical behaviour of Tunisian clayey soil used as discharge site of acidic waste; the Consolidation and rebound properties of Opalinus clay: a long-term, fully-drained test; the multidimensional modeling of a poro-elastic medium: identification of the behaviour of a clay formation from a stochastic representation of piezometric fluctuations; various approaches for the comprehension of the time-dependent behaviour of Callovo-Oxfordian argilite; a new approach of estimating the influence of drilling mud on the borehole pressure history; the thermo-chemical-hydro-mechanical modelling: contributions to the assessment of the long term behaviour of a nuclear waste disposal in a deep clay formation; and the impact of thermal load on the far field and galleries of a repository.

  2. H, HM, and THM-C processes in engineered barriers

    Energy Technology Data Exchange (ETDEWEB)

    Cui, Y.J.; Tang, A.M.; Loiseau, C.; Delage, P.; Polak, M.; Souli, H.; Fleureau, J.M.; Wu, P.L.; Tien, Y.M.; Romero, E.; LI, Xiang Ling; Tanaka, Y.; Hasegawa, T.; Nakamura, K.; Sahara, F.; Murakami, T.; Kobayashi, I.; Mihara, M.; Ohi, T.; Lu, J.D.; Huang, W.H.; Lee, W.Y.; Sui, I.H.; Villar, M.V.; Sanchez, M.; Gens, A.; Samper, J.; Lu, C.; Montenegro, L.; Birgersson, M.; Karnland, O.; Nilsson, U.; Akesson, M.; Kristensson, O.; Gatabin, C.; Yang, C.R.; Huang, W.H.; Hsiao, T.H.; Dueck, A.; Lonnqvist, M.; Goudarzi, R.; Borgesson, L.; Fernandez, A.M.; Rivas, P.; Melon, A.M.; Villar, M.V.; Ferrow, E.; Bender Koch, Ch.; Suzuki, S.; Sazarashi, M.; Takegahara, T.; Takao, H.; Tanai, K.; Matsumoto, K.; Gatabin, C.; Touze, G.; Imbert, C.; Guillot, W.; Billaud, P

    2007-07-01

    This session gathers 24 articles (posters) dealing with: determining water permeability of a compacted bentonite sand mixture under confined and free-swell conditions; the model prediction of engineered barrier system effectiveness in the fracture at laboratory scale; the changes in the hydraulic properties of a smectite in presence of chromium; the wall friction and ejection behaviour of bentonite-base buffer material; the thermo-hydro-mechanical behaviour of a large scale mock-up test 'Ophelie' in Belgium: laboratory characterization and numerical modelling; modeling swelling characteristics and permeability of several compacted bentonite affected by saline water; modelling for the long-term Mechanical and Hydraulic behaviour of bentonite-based materials considering chemical transitions; the coupled thermal-hydro analysis on partially saturated bentonite; the behaviour of a bentonite barrier in the laboratory: experimental results up to 8 years and numerical simulation; a coupled hydrogeochemical calculations of the interactions of corrosion products and bentonite; the freezing in saturated bentonite: a thermodynamic approach; the mechanical modeling of MX-80: Development of constitutive laws; the mechanical modeling of MX-80 - Quick tools for BBM parameter analysis; TBT{sub 3} Mock-up test-experimental and model results; the suction characteristics of two compacted bentonite; the retention curves and volume change properties of unsaturated MX-80 bentonite: a laboratory study; humidity induced swelling and water absorption rate of highly compacted bentonite; unconfined compression tests on bentonite samples exposed to high temperature during long time in the field test lot; the thermophysical properties of bentonite; the geochemistry and mineralogy of a bentonite subjected to heating and hydration in an in-situ test after five years operation; the LOT project, long term test of buffer material at Aespoe: a Moessbauer spectroscopic study; the self-sealing properties of buffer material under saline condition; a study on extrusion behaviour of buffer material into fractures using X-ray Ct method; and the ESDRED Project, module 1: selection and THM characterisation of the buffer material.

  3. 5. H.M. Majeed Reincarnation, Predestination and Moral ...

    African Journals Online (AJOL)

    REGINALDS

    The article also reveals some serious philosophical difficulties which this Akan conception of moral ... life are believed to be determined or fixed in advance. ... 1 I do not suggest that Indian philosophy may not have a position similar to this.

  4. UK HSE Training of HM Radiation Specialist Inspectors

    International Nuclear Information System (INIS)

    Nattres, E.; Barrett, J. A.

    2004-01-01

    HSE's mission is to ensure that risks to people's health and safety from work activities are properly controlled. Radiation Specialist Inspectors make an essential contribution to HSE's objectives through the application of their professional skills and knowledge. The role of the Radiation Specialist Inspector includes inspection work in the field to ensure compliance by employers with the Health and Safety at Work etc Act 1974, Ionising Radiations Regulations 1999 and associated legislation. They also contribute to research, and the development of technical policy, legislation, standards, and guidance on protection against the possible harm from exposure to electromagnetic fields, optical or ionizing radiation. This paper explains how Radiation Specialist Inspectors are trained. It starts with the recruitment process, with an emphasis on recruiting people who have already gained relevant experience from radiation work practices in previous employments. The interview process is explored, which includes both technical and behavioural interviews, making a presentation and completing a personality questionnaire. The initial twelve months training is then discussed in detail, including the six months as a general Health and Safety Inspector where inspector' skills and techniques' are developed by practical involvement in inspection, followed by a challenging six months with a Radiation Specialist group. The programme for this period is designed to broaden and develop skills and knowledge within the radiation protection specialist. After the initial twelve months probationary period, new Inspectors are expected to confirm and establish themselves in their role of Radiation Specialist Inspectors. However, it does not end there, continuing professional development to ensure that Inspectors have cutting edge knowledge of the latest advances within the radiation field and health and safety as a whole is essential and will be discussed in more detail. (Author) 6 refs

  5. Effectiveness of radiation control program for Dornier HM3 lithotriptor

    International Nuclear Information System (INIS)

    Griffith, D.P.; Gleeson, M.J.; Politis, G.; Glaze, S.

    1989-01-01

    Radiation exposure during extracorporeal shock-wave lithotripsy (ESWL) was calculated using a worst-case method in 135 randomly selected patients. The patients were divided into four groups according to body weight: small (less than 140 pounds), medium (141-180 pounds), large (181-220 pounds), and very large (greater than 220 pounds). Average skin exposure was found to be 15.2 R (from 1.2 to 95.6 R). After implementation of a radiation awareness program radiation exposure was calculated in 128 cases (matched for body weight and stone burden) and average exposure was 9.5 R (from 0.9 to 33.4 R) with a reduction of 20, 37, 33, and 62 percent for each group, respectively. Radiation exposure reduction was primarily due to a reduction in the number of radiographic snapshots taken as a result of preferential use of special-mode fluoroscopic stills. 21 references

  6. Effectiveness of radiation control program for Dornier HM3 lithotriptor

    Energy Technology Data Exchange (ETDEWEB)

    Griffith, D.P.; Gleeson, M.J.; Politis, G.; Glaze, S.

    1989-01-01

    Radiation exposure during extracorporeal shock-wave lithotripsy (ESWL) was calculated using a worst-case method in 135 randomly selected patients. The patients were divided into four groups according to body weight: small (less than 140 pounds), medium (141-180 pounds), large (181-220 pounds), and very large (greater than 220 pounds). Average skin exposure was found to be 15.2 R (from 1.2 to 95.6 R). After implementation of a radiation awareness program radiation exposure was calculated in 128 cases (matched for body weight and stone burden) and average exposure was 9.5 R (from 0.9 to 33.4 R) with a reduction of 20, 37, 33, and 62 percent for each group, respectively. Radiation exposure reduction was primarily due to a reduction in the number of radiographic snapshots taken as a result of preferential use of special-mode fluoroscopic stills. 21 references.

  7. The (Almost) Unseen Total Eclipse of 1831

    Science.gov (United States)

    Bartky, Ian R.

    2008-03-01

    The total eclipse of August 1831 began at sunrise in Australia, swept across the western South Pacific Ocean, and ended at sunset in the central South Pacific. As a result of the eclipse's path over mostly uninhabited ocean, the region's sparse European (British) population, and near-useless local predictions of the event at Hobart and Sydney in almanacs sold to the general public, almost no one witnessed its passage. In an attempt to document the eclipse, journals of naive observers - those having no access to a prediction - were examined. Thus far, the sole record is in the Pitcairn Island Register Book. Considering the Pitcairners' extreme isolation and the rather modest partial eclipse that occurred there, the entry is a surprising one; however, it can be explained in terms of events associated with their initial removal to Tahiti in March 1831 followed by their return home in June. Further, an authoritative means to identify any issues associated with eclipse predictions compiled for private-sector almanacs came in 1833 when sweeping changes in the British Nautical Almanac's section on eclipses were instituted.

  8. Nautical studies for new LPG (Liquefied Petroleum Gases) in Barra do Riacho

    Energy Technology Data Exchange (ETDEWEB)

    Amorim, Anderson B.A.; Biolchini, Luiz C.A. [Petroleo do Brasil S.A. (PETROBRAS), Rio de Janeiro, RJ (Brazil); Antunes, Felippe L. [Petrobras Transporte S/A (TRANSPETRO), Rio de Janeiro, RJ (Brazil); Vieira Neto, Tancredo [Poyry Technology, Sao Paulo, SP (Brazil)

    2009-07-01

    PETROBRAS is developing projects to increase the natural gas production, supply and allow transportation to the market. LPG and natural gasoline produced in Cacimbas (ES) will be transferred through pipelines to under construction Barra do Riacho Terminal, to be stored and loaded on ships. In Barra do Riacho, a municipality of Aracruz on the northern coast of the Espirito Santo state, a pulp specialized terminal already operates. The new PETROBRAS terminal will monthly load about 30,000 t of refrigerated LPG and 90,000 m{sup 3} of natural gasoline through a new pier with two berths. This pier will be able to receive tankers up to 60,000 dwt. With the challenge to safely maneuver and berth vessels of this size in a restricted area with operating facilities, PETROBRAS developed a basic design with the support of contracted companies to evaluate the minimum area needed to assure operation and design the best location, minimizing wave disturbance over the new jetty as well as over the existing above mentioned berths. This paper presents the port issues analyzed during the basic design of the new marine refrigerated LPG terminal to be located at Barra do Riacho Port. (author)

  9. A Quality Assessment of Tourist Information: the Case of Nautical Tourism at Shiretoko Peninsula

    Directory of Open Access Journals (Sweden)

    Bart Neuts

    2014-07-01

    Full Text Available The success of tourism promotion in a destination partially depends on the extent to which it successfully links varied products catering to a heterogeneous group of visitors in a multi-client system. In contemporary destination marketing, communication between the service providers at the destination and the (prospective tourists has become increasingly important as a result of the rise in informal communication channels and social media. This paper focuses on the effect of using different information sources when booking a cruise tour in Shiretoko Peninsula (a natural World Heritage Site by employing a multi-group structural model. Our findings revealed that a mismatch between the expectation created by the visitors based on the information about the site and the satisfaction they experience when visiting the place can be a strong factor of dissatisfaction, with negative implications on the possible recommendations and loyalty. Additionally, it was possible to conclude that information available on the internet and via guidebooks seems to negatively affect satisfaction on certain elements and routes, while local information from tourist offices, hotels and local shops was found less problematic.

  10. Ships in an Artificial Force Field : A Multi-agent System for Nautical Traffic and Safety

    NARCIS (Netherlands)

    Xiao, F.

    2014-01-01

    The main objective of this research is developing a simulation tool that provides information of detailed ship behavior in a specific navigational environment, on both the ship traffic level and the individual ship level, for safety analysis, decision making, planning of ports and waterways, and

  11. Computation of the Quantities Describing the Lunar Librations in the Astronomical Almanac

    Science.gov (United States)

    2010-08-01

    this system ~e ( COS( -(3) cost >. + 180’ - tt)) cost -(3) sine>. + 180’ - tt) sin(-(3) , (1) Consid~r neXt, point M referred to axes OX’’z’ iIi...now write (7) as the three equl\\tions " cos b cos(1 + LM - tt) = cosj3 cost >. - tt - N) cos b sin(1 + LM - tt) ,= cos Lcosj3si,n(>’,- tt -’N) ,- sin...8217?’~ on . .the sel~~~centric sphere. The geocentric right ascension and declination of the Moon are 0:, 0 and so the right ascension and declination of

  12. Novel application of ALMANAC: Modelling a functional group, exotic warm-season perennial grasses

    Science.gov (United States)

    Introduced perennial C4 grasses such buffelgrass (Pennisetum ciliare [(L.) Link]) and old world bluestems (OWB), including genera such as Bothriochloa Kuntze, Capillipedium Stapf, and Dichanthium Willemet have the potential to dominate landscapes. A process-based model that realistically simulates ...

  13. Cruel Seas: World War 2 Merchant Marine-Related Nautical Fiction from the 1930s to Present

    OpenAIRE

    Krummes, Daniel C

    2015-01-01

    Cruel Seas is an annotated bibliography of fiction in English that involves civilian steamships of the merchant marine in works set during World War Two (or slightly before).  While the subtitle states "1930s to Present," the last entry was added in 2008, and the work will not be updated.  The entries include novels, novellas, and short stories, but exclude poetry, theater plays, and fiction written for juveniles (unless the work can appeal to adults as well). Many of the works invol...

  14. Enabling Collaborative Human-Machine (H-M) Decision Making in Time-critical Activities

    Data.gov (United States)

    National Aeronautics and Space Administration — Self-adjusting autonomous systems (SAS) are spreading from well-defined control activities, such as manufacturing, to complex activities with multi-faceted human...

  15. HM Nuclear Installations Inspectorate: a bibliography of published work, 1962-1987

    International Nuclear Information System (INIS)

    McNichol, K.

    1988-04-01

    This bibliography contains references to published reports, conference papers and journal articles produced by individual members of the Nuclear Installations Inspectorate and the Inspectorate as a whole. The bibliography has been compiled from records held by the Health and Safety Executive Library and Information Service. All items have been indexed in HSELINE, HSE's publicly available database. The bibliography is arranged in 2 parts: by author(s) and by subject. (author)

  16. Great day: H.M. Queen Elizabeth II at the Calder Hall opening

    International Nuclear Information System (INIS)

    1956-01-01

    The opening of the world's first nuclear power station, Calder Hall, was a major event in the history of post-war Britain. This film describes the construction and design of the station and its opening by the Queen. It is also an interesting historical document reflecting the beliefs and aspirations of the time. (author)

  17. Platelet labelled radioisotope studies with Tc-99m-HM-PAO - own experience

    International Nuclear Information System (INIS)

    Dobkowski, P.; Krolicki, L.; Serafin-Krol, M.; Kielin, Z.; Staszkiewicz, W.

    1992-01-01

    The protocol of platelet labelling and results of 28 examinations with Tc- 99m labelled thrombocytes have been presented. In 6 cases this method was the only one, which allowed to show thrombotic lesions in carotid arteries. (author). 2 figs, 1 tab

  18. SOBRE CULTIVOS AXÉNICOS DE Entamoeba histolytica HM1-IMSS

    African Journals Online (AJOL)

    joss-brayan

    2013-04-17

    Apr 17, 2013 ... cyst in contaminated food or water (Botero and Restrepo,. 2003). Although it is ... phytochemicals that prevent certain diseases. The classic concept ... well for constipation (Chicouri and Chicouri, 2000), and has proven activity ...

  19. HM modelling of in-situ gas injection tests in bentonite and argillite: the PGZ experiment

    International Nuclear Information System (INIS)

    Gerard, P.; Charlier, R.; Radu, J.P.; La Vaissiere, R. de; Talandier, J.; Collin, F.

    2010-01-01

    Document available in extended abstract form only. During long-term repository of high and intermediate level nuclear waste in deep argillaceous geological formation, steel containers will corroded and organic material will be irradiated. The two processes lead mostly to hydrogen production. This study deals with the numerical modelling of the gas migration in both the host formation and a bentonite plug, with an emphasis on coupling between the gas transfer and the mechanical strains and stresses. More particularly the study aims to support the design of the PGZ in situ experiment that will be performed by Andra in its underground laboratory at Bure. The objective of the experiment is the analysis of the dynamics of the bentonite plug re-saturation, studying the competition between the liquid water coming from the argillite and a gas injection. The modelled experiment consists of a borehole drilled in rock clay, inside which a plug of MX-80 bentonite is set. The bentonite is naturally re-saturated by water coming from the host formation. At the same time a gas pressure, higher than the initial water pressure in the host rock, is imposed at both ends of the plug. The developed model takes into account the coupling between the mechanical behaviour and the water and gas transfers in undisturbed geo-materials. It manages explicitly liquid and vapour water, gaseous and dissolved hydrogen. Elastoplastic and non-linear elastic model are used to model the behaviour of, respectively, the argillaceous rock and the bentonite. The numerical results show the small desaturation obtained in bentonite and argillite. The influence of the coupling of the mechanic on the water and gas transfers is thus limited (due to the Bishop's effective stress). The swelling of the bentonite plug is not hindered by the gas migration and the confining effect of the engineered barrier is maintained. An analysis is made of the influence of the main transfer rock properties on the gas pressure measured in the plug and in the argillite and the kinetics of the transfers. The influence of the water retention curve and the gas relative permeability expression in the quasi-saturated domain is evidenced. It emphasizes the need of the correct experimental determination of the relative permeabilities and the retention properties of the geo-materials in this range of saturation. (authors)

  20. Meie avangardismi löögirühm / Jüri Hain

    Index Scriptorium Estoniae

    Hain, Jüri, 1941-

    2005-01-01

    Näitus "Eesti Kunstnikkude Ryhm" Tartu Kunstimuuseumis 21. I-20. III. 1923. a. lõpul asutatud rühmitusest, EKRi näitusetegevusest, 1928. a. ilmunud almanahhist "Uue Kunsti Raamat" (kujundaja Märt Laarman), mille kohta ajakirjas "Die Form" ilmus Theo van Doesburgi artikkel "Raamat ja selle kujundus"

  1. Hull, Mechanical & Electrical (HM &E) Roadmap: Revolutionizing Naval Warfare and Achieving Energy Security

    Science.gov (United States)

    2012-01-01

    Further, recent economic studies have employed full-cost accounting methods ( Kaplan 2011) to estimate the costs force projection in the Persian...Type 45 Destroyer with an IPS and the Type 23 Frigate powered by the Combined Diesel- Electric and Gas Turbine (CODLAG) architecture provides an...Ammunition Ship and the Combined Diesel- Electric or Gas Turbine (CODLOG) (also known as hybrid gas- turbine -electric drive) aboard the USS MAKIN ISLAND

  2. 1970. aastatel alustas arhitektidest sõprade ja kolleegide rühm... / Mari Laanemets

    Index Scriptorium Estoniae

    Laanemets, Mari, 1975-

    2008-01-01

    27.VI avatakse Eesti Arhitektuurimuuseumis Rotermanni soolalaos 1970. ja 1980. alguse eksperimentaalset arhitektuuripraktikat käsitlev näitus "Keskkond, objektid, kontseptsioonid. Tallinna kooli arhitektid 1972-1985". Näha saab Ülevi Eljandi, Ignar Fjuki, Veljo Kaasiku, Tiit Kaljundi, Vilen Künnapu, Leonhard Lapini, Avo-Himm Looveere, Kristin-Mari Looveere, Marika Lõokese, Jüri Okase, Jaan Olliku, Ain Padriku, Toomas Reinu, Andres Ringo, Sirje Runge, Harry Sheini, Tõnis Vindi ja Matti Õunapuu töid. Näituse kuraatorid Andres Kurg ja Mari Laanemets. Samas: "Uue arhitektuuri näituse programm" (1972)

  3. A combined HM-PCR/SNuPE method for high sensitive detection of rare DNA methylation

    Directory of Open Access Journals (Sweden)

    Tierling Sascha

    2010-06-01

    Full Text Available Abstract Background DNA methylation changes are widely used as early molecular markers in cancer detection. Sensitive detection and classification of rare methylation changes in DNA extracted from circulating body fluids or complex tissue samples is crucial for the understanding of tumor etiology, clinical diagnosis and treatment. In this paper, we describe a combined method to monitor the presence of methylated tumor DNA in an excess of unmethylated background DNA of non-tumorous cells. The method combines heavy methyl-PCR, which favors preferential amplification of methylated marker sequence from bisulfite-treated DNA with a methylation-specific single nucleotide primer extension monitored by ion-pair, reversed-phase, high-performance liquid chromatography separation. Results This combined method allows detection of 14 pg (that is, four to five genomic copies of methylated chromosomal DNA in a 2000-fold excess (that is, 50 ng of unmethylated chromosomal background, with an analytical sensitivity of > 90%. We outline a detailed protocol for the combined assay on two examples of known cancer markers (SEPT9 and TMEFF2 and discuss general aspects of assay design and data interpretation. Finally, we provide an application example for rapid testing on tumor methylation in plasma DNA derived from a small cohort of patients with colorectal cancer. Conclusion The method allows unambiguous detection of rare DNA methylation, for example in body fluid or DNA isolates from cells or tissues, with very high sensitivity and accuracy. The application combines standard technologies and can easily be adapted to any target region of interest. It does not require costly reagents and can be used for routine screening of many samples.

  4. João Henrique Böhm, o fundador do exército brasileiro

    Directory of Open Access Journals (Sweden)

    Carlos H. Oberacker Jr.

    2015-11-01

    Full Text Available (Primeiras linhas do texto "Durante a Guerra dos Sete Anos, quando em 17 de agôsto de 1761 as potências sob os Bourbons — França, Espanha e Parma — firmaram o chamado Pacto de Família para quebrantar o poderio inglês, exigiram por uma espécie de ultimatum a Portugal, aliado da Inglaterra, que fizesse parte dêsse Pacto, e acabaram por declarar guerra à nação insular, com a qual a França já em 1756 disputava a hegemonia mundial. (..."

  5. The emotional labor of nurses working in her Majesty's (HM) prison service.

    Science.gov (United States)

    Walsh, Elizabeth

    2009-01-01

    In this study, a qualitative, reflexive methodology was adopted with a postmodern philosophical foundation in order to examine the emotional labor of nurses working in prisons in England and Wales. Phase 1 of the study involved semistructured interviews with nine qualified, registered nurses from three adult prisons: two male establishments and one female. In phase 2 of the study, two of these nurses entered into a supervisory relationship with the researcher, with the researcher as clinical supervisor. Monthly clinical supervision sessions were held with both nurses over 6 months. Findings from this study suggest that the nurse working in prison experiences emotional labor as a consequence of four key relationships: the relationship with the prisoner patient, the relationship with officer colleagues, and the relationship with the Institution; the fourth relationship centers on the contradictory discourses the nurse engages with internally, and is referred to as the "intranurse" relationship. This relationship involves on-going internal dialogue between the two selves of the nurse: the professional self and the emotional "feeling" self. In order to manage the emotion work inherent in prison work, it is suggested that the development of emotional intelligence through clinical supervision and reflective practice is of significant benefit to both healthcare and discipline staff.

  6. Study of the fragmentation of astrophysical interest molecules (CnHm) induced by high velocity collision

    International Nuclear Information System (INIS)

    Tuna, Th.

    2008-07-01

    This work shows the study of atom-molecule collision processes in the high velocity domain (v=4,5 a.u). The molecules concerned by this work are small unsaturated hydrocarbons C 1-4 H and C 3 H 2 . Molecules are accelerated with the Tandem accelerator in Orsay and their fragmentation is analyzed by the 4π, 100% efficient detector, AGAT. Thanks to a shape analysis of the current signal from the silicon detectors in association with the well known grid method, we are able to measure all the fragmentation channels of the incident molecule. These dissociation measurements have been introduced in the modelization of two objects of the interstellar medium in which a lot of hydrocarbon molecules have been observed (TMC1, horse-head nebula). We have extended our branching ratios obtained by high velocity collision to other electronic processes included in the chemical database like photodissociation and dissociative recombination. This procedure is feasible under an assumption of the statistical point of view of the molecular fragmentation. The deviations following our modification are very small in the modelization of TMC1 but significant in the photodissociation region. The first part is dedicated to the description of the experimental setting that has enabled us to study the fragmentation of C n H m molecules: the Orsay's Tandem accelerator and the Agat detector. The second part deals with negative ion sources and particularly with the Sahat source that is based on electronic impact and has shown good features for the production of anions and correct stability for its use with accelerators. The third part is dedicated to the experimental results in terms of cross-sections, number of fragments and branching ratios, associated to the various collisional processes. The last part presents an application of our measurement of fragmentation data to astro-chemistry. In this field, the simulation codes of the inter-stellar medium require databases of chemical reactions that depend on the issues of the fragmentation processes

  7. 46 CFR 174.055 - Calculation of wind heeling moment (Hm).

    Science.gov (United States)

    2010-10-01

    ... for an exposed surface on the unit in foot-pounds (kilogram-meters); (2) k=0.00338 lb./(ft.2-knots2... (25.8 meters per second) for damage conditions. (4) A=projected area in square feet (squrae meters) of an exposed surface on the unit; (5) Ch=height coefficient for “A” from Table 174.055(a); (6) Cs=shape...

  8. An evaluation of the HM prison service "thinking skills programme" using psychometric assessments.

    Science.gov (United States)

    Gobbett, Matthew J; Sellen, Joselyn L

    2014-04-01

    The most widely implemented offending behaviour programme in the United Kingdom was Enhanced Thinking Skills (ETS), a cognitive-behavioural group intervention that aimed to develop participant's general cognitive skills. A new offending behaviour programme has been developed to replace ETS: the Thinking Skills Programme (TSP). This study reports an evaluation of the effectiveness of TSP using psychometric assessments. Phasing of the two programmes created an opportunity to compare the two programmes consecutively. Forty participants, 20 from each programme, completed a range of psychometric measures to examine cognition, attitudes, and thinking styles. Analysis of pre- and post-programme psychometric results indicated that participants of TSP demonstrated improvements on 14 of the 15 scales, 9 of which were statistically significant. Effect sizes between pre-post results were generally greater for TSP than ETS, demonstrating that TSP had a more positive impact on the thinking styles and attitudes of participants than the ETS programme.

  9. Postponement in Fashion Retailing : A Case Study of H&M

    OpenAIRE

    Nawaz, Mohsin; Saleem, Munawar

    2010-01-01

    Abstract In fashion industry, customer demand is constantly changing. One of the main reasons is due to the time of delicate fashion awareness among the consumers, which has come into larger variety and frequent assortment changes. The changing trends in fashion industry allow researchers to get into the postponement strategy as a customized operation in order to focus on quality and flexibility. In today’s fashion market the key for success is to keep an eye on and react to the customer dema...

  10. Simplified modeling of HM behavior of swelling clays for nuclear waste disposal buffers

    International Nuclear Information System (INIS)

    Hoxha, Dashnor; Belayachi, Naima; Do, Duc-Phi; Poutrel, Adrien; Wendling, Jacques

    2010-01-01

    Document available in extended abstract form only. The swelling clays are extensively studied these last decades in relation with many industrial applications: foundations in civil engineering, sealing of waste disposals., etc. Especially in the case of waste disposals buffers the swelling pressure and its kinetics are of great importance. In the research programme of ANDRA (French National Radioactive Waste Management Agency), a mixing of bentonite MX80 with 30% of sands has been chosen as a buffering material. The modelling of behaviour of this material has been object of several works and several sophisticated models have been proposed. However as the practice of nuclear waste disposals proves, the needs for robust and simple models, able to describe the most important features of buffers, are yet to be meet by engineers and researches. This paper aims at a simplified model for the buffers behaviour based upon an extension of previous works and laboratory results. As discussed and proposed by many authors modeling of swelling clays behavior needs to consider both crystalline and osmotic swelling. While molecular dynamics could be used to understand the relation between the structure of clay minerals and its swelling properties a multiscale approach counting for chemical and hydro-mechanical couplings in various scale is revealed to give insights on the mechanisms governing clayey soil swelling. However in many industrial application large scale problems would be considered for which macroscopic and robust models should be used. From macroscopic point of view, basically two alternative approaches are used: effective stress approach and so called independent stress state variables. For an isotropic material, the volumetric strain of unsaturated media predicted by BBM model, could be written as a function of: the mean stress of applied mechanical stress, the air pressure, the suction (or pore pressure where the media is fully saturated), the drained bulk incompressibility and the equivalent bulk incompressibility to account for suction variation. In order to use this relation in the case of a swelling material, one has to introduce the impact of chemical coupling on strains evolution. Recalling that chemical stress depends both on the connected pore space organization and concentration of exchangeable ions, one could reasonably suppose that in unsaturated case, for a constant concentration of ions in the porous space, this stress depends implicitly on the saturation state. We describe the total mean strain induced either by a variation of mean mechanical stress, pore pressure or concentration via an effective stress similar to Biot's effective stress

  11. 1 HM Majeed Religion and the Problem of Rationality, Insights from ...

    African Journals Online (AJOL)

    REGINALDS

    beliefs have one or more of the following features: ... Akan religion on the usefulness of religion to human life on earth, as well as the absence of .... instance, he remarks of belief in the last judgement: 'how are we to know whether to say .... science; instead, my point is that beliefs and assumptions lead to different degrees of.

  12. HM-EH-RT: hybrid multimodal energy harvesting from rotational and translational motions

    Directory of Open Access Journals (Sweden)

    Miles Larkin

    2013-12-01

    Full Text Available This paper presents a novel hybrid multimodal energy harvesting device consisting of an unbalanced rotary disk that supports two transduction methods, piezoelectric and electromagnetic. The device generates electrical energy from oscillatory motion either orthogonal or parallel to the rotary axis to power electronic devices. Analytical models for the electromagnetic and piezoelectric systems were developed to describe the mechanical and electrical behavior of the device. From these models, numerical simulations were performed to predict power generation capabilities. The device was fabricated, and several components were optimized experimentally. The energy harvester was then experimentally characterized using a modal shaker in several different orientations. The device generates a maximum RMS power output of 120 mW from the electromagnetic system at 5 Hz and 0.8 g, and 4.23 mW from the piezoelectric system at 20.2 Hz and 0.4 g excitation acceleration. The device is 180 mm in diameter and 45 mm thick including the rotor height. Further size optimization will produce an energy harvester capable of being used as a wearable device to power mobile electronics for multiple applications.

  13. HM-EH-RT: hybrid multimodal energy harvesting from rotational and translational motions

    OpenAIRE

    Miles Larkin; Yonas Tadesse

    2013-01-01

    This paper presents a novel hybrid multimodal energy harvesting device consisting of an unbalanced rotary disk that supports two transduction methods, piezoelectric and electromagnetic. The device generates electrical energy from oscillatory motion either orthogonal or parallel to the rotary axis to power electronic devices. Analytical models for the electromagnetic and piezoelectric systems were developed to describe the mechanical and electrical behavior of the device. From these models, nu...

  14. Obituary: Alan D. Fiala (1942-2010)

    Science.gov (United States)

    Kaplan, George

    2011-12-01

    Dr. Alan Dale Fiala, astronomer and expert on solar eclipses, died on May 26, 2010 in Arlington, Virginia, of respiratory failure after a brief illness. He was 67. Fiala had been a staff astronomer at the U.S. Naval Observatory in Washington, D.C., for his entire professional career, where he rose from a position as a summer intern to become the Chief of the Nautical Almanac Office, responsible for annual publications for astronomy and navigation that are used the world over. He retired from the observatory in 2000. Although a childhood case of polio affected his mobility for the rest of his life, he seldom let his physical constraints limit his activities, which were many and varied. Alan Fiala was born in Beatrice, Nebraska on November 9, 1942, the middle son of Emil A. ("John") and Lora Marie Fiala. Fiala's father was a postal clerk and Civil Service examiner. Fiala expressed interest in astronomy at a very young age. He contracted polio when he was 9. He graduated from Beatrice High School in 1960 with a straight-A average and went on to study at Carleton College. He received his B.A. summa cum laude after three years, in 1963, with a major in astronomy and minors in physics and mathematics. He was elected to Phi Beta Kappa, Sigma Xi, and Pi Mu Epsilon (mathematics). In 1962, Alan Fiala obtained a job as a summer intern at the Naval Observatory in Washington, working in the Nautical Almanac Office (NAO). He entered the graduate program at Yale University and continued to work summers at the observatory. He received his Ph.D. in 1968, under Gerald Clemence. His dissertation was titled "Determination of the Mass of Jupiter from a Study of the Motion of 57 Mnemosyne." After receiving his doctorate, Fiala became a permanent member of the Naval Observatory staff. Computers were just being introduced there and he participated in the automation of many procedures used to prepare the annual publications of the Nautical Almanac Office. One of his first assignments was

  15. Almanac 2012: Cardiovascular risk scores. The national society journals present selected research that has driven recent advances in clinical cardiology

    Directory of Open Access Journals (Sweden)

    Jill P. Pell

    2013-03-01

    Full Text Available Global risk scores use individual level information on non-modifiable risk factors (such as age, sex, ethnicity and family history and modifiable risk factors (such as smoking status and blood pressure to predict an individual’s absolute risk of an adverse event over a specified period of time in the future. Cardiovascular risk scores have two major uses in practice. First, they can be used to dichotomise people into a group whose baseline risk, and therefore potential absolute benefit, is sufficiently high to justify the costs and risks associated with an intervention (whether treatment or prevention and a group with a lower absolute risk to whom the intervention is usually denied. Second, they can be used to assess the effectiveness of an intervention (such as smoking cessation or antihypertensive treatment at reducing an individual’s risk of future adverse events. In this context, they can be helpful in informing patients, motivating them to change their lifestyle, and reinforcing the importance of continued compliance.

  16. 51. Meeting of the Chemical Societies: Almanac of Contributions, Vol. Program, 1, 2, 3, 4 Molecular Models (Workshop)

    International Nuclear Information System (INIS)

    Uher, M.; Benes, P.; Carsky, J.; Ctrnactova, H.; Fecenko, J.; Fellner, P.; Hodul, P.; Koprda, V.; Kratochvil, B.; Krkoska, P.; Kuruc, J.; Lehotay, J.; Matousek, J.; Milichovsky, P.; Omastova, M.; Petrus, L. jr.; Petrus, L. sr.; Schwendt, P.; Silny, P.; Sevcik, P.; Toma, S.; Uherova, R.; Zachar, P.

    1999-09-01

    The publication has been set up as a abstracts of the meeting dealing with different chemical problems. The book (Vol. 1) consists of the sections: All-plenary lectures (9 papers); (D) History of the chemistry (14); (K) Didactics of chemistry (32); The book (Vol. 2) consists of the sections: (A) Analytical chemistry (48); (B) Inorganic chemistry (75); (C) Physical chemistry (27); (F) Nuclear chemistry and radioecology (12); (L) Environmental chemistry and toxicology (33); (M) Agricultural chemistry (20). The book (Vol. 3) consists of the sections: (E) Wood, pulp, paper (15); (G) Macromolecular chemistry (42); (H) Organic chemistry, bio-organic chemistry and pharmaceutical chemistry (96); (I) Food chemistry and biochemistry (34); (J) Textile, fibres and foil materials (9). The book (Vol. 4) consists of the workshop Molecular models (3 papers)

  17. Plunkett's E-Commerce & Internet Business Almanac 2012 E-Commerce & Internet Business Industry Market Research, Statistics, Trends & Leading Companies

    CERN Document Server

    Plunkett, Jack W

    2012-01-01

    Market research guide to the e-commerce and Internet business-a tool for strategic planning, competitive intelligence, employment searches or financial research. Contains trends analysis, globalization, trade, statistical tables and an industry glossary. Includes our profiles of nearly 450 top e-commerce and internet industry firms, featuring addresses, phone numbers and executive names.

  18. Forest products from Latin America : an almanac of the state of the knowledge and the state of the art

    Science.gov (United States)

    Robert R. Maeglin

    1991-01-01

    In 1985, the U.S. Congress mandated a program commonly called the Caribbean Initiative. To fulfill their portion of this Initiative, the USDA Forest Service developed a “Program for Tropical Forestry in Latin America and the Caribbean.” This document is part of the Forest Service program, and it was funded by the legislation for the Caribbean Initiative. This document...

  19. A COMPARATIVE ANALYSIS OF CSR STRATEGIES, IMPLEMENTATION AND OUTCOMES : A Qualitative Case Study of IKEA, Starbucks and H&M

    OpenAIRE

    Afzal, Sadaf; Thiengnoi, Phunbubpha

    2009-01-01

    A business activity generates both negative and positive externality simultaneously for both the environment and the society. The basic idea is to minimize the negative externality and generate more positive externality.Expectations of the society towards businesses have grown tremendously during the past few decades, the stress is upon a socially, environmentally and legally responsible businesses. Organizations have responded to this expectation by indulging in a set of activities which are...

  20. Performance-oriented packaging: A guide to identifying, procuring, and using. Procurement and use of packaging using HM-181 regulations

    International Nuclear Information System (INIS)

    1994-09-01

    This document addresses procurement of nonbulk packaging used for nonradioactive, hazardous materials that are transported by highway. The basic procedure is the same when making shipments by other modes. However, other sections of the regulations may affect the packaging requirements when shipping by other modes. The variation in requirements is extensive when air transportation is selected. A packaging engineer or transportation specialist should be contacted for guidance wen transport is by a mode other than highway

  1. The influence of main parameters of the process of forging on the initial quality of forging for steel 35HM

    International Nuclear Information System (INIS)

    Banaszek, G.; Dyja, H.; Berski, S.

    2001-01-01

    The article discuss the effect of the main forging parameters and the selection of tools on improving the internal quality of forgings and closing up discontinuities of metallurgical origin during forging. As a result of investigations, the optimal values of the main technological parameters of forging have been determined and the application of an appropriate group of tools have been proposed for the flat die forging of forgings. (author)

  2. [EDRP public local inquiry] statement by H.M. Nuclear Installations Inspectorate of the Health and Safety Executive

    International Nuclear Information System (INIS)

    1986-01-01

    An outline is given of the regulatory system, and the administrative and technical review procedures which would be applied before the licence and subsequent authorisations were granted. How the Inspectorate would set about its task of examining the operators safety case is also indicated. (U.K.)

  3. MEMBANGUN MEREK DENGAN MENGAKUISISI PERUSAHAAN : REALITAS MEREK-MEREK YANG BERHASIL (STUDI KASUS – COCA COLA, STARBUCKS & HM SAMPOERNA

    Directory of Open Access Journals (Sweden)

    S Pantja Djati

    2006-01-01

    Full Text Available Membangun sebuah merek sebagai investasi yang cukup panjang dan akan menghasilkan suatu keuntungan besar bagi perusahaan. Pada kenyataannya banyak merek-merek internasional yang sudah berhasil untuk jangka waktu yang panjang sampai saat ini, sebab ia sudah berhasil dalam merencanakan suatu merek. Pada beberapa waktu ternyata nilai suatu merek melebihi dari total asset perusahaan, tanah dan mesin yang dimiliki perusahaan, karena citra merek yang tinggi bisa mendatangkan keuntungan yang besar. Pada beberapa kasus di perusahaan pada dasarnya investasi dengan membeli perusahaan memiliki kecenderungan untuk mempertahankan merek mula-mula, yaitu merek yang sejak awal dibeli yang sudah cukup kuat di benak konsumen. Membuat merek baru lebih beresiko dan perlu biaya mahal. Justru dengan mengakuisisi perusahaan untuk menambah portofolio merek perusahaan.

  4. R. v. H.M. Inspectorate of Pollution and Ministry of Agriculture, Fisheries and Food, ex parte Greenpeace

    International Nuclear Information System (INIS)

    Otton, J.

    1994-01-01

    The British Nuclear Fuel plc (BNFL) Thermal Oxide Reprocessing Plant, THORP, has been constructed to reprocess spent nuclear fuel at Sellafield. BNFL have existing authorisations for the emissions of liquid and gaseous radioactive wastes relating to its existing operations. In April 1993, BNFL applied to vary the authorisations to start testing operation of THORP. As the emissions were expected to be covered by existing authorisations BNFL wanted to start tests before formal authorisations were granted. Her Majesty's Inspectorate of Pollution (HMIP) stressed the need for formal application and for public consultation. Greenpeace challenged the granting by HMIP of variations so THORP could be operated on several grounds. Greenpeace's application for a judicial review was dismissed. (UK)

  5. Clinical experience with Tc-99m HM-PAO high resolution SPECT of the brain in patients with cerebrovascular accidents

    International Nuclear Information System (INIS)

    Roo, M. de; Mortelmans, L.; Devos, P.; Verbruggen, A.; Wilms, G.; Carton, H.; Wils, V.; Bergh, R. van den

    1989-01-01

    In order to evaluate the diagnostic contribution of brain SPECT imaging with 99m Tc-HMPAO in cerebrovascular disease, we examined 92 stroke cases (144 lesions), 2 hematoma cases and 30 cases with transient neurologic symptoms. Abnormal tracer distribution is visible as zones of either hypoactivity or hyperactivity (border zone hyperemia or luxury perfusion). Remote vascularization changes could also be found (crossed cerebellar diaschisis or ipsilateral cortical perfusion reduction in thalamic or capsula interna lesions). Both X-ray CT and blood flow SPECT have comparable sensitivity in the exploaration of cerebral infarction, with detection in, respectively, 89,5% and 87,5% of the lesions. False negative scintitomographic images are frequently recorded in small lacunar infarcts within the basal ganglia and white matter (capsula interna). Some early infarcts and asymmetry of brain perfusion in patients with transient neurologic symptoms are frequently not detected by CT. An additional advantage of blood flow SPECT is its ability to visualize remote blood flow changes and the changing pattern of vascularization of ischemic lesions and their surrounding areas including hyperemia. (orig.)

  6. Clinical experience with Tc-99m HM-PAO high resolution SPECT of the brain in patients with cerebrovascular accidents

    Energy Technology Data Exchange (ETDEWEB)

    Roo, M. de; Mortelmans, L.; Devos, P.; Verbruggen, A.; Wilms, G.; Carton, H.; Wils, V.; Bergh, R. van den

    1989-01-01

    In order to evaluate the diagnostic contribution of brain SPECT imaging with /sup 99m/Tc-HMPAO in cerebrovascular disease, we examined 92 stroke cases (144 lesions), 2 hematoma cases and 30 cases with transient neurologic symptoms. Abnormal tracer distribution is visible as zones of either hypoactivity or hyperactivity (border zone hyperemia or luxury perfusion). Remote vascularization changes could also be found (crossed cerebellar diaschisis or ipsilateral cortical perfusion reduction in thalamic or capsula interna lesions). Both X-ray CT and blood flow SPECT have comparable sensitivity in the exploaration of cerebral infarction, with detection in, respectively, 89,5% and 87,5% of the lesions. False negative scintitomographic images are frequently recorded in small lacunar infarcts within the basal ganglia and white matter (capsula interna). Some early infarcts and asymmetry of brain perfusion in patients with transient neurologic symptoms are frequently not detected by CT. An additional advantage of blood flow SPECT is its ability to visualize remote blood flow changes and the changing pattern of vascularization of ischemic lesions and their surrounding areas including hyperemia.

  7. Van autonomie terug naar natuurlijk­heid? Een reactie op prof.dr. H.M. Dupuis

    NARCIS (Netherlands)

    Boer, Th.A.

    Wie de inleidingen van Prof. Dupuis en Mgr. Eijk leest, kan zich moeilijk aan de indruk onttrekken dat zij het onderling behoorlijk eens zijn. Dat verbaast, want Eijk staat bekend als een aanhanger van het natuurrecht zoals geïnterpreteerd in de rooms-katholieke traditie en Dupuis als een

  8. H-M bearing capacity of a modified suction caisson determined by using load-/displacement-controlled methods

    Science.gov (United States)

    Zhang, Yu-kun; Gao, Yu-feng; Li, Da-yong; Mahfouz, Ali H.

    2016-12-01

    This paper presents a series of monotonically combined lateral loading tests to investigate the bearing capacity of the MSCs (modified suction caissons) in the saturated marine fine sand. The lateral loads were applied under load- and displacement-controlled methods at the loading eccentricity ratios of 1.5, 2.0 and 2.5. Results show that, in the displacement-controlled test, the deflection-softening behavior of load-deflection curves for MSCs was observed, and the softening degree of the load-deflection response increased with the increasing external skirt length or the decreasing loading eccentricity. It was also found that the rotation center of the MSC at failure determined by the load-controlled method is slightly lower than that by the displacement-controlled method. The calculated MSC capacity based on the rotation center position in serviceability limit state is relatively conservative, compared with the calculated capacity based on the rotation center position in the ultimate limit state. In the limit state, the passive earth pressures opposite the loading direction under load- and displacement-controlled methods decrease by 46% and 74% corresponding to peak values, respectively; however, the passive earth pressures in the loading direction at failure only decrease by approximately 3% and 7%, compared with their peak values.

  9. Toetusrühm on toetuseks ehk maalitud seinast, kuldvõtmekesest ja tegelikust elust / Avo Üprus

    Index Scriptorium Estoniae

    Üprus, Avo, 1954-

    2005-01-01

    Autor leiab, et valitsus saab juhtida oma programme ka kodanikeühenduste koostöövõrgu kaudu ning lihtsustada nii riigi ülesehitust. Muutuvas maailmas võib kaasamise kaudu kasvatada usaldust ja vastutust

  10. Dampak Komitmen Organisasi, Self Efficacy terhadap Konflik Peran dan Kinerja Karyawati PT. HM Sampoerna Tbk. di Surabaya

    OpenAIRE

    Handayani, Wiwik

    2008-01-01

    There are many things need motivated married woman to work. Indonesian woman show high performance in education and working word. People have psychologist pressing from environment. It causes problem in family position (her role) and duty in his job and family as mother. This research has done to know the effect of organization commitment, self efficacy to role conflict and her performance as an employment at PT. Sampoerna, Tbk.Variabel use in this research are organization commitment, self e...

  11. Using the supply-chain operations reference model (SCOR) to model the production of nautical charts by the SA navy hydrographic office

    CSIR Research Space (South Africa)

    Schmitz, Peter MU

    2011-07-01

    Full Text Available as the Centre of Hydrographic Excellence in Africa by the International Hydrographic Community through its proven professional conduct, products, innovation and supreme service. Since chart production can be seen as a supply chain, it was decided to model...

  12. The U.S. continental shelf beyond 200 nautical miles. Legal questions arising from non-accession to the UN Convention on the Law of the Sea

    OpenAIRE

    Longtain, Shay

    2015-01-01

    The elaborate legal framework contained in Part VI of the 1982 United Nations Convention on the Law of the Sea (LOSC) resembles both codification and progressive development of the law of the sea as it relates to the continental shelf. As a non-party to the Convention, the United States is only bound to those provisions which now reflect customary rules of international law or have otherwise created rights or obligations for third states. This thesis identifies several distinct components o...

  13. Historical Map & Chart Collection of NOAA's Nautical Charts, Hydrographic Surveys, Topographic Surveys, Geodetic Surveys, City Plans, and Civil War Battle Maps Starting from the mid 1700's

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The Historical Map and Chart Collection of the Office of Coast Survey contains over 20000 historical maps and charts from the mid 1700s through the late 1900s. These...

  14. Kapteni roll tõendite kogumisel / North East Branch of the Nautical Institute ; [tlk. Uno Laur ; toim. Viiu Suurväli ; eess.: Gerald Darling

    Index Scriptorium Estoniae

    1997-01-01

    Kapteni osa, logiraamatud ; lasti kahjustus, kaotus ja puudujääk ; kindlustus ja laevarike ; vaegtäitmise- ja ülekulupretensioonid ; ohtlikud sadamad ja laadimispaigad ; statsionaarsete ja ujuvobjektide vigastused ; õlireostus ; üldavarii ; päästmine ; laevakokkupõrked ; töötülide lahendamine ja distsiplinaarküsimused ; õnnetusjuhtumid inimestega ; piletita reisijad , põgenikud

  15. Kapteni roll tõendite kogumisel / North East Branch of the Nautical Institute ; [tlk. Uno Laur ; toim. Viiu Suurväli ; eess.: Gerald Darling

    Index Scriptorium Estoniae

    1998-01-01

    Kapteni osa, logiraamatud ; lasti kahjustus, kaotus ja puudujääk ; kindlustus ja laevarike ; vaegtäitmise- ja ülekulupretensioonid ; ohtlikud sadamad ja laadimispaigad ; statsionaarsete ja ujuvobjektide vigastused ; õlireostus ; üldavarii ; päästmine ; laevakokkupõrked ; töötülide lahendamine ja distsiplinaarküsimused ; õnnetusjuhtumid inimestega ; piletita reisijad , põgenikud

  16. Meeting of the Chemical Societies: Almanac of the contributions of the fifty-first meeting of the chemical societies. Vol. 3

    International Nuclear Information System (INIS)

    Uher, M.; Benes, P.; Carsky, J.; Ctrnactova, H.; Fecenko, J.; Fellner, P.; Hodul, P.; Koprda, V.; Kratochvil, B.; Krkoska, P.; Kuruc, J.; Lehotay, J.; Matousek, J.; Milichovsky, P.; Omastova, M.; Petrus, L. jr.; Petrus, L. sr.; Schwendt, P.; Silny, P.; Sevcik, P.; Toma, S.; Uherova, R.; Zachar, P.

    1999-09-01

    The publication has been set up as an abstracts of the meeting dealing with different chemical problems. The book (Vol. 3) consists of the sections: (E) Wood, pulp, paper (15 papers); (G) Macromolecular chemistry (42 papers); (H) Organic chemistry, bio-organic chemistry and pharmaceutical chemistry (96 Papers); (I) Food chemistry and biochemistry; (J) Textile, fibres and foil materials

  17. Meeting of the Chemical Societies: Almanac of the contributions of the fifty-third meeting of the chemical societies, Vol. 3

    International Nuclear Information System (INIS)

    Toelgyessy, J.

    2001-09-01

    The publication has been set up as the abstracts of the meeting dealing with different chemical problems. The book (Vol. 3) consists of the sections: (F) Chemistry of polymers, organic materials, textile, fibres, foil materials (63 papers); (I) Organic and pharmaceutical chemistry (59 papers); (J) Food chemistry and biotechnology (26 papers); (M) Environment, Toxicology (51 papers)

  18. Maritime Limits and Boundaries of United States of America

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — NOAA is responsible for depicting on its nautical charts the limits of the 12 nautical mile Territorial Sea, 24 nautical mile Contiguous Zone, and 200 nautical mile...

  19. Software Products - Naval Oceanography Portal

    Science.gov (United States)

    are here: Home › USNO › Astronomical Applications › Software Products USNO Logo USNO Navigation Data Services Astronomical Information Center Almanacs and Other Publications Software Products For DoD Users Info Software Products MICA - Multiyear Interactive Computer Almanac MICA CDROM (thumb) MICA is an

  20. Influence of regenerative heat treatment on structure and properties of G20CrMo2 - 5 (L20HM cast steel

    Directory of Open Access Journals (Sweden)

    G. Golański

    2008-03-01

    Full Text Available Thc papcr prcscnts rcsuSts or rcscarch on thc influence of rcgcncratic hcat treatment on thc structurc and propcrtics [hardncss. impactcncrgy or L2O11M cnst stccl. Invcstipatcd material was taken from outer fmmc of a turbinc which was scrviccd for t 67 424 hours a! thctcmpcrauirc or 535 "C and prcssurc or 12.75 MPa. In psi-operating condition ~hicnv cstigntcd cast steel was cl~aracteri~cbdy low impactcncrpy of II I ant1 hart3ncss of 139HV30. Analysis uF the irlflue~~uuel ;lustcniriz;~ti on pariimctcrs (tcrnpcr;lturc and lime has rcvealcd rhntat thc tcinpcr;~turcr angc o f 895 + 955 "C (i-e. h3 - +I IO + 70 "C.fo r both 3 and 5 hours of holtl timc. rhc ohtaincd grain sizc amounls to 20+ 2511m. I has hccn pmved that tempcred bainitic-rcrri~ica nd remit ic-hainiric-pearlit ic stn~cturco f thc invcstigatcd cast stccl msurcs highimpact cncrgy, i.c. KV > 1001. as well a5 hardncss. i.e. 11Y30. just at thc tcrnpcmturc of OXl "C. 'I'crnpcmliirc or 7110 "C causcs i'~tnhcrincrclrsc of impact cncrgy along with a slight dccrcasc of hardncss. Morcovcr. it has hccn concludd that nppl ying oS under-annealinginstcad or tcmpcring. nflcr standardizalion. guarantees scquircd impact cncrgy of KY r 271.

  1. Business, Management and Administration. A Subject-Based Aspect Report on Provision in Scotland's Colleges by HM Inspectors on Behalf of the Scottish Funding Council

    Science.gov (United States)

    Her Majesty's Inspectorate of Education, 2010

    2010-01-01

    This report evaluates college programmes within a wide range of disciplines subsumed within the business, management and administration (BMA) area. The disciplines covered are: business and finance; economics; law; management; public administration; international business studies; enterprise; management skills; management planning and control…

  2. Self-Evaluation and Internal Review: An Aspect Report on Provision in Scotland's Colleges by HM Inspectors on Behalf of the Scottish Funding Council

    Science.gov (United States)

    Education Scotland, 2011

    2011-01-01

    This report examines the contribution of self-evaluation to internal review processes in Scotland's colleges. It identifies the range of methodologies used by colleges, what makes these effective and what needs to improve further. It explores in particular, the extent to which self-evaluation has a positive impact on learners' experiences. The…

  3. Equality and Diversity. An Aspect Report on Provision in Scotland's Colleges by HM Inspectors on Behalf of the Scottish Funding Council

    Science.gov (United States)

    Her Majesty's Inspectorate of Education, 2010

    2010-01-01

    This report evaluates the extent to which Scotland's colleges have developed and embedded a culture of promoting equality and diversity effectively for all learners and staff. It considers how effectively colleges have mainstreamed equality and diversity in all aspects of their operations. The fieldwork for this report has been informed by…

  4. Session 1984-85. Radioactive waste. Minutes of evidence, Wednesday 15 May 1985, National Radiological Protection Board, HM Nuclear Installations Inspectorate

    International Nuclear Information System (INIS)

    1985-01-01

    The Environment Select Committee of the House of Commons received a memorandum from the National Radiological Protection Board entitled 'Radioactive effluents and solid wastes - a summary of NRPB work on standards, assessments and research', under the headings introduction; development of standards (ICRP; NEA Expert Group; IAEA; NRPB; cost-benefit analysis; critical-group; transport regulations); assessments of the radiological impact of waste management practices (including matters connected with the operation of the Sellafield reprocessing plant, BNF plc); research on environmental transfer processes and dosimetry; general conclusions; references. A representative of NRPB was examined on the subject of the memorandum and the minutes of evidence are recorded. A memorandum was also received from the Nuclear Installations Inspectorate (Health and Safety Executive) under the headings: introduction; the site licence; radioactive waste management policy and NII; quantities and forms of waste and methods of disposal; financial, administrative and political aspects; transport. Representatives of the NII were examined, and the minutes of evidence are recorded. (U.K.)

  5. Businesses, the UN and decent work promotion: a case study of H&M, ILO and Sida’s engagement in Cambodia

    OpenAIRE

    Soares Oliveira, Thaís

    2018-01-01

    Some retail companies have been facing boycotts and negative criticism due to their association with sweatshop practices and human rights scandals. In order to deal with such criticism, it has become common for these garment sector businesses to implement corporate responsibility projects in countries in which their independent suppliers are located. These projects fall within the Sustainable Development Goals (SDGs) framework, more specifically on how the private sector can contribute to the...

  6. Thermodynamic properties of (an ester + an alkane). XVIII. Experimental HmEandVmE values for (an alkyl butanoate + an alkane) at T = 318.15 K

    International Nuclear Information System (INIS)

    Ortega, J.; Navas, A.; Sabater, G.; Ascanio, M.; Placido, J.

    2007-01-01

    This work presents the experimental values of H m E andV m E obtained at a temperature of 318.15 K and atmospheric pressure for a group of 24 binary mixtures comprised of the first four alkyl butanoates (methyl to butyl) with six odd alkanes, from heptane to heptadecane. All the mixtures are endothermic, and present a regular increase in H m E with the molecular weight of the saturated hydrocarbon, while, for a same alkane, the enthalpic effects diminish with increasing alcoholic chain of the butanoate. The variation in V m E occurs in the same direction. In this paper the structural behaviour of these systems and the influence of temperature on excess properties are analysed. Experimental data are correlated with a suitable polynomial equation which is given as a function of concentration and temperature, that permits a simultaneous correlation to be established with other properties of the mixture, such as (vapour + liquid) equilibria; and acceptable results are obtained. Finally, an estimation of H m E is made with two known versions of the UNIFAC model. In the version by Dang and Tassios [J. Dang, D.P. Tassios, Ind. Eng. Chem. Process Des. Dev. 25 (1986) 22-31.], a method is proposed that considers the interaction parameters as a function of the butanoate alkanolic chain. The estimations obtained for H m E are good

  7. Luxury for the Masses : A Study of the H&M Luxury Collaborations with Focus on the Images of the Luxury Designer Brands

    OpenAIRE

    Ginman, Carole; Lundell, Charlotte; Turek, Catherine

    2010-01-01

    A strong brand is important for all companies; however, it is imperative for the success of a luxury fashion house as the image is one of its core assets. As strategic alliances are increasing in popularity the effect they have on how customers look at the partner brands is both interesting for the general person, but also – and more importantly – vital knowledge for companies pondering such a strategic move. The major focus of this study is to answer the question of how luxury designers’ col...

  8. Session 1984-85. Radioactive waste. Minutes of evidence, Wednesday 15 May 1985, National Radiological Protection Board, HM Nuclear Installations Inspectorate

    Energy Technology Data Exchange (ETDEWEB)

    1985-01-01

    The Environment Select Committee of the House of Commons received a memorandum from the National Radiological Protection Board entitled 'Radioactive effluents and solid wastes - a summary of NRPB work on standards, assessments and research', under the headings introduction; development of standards (ICRP; NEA Expert Group; IAEA; NRPB; cost-benefit analysis; critical-group; transport regulations); assessments of the radiological impact of waste management practices (including matters connected with the operation of the Sellafield reprocessing plant, BNF plc); research on environmental transfer processes and dosimetry; general conclusions; references. A representative of NRPB was examined on the subject of the memorandum and the minutes of evidence are recorded. A memorandum was also received from the Nuclear Installations Inspectorate (Health and Safety Executive) under the headings: introduction; the site licence; radioactive waste management policy and NII; quantities and forms of waste and methods of disposal; financial, administrative and political aspects; transport. Representatives of the NII were examined, and the minutes of evidence are recorded.

  9. ' - HY'PERc;~.Lc;Et§a'.IA'"'0i§' M“AL'IGNAN'CY' _(H_.HM) 'US'!N'G ...

    African Journals Online (AJOL)

    sfsintillafion counter LKB Rabbrzta, with tritium. ¢ff1c:i<-zncyof 30%. _. Results i _ l _. Pre!_ii_”cra£ion_€m=as 'asses&ed'_using the DZ_\\_¥A and t_k1yn1i_dine ( incerporation assays. Resulzg were expresséd as_ % <_$0ntrQ1'f0I_ each experiment. _Data- are M +1'-l SE_M_of fcur cxpcziznflfits. Data were analyzed by ...

  10. Algorithmes adaptatifs et efficaces de partage de ressources radio pour les communications de type MTC : cas de coexistence H2H/M2M

    OpenAIRE

    Hamdoun , Safa

    2017-01-01

    The Internet-of-Things (IoT) refers to the ever-growing network of everyday objects that interconnect to each other or to other Internet-enabled systems via wireless sensors attached to them. IoT envisions a future where billions of smart devices will be connected and managed through a range of communication networks and cloud-based servers, enabling a variety of monitoring and control applications. Machine-to-Machine (M2M) communications supported by cellular networks, also known as Machine-...

  11. George William Hill, the Great but Unknown 19th Century Celestial Mechanician

    Science.gov (United States)

    Corbin, Brenda G.

    2012-01-01

    George William Hill (1838-1914) has long been considered one of the most famous and talented celestial mechanicians of the past century and a half. However, many people have never heard of him and his work. Simon Newcomb said he "will easily rank as the greatest master of mathematical astronomy during the last quarter of the nineteenth century.” After receiving a B.A. at Rutgers in 1859, Hill began work in 1861 at the office of the American Ephemeris and Nautical Almanac in Cambridge, MA. He moved to Washington with the group in 1882 which then became part of the U. S. Naval Observatory. Newcomb, beginning his work on planetary motion, assigned the theory of Jupiter and Saturn to him, calling it about the most difficult topic. Hill's work was published by the USNO in 1890 as A New Theory of Jupiter and Saturn. From 1898 to 1901, Hill lectured on the subject of celestial mechanics at Columbia University in a position created just for him. After 1892 and until his death, he lived at the family homestead in West Nyack, NY. He never married, was something of a recluse, and spent most of his time with his books and research. Hill was an amateur botanist and enjoyed exploring on long walks in the countryside. Many honors and awards came to him during his lifetime, both from the U.S. and abroad, including serving as president of the American Mathematical Society. All of Hill's mathematical and astronomical research was incorporated in The Collected Mathematical Works of George William Hill. This work, containing a preface in French by Poincare, was published in 4 large volumes by the Carnegie Institution of Washington in 1905.

  12. There's An App For That: Planning Ahead for the Solar Eclipse in August 2017

    Science.gov (United States)

    Chizek Frouard, Malynda R.; Lesniak, Michael V.; Bell, Steve

    2017-01-01

    With the total solar eclipse of 2017 August 21 over the continental United States approaching, the U.S. Naval Observatory (USNO) on-line Solar Eclipse Computer can now be accessed via an Android application, available on Google Play.Over the course of the eclipse, as viewed from a specific site, several events may be visible: the beginning and ending of the eclipse (first and fourth contacts), the beginning and ending of totality (second and third contacts), the moment of maximum eclipse, sunrise, or sunset. For each of these events, the USNO Solar Eclipse 2017 Android application reports the time, Sun's altitude and azimuth, and the event's position and vertex angles. The app also lists the duration of the total phase, the duration of the eclipse, the magnitude of the eclipse, and the percent of the Sun obscured for a particular eclipse site.All of the data available in the app comes from the flexible USNO Solar Eclipse Computer Application Programming Interface (API), which produces JavaScript Object Notation (JSON) that can be incorporated into third-party Web sites or custom applications. Additional information is available in the on-line documentation (http://aa.usno.navy.mil/data/docs/api.php).For those who prefer using a traditional data input form, the local circumstances can still be requested at http://aa.usno.navy.mil/data/docs/SolarEclipses.php.In addition the 2017 August 21 Solar Eclipse Resource page (http://aa.usno.navy.mil/data/docs/Eclipse2017.php) consolidates all of the USNO resources for this event, including a Google Map view of the eclipse track designed by Her Majesty's Nautical Almanac Office (HMNAO).Looking further ahead, a 2024 April 8 Solar Eclipse Resource page (http://aa.usno.navy.mil/data/docs/Eclipse2024.php) is also available.

  13. 51. Meeting of the Chemical Societies: Almanac of Contributions, Vol. Program, 1, 2, 3, 4 Molecular Models (Workshop); 51. Zjazd chemickych spolocnosti: Zbornik prispevkov, Diel: Program, 1, 2, 3, 4 Molekulove modely (Workshop)

    Energy Technology Data Exchange (ETDEWEB)

    Uher, M [ed.; Dept. of Org. Chem., Slovak Techn. Univ., Bratislava (Slovakia); Benes, P [ed.; Dept. Nucl. Chem., Czech Techn. Univ., Prague (Czech Republic); Carsky, J [ed.; Inst. of Med. Chem., Biochem. and Clin. Biochem., Comenius Univ., Bratislava (Slovakia); Ctrnactova, H [ed.; Dept. of Educat. and Didactics of Chem., Charles Univ., Prague (Czech Republic); Fecenko, J [ed.; Dept. of Agricult. Chem. and Susten. of Veget., Slovak Agricult. Univ., Nitra (Slovakia); Fellner, P [ed.; Dept. of Inorg. Chem., Slovak Techn. Univ., Bratislava (Slovakia); Hodul, P [ed.; Dept. of Fibres and Textile, Slovak Techn. Univ., Bratislava (Slovakia); Koprda, V [ed.; Dept. of Envir., Slovak Techn. Univ., Bratislava (Slovakia); Kratochvil, B [ed.; Inst. of. Solid State Chem., Chem. Univ., Prague (Czech Republic); Krkoska, P [ed.; Dept. of Chem. Technol. of Wood, Pulp and Paper, Slovak Techn. Univ., Bratislava (Slovakia); Kuruc, J [ed.; Dept. of Nucl. Chem., Comenius Univ., Bratislava (Slovakia); Lehotay, J [ed.; Dept. of Anal. Chem., Slovak Techn. Univ., Bratislava (Slovakia); Matousek, J [ed.; Inst. of Chem. and Technol. of the Envir., Techn. Univ, Brno (Czech Republic); Milichovsky, P [ed.; Dept. of Chem. Techn. of Wood, Pulp and Paper, Univ. Pardubice, Pardubice (Czech Republic); Omastova, M [ed.; Inst. of Polym., SAS, Bratislava (Slovakia); Petrus, L jr; Petrus, L sr [eds.; Inst. of Chem., SAS, Bratislava (Slovakia); Salisova, M [ed.; Dept. of Org. Chem., Comenius Univ., Bratislava (Slovakia); Schwendt, P [ed.; Dept. of Inorg. Chem., Comenius Univ., Bratislava (Slovakia); Silny, P; Sevcik, P; Toma, S [eds.; Comenius Univ., Bratislava (Slovakia); Uherova, R [ed.; Slovak Techn. Univ., Bratislava (Slovakia); Vanek, L [ed.; Charles Univ., Prague (Czech Republic); Zachar, P [ed.; Chem. Univ., Prague (Czech Republic)

    1999-09-01

    The publication has been set up as a abstracts of the meeting dealing with different chemical problems. The book (Vol. 1) consists of the sections: All-plenary lectures (9 papers); (D) History of the chemistry (14); (K) Didactics of chemistry (32); The book (Vol. 2) consists of the sections: (A) Analytical chemistry (48); (B) Inorganic chemistry (75); (C) Physical chemistry (27); (F) Nuclear chemistry and radioecology (12); (L) Environmental chemistry and toxicology (33); (M) Agricultural chemistry (20). The book (Vol. 3) consists of the sections: (E) Wood, pulp, paper (15); (G) Macromolecular chemistry (42); (H) Organic chemistry, bio-organic chemistry and pharmaceutical chemistry (96); (I) Food chemistry and biochemistry (34); (J) Textile, fibres and foil materials (9). The book (Vol. 4) consists of the workshop Molecular models (3 papers)

  14. Dictionnaires et encyclopedies (Dictionaries and Encyclopedias).

    Science.gov (United States)

    Ferran, Pierre

    1988-01-01

    Eight French dictionaries and encyclopedic reference books are reviewed, focusing on their formats, characteristics, and intended uses. They include references for language, geopolitics and economics, economic history, signs and symbols, and an almanac. (MSE)

  15. Researcher Story: Stuttering

    Medline Plus

    Full Text Available ... Contact Us More » Quick Links The NIH Director The NIH Almanac NIH…Turning Discovery Into Health ® Impact of NIH Research Science, Health, and Public Trust You are here Home » ...

  16. Talking to Your Doctor

    Medline Plus

    Full Text Available ... Contact Us More » Quick Links The NIH Director The NIH Almanac NIH…Turning Discovery Into Health ® Impact of NIH Research Science, Health, and Public Trust You are here Home » ...

  17. Researcher Story: Stuttering

    Medline Plus

    Full Text Available ... The NIH Director The NIH Almanac NIH…Turning Discovery Into Health ® Impact of NIH Research Science, Health, ... about NIDCD Stuttering Research The Long Road to Discovery: Stuttering Genes Turn Up in the Most Unexpected ...

  18. Underage Drinking

    Science.gov (United States)

    ... Organization Budget History NIH Almanac Public Involvement Outreach & Education Visitor Information RePORT ... Since Colonial times, drinking alcohol has been part of American culture and its use by young people has been accepted by many as part ...

  19. Obituary: Julena Steinheider Duncombe, 1911-2003

    Science.gov (United States)

    Seidelmann, P. Kenneth

    2004-12-01

    Julena Steinheider Duncombe died on 13 September 2003, just eight days before her 92nd birthday. Julena Steinheider was born September 21, 1911 on a farm in Dorchester, Nebraska and grew up in Goehner, Nebraska. Her parents were Frederick and Ella Beenders Steinheider, and she had four brothers. She began college at the age of 17 and graduated at 21 from Doane College in Crete, Nebraska with a major in mathematics and a minor in astronomy. She started teaching in a one-room schoolhouse, where, with assistance from her family, she started possibly the first school lunch program by fixing lunches on the schoolhouse stove to provide food for children who only had popcorn to eat. Then she taught in Minatare and Scotts Bluff, Nebraska, and in a Japanese Relocation Camp in Wyoming. In 1945 she moved to Washington DC to begin working at the US Naval Observatory (USNO). She was the first woman observer on the 6-inch transit circle. She worked as an observer and mathematician reducing and analyzing observations of the Sun, Moon, planets, and stars. At the Naval Observatory she met Raynor Duncombe and married him in Goehner, Nebraska, in January 1948. She resigned from the USNO in 1948 to go with her husband to Yale University. At Yale the Duncombes introduced punched card equipment into the Astronomy Department. Ray also took graduate classes and Julie worked on Astrographic Catalog reductions. Upon returning to USNO in 1950 she joined the Nautical Almanac Office. She supervised the punched card operated typewriter to produce tables of positions of celestial bodies for air and sea navigation. With Dorrit Hoffleit she directed the keypunching of over 150 star catalogs, approximating 1.5 million cards. Several thousand errata to the catalogs were discovered and corrected on the cards and tape versions of the catalogs. This activity was the basis for future stellar databases. From 1963 she was responsible for producing the tabular predictions and maps for solar and lunar

  20. Solar Eclipse Computer API: Planning Ahead for August 2017

    Science.gov (United States)

    Bartlett, Jennifer L.; Chizek Frouard, Malynda; Lesniak, Michael V.; Bell, Steve

    2016-01-01

    With the total solar eclipse of 2017 August 21 over the continental United States approaching, the U.S. Naval Observatory (USNO) on-line Solar Eclipse Computer can now be accessed via an application programming interface (API). This flexible interface returns local circumstances for any solar eclipse in JavaScript Object Notation (JSON) that can be incorporated into third-party Web sites or applications. For a given year, it can also return a list of solar eclipses that can be used to build a more specific request for local circumstances. Over the course of a particular eclipse as viewed from a specific site, several events may be visible: the beginning and ending of the eclipse (first and fourth contacts), the beginning and ending of totality (second and third contacts), the moment of maximum eclipse, sunrise, or sunset. For each of these events, the USNO Solar Eclipse Computer reports the time, Sun's altitude and azimuth, and the event's position and vertex angles. The computer also reports the duration of the total phase, the duration of the eclipse, the magnitude of the eclipse, and the percent of the Sun obscured for a particular eclipse site. On-line documentation for using the API-enabled Solar Eclipse Computer, including sample calls, is available (http://aa.usno.navy.mil/data/docs/api.php). The same Web page also describes how to reach the Complete Sun and Moon Data for One Day, Phases of the Moon, Day and Night Across the Earth, and Apparent Disk of a Solar System Object services using API calls.For those who prefer using a traditional data input form, local circumstances can still be requested that way at http://aa.usno.navy.mil/data/docs/SolarEclipses.php. In addition, the 2017 August 21 Solar Eclipse Resource page (http://aa.usno.navy.mil/data/docs/Eclipse2017.php) consolidates all of the USNO resources for this event, including a Google Map view of the eclipse track designed by Her Majesty's Nautical Almanac Office (HMNAO). Looking further ahead, a

  1. Review: Christine von Blanckenburg, Birgit Böhm, Hans-Luidger Dienel & Heiner Legewie (2005. Leitfaden für interdisziplinäre Forschergruppen: Projekte initiieren – Zusammenarbeit gestalten [Guidelines for Interdisciplinary Research Teams: Initiating Projects—Developing Cooperation

    Directory of Open Access Journals (Sweden)

    Iris Rittenhofer

    2008-01-01

    Full Text Available Today, project-oriented work is an integral part of academic life. However, not all academics are ready to cope with this organizational aspect of scientific work or with the management of research teams. "Guidelines for Interdisciplinary Research Teams" provides a detailed outline of the various project stages, the potential conflicts and burgeoning power issues, as well as the basics and techniques of moderation. This volume offers excellent insight into the scientific enterprise and provides useful strategic options for managing teamwork. Thus, the volume is suitable for two purposes, namely as a set of guidelines for those inexperienced in scientific cooperation, and as a reference book for those who want to master their previous project experiences and utilize them in future enterprises. However, the intercultural aspect of scientific project organization is not discussed in the volume. URN: urn:nbn:de:0114-fqs0801179

  2. Redistribuce hliníku a uhlíku ve svarech ocelí v intervalu teplot 500-1100 stupňů C (0,34 hm.

    Czech Academy of Sciences Publication Activity Database

    Stránský, K.; Million, Bořivoj; Foret, R.; Michalička, Petr; Rek, A.

    2003-01-01

    Roč. 76, č. 290 (2003), s. 213-221 ISSN 1429-6055. [Mezinárodní sympózium Struktura a vlastnosti konstrukčních materiálů /18./. Svratka, 25.11.2003-27.11.2003] R&D Projects: GA ČR GA106/01/0379; GA ČR GA106/01/0382 Institutional research plan: CEZ:AV0Z2041904 Keywords : aluminium and carbon diffusion * steel weldments Subject RIV: JG - Metallurgy

  3. Redistribuce hliníku a uhlíku ve svarech ocelí v intervalu teplot 500-1100 stupňů C (0,34 hm.

    Czech Academy of Sciences Publication Activity Database

    Stránský, K.; Million, Bořivoj; Foret, R.; Michalička, Petr; Rek, A.

    2003-01-01

    Roč. 76, č. 290 (2003), s. 213-216 ISSN 1429-6055. [Mezinárodní sympózium Struktura a vlastnosti konstrukčních materiálů /18./. Svratka, 25.11.2003-27.11.2003] R&D Projects: GA ČR GA106/01/0379; GA ČR GA106/01/0382 Institutional research plan: CEZ:AV0Z2041904 Keywords : aluminium and carbon diffusion * steel weldments Subject RIV: JG - Metallurgy

  4. Thermodynamic properties of (an ester+an alkane). XVII. Experimental HmE and VmE values for (an alkyl propanoate+an alkane) at 318.15K

    International Nuclear Information System (INIS)

    Ortega, J.; Espiau, F.; Toledo, F.J.; Dieppa, R.

    2005-01-01

    In this article, we record the experimental values of H m E and V m E , obtained at a temperature of T=318.15K and atmospheric pressure for a set of 30 binary mixtures comprised of five alkyl propanoates (methyl to pentyl) with six odd alkanes (heptane to heptadecane). The net values obtained for these properties are the result of different effects of the selected compounds on the mixing process. These effects and the variation with temperature are studied. The H m E are positive in all cases and increase with the saturated hydrocarbon chain and diminish with the alkanolic portion of the ester. The variation in V m E is similar to that occurring in the H m E . For the data correlation, a new form of polynomial equation is used in which the variable is the so-called active fraction which, in turn, is a function of the concentration of the mixture, giving acceptable estimations for simultaneous correlations between the values of Gibbs function obtained in the isobaric (liquid+vapour) equilibria and the enthalpies of the mixture, for some of the mixtures studied. The results are explained with the molecular model proposed for (ester+alkane) mixtures. Finally, the application of two versions of the UNIFAC groups contribution method to estimate enthalpies of the mixtures does not give satisfactory results, although the modified UNIFAC gives somewhat better results

  5. Evaluation of SPECT with N-isopropyl [I-123]-p-iodoamphetamine (IMP) or technetium-99m [99mTc]-d,1-hexamethyl-propyleneamine oxime (d,1-HM-PAO) in cerebral concussion patients

    International Nuclear Information System (INIS)

    Torigoe, Ryuichiro; Hayashi, Takashi; Anegawa, Shigetaka; Harada, Katsuhiko; Matsuo, Hiromasa; Yoshikawa, Ichiro.

    1991-01-01

    123 I-IMP and Tc-PAO SPECT were performed in 20 cases of cerebral concussion ranging in age from 4 to 20 years old, including six cases of the juvenile head trauma syndrome (JHTS). The SPECT findings were divided into two main types: six cases in the normal group with no blood flow abnormalities, and 14 cases in abnormal group showing reduced blood flow, mainly in cerebellum and occipital lobe except in one case. In 10 cases of reduced blood flow which could be analyzed, calculation of the blood flow ratio in the temporal and occipital lobes and the cerebellum with the frontal lobe taken as 100 showed values of 93.5% for the temporal lobe, 82.7% for the occipital lobe and 76.8% for the cerebellum. A statistically significant reduction in blood flow occurred in the occipital lobe and cerebellum. In blood examination, abnormally high values of white blood cell counts were observed transiently in 94% of cerebral concussion cases. Abnormalities in brain stem and hypothalamus appeared to cause these abnormal WBC values. From these findings, it was suggested that the blood flow regions of the basilar and posterior cerebral arteries, i.e., the brain stem and hypothalamus are closely connected with the lesions responsible for cerebral concussion. It also appeared that the JHTS occurs in cerebral concussion cases where recovery of the abnormal blood flow in these regions in poor. (author)

  6. 46 CFR 167.01-1 - Basis and purpose of part.

    Science.gov (United States)

    2010-10-01

    ... uniform application. This part is not applicable to civilian nautical school ships. [CGD 95-028, 62 FR... Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) NAUTICAL SCHOOLS PUBLIC NAUTICAL SCHOOL... are prescribed and apply to public nautical school ships, except vessels of the Navy or Coast Guard...

  7. All at sea without a clock - Longitude from lunar distances.

    Science.gov (United States)

    Floyd, D. J. E.

    2005-12-01

    I present a brief history of the ``Lunar Distance" technique for determining Longitude at sea, as developed by Astronomer Royal Neville Maskelyne (1732-1811) and others. I illustrate this history using images and results from a recent (2001) BBC History project to re-enact part of Captain James Cook's first voyage, from near-shipwreck on the east coast Australia, back to the relative safety of Batavia (modern-day Djakarta). I demonstrate the practical use of Lunars to determine longitude at sea, illustrated through comparison to GPS coordinates obtained along the voyage. During windows of lunar visibility, using new tables drawn up at HMNAO, we were able to match or exceed Maskelyne's stated accuracy of 30 nautical miles (0.5 degrees). Close to New Moon, dependent on our own skills of dead-reckoning, we prove far less able navigators than Cook and his cohort! I acknowledge the enormous assistance of Catherine Hohenkerk of the HMNAO, Tanya Batchelor of the BBC, George Huxtable, John Jeffrey, and John Selwyn-Gilbert in researching this subject. I gratefully acknowledge funding from the BBC, and HM Bark Endeavour Foundation for the use of their glorious ship, the Endeavour.

  8. Pre-astronomica navigation in antiquity: the use of birds for nautical orientation | La navegación pre-astronómica en la antigüedad: utilización de pájaros en la orientación náutica

    Directory of Open Access Journals (Sweden)

    José María Luzón Nogué

    1986-12-01

    Full Text Available This paper deals with the use of birds (ravens and doves as attendants of the sailors to search the coast from the sea. This use is documented since the III millennium B. C. in the Aegean Sea. The possibilities and limitations of this art of sailing are very important to the cultural interrelationship in the Mediterranean. An experience performed in 1986 has allowed us to verify the efficiency of the birds to guide sailors in high sea. The astronomical orientation assumes the possibility of big return routes, which are radically changing the cultural and economic panorama of the Mediterranean since the I millennium B. C. | El presente estudio reúne los datos referentes a la utilización de pájaros (preferentemente cuervos y palomas como auxiliares de los navegantes, para buscar la costa desde alta mar. Su utilización está documentada desde el tercer milenio a. C. en Oriente y durante el segundo milenio a. C. en el Egeo. De las posibilidades y limitaciones de esta forma de navegar depende en gran medida la interrelación cultural en el Mediterráneo. Un experimento practicado realizado en 1986 permite comprobar la eficacia de la suelta de aves para orientar a los navegantes que se pierden en alta mar. La orientación astronómica supone la posibilidad de grandes rutas de ida y vuelta que van a cambiar radicalmente el panorama cultural y económico del Mediterráneo a partir del primer milenio a. C.

  9. The interactive influence of water chemistry and nanoparticle characteristics in determining the environmental fate of metal-based nanoparticles: a case of nAg and nZnO

    CSIR Research Space (South Africa)

    Thwala, M

    2014-09-01

    Full Text Available . The NP concentration (number/mL) in 100HM remained relatively higher than in 50HM, more so for nAg. Such an observation suggested a stabilising effect in high ionic strength (IS) 100HM, such an effect was confirmed by lower dissolution in 100HM relative...

  10. Leptin Levels Are Higher in Whole Compared to Skim Human Milk, Supporting a Cellular Contribution.

    Science.gov (United States)

    Kugananthan, Sambavi; Lai, Ching Tat; Gridneva, Zoya; Mark, Peter J; Geddes, Donna T; Kakulas, Foteini

    2016-11-08

    Human milk (HM) contains a plethora of metabolic hormones, including leptin, which is thought to participate in the regulation of the appetite of the developing infant. Leptin in HM is derived from a combination of de novo mammary synthesis and transfer from the maternal serum. Moreover, leptin is partially lipophilic and is also present in HM cells. However, leptin has predominately been measured in skim HM, which contains neither fat nor cells. We optimised an enzyme-linked immunosorbent assay for leptin measurement in both whole and skim HM and compared leptin levels between both HM preparations collected from 61 lactating mothers. Whole HM leptin ranged from 0.2 to 1.47 ng/mL, whilst skim HM leptin ranged from 0.19 to 0.9 ng/mL. Whole HM contained, on average, 0.24 ± 0.01 ng/mL more leptin than skim HM ( p < 0.0001, n = 287). No association was found between whole HM leptin and fat content ( p = 0.17, n = 287), supporting a cellular contribution to HM leptin. No difference was found between pre- and post-feed samples (whole HM: p = 0.29, skim HM: p = 0.89). These findings highlight the importance of optimising HM leptin measurement and assaying it in whole HM to accurately examine the amount of leptin received by the infant during breastfeeding.

  11. Leptin Levels Are Higher in Whole Compared to Skim Human Milk, Supporting a Cellular Contribution

    Directory of Open Access Journals (Sweden)

    Sambavi Kugananthan

    2016-11-01

    Full Text Available Human milk (HM contains a plethora of metabolic hormones, including leptin, which is thought to participate in the regulation of the appetite of the developing infant. Leptin in HM is derived from a combination of de novo mammary synthesis and transfer from the maternal serum. Moreover, leptin is partially lipophilic and is also present in HM cells. However, leptin has predominately been measured in skim HM, which contains neither fat nor cells. We optimised an enzyme-linked immunosorbent assay for leptin measurement in both whole and skim HM and compared leptin levels between both HM preparations collected from 61 lactating mothers. Whole HM leptin ranged from 0.2 to 1.47 ng/mL, whilst skim HM leptin ranged from 0.19 to 0.9 ng/mL. Whole HM contained, on average, 0.24 ± 0.01 ng/mL more leptin than skim HM (p < 0.0001, n = 287. No association was found between whole HM leptin and fat content (p = 0.17, n = 287, supporting a cellular contribution to HM leptin. No difference was found between pre- and post-feed samples (whole HM: p = 0.29, skim HM: p = 0.89. These findings highlight the importance of optimising HM leptin measurement and assaying it in whole HM to accurately examine the amount of leptin received by the infant during breastfeeding.

  12. A conversation of a bookseller and a poet: А. Pluchart’s “Theater almanac” within the context of the early 19th c. theater critique

    Directory of Open Access Journals (Sweden)

    Ю. Ю. Полякова

    2014-07-01

    Full Text Available The article gives a general description of the “Theater Almanac” (1830, published by A. Pluchart, in comparison with other literary almanacs of the first third of the 19th century. Having analyzed the anonymous introductory note to the almanac, as well as A. Delvig’s critical review, the author brings forward a hypothesis that the note may have been written by A. Pluchart himself, or by R.M. Zotov, a writer of that period. The article also contains an assessment of the introductory note to the “Theater Almanac” as a source for studying the history of theater and theater critique in Russia.

  13. Herbal Medicines: challenges in the modern world. Part 5. status and current directions of complementary and alternative herbal medicine worldwide.

    Science.gov (United States)

    Enioutina, Elena Yu; Salis, Emma R; Job, Kathleen M; Gubarev, Michael I; Krepkova, Lubov V; Sherwin, Catherine M T

    2017-03-01

    Herbal medicine (HM) use is growing worldwide. Single herb preparations, ethnic and modern HM formulations are widely used as adjunct therapies or to improve consumer wellbeing. Areas covered: This final part in the publication series summarizes common tendencies in HM use as adjunct or alternative medicine, education of healthcare professionals and consumers, current and proposed guidelines regulating of production. We discuss potential HM-HM and HM-drug interactions that could lead to severe adverse events in situations where HMs are taken without proper medical professional oversight. Expert commentary: A number of serious problems have arisen with the steady global increase in HM use. HM interaction with conventional drugs (CD) may result in inadequate dosing of CD or adverse reactions; HM-HM interaction within herbal supplements could lead to toxicity of formulations. Inadequate education of clinicians and patients regarding medicinal properties of HMs must be addressed regionally and globally to ensure consumer safety.

  14. Celestial Navigation on the Surface of Mars

    Science.gov (United States)

    Malay, Benjamin P.

    2001-05-01

    A simple, accurate, and autonomous method of finding position on the surface of Mars currently does not exist. The goal of this project is to develop a celestial navigation process that will fix a position on Mars with 100-meter accuracy. This method requires knowing the position of the stars and planets referenced to the Martian surface with one arcsecond accuracy. This information is contained in an ephemeris known as the Aeronautical Almanac (from Ares, the god of war) . Naval Observatory Vector Astrometry Subroutines (NOVAS) form the basis of the code used to generate the almanac. Planetary position data come the JPL DE405 Planetary Ephemeris. The theoretical accuracy of the almanac is determined mathematically and compared with the Ephemeris for Physical Observations of Mars contained in the Astronautical Almanac. A preliminary design of an autonomous celestial navigation system is presented. Recommendations of how to integrate celestial navigation into NASA=s current Mars exploration program are also discussed. This project is a useful and much-needed first step towards establishing celestial navigation as a practical way to find position on the surface of Mars.

  15. Benjamin Banneker and the Law of Sines

    Science.gov (United States)

    Mahoney, John F.

    2005-01-01

    Benjamin Banneker, a self-taught mathematician, surveyor and astronomer published annual almanacs containing his astronomical observations and predictions. Banneker who also used logarithms to apply the Law of Sines believed that the method used to solve a mathematical problem depends on the tools available.

  16. Autosomal Dominant Polycystic Kidney Disease

    Science.gov (United States)

    ... NIH Director Organization Budget History NIH Almanac Public Involvement Outreach & Education Visitor Information RePORT NIH Fact Sheets Home > Autosomal ... other than the observation that 50 percent of children born to an affected parent would develop the disease. Diagnosis of well-established ...

  17. Military Review, December 1991. Volume 71, Volume 12

    Science.gov (United States)

    1991-12-01

    than 2 hours, 353 Japanese planes broke the 94 December 1991 * MILITARY REVIEW WWII ALMANAC spine of the Pacific Fleet by sinking or seriously dam... hedgehog defenses kov’s Western Front, with a combat strength of across the front and caught in encirclements of up to 388,000 men and 550 tanks

  18. Cost Efficiency in Public Higher Education.

    Science.gov (United States)

    Robst, John

    This study used the frontier cost function framework to examine cost efficiency in public higher education. The frontier cost function estimates the minimum predicted cost for producing a given amount of output. Data from the annual Almanac issues of the "Chronicle of Higher Education" were used to calculate state level enrollments at two-year and…

  19. Talking to Your Doctor

    Medline Plus

    Full Text Available ... The NIH Director The NIH Almanac NIH…Turning Discovery Into Health ® Impact of NIH Research Science, Health, ... General USA.gov – Government Made Easy NIH…Turning Discovery Into Health ® National Institutes of Health, 9000 Rockville ...

  20. Taking Care of Business: Bridging the Skills Gap

    Science.gov (United States)

    Gatewood, Algie

    2017-01-01

    This brief article describes how Alamance Community College, a mid-sized community college sandwiched between two of North Carolina's largest metropolitan markets in Raleigh-Durham and Greensboro-Winston-Salem, has developed several new study programs and initiatives to better service business and industry. Among other things, Almanac has…

  1. Eagle Heights Woods: Man's Use of Land.

    Science.gov (United States)

    Pratt, Cay; Nelson, Redgy

    This teacher's guide for use in the elementary grades was prepared as a result of the 1970 Local Materials Workshop on Outdoor Education, Madison, Wisconsin. It develops the concept of a land ethnic as expressed by Aldo Leopold in "A Sand County Almanac". A filmstrip is employed to discover the meaning of several words pertinent to…

  2. Researcher Story: Stuttering

    Medline Plus

    Full Text Available ... NCATS NCCIH OD About NIH Who We Are What We Do Jobs at NIH Visitor Information Frequently Asked Questions Contact Us More » Quick Links The NIH Director The NIH Almanac NIH…Turning Discovery Into Health ® Impact of NIH Research Science, Health, and Public Trust You are here Home » ...

  3. Talking to Your Doctor

    Medline Plus

    Full Text Available ... NCATS NCCIH OD About NIH Who We Are What We Do Jobs at NIH Visitor Information Frequently Asked Questions Contact Us More » Quick Links The NIH Director The NIH Almanac NIH…Turning Discovery Into Health ® Impact of NIH Research Science, Health, and Public Trust You are here Home » ...

  4. Retained satellite information influences performance of GPS devices in a forested ecosystem

    Science.gov (United States)

    Katie M. Moriarty; Clinton W. Epps

    2015-01-01

    Global Positioning System (GPS) units used in animal telemetry often suffer from nonrandom data loss and location error. GPS units use stored satellite information to estimate locations, including almanac and ephemeris data reflecting satellite positions at weekly and at <4-hr temporal scales, respectively. Using the smallest GPS collars (45–51 g) available for...

  5. Talking to Your Doctor

    Medline Plus

    Full Text Available ... The NIH Almanac NIH…Turning Discovery Into Health ® Impact of NIH Research Science, Health, and Public Trust ... NCCIH) Diabetes Questions to Ask about Your Diabetes Medicines Español More Information For more information about this ...

  6. Domestic Resistance: Gardening, Mothering, and Storytelling in Leslie Marmon Silko's "Gardens in the Dunes"

    Science.gov (United States)

    Li, Stephanie

    2009-01-01

    Leslie Marmon Silko began her most recent work, "Gardens in the Dunes" (1999), intending to write a novel that would not be political. Following the publication of "Almanac of the Dead" (1992), which was simultaneously hailed as one of the most important books of the twentieth century and condemned for its angry self-righteousness, Silko…

  7. Using ecological site information to improve landscape management for ecosystem services

    Science.gov (United States)

    People and their societies, have a complicated relationship with land. The unofficial patron saint of ecologists, Aldo Leopold, in “The Sand County Almanac,” traced the modern human relationship with land from a purely economic to an ecologically based approach, culminating in his “ Land Ethic.” In...

  8. Talking to Your Doctor

    Medline Plus

    Full Text Available ... The NIH Almanac NIH…Turning Discovery Into Health ® Impact of NIH Research Science, Health, and Public Trust ... 27, 2017 Connect with Us Contact Us Twitter Facebook Instagram YouTube Flickr More Social Media from NIH ...

  9. 46 CFR 168.01-1 - Purpose of regulations.

    Science.gov (United States)

    2010-10-01

    ... Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) NAUTICAL SCHOOLS CIVILIAN NAUTICAL SCHOOL... this part is to set forth uniform minimum requirements for vessels, whether being navigated or not, which are used by or in connection with any civilian nautical school, except vessels of the Navy or...

  10. 46 CFR 167.15-10 - Application for annual inspection.

    Science.gov (United States)

    2010-10-01

    ... NAUTICAL SCHOOL SHIPS Inspections § 167.15-10 Application for annual inspection. Application in writing for the annual inspection of every nautical school ship required to be inspected by law and the... Inspection, at any local Marine Inspection Office, U.S. Coast Guard, where the nautical school ship may be...

  11. 46 CFR 167.30-1 - Notice of repairs or alterations required.

    Science.gov (United States)

    2010-10-01

    ... Inspection, whenever repairs or alterations are required, or will be made on a nautical school ship. (b) Whenever a nautical school ship is placed upon the dock, it shall be the duty of the master, owner or agent... NAUTICAL SCHOOL SHIPS Repairs or Alterations § 167.30-1 Notice of repairs or alterations required. (a) It...

  12. 46 CFR 167.60-1 - Issuance by Officer in Charge, Marine Inspection.

    Science.gov (United States)

    2010-10-01

    ... SCHOOLS PUBLIC NAUTICAL SCHOOL SHIPS Certificates of Inspection § 167.60-1 Issuance by Officer in Charge, Marine Inspection. (a) Every nautical school ship shall be inspected annually and if in the opinion of the Officer in Charge, Marine Inspection, the nautical school ship can be operated safely, he shall...

  13. VizieR Online Data Catalog: Uranometria Argentina catalog of bright southern stars (Gould, 1879)

    Science.gov (United States)

    Gould, B. G.

    2010-07-01

    In 1879 Benjamin Apthorp Gould published in Buenos Aires, Argentina, the Uranometria Argentina catalog of 7756 stars south of declination +10 degrees. This included all those stars he considered magnitude 7 or brighter and some fainter stars which are close companions to brighter stars or to each other and have combined magnitude 7 or brighter. Star positions are in 1875 coordinates, and constellation boundaries also in 1875 coordinates were defined within the aforementioned declination range. With only a few small changes these were incorporated into the boundaries adopted by the IAU in 1930 and subsequently universally accepted. In terms of accurate photoelectric magnitude measurements the Uranometria Argentina is nearly complete to magnitude 6.5 in its declination range. In each constellation the individual stars considered to be magnitude 7 and brighter were numbered in sequence of increasing right ascension in 1875 coordinates, except that in a few cases this sequence was somewhat adjusted so that stars close together could be listed on adjacent lines of text. The numbering system is analogous to that in the Flamsteed Catalogus Brittanicus and now widely used. Star numbers from the Uranometria Argentina rarely appear in the 21st century despite the potential utility of their use. They were included in the American Ephemeris and Nautical Almanac until 1978, and in the FK5 catalog until 1999, always with the letter G following the number in the Uranometria Argentina catalog. This serves to distinguish Flamsteed numbers with no following letters from Gould numbers, and is utilized in this presentation and recommended for general use. The file catalog.dat includes every star in the original Uranometria Argentina. In the original the constellations were presented in sequence of increasing distance from the south pole and numbered accordingly. For the convenience of 21st century astronomers the constellations are presented here by alphabetical sequence in

  14. Efficacy and Safety of Peroral Endoscopic Myotomy for Treatment of Achalasia After Failed Heller Myotomy.

    Science.gov (United States)

    Ngamruengphong, Saowanee; Inoue, Haruhiro; Ujiki, Michael B; Patel, Lava Y; Bapaye, Amol; Desai, Pankaj N; Dorwat, Shivangi; Nakamura, Jun; Hata, Yoshitaka; Balassone, Valerio; Onimaru, Manabu; Ponchon, Thierry; Pioche, Mathieu; Roman, Sabine; Rivory, Jérôme; Mion, François; Garros, Aurélien; Draganov, Peter V; Perbtani, Yaseen; Abbas, Ali; Pannu, Davinderbir; Yang, Dennis; Perretta, Silvana; Romanelli, John; Desilets, David; Hayee, Bu; Haji, Amyn; Hajiyeva, Gulara; Ismail, Amr; Chen, Yen-I; Bukhari, Majidah; Haito-Chavez, Yamile; Kumbhari, Vivek; Saxena, Payal; Talbot, Michael; Chiu, Philip Wai-Yan; Yip, Hon-Chi; Wong, Vivien Wai-Yin; Hernaez, Ruben; Maselli, Roberta; Repici, Alessandro; Khashab, Mouen A

    2017-10-01

    In patients with persistent symptoms after Heller myotomy (HM), treatment options include repeat HM, pneumatic dilation, or peroral endoscopic myotomy (POEM). We evaluated the efficacy and safety of POEM in patients with achalasia with prior HM vs without prior HM. We conducted a retrospective cohort study of 180 patients with achalasia who underwent POEM at 13 tertiary centers worldwide, from December 2009 through September 2015. Patients were divided into 2 groups: those with prior HM (HM group, exposure; n = 90) and those without prior HM (non-HM group; n = 90). Clinical response was defined by a decrease in Eckardt scores to 3 or less. Adverse events were graded according to criteria set by the American Society for Gastrointestinal Endoscopy. Technical success, clinical success, and rates of adverse events were compared between groups. Patients were followed up for a median of 8.5 months. POEM was technically successful in 98% of patients in the HM group and in 100% of patients in the non-HM group (P = .49). A significantly lower proportion of patients in the HM group had a clinical response to POEM (81%) than in the non-HM group (94%; P = .01). There were no significant differences in rates of adverse events between the groups (8% in the HM group vs 13% in the non-HM group; P = .23). Symptomatic reflux and reflux esophagitis after POEM were comparable between groups. POEM is safe and effective for patients with achalasia who were not treated successfully by prior HM. Although the rate of clinical success in patients with prior HM is lower than in those without prior HM, the safety profile of POEM is comparable between groups. Copyright © 2017 AGA Institute. Published by Elsevier Inc. All rights reserved.

  15. Characterization and phylogenetic analysis of α-gliadin gene ...

    Indian Academy of Sciences (India)

    2014-12-01

    Dec 1, 2014 ... 1School of Life Science and Technology, University of Electronic Science and Technology of China,. Chengdu .... Fifteen positive clones were sequenced on an automatic ... NCBI GenBank (HM188546 to HM188559) was car-.

  16. Osteomalacia

    Science.gov (United States)

    ... tests will be done to check vitamin D, creatinine, calcium, phosphate , electrolytes, alkaline phosphatase, and parathyroid hormone ... MB, Kronenberg HM. Hormones and disorders of mineral metabolism. In: Melmed S, Polonsky KS, Larsen PR, Kronenberg HM, ...

  17. What causes bone loss?

    Science.gov (United States)

    ... Paula FJA, Black DM, Rosen CJ. Osteoporosis and bone biology. In: Melmed S, Polonsky KS, Larsen PR, Kronenberg HM, eds. Williams Textbook of Endocrinology . 13th ed. Philadelphia, PA: ... HM. Bone development and remodeling. In: Jameson JL, De Groot ...

  18. Thermodynamic study of (alkyl esters+α,ω-alkyl dihalides) III. HmEandVmE for 20 binary mixtures {xCu-1H2u-1CO2C4H9+(1-x)α,ω-ClCH2(CH2)v-2CH2Cl}, where u=1 to 4, α=1 and v=ω=2 to 6

    International Nuclear Information System (INIS)

    Ortega, J.; Marrero, E.; Toledo, F.J.

    2006-01-01

    In this article, the experimental data of excess molar enthalpies H m E and excess molar volumes V m E are presented for a set of 20 binary mixtures comprised of the first four butyl alkanoates (methanoate to butanoate) and five α,ω-dichloroalkanes (1,2-dichloroethane to 1,6-dichlorohexane), obtained at atmospheric pressure and at a temperature of 298.15K. The results indicate the existence of specific interactions between both kinds of compounds resulting in exothermic processes for most mixtures, except for those containing butyl methanoate which give rise to net endo/exothermic effects. The V m E are positive for mixtures of (butyl esters+1,2-dichloroethane or 1,3-dichloropropane) and negative for the remaining ones. The change in H m E with the dichloroethane chain length for a same ester is regular although the V m E presents an irregular variation. It can, therefore, be deuced from this that the mixing process involves both effects, exothermic/endothermic and expansion/contraction, simultaneously. The behaviour of the mixtures is interpreted on the basis of the results observed and attributed to different effects taking place among the molecules studied. To improve application of the UNIFAC model using the version of Dang and Tassios, average values were recalculated again for parameters of the ester/chloride interaction, distinguishing, during its application, the functional group of the acid part of the ester. In spite of this, the model does not adequately reproduce the systems' behaviour.

  19. Estudio mediante teoría de funcionales de la densidad de las propiedades electrónicas, estructurales y energéticas de complejos organometálicos de cúmulos de hierro con benceno en fase gaseosa : fen(c6h&)m, n<=7, m>=4 /

    OpenAIRE

    Valencia Quiroz, Israel

    2012-01-01

     tesis que para obtener el grado de Doctorado en Ciencias Químicas, presenta Israel Valencia Quiroz ; asesor Miguel Castro Martínez149 páginas : ilustracionesDoctorado en Ciencias Químicas UNAM, Facultad de Química, 2012

  20. Compensatory structural and functional adaptation after radical nephrectomy for renal cell carcinoma according to preoperative stage of chronic kidney disease. Choi DK, Jung SB, Park BH, Jeong BC, Seo SI, Jeon SS, Lee HM, Choi HY, Jeon HG.J Urol. 2015 Oct;194(4):910-5. [Epub 2015 Apr 28]. doi: 10.1016/j.juro.2015.04.093.

    Science.gov (United States)

    Jay, Raman; Jung, S B; Park, B H; Jeong, B C; Seo, S I; Jeon, S S; Lee, H M; Choi, H Y; Jeon, H G

    2017-03-01

    We investigated structural hypertrophy and functional hyperfiltration as compensatory adaptations after radical nephrectomy in patients with renal cell carcinoma according to the preoperative chronic kidney disease stage. We retrospectively identified 543 patients who underwent radical nephrectomy for renal cell carcinoma between 1997 and 2012. Patients were classified according to preoperative glomerular filtration rate as no chronic kidney disease-glomerular filtration rate 90ml/min/1.73m 2 or greater (230, 42.4%), chronic kidney disease stage II-glomerular filtration rate 60 to less than 90ml/min/1.73m 2 (227, 41.8%), and chronic kidney disease stage III-glomerular filtration rate 30 to less than 60ml/min/1.73m 2 (86, 15.8%). Computerized tomography performed within 2 months before surgery and 1 year after surgery was used to assess functional renal volume for measuring the degree of hypertrophy of the remnant kidney, and the preoperative and postoperative glomerular filtration rate per unit volume of functional renal volume was used to calculate the degree of hyperfiltration. Among all patients (mean age = 56.0y) mean preoperative glomerular filtration rate, functional renal volume, and glomerular filtration rate/functional renal volume were 83.2ml/min/1.73m 2 , 340.6cm 3 , and 0.25ml/min/1.73m 2 /cm 3 , respectively. The percent reduction in glomerular filtration rate was statistically significant according to chronic kidney disease stage (no chronic kidney disease 31.2% vs. stage II 26.5% vs. stage III 12.8%, P<0.001). However, the degree of hypertrophic functional renal volume in the remnant kidney was not statistically significant (no chronic kidney disease 18.5% vs. stage II 17.3% vs. stage III 16.5%, P = 0.250). The change in glomerular filtration rate/functional renal volume was statistically significant (no chronic kidney disease 18.5% vs. stage II 20.1% vs. stage III 45.9%, P<0.001). Factors that increased glomerular filtration rate/functional renal volume above the mean value were body mass index (P = 0.012), diabetes mellitus (P = 0.023), hypertension (P = 0.015), and chronic kidney disease stage (P<0.001). Patients with a lower preoperative glomerular filtration rate had a smaller reduction in postoperative renal function than those with a higher preoperative glomerular filtration rate due to greater degrees of functional hyperfiltration. Copyright © 2017. Published by Elsevier Inc.

  1. Alleviation of Heavy Metal Stress in Plants and Remediation of Soil by Rhizosphere Microorganisms

    OpenAIRE

    Mishra, Jitendra; Singh, Rachna; Arora, Naveen K.

    2017-01-01

    Increasing concentration of heavy metals (HM) due to various anthropogenic activities is a serious problem. Plants are very much affected by HM pollution particularly in contaminated soils. Survival of plants becomes tough and its overall health under HM stress is impaired. Remediation of HM in contaminated soil is done by physical and chemical processes which are costly, time-consuming, and non-sustainable. Metal–microbe interaction is an emerging but under-utilized technology that can be ex...

  2. ÜhesHingamise peol Tallinnas on Pala valla kultuurisaadikuks kolm rahvatantsurühma / Jaan Lukas

    Index Scriptorium Estoniae

    Lukas, Jaan, 1964-

    2009-01-01

    2.- 5. juulini Tallinnas toimuval tantsupeol "ÜhesHingamine" esinevad Anna Haava nimelise Pala Kooli kaheksandate ja üheksandate klasside segarühm (juhendaja on kooli direktor Malle Weinrauch), Pala Kultuurimaja segarühm (juhendaja M. Weinrauch) ja Ranna naisrühm Lahe (juhendaja Julia Tross). Laulupeost võtab osa Pala Kultuurimaja segakoor

  3. Breast milk nutrient content and infancy growth

    NARCIS (Netherlands)

    Prentice, Philippa; Ong, Ken K.; Schoemaker, Marieke H.; Tol, van Eric A.F.; Vervoort, Jacques; Hughes, Ieuan A.; Acerini, Carlo L.; Dunger, David B.

    2016-01-01

    Aim: Benefits of human breast milk (HM) in avoiding rapid infancy weight gain and later obesity could relate to its nutrient content. We tested the hypothesis that differential HM total calorie content (TCC) or macronutrient contents may be associated with infancy growth. Methods: HM hindmilk

  4. Analysis of DNA Hydroxymethylation Using Colorimetric Assay.

    Science.gov (United States)

    Golubov, Andrey; Kovalchuk, Igor

    2017-01-01

    Hydroxymethylcytosine (hmC or 5-hmC) is a nitrogen base occurring as a result of cytosine methylation followed by replacing a methyl group with a hydroxyl group through active oxidation. 5-hmC is considered to be one of the forms of epigenetic modification and is suggested as an intermediate step in a semi-active loss of DNA methylation mark. 5-hmC plays an important role in the epigenetic regulation of gene expression in animals, although its role in plants remains controversial. Here, we present a colorimetric method of quantification of 5-hmC using Brassica rapa DNA.

  5. FCJ-183 iHootenanny: A Folk Archeology of Social Media

    Directory of Open Access Journals (Sweden)

    Henry Adam Svec

    2016-02-01

    Full Text Available This paper excavates two models of communication that can be found littered across the intertwining histories of folk revivalism and digital culture in the United States. First I examine the Hootenanny, initially a form of rent party made popular in New York City in the 1940s by the group the Almanac Singers, which constituted a complex site of convergence of a range interests, styles, media, and performance genres. Second, I explore how the utopian vision of a community joined in song has been taken up recently by ‘social music’ iPhone apps made by the developer Smule. I will ultimately consider how the mediation idealised by the Almanacs has trickled down to a narcissistic will-to-be-‘in touch’ in mainstream digital culture, making the Hootenanny a virtual path untaken in the history of mobile communication.

  6. Highly efficient PCR assay to discriminate allelic DNA methylation status using whole genome amplification

    Directory of Open Access Journals (Sweden)

    Ito Takashi

    2011-06-01

    Full Text Available Abstract Background We previously developed a simple method termed HpaII-McrBC PCR (HM-PCR to discriminate allelic methylation status of the genomic sites of interest, and successfully applied it to a comprehensive analysis of CpG islands (CGIs on human chromosome 21q. However, HM-PCR requires 200 ng of genomic DNA to examine one target site, thereby precluding its application to such samples that are limited in quantity. Findings We developed HpaII-McrBC whole-genome-amplification PCR (HM-WGA-PCR that uses whole-genome-amplified DNA as the template. HM-WGA-PCR uses only 1/100th the genomic template material required for HM-PCR. Indeed, we successfully analyzed 147 CGIs by HM-WGA-PCR using only ~300 ng of DNA, whereas previous HM-PCR study had required ~30 μg. Furthermore, we confirmed that allelic methylation status revealed by HM-WGA-PCR is identical to that by HM-PCR in every case of the 147 CGIs tested, proving high consistency between the two methods. Conclusions HM-WGA-PCR would serve as a reliable alternative to HM-PCR in the analysis of allelic methylation status when the quantity of DNA available is limited.

  7. Heavy metal phytoremediation from a meta-analytical perspective

    Energy Technology Data Exchange (ETDEWEB)

    Audet, Patrick [Ottawa-Carleton Institute of Biology, Department of Biology, University of Ottawa, 30 Marie-Curie St., Ottawa, Ont. K1N 6N5 (Canada)]. E-mail: paude086@uottawa.ca; Charest, Christiane [Ottawa-Carleton Institute of Biology, Department of Biology, University of Ottawa, 30 Marie-Curie St., Ottawa, Ont. K1N 6N5 (Canada)]. E-mail: ccharest@science.uottawa.ca

    2007-05-15

    We conducted a literature survey and correlated heavy metal (HM) uptake and plant growth factors from published data to estimate the effectiveness of phytoextraction. The indicators of the actual plant HM uptake showed positive correlations with soil-HM concentrations, while the relative plant HM uptake showed negative correlations. Plant growth was negatively correlated with both the plant and soil-HM concentrations. These significant relationships were found for the majority of HM tested (e.g. Zn, Cd, Pb, Cu, Cr, and Fe) with a few exceptions (e.g. Ni, Co, and Mn). After fitting the correlation coefficients, the highest proportion of variance among the studies was mainly due to the experimental parameters or the plant species. When the metabolic costs of HM uptake are taken into account, the phytoextraction appears to be less effective beyond critical HM concentrations. Despite these constraints, it is emphasized that HM phytoextraction can play an important role in bioremediation. - This meta-analytical approach has revealed a compromise between growth and HM uptake when plants are subjected to toxic soil-HM levels.

  8. Heavy metal phytoremediation from a meta-analytical perspective

    International Nuclear Information System (INIS)

    Audet, Patrick; Charest, Christiane

    2007-01-01

    We conducted a literature survey and correlated heavy metal (HM) uptake and plant growth factors from published data to estimate the effectiveness of phytoextraction. The indicators of the actual plant HM uptake showed positive correlations with soil-HM concentrations, while the relative plant HM uptake showed negative correlations. Plant growth was negatively correlated with both the plant and soil-HM concentrations. These significant relationships were found for the majority of HM tested (e.g. Zn, Cd, Pb, Cu, Cr, and Fe) with a few exceptions (e.g. Ni, Co, and Mn). After fitting the correlation coefficients, the highest proportion of variance among the studies was mainly due to the experimental parameters or the plant species. When the metabolic costs of HM uptake are taken into account, the phytoextraction appears to be less effective beyond critical HM concentrations. Despite these constraints, it is emphasized that HM phytoextraction can play an important role in bioremediation. - This meta-analytical approach has revealed a compromise between growth and HM uptake when plants are subjected to toxic soil-HM levels

  9. Hospital Medicine Resident Training Tracks: Developing the Hospital Medicine Pipeline.

    Science.gov (United States)

    Sweigart, Joseph R; Tad-Y, Darlene; Kneeland, Patrick; Williams, Mark V; Glasheen, Jeffrey J

    2017-03-01

    Hospital medicine (HM) is rapidly evolving into new clinical and nonclinical roles. Traditional internal medicine (IM) residency training likely does not optimally prepare residents for success in HM. Hospital medicine residency training tracks may offer a preferred method for specialized HM education. Internet searches and professional networks were used to identify HM training tracks. Information was gathered from program websites and discussions with track directors. The 11 HM tracks at academic medical centers across the United States focus mostly on senior residents. Track structure and curricular content are determined largely by the structure and curricula of the IM residency programs in which they exist. Almost all tracks feature experiential quality improvement projects. Content on healthcare economics and value is common, and numerous track leaders report this content is expanding from HM tracks into entire residency programs. Tracks also provide opportunities for scholarship and professional development, such as workshops on abstract creation and job procurement skills. Almost all tracks include HM preceptorships as well as rotations within various disciplines of HM. HM residency training tracks focus largely on quality improvement, health care economics, and professional development. The structures and curricula of these tracks are tightly linked to opportunities within IM residency programs. As HM continues to evolve, these tracks likely will expand to bridge clinical and extra-clinical gaps between traditional IM training and contemporary HM practice. Journal of Hospital Medicine 2017;12:173-176. © 2017 Society of Hospital Medicine

  10. Production and characterization of biodiesel derived from Hodgsonia macrocarpa seed oil

    International Nuclear Information System (INIS)

    Cao, Leichang; Zhang, Shicheng

    2015-01-01

    Highlights: • The oil content of HM seed was 71.65 wt%. The HM biodiesel yield was 95.46 wt%. • HM biodiesel satisfied ASTM D6751 and EN 14214 standards, with the exception of OS. • The transportation safety and cold flow properties of HM biodiesel were excellent. • After treatment with 400 ppm TBHQ, the OS of HM biodiesel satisfied EN 14214. - Abstract: Using inexpensive and high-quality oil feedstock is an effective means to produce low-cost biodiesel. This work investigated the production and fuel properties of biodiesel derived from Hodgsonia macrocarpa (HM). The oil content of HM seed was 71.65 wt%, which is much higher than that of many potential oil plants. With traditional base-catalyzed transesterification, biodiesel was readily prepared from HM seed oil. The biodiesel yield was 95.46 wt% from HM seed oil. Biodiesel derived from HM met all ASTM D6751 and EN 14214 specifications, except for oxidative stability (OS). The OS specifications of the two biodiesel standards were met after treatment of HM biodiesel with 400 ppm tertbutyl hydroquinone. The biodiesel exhibited excellent transportation safety and cold flow properties, with flash point of 153 °C, pour point of −9 °C, and cold filter plugging point of −7 °C

  11. Dynamics of arbuscular mycorrhizal symbiosis in heavy metal phytoremediation: Meta-analytical and conceptual perspectives

    Energy Technology Data Exchange (ETDEWEB)

    Audet, Patrick [Ottawa-Carleton Institute of Biology, Department of Biology, University of Ottawa, 30 Marie-Curie Street, Ottawa, ON, K1N 6N5 (Canada)]. E-mail: paude086@uottawa.ca; Charest, Christiane [Ottawa-Carleton Institute of Biology, Department of Biology, University of Ottawa, 30 Marie-Curie Street, Ottawa, ON, K1N 6N5 (Canada)]. E-mail: ccharest@science.uottawa.ca

    2007-06-15

    To estimate dynamics of arbuscular mycorrhizal (AM) symbiosis in heavy metal (HM) phytoremediation, we conducted a literature survey and correlated HM uptake and relative plant growth parameters from published data. After estimating AM feedback responses for these parameters at low and high soil-HM concentration intervals, we determined that the roles of AM symbiosis are characterized by (1) an increased HM phytoextraction via mycorrhizospheric 'Enhanced Uptake' at low soil-HM concentrations, and (2) a reduced HM bioavailability via AM fungal 'Metal-Binding' processes at high soil-HM levels, hence resulting in increased plant biomass and enhanced plant tolerance through HM stress-avoidance. We present two conceptual models which illustrate the important compromise between plant growth, plant HM uptake and HM tolerance, and further emphasize the importance of AM symbiosis in buffering the soil environment for plants under such stress conditions. - This meta-analysis has revealed a transition role of the AM symbiosis in phytoremediation shifting from 'Enhanced Uptake' to 'Metal-Binding' beyond critical soil-HM levels.

  12. Dynamics of arbuscular mycorrhizal symbiosis in heavy metal phytoremediation: Meta-analytical and conceptual perspectives

    International Nuclear Information System (INIS)

    Audet, Patrick; Charest, Christiane

    2007-01-01

    To estimate dynamics of arbuscular mycorrhizal (AM) symbiosis in heavy metal (HM) phytoremediation, we conducted a literature survey and correlated HM uptake and relative plant growth parameters from published data. After estimating AM feedback responses for these parameters at low and high soil-HM concentration intervals, we determined that the roles of AM symbiosis are characterized by (1) an increased HM phytoextraction via mycorrhizospheric 'Enhanced Uptake' at low soil-HM concentrations, and (2) a reduced HM bioavailability via AM fungal 'Metal-Binding' processes at high soil-HM levels, hence resulting in increased plant biomass and enhanced plant tolerance through HM stress-avoidance. We present two conceptual models which illustrate the important compromise between plant growth, plant HM uptake and HM tolerance, and further emphasize the importance of AM symbiosis in buffering the soil environment for plants under such stress conditions. - This meta-analysis has revealed a transition role of the AM symbiosis in phytoremediation shifting from 'Enhanced Uptake' to 'Metal-Binding' beyond critical soil-HM levels

  13. Role of Ethylene and Its Cross Talk with Other Signaling Molecules in Plant Responses to Heavy Metal Stress1

    Science.gov (United States)

    Thao, Nguyen Phuong; Khan, M. Iqbal R.; Thu, Nguyen Binh Anh; Hoang, Xuan Lan Thi; Asgher, Mohd; Khan, Nafees A.; Tran, Lam-Son Phan

    2015-01-01

    Excessive heavy metals (HMs) in agricultural lands cause toxicities to plants, resulting in declines in crop productivity. Recent advances in ethylene biology research have established that ethylene is not only responsible for many important physiological activities in plants but also plays a pivotal role in HM stress tolerance. The manipulation of ethylene in plants to cope with HM stress through various approaches targeting either ethylene biosynthesis or the ethylene signaling pathway has brought promising outcomes. This review covers ethylene production and signal transduction in plant responses to HM stress, cross talk between ethylene and other signaling molecules under adverse HM stress conditions, and approaches to modify ethylene action to improve HM tolerance. From our current understanding about ethylene and its regulatory activities, it is believed that the optimization of endogenous ethylene levels in plants under HM stress would pave the way for developing transgenic crops with improved HM tolerance. PMID:26246451

  14. Can Smartphones and Tablets Improve the Management of Childhood Illness in Tanzania? A Qualitative Study froma Primaryhealth Care worker’s Perspective

    OpenAIRE

    Shao, Amani Flexson; Rambaud-Althaus, Clotilde; Swai, Ndeniria; Kahama-Maro, Judith; Genton, Blaise; D’Acremont, Valerie; Pfeiffer, Constanze

    2015-01-01

    The impact of the Integrated Management of Childhood Illness (IMCI) strategy has been less than anticipated because of poor uptake. Electronic algorithms have the potential to improve quality of health care in children. However, feasibility studies about the use of electronic protocols on mobile devices over time are limited. This study investigated constraining as well as facilitating factors that influence the uptake of a new electronic Algorithm for Management of Childhood Illness (ALMANAC...

  15. An Ecological Probe into Land Ethics by Aldo Leopold

    Institute of Scientific and Technical Information of China (English)

    白虎跃

    2015-01-01

    Aldo Leopold has gained considerable repute as the initiator of eco-conservationism and been globally known as the father of American wilderness governance.“Land ethics”,which possesses paramount importance to eco-systems,is brought forth in his Sand Country Almanac.This thesis mainly touches upon the engendering,contents and significance of the thoughts to nowadays society by means of which the contemporary values of ecological civilization embodied in“land ethics”can be concluded provokingly.

  16. Fate of nitrogen in soil-crop system by nuclear techniques. Effects of applied rate of ammonium bicarbonate

    International Nuclear Information System (INIS)

    Chen Qing

    1996-11-01

    The experiment was conducted with 15 N tracing techniques in Shijiazhuang from 1994 to 1995. Three nitrogen rates, including optimum rate (150 kg/hm 2 ) based on the recommendation of local farmers, above 50% of optimum rate (225 kg/hm 2 ) and below 50% of optimum rate (75 kg/hm 2 ), were selected to study the effect of application rates of ammonium bicarbonate on yield of winter wheat and fate of applied nitrogen under local management and irrigated condition. The results showed that nitrogen uptake and grain yield of wheat under fertilized treatments were higher than those in unfertilized treatment (except 225 kg/hm 2 treatment). The highest yield and top dry mater weight (grain 6.80 t/hm 2 , top 14.70 t/hm 2 ) were obtained in optimum N applied treatment (150 kg/hm 2 ), while the highest nitrogen recovery efficiency (38.5%) of ammonium bicarbonate by winter wheat was found in below 50% of optimum rate treatment (75 kg/hm 2 ) due to the relatively high basic fertility of the field. However, nitrogen recovery efficiency of ammonium bicarbonate decreased with the increasing N application rate. The highest residue of fertilizer N was found in 225 kg/hm 2 treatment, and 46% of the residue existed in the top layer of the soil (0∼50 cm). The unaccounted N from fertilizer were 30.20%, 36.56%, 31.25% in 75 kg/hm 2 , 150 kg/hm 2 , 225 kg/hm 2 treatments respectively according to 15 N balance calculation in soil-plant system. The effect of residue N in soil on the next crop, maize, in 225 kg/hm 2 treatment was best in three fertilized treatments, suggesting the possibilities of nitrate leaching down in 225 kg/hm 2 treatment. (15 tabs.)

  17. Regional Sediment Management Studies of Matagorda Ship Channel and Matagorda Bay System, Texas

    Science.gov (United States)

    2013-08-01

    undisturbed free water surface.” The USACE presently has no standardized method to measure the fluid mud to determine nautical depth. The Engineer Manual...structural member in the bottom of the hull and channel bottom) is used to account for parameters such as ship motion from waves, squat , safety...distance between the nautical bottom and undisturbed free water surface. To complete the definition of nautical bottom, the physical characteristic(s) on

  18. Long-term activation upon brief exposure to xanomleline is unique to M1 and M4 subtypes of muscarinic acetylcholine receptors.

    Directory of Open Access Journals (Sweden)

    Eva Šantrůčková

    Full Text Available Xanomeline is an agonist endowed with functional preference for M1/M4 muscarinic acetylcholine receptors. It also exhibits both reversible and wash-resistant binding to and activation of these receptors. So far the mechanisms of xanomeline selectivity remain unknown. To address this question we employed microfluorometric measurements of intracellular calcium levels and radioligand binding to investigate differences in the short- and long-term effects of xanomeline among muscarinic receptors expressed individually in Chinese hamster ovary cells. 1/One-min exposure of cells to xanomeline markedly increased intracellular calcium at hM1 and hM4, and to a lesser extent at hM2 and hM3 muscarinic receptors for more than 1 hour. 2/Unlike the classic agonists carbachol, oxotremorine, and pilocarpine 10-min exposure to xanomeline did not cause internalization of any receptor subtype. 3/Wash-resistant xanomeline selectively prevented further increase in intracellular calcium by carbachol at hM1 and hM4 receptors. 4/After transient activation xanomeline behaved as a long-term antagonist at hM5 receptors. 5/The antagonist N-methylscopolamine (NMS reversibly blocked activation of hM1 through hM4 receptors by xanomeline. 6/NMS prevented formation of xanomeline wash-resistant binding and activation at hM2 and hM4 receptors and slowed them at hM1, hM3 and hM5 receptors. Our results show commonalities of xanomeline reversible and wash-resistant binding and short-time activation among the five muscarinic receptor subtypes. However long-term receptor activation takes place in full only at hM1 and hM4 receptors. Moreover xanomeline displays higher efficacy at hM1 and hM4 receptors in primary phasic intracellular calcium release. These findings suggest the existence of particular activation mechanisms specific to these two receptors.

  19. Classification of hydromagnetic emissions based on frequency--time spectra

    International Nuclear Information System (INIS)

    Fukunishi, H.; Toya, T.; Koike, K.; Kuwashima, M.; Kawamura, M.

    1981-01-01

    By using 3035 hydromagnetic emission events observed in the frequency range of 0.1--2.0 Hz at Syowa (Lapprox.6), HM emissions have been classified into eight subtypes based on their spectral structures, i.e., HM whistler, periodic HM emission, HM chorus, HM emission burst, IPDP, morning IPDP, Pc 1--2 band, and irregular HM emission. It is seen that each subtype has a preferential magnetic local time interval and also a frequency range for its occurrence. Morning IPDP events and irregular HM emissions occur in the magnetic morning hours, while dispersive periodic HM emissions and HM emission bursts occur around magnetic local noon, then HM chorus emissions occur in the afternoon hours and IPDP events occur in the evening hours. Furthermore, it is noticed that the mid-frequencies of these emissions vary from high frequencies in the morning hours to low frequencies in the afternoon hours. On the basis of these results, the generation mechanisms of each subtype are discussed

  20. Genotypic and environmental variation in cadmium, chromium, lead and copper in rice and approaches for reducing the accumulation

    Energy Technology Data Exchange (ETDEWEB)

    Cao, Fangbin; Wang, Runfeng [Institute of Crop Science, Department of Agronomy, College of Agriculture and Biotechnology, Zijingang Campus, Zhejiang University, Hangzhou 310058 (China); Cheng, Wangda [Jiaxing Academy of Agricultural Sciences, Jiaxing 314016 (China); Zeng, Fanrong; Ahmed, Imrul Mosaddek; Hu, Xinna; Zhang, Guoping [Institute of Crop Science, Department of Agronomy, College of Agriculture and Biotechnology, Zijingang Campus, Zhejiang University, Hangzhou 310058 (China); Wu, Feibo, E-mail: wufeibo@zju.edu.cn [Institute of Crop Science, Department of Agronomy, College of Agriculture and Biotechnology, Zijingang Campus, Zhejiang University, Hangzhou 310058 (China)

    2014-10-15

    The field scale trials revealed significant genotypic and environmental differences in grain heavy metal (HM) concentrations of 158 newly developed rice varieties grown in twelve locations of Zhejiang province of China. Grain Pb and Cd contents in 5.3% and 0.4% samples, respectively, were above the maximum permissible concentration (MPC); none of samples had Cr/Cu exceeding MPC. Stepwise multiple linear regression analysis estimated soil HM critical levels for safe rice production. Low grain HM accumulation cultivars such as Xiushui817, Jiayou08-1 and Chunyou689 were recommended as suitable cultivars for planting in slight/medium HM contaminated soils. The alleviating regulator (AR) of (NH{sub 4}){sub 2}SO{sub 4} as N fertilizer coupled with foliar spray of a mixture containing glutathione (GSH), Si, Zn and Se significantly decreased grain Cd, Cr, Cu and Pb concentrations grown in HM contaminated fields with no effect on yield, indicating a promising measurement for further reducing grain HM content to guarantee safe food production. - Highlights: • Field trials evaluated situation of grain HM in main rice growing areas of Zhejiang. • Forecasting index system to predict rice grain HM concentration was achieved. • Hybrid rice holds higher grain Cd concentration than conventional cultivars. • Low grain HM accumulation rice cultivars were successfully identified. • Developed alleviating regulator which effectively reduced grain toxic HM.

  1. Yeast cell wall extract induces disease resistance against bacterial and fungal pathogens in Arabidopsis thaliana and Brassica crop.

    Directory of Open Access Journals (Sweden)

    Mari Narusaka

    Full Text Available Housaku Monogatari (HM is a plant activator prepared from a yeast cell wall extract. We examined the efficacy of HM application and observed that HM treatment increased the resistance of Arabidopsis thaliana and Brassica rapa leaves to bacterial and fungal infections. HM reduced the severity of bacterial leaf spot and anthracnose on A. thaliana and Brassica crop leaves with protective effects. In addition, gene expression analysis of A. thaliana plants after treatment with HM indicated increased expression of several plant defense-related genes. HM treatment appears to induce early activation of jasmonate/ethylene and late activation of salicylic acid (SA pathways. Analysis using signaling mutants revealed that HM required SA accumulation and SA signaling to facilitate resistance to the bacterial pathogen Pseudomonas syringae pv. maculicola and the fungal pathogen Colletotrichum higginsianum. In addition, HM-induced resistance conferred chitin-independent disease resistance to bacterial pathogens in A. thaliana. These results suggest that HM contains multiple microbe-associated molecular patterns that activate defense responses in plants. These findings suggest that the application of HM is a useful tool that may facilitate new disease control methods.

  2. A feasibility test to estimate the duration of phytoextraction of heavy metals from polluted soils.

    Science.gov (United States)

    Japenga, J; Koopmans, G F; Song, J; Römkens, P F A M

    2007-01-01

    The practical applicability of heavy metal (HM) phytoextraction depends heavily on its duration. Phytoextraction duration is the main cost factorfor phytoextraction, both referring to recurring economic costs during phytoextraction and to the cost of the soil having no economic value during phytoextraction. An experiment is described here, which is meant as a preliminary feasibility test before starting a phytoextraction scheme in practice, to obtain a more realistic estimate of the phytoextraction duration of a specific HM-polluted soil. In the experiment, HM-polluted soil is mixed at different ratios with unpolluted soil of comparable composition to mimic the gradual decrease of the HM content in the target HM-polluted soil during phytoextraction. After equilibrating the soil mixtures, one cropping cycle is carried out with the plant species of interest. At harvest, the adsorbed HM contents in the soil and the HM contents in the plant shoots are determined. The adsorbed HM contents in the soil are then related to the HM contents in the plant shoots by a log-log linear relationship that can then be used to estimate the phytoextraction duration of a specific HM-polluted soil. This article describes and evaluates the merits of such a feasibility experiment. Potential drawbacks regarding the accuracy of the described approach are discussed and a greenhouse-field extrapolation procedure is proposed.

  3. Genotypic and environmental variation in cadmium, chromium, lead and copper in rice and approaches for reducing the accumulation

    International Nuclear Information System (INIS)

    Cao, Fangbin; Wang, Runfeng; Cheng, Wangda; Zeng, Fanrong; Ahmed, Imrul Mosaddek; Hu, Xinna; Zhang, Guoping; Wu, Feibo

    2014-01-01

    The field scale trials revealed significant genotypic and environmental differences in grain heavy metal (HM) concentrations of 158 newly developed rice varieties grown in twelve locations of Zhejiang province of China. Grain Pb and Cd contents in 5.3% and 0.4% samples, respectively, were above the maximum permissible concentration (MPC); none of samples had Cr/Cu exceeding MPC. Stepwise multiple linear regression analysis estimated soil HM critical levels for safe rice production. Low grain HM accumulation cultivars such as Xiushui817, Jiayou08-1 and Chunyou689 were recommended as suitable cultivars for planting in slight/medium HM contaminated soils. The alleviating regulator (AR) of (NH 4 ) 2 SO 4 as N fertilizer coupled with foliar spray of a mixture containing glutathione (GSH), Si, Zn and Se significantly decreased grain Cd, Cr, Cu and Pb concentrations grown in HM contaminated fields with no effect on yield, indicating a promising measurement for further reducing grain HM content to guarantee safe food production. - Highlights: • Field trials evaluated situation of grain HM in main rice growing areas of Zhejiang. • Forecasting index system to predict rice grain HM concentration was achieved. • Hybrid rice holds higher grain Cd concentration than conventional cultivars. • Low grain HM accumulation rice cultivars were successfully identified. • Developed alleviating regulator which effectively reduced grain toxic HM

  4. Effects of Watering and Nitrogen Fertilization on Yield and Water and Nitrogen Use Efficiency of Cropping Oil Sunflower

    Directory of Open Access Journals (Sweden)

    TAN Jian-xin

    2015-10-01

    Full Text Available The field experiment with split-plot design was conducted to study the effects of the interaction of water and nitrogen fertilization on the growth and yield of oil sunflower, water and nitrogen use efficiency of cropping oil sunflower. This experiment set three irrigation rate treatments, including high irrigation treatment (5 250 m3·hm-2, middle irrigation treatment (3 750 m3·hm-2, low irrigation treatment (2 250 m3·hm-2, and four nitrogen application rate treatments, covering no nitrogen fertilization treatment (0 kg·hm-2, low nitrogen application treatment (120 kg·hm-2, middle nitrogen application treatment (240 kg·hm-2 and high nitrogen application treatment (360 kg·hm-2. The results showed that the nitrogen absorption and nitrogen use efficiency of cropping oil sunflower increased as the irrigation rate increased. With the nitrogen application rate increased, the yield of cropping oil sunflower was increased when the nitrogen application rate was 0~240 kg·hm-2, but beyond the 240 kg·hm-2, there was no significant increase. With the irrigation rate increased, the water consumption amount of cropping oil sunflower increased all the time, but the water use efficiency increased first, and hen decreased. Besides there was no significant difference between 240 kg·hm-2 and 360 kg·hm-2 treatment. Under our experiment condition, during the cropping oil sunflower growth period, when the irrigation rate was 5 250 m3·hm-2 (high irrigation rate and the nitrogen ertilization was 360 m3·hm-2 (high nitrogen application rate, the yield of cropping oil sunflower was 3 598 kg·hm-2. When the irrigation rate was 3 750 m3·hm-2 (middle irrigation rate and the nitrogen fertilization was 240 m3·hm-2 (middle nitrogen application rate, the yield was 3 518 kg·hm-2, with the yield components similar with the high irrigation rate and high nitrogen application rate treatment. Considering various factors, middle irrigation rate and middle nitrogen

  5. Thermodynamic study of (alkyl esters + α,ω-alkyl dihalides) VI. HmE and VmE for 20 binary mixtures {xCu-1H2u-1CO2(CH2)3CH3 + (1 - x)α,ω-BrCH2(CH2)v-2CH2Br}, where u = 1 to 5, α = 1, and v = ω = 2 to 6

    International Nuclear Information System (INIS)

    Navas, A.; Ortega, J.; Nuez, I. de la

    2009-01-01

    This work shows the experimental values obtained for H m E and V m E at the temperature of 298.15 K and atmospheric pressure, for a set of 20 binary mixtures comprised of the first four butyl esters (methanoate to butanoate) with five α,ω-dibromoalkanes (1,2-dibromoethane to 1,6-dibromohexane). The H m E are endothermic for mixtures with butyl methanoate, while for the other esters the H m E adopt a sigmoidal shape. The V m E are positive for mixtures with low molecular weight dibromoalkanes, becoming negative with contractive effects in the final mixture, as the dihalide chain increases. The results indicate that the mixtures present specific interactions, with simultaneous expansion/contraction and exothermic/endothermic effects, and an explanation is given for the different types of interaction taking place. Experimental data are correlated with a polynomial equation used in previous works with satisfactory results. Modelling of the experimental results of the mixtures is carried out on the H m E values, giving rise to an adequate definition of the different interactions taking place. Two versions of the UNIFAC method were used, and for Dang and Tassios' version different possibilities were considered for the interaction parameters of the ester (G)/dibromide (G'). The best estimations were obtained when the pair of interaction parameters, type a G/G ' , depended on the number of carbon atoms in the compounds constituting the mixture.

  6. Commentary on "Patient-reported outcomes after 3-dimensional conformal, intensity-modulated, or proton beam radiotherapy for localized prostate cancer." Gray PJ, Paly JJ, Yeap BY, Sanda MG, Sandler HM, Michalski JM, Talcott JA, Coen JJ, Hamstra DA, Shipley WU, Hahn SM, Zietman AL, Bekelman JE, Efstathiou JA. Harvard Radiation Oncology Program, Boston, MA.: Cancer 2013;119(9):1729-35. doi: 10.1002/cncr.27956. [Epub 2013 Feb 22].

    Science.gov (United States)

    Gottschalk, Alexander

    2014-04-01

    Recent studies have suggested differing toxicity patterns for patients with prostate cancer who receive treatment with 3-dimensional conformal radiotherapy (3DCRT), intensity-modulated radiotherapy (IMRT), or proton beam therapy (PBT). The authors reviewed patient-reported outcomes data collected prospectively using validated instruments that assessed bowel and urinary quality of life (QOL) for patients with localized prostate cancer who received 3DCRT (n = 123), IMRT (n = 153) or PBT (n = 95). Clinically meaningful differences in mean QOL scores were defined as those exceeding half the standard deviation of the baseline mean value. Changes from baseline were compared within groups at the first post-treatment follow-up (2-3 months from the start of treatment) and at 12 months and 24 months. At the first post-treatment follow-up, patients who received 3DCRT and IMRT, but not those who received PBT, reported a clinically meaningful decrement in bowel QOL. At 12 months and 24 months, all 3 cohorts reported clinically meaningful decrements in bowel QOL. Patients who received IMRT reported clinically meaningful decrements in the domains of urinary irritation/obstruction and incontinence at the first post-treatment follow-up. At 12 months, patients who received PBT, but not those who received IMRT or 3DCRT, reported a clinically meaningful decrement in the urinary irritation/obstruction domain. At 24 months, none of the 3 cohorts reported clinically meaningful changes in urinary QOL. Patients who received 3DCRT, IMRT, or PBT reported distinct patterns of treatment-related QOL. Although the timing of toxicity varied between the cohorts, patients reported similar modest QOL decrements in the bowel domain and minimal QOL decrements in the urinary domains at 24 months. Prospective randomized trials are needed to further examine these differences. © 2013 Published by Elsevier Inc.

  7. Thermodynamic study of (alkyl esters + α,ω-alkyl dihalides) VII. HmE and VmE for 20 binary mixtures {xCu-1H2u-1CO2C3H7 + (1 - x)α,ω-ClCH2(CH2)v-2CH2Cl}, where u = 1 to 4, α = 1 and v = ω = 2 to 6. An analysis of behavior using the COSMO-RS methodology

    International Nuclear Information System (INIS)

    Marrero, E.; Ortega, J.; Palomar, J.

    2009-01-01

    Summary: Excess enthalpies H m E and excess volumes V m E obtained at a temperature of 298.15 K and atmospheric pressure are presented for a set of 20 binary mixtures comprised of the first four propyl esters, C u-1 H 2u-1 COOC 3 H 7 (u = 1 to 4), and five α,ω-dichloroalkanes, ClCH 2 (CH 2 ) v-2 CH 2 Cl (v = 2 to 6). All the mixtures are exothermic except for those corresponding to propyl methanoate with v ≥ 4. The V m E are positive in most mixtures except for those where v = 4, 5, 6, for V m E m E with v, while the increase in u produces a greater exothermicity in the mixing process, which becomes inverted for propyl butanoate. The variation in V m E with the chain length of the compounds of the mixtures studied is not regular since both the enthalpic and the volumetric effects are due to interactions of different nature, positive and negative. Interpretation of the behavior was assisted by applying the quantum-chemistry method COSMO-RS. This method describes qualitatively and quantitatively the contribution of the different types of interactions, electrostatic, van der Waals, and those due to the (Cl, Cl) bond in the dihalide, and the influence of the ester and dichloroalkane chains. This information was also useful to adequately modify the application of the UNIFAC group contribution model, proposing parameters for the Cl, Cl/carboxylate interaction that vary with the chain length of the compounds involved. With this modification, the results estimated by UNIFAC model can be considered good

  8. Thermodynamic study of (alkyl esters+α,ω-alkyl dihalides) I: HmE and VmE for 25 binary mixtures {xCu-1H2u-1CO2C2H5+(1-x)α,ω-ClCH2(CH2)v-2CH2Cl}, where u=1 to 5, α=1 and v=ω=2 to 6

    International Nuclear Information System (INIS)

    Ortega, J.; Marrero, E.; Toledo, F.J.; Espiau, F.

    2005-01-01

    This article presents the experimental data of H m E and V m E , obtained at atmospheric pressure and at a temperature of 298.15K, for a set of 25 binary mixtures composed of the first 5 ethyl alkanoates (methanoate to pentanoate) and five α,ω-dichloroalkanes (1,2-dichloroethane to 1,6-dichlorohexane). Quantitatively, and with only a few exceptions, small values are obtained for the excess properties and the results imply that specific interactions exist between both types of compounds, with exothermic process for most mixtures, but with the exception of some that contain ethyl methanoate and ethanoate. The change in enthalpies with increasing length of the dichloroalkane chain for the same ester is regular, and also the change in H m E with the acid portion of the ethyl ester. However, the change in excess volumes does not present such a regular variation. A behavioural structural model is established to explain the results of the excess properties. Experimental values of H m E and V m E were correlated, as a function of ester concentration, x with a new expression which uses the so-called active fraction as a variable and which, in turn, is a function of this concentration. The application of two versions of the UNIFAC group contribution models produces no good estimations of H m E .

  9. Thermodynamic study of (alkyl esters+α,ω-alkyl dihalides) II: HmE and VmE for 25 binary mixtures {xCu-1H2u-1CO2C2H5+(1-x)α,ω-BrCH2(CH2)v-2CH2Br}, where u=1 to 5, α=1 and v=ω=2 to 6

    International Nuclear Information System (INIS)

    Ortega, J.; Navas, A.; Placido, J.; Toledo, F.J.

    2006-01-01

    Excess molar enthalpies H m E , and excess molar volumes V m E , have been determined experimentally at constant conditions of atmospheric pressure and a temperature of T=298.15K, for a set of 25 binary mixtures, composed of ethyl alkanoate (methanoate to pentanoate) with each of the α,ω-dibromoalkanes (1,2-dibromoethane to 1,6-dibromohexane), presenting the values of excess quantities Y m E as a function of the ester composition x. Most of the mixtures presented V m E >0, except those formed by 1,5-dibromopentane and 1,6-dibromohexane with propanoate, butanoate and ethyl pentanoate, for which V m E m E are made using two versions of the UNIFAC group contribution model. The version proposed by Dang and Tassios produces unacceptable estimations, while the version of Gmehling et al. produces results closer to experimentals.

  10. Wood and bark of Pinus halepensis as archives of heavy metal pollution in the Mediterranean Region.

    Science.gov (United States)

    Rodríguez Martin, José Antonio; Gutiérrez, Carmen; Torrijos, Manuel; Nanos, Nikos

    2018-04-18

    Natural levels of heavy metals (HM) have increased during the industrial era to the point of posing a serious threat to the environment. The use of tree species to record contamination is a well-known practice. The objective of the study was to compare HM levels under different pollution conditions: a) soil pollution due to mining waste; b) atmospheric pollution due to coal-fired power plant emissions. We report significant HM enrichment in Pinus halepensis tissues. Near a burning power plant, Pb content in a tree wood was 2.5-fold higher that in natural areas (no pollution; NP). In mining areas, Cd content was 25-fold higher than NP. The hypothesis that HM contents in tree rings should register pollution is debatable. HM uptake by pines from soil, detoxification mechanisms and resuspended local soil dust is involved in HM contents in wood and bark. Copyright © 2018 Elsevier Ltd. All rights reserved.

  11. 46 CFR 167.43-1 - Application.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 7 2010-10-01 2010-10-01 false Application. 167.43-1 Section 167.43-1 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) NAUTICAL SCHOOLS PUBLIC NAUTICAL SCHOOL SHIPS Work Vests § 167.43-1 Application. (a) Provisions of this subpart shall apply to all vessels inspected and...

  12. 46 CFR 167.45-80 - Fire axes.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 7 2010-10-01 2010-10-01 false Fire axes. 167.45-80 Section 167.45-80 Shipping COAST... Firefighting and Fire Prevention Requirements § 167.45-80 Fire axes. (a) All nautical school ships shall be provided with fire axes, as follows: Number of axes Gross tons of nautical school ships: All not over 50...

  13. 46 CFR 167.45-50 - Foam smothering system requirements.

    Science.gov (United States)

    2010-10-01

    ... 167.45-50 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) NAUTICAL SCHOOLS PUBLIC NAUTICAL SCHOOL SHIPS Special Firefighting and Fire Prevention Requirements § 167.45-50 Foam smothering... deep in not more than 3 minutes. The arrangement of piping shall be such as to give a uniform...

  14. 46 CFR 167.25-5 - Inspection of boilers, pressure vessels, piping and appurtenances.

    Science.gov (United States)

    2010-10-01

    ...) NAUTICAL SCHOOLS PUBLIC NAUTICAL SCHOOL SHIPS Marine Engineering § 167.25-5 Inspection of boilers, pressure vessels, piping and appurtenances. The inspection of boilers, pressure vessels, piping and appurtenances... 46 Shipping 7 2010-10-01 2010-10-01 false Inspection of boilers, pressure vessels, piping and...

  15. 46 CFR 167.60-10 - Exhibition of certificate of inspection.

    Science.gov (United States)

    2010-10-01

    ... PUBLIC NAUTICAL SCHOOL SHIPS Certificates of Inspection § 167.60-10 Exhibition of certificate of inspection. On every nautical school ship, the original certificate of inspection shall be framed under glass... 46 Shipping 7 2010-10-01 2010-10-01 false Exhibition of certificate of inspection. 167.60-10...

  16. 46 CFR 167.65-35 - Use of auto pilot.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 7 2010-10-01 2010-10-01 false Use of auto pilot. 167.65-35 Section 167.65-35 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) NAUTICAL SCHOOLS PUBLIC NAUTICAL SCHOOL SHIPS Special Operating Requirements § 167.65-35 Use of auto pilot. Except as provided in 33 CFR 164.15, when...

  17. 46 CFR 167.05-20 - Marine inspector or inspector.

    Science.gov (United States)

    2010-10-01

    ...-20 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) NAUTICAL SCHOOLS PUBLIC NAUTICAL SCHOOL SHIPS Definitions § 167.05-20 Marine inspector or inspector. These terms mean any person from the... Officer in Charge, Marine Inspection, or any other person as may be designated for the performance of...

  18. 50 CFR 300.31 - Definitions.

    Science.gov (United States)

    2010-10-01

    ... Party Laws AUSTRALIA Antarctic Marine Living Resources Conservation Act, 1981.Fisheries Management Act... that may be provided by the Regional Administrator: Pacific Island Party Area AUSTRALIA All waters... nautical mile territorial sea and nine nautical mile exclusive fishery zone and on all named banks and...

  19. 46 CFR 168.15-45 - Heating and cooling.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 7 2010-10-01 2010-10-01 false Heating and cooling. 168.15-45 Section 168.15-45 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) NAUTICAL SCHOOLS CIVILIAN NAUTICAL SCHOOL VESSELS Accommodations § 168.15-45 Heating and cooling. All quarters must be adequately heated and cooled...

  20. 77 FR 16211 - Availability of Seats for the Northwestern Hawaiian Islands Coral Reef Ecosystem Reserve Advisory...

    Science.gov (United States)

    2012-03-20

    ... Monument World Heritage site established by UNESCO in July, 2010. The Reserve encompasses an area of the... nautical miles long and 100 nautical miles wide. The Reserve is managed by the Secretary of Commerce... Service, National Science Foundation, U.S. Coast Guard, Western Pacific Regional Fishery Management...

  1. 76 FR 77779 - Availability of Seats for the Northwestern Hawaiian Islands Coral Reef Ecosystem Reserve Advisory...

    Science.gov (United States)

    2011-12-14

    ... Papahanaumokuakea Marine National Monument World Heritage site established by UNESCO in July, 2010. The Reserve... approximately 1200 nautical miles long and 100 nautical miles wide. The Reserve is managed by the Secretary of... National Marine Fisheries Service, National Science Foundation, U.S. Coast Guard, Western Pacific Regional...

  2. 46 CFR 168.15-10 - Construction.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 7 2010-10-01 2010-10-01 false Construction. 168.15-10 Section 168.15-10 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) NAUTICAL SCHOOLS CIVILIAN NAUTICAL SCHOOL VESSELS Accommodations § 168.15-10 Construction. (a) The accommodations provided must be securely constructed, properly...

  3. Distribution and features of hematological malignancies in Eastern Morocco: a retrospective multicenter study over 5?years

    OpenAIRE

    Elidrissi Errahhali, Mounia; Elidrissi Errahhali, Manal; Boulouiz, Redouane; Ouarzane, Meryem; Bellaoui, Mohammed

    2016-01-01

    Background Hematological malignancies (HM) are a public health problem. The pattern and distribution of diagnosed hematological cancers vary depending on age, sex, geography, and ethnicity suggesting the involvement of genetic and environmental factors for the development of these diseases. To our knowledge, there is no published report on HM in the case of Eastern Morocco. In this report we present for the first time the overall pattern of HM for this region. Methods Retrospective descriptiv...

  4. Excessive scleral shrinkage, rather than choroidal thickening, is a major contributor to the development of hypotony maculopathy after trabeculectomy.

    Directory of Open Access Journals (Sweden)

    Mari Sakamoto

    Full Text Available We previously reported that eyes with hypotony maculopathy (HM after trabeculectomy (TLE exhibited more reduction of axial length (AL than those without HM, suggesting that inward collapse of the scleral wall may contribute to the development of HM after TLE. However, we did not evaluate change in choroidal thickness (CT, which could influence AL measures. We compared the magnitude and rate of AL and CT changes in eyes with and without HM by simultaneously measuring these parameters before and after TLE.We enrolled 77 eyes of 77consecutive patients with glaucoma, who underwent TLE between March 2014 and March 2016. Intraocular pressure (IOP, central corneal thickness, keratometry, AL, and CT were measured pre- and postoperatively, up to 6 months. These biometrics were compared in eyes with and without HM.The 14 patients who developed HM were significantly younger than those who did not. The eyes with HM exhibited significantly reduced AL (2.8% compared to those without HM (0.7%. There was no significant difference in CT change between the two groups. The rate of AL reduction was significantly correlated with age, postoperative IOP, and preoperative AL. Post-adjustment logistic regression analysis revealed that eyes with AL reduction rate ≥ 2% had 11.67 higher risk for developing HM (95% confidence interval, 1.28-106.6; P = 0.03.AL reduction rates ≥ 2% were significantly associated with HM. Excessive reduction in AL, which was seen in eyes with HM, was not an artificial measure resulting from choroidal thickening but rather reflected reductions in the anterior-posterior diameter of the eyeball. Inward collapse of the scleral wall leads to redundancy of the chorioretinal tissue, contributing to the development of HM after TLE.

  5. Automatic remote monitoring utilizing daily transmissions: transmission reliability and implantable cardioverter defibrillator battery longevity in the TRUST trial.

    Science.gov (United States)

    Varma, Niraj; Love, Charles J; Schweikert, Robert; Moll, Philip; Michalski, Justin; Epstein, Andrew E

    2018-04-01

    Benefits of automatic remote home monitoring (HM) among implantable cardioverter defibrillator (ICD) patients may require high transmission frequency. However, transmission reliability and effects on battery longevity remain uncertain. We hypothesized that HM would have high transmission success permitting punctual guideline based follow-up, and improve battery longevity. This was tested in the prospective randomized TRUST trial. Implantable cardioverter defibrillator patients were randomized post-implant 2:1 to HM (n = 908) (transmit daily) or to Conventional in-person monitoring [conventional management (CM), n = 431 (HM disabled)]. In both groups, five evaluations were scheduled every 3 months for 15 months. Home Monitoring technology performance was assessed by transmissions received vs. total possible, and number of scheduled HM checks failing because of missed transmissions. Battery longevity was compared in HM vs. CM at 15 months, and again in HM 3 years post-implant using continuously transmitted data. Transmission success per patient was 91% (median follow-up of 434 days). Overall, daily HM transmissions were received in 315 795 of a potential 363 450 days (87%). Only 55/3759 (1.46%) of unsuccessful scheduled evaluations in HM were attributed to transmission loss. Shock frequency and pacing percentage were similar in HM vs. CM. Fifteen month battery longevity was 12% greater in HM (93.2 ± 8.8% vs. 83.5 ± 6.0% CM, P battery longevity was 50.9 ± 9.1% (median 52%) at 36 months. Automatic remote HM demonstrated robust transmission reliability. Daily transmission load may be sustained without reducing battery longevity. Home Monitoring conserves battery longevity and tracks long term device performance. ClinicalTrials.gov; NCT00336284.

  6. Heavy metals in carabids (Coleoptera, Carabidae

    Directory of Open Access Journals (Sweden)

    Ruslan Butovsky

    2011-05-01

    Full Text Available Carabid beetles (Coleoptera, Carabidae are one of the most studied soil groups in relation to heavy metal (HM accumulation and use for bioindication of environmental pollution. Accumulation of Zn and Cu in carabid beetles was species-, sex- and trophic group-specific. No differences were found in HM contents between omnivorous and carnivorous species. The use of carabid beetles as indicators of HM accumulation appears to be rather limited.

  7. Presentation of human minor histocompatibility antigens by HLA-B35 and HLA-B38 molecules

    International Nuclear Information System (INIS)

    Yamamoto, Junji; Kariyone, Ai; Kano, Kyoichi; Takiguchi, Masafumi; Akiyama, Nobuo

    1990-01-01

    Cytotoxic T lymphocyte (CTL) clones specific for human minor histocompatibility antigens (hmHAs) were produced from a patient who had been grafted with the kidneys from his mother and two HLA-identical sisters. Of eight CTL clones generated, four recognized an hmHA (hmHA-1) expressed on cells from the mother and sister 3 (second donor); two recognized another antigen (hmHA-2) on cells from the father, sister (third donor), and sister 3; and the remaining two clones recognized still another antigen (hmHA-3) on cells from the father and sister 3. Panel studies revealed that CTL recognition of hmHA-1 was restricted by HLA-B35 and that of hmHA-2 and hmHA-3 was restricted by HLA-B38. The HLA-B35 restriction of the hmHA-1 -specific CTL clones was substantiated by the fact that they killed HLA-A null/HLA-B null Hmy2CIR targets transfected with HLA-B35 but not HLA-B51, -Bw52, or -Bw53 transfected Hmy2CIR targets. These data demonstrated that the five amino acids substitutions on the α 1 domain between HLA-B35 and -Bw53, which are associated with Bw4/Bw6 epitopes, play a critical role in the relationship of hmHA-1 to HLA-B35 molecules. The fact that the hmHA-1-specific CTLs failed to kill Hmy2CIR cells expressing HLA-B35/51 chimeric molecules composed of the α 1 domain of HLA-B35 and other domains of HLA-B51 indicated that eight residues on the α 2 domain also affect the interaction of hmHA-1 and the HLA-B35 molecules

  8. Effect of large-scale pig farm waste water on wheat yield and quality%规模化养猪场处理污水施用对小麦产量和品质的影响

    Institute of Scientific and Technical Information of China (English)

    朱正杰; 高威; 庄恒扬

    2012-01-01

    随着我国规模化养猪场迅速发展,排放的粪尿污水不断增加,导致严重的环境污染,成为规模化养猪可持续发展亟待解决的问题.种养结合是污水最佳处理利用途径.规模化养猪场污水在农田特别是在农场经营条件下应用的技术缺少系统研究,本研究通过田间试验探讨实现小麦高产优质高效的污水利用技术,为规模化养猪场-农田种植循环农业模式的应用提供技术支持.试验所用污水为养猪场粪尿和冲洗废水经过充分发酵后的污水,污水含全氮1000 mg·L-1、速效氮540 mg·L-1、速效磷779 mg·L-1.在常规基施化肥基础上,设计小麦越冬期施入0 m3·hm-2、30 m3·hm-2、60 m3·hm-2、90 m3·hm-2、120 m3·hm-2的污水与穗期施氮肥0kg(N)·hm-2、30 kg(N)·hm-2、60 kg(N)·hm-2、90 kg(N)·hm-2组合为处理,研究对小麦产量和品质的影响.结果表明,越冬期施污水30 m3·hm-2、60 m3·hm-2或90 m3·hm-2与穗期施氮60 kg(N)·hm-2相结合的3个处理产量分别为8 496.27 kg·hm-2、8 372.28 kg·hm-2、8 419.97 kg·hm-2,与大田常规施肥的产量8 305.52 kg·hm-2相当,穗期不追施或施氮量30 kg(N).hm-2处理,产量都低于常规施肥产量,说明越冬期污水施用必须与一定量化肥配合才能获得理想的产量,在品质方面,穗期不施氮肥或施氮30 kg(N)·hm-2处理的籽粒蛋白质含量都低于中筋小麦下限13%的要求.从产量与品质两方面考虑,污水施用量60 m3·hm-2与穗期施氮90 kg(N).hm-2组合、污水施用量90 m3.hm-2与穗期施氮60 kg(N)·hm-2处理均为较优的施肥方案.再考虑到农田较大污水承载量和减少化肥施用的目标,污水施用量为90 m3·hm-2、穗期施氮60 kg(N)·hm-2处理为小麦优质高产高效的污水施用方案.%With the rapid development of China's large-scale pig farms, increasing manure and sewage discharge is causing severe environmental pollution that in turn threatens the sustainable

  9. Heavy metal accumulation in Pelargonium hortorum: Effects on growth and development

    OpenAIRE

    Orroño, DI; Lavado, RS

    2009-01-01

    Ornamental plants have been proposed for growing in heavy metal (HM) contaminated soils, and also for phytoremediation. We evaluated (1) biomass production and (2) HM accumulation in Pelargonium hortorum. Plants were grown for 16 weeks on HM (cadmium, chromium, copper, lead, nickel and zinc) enriched soils. Treatments were i) control, non-enriched soil, ii) medium concentration treatment, and iii) high concentration treatment. Four destructive harvests were carried out, and roots, stems, leav...

  10. Alleviation of Heavy Metal Stress in Plants and Remediation of Soil by Rhizosphere Microorganisms.

    Science.gov (United States)

    Mishra, Jitendra; Singh, Rachna; Arora, Naveen K

    2017-01-01

    Increasing concentration of heavy metals (HM) due to various anthropogenic activities is a serious problem. Plants are very much affected by HM pollution particularly in contaminated soils. Survival of plants becomes tough and its overall health under HM stress is impaired. Remediation of HM in contaminated soil is done by physical and chemical processes which are costly, time-consuming, and non-sustainable. Metal-microbe interaction is an emerging but under-utilized technology that can be exploited to reduce HM stress in plants. Several rhizosphere microorganisms are known to play essential role in the management of HM stresses in plants. They can accumulate, transform, or detoxify HM. In general, the benefit from these microbes can have a vast impact on plant's health. Plant-microbe associations targeting HM stress may provide another dimension to existing phytoremediation and rhizoremediation uses. In this review, applied aspects and mechanisms of action of heavy metal tolerant-plant growth promoting (HMT-PGP) microbes in ensuring plant survival and growth in contaminated soils are discussed. The use of HMT-PGP microbes and their interaction with plants in remediation of contaminated soil can be the approach for the future. This low input and sustainable biotechnology can be of immense use/importance in reclaiming the HM contaminated soils, thus increasing the quality and yield of such soils.

  11. ORF Alignment: EHA1 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available GVPLDLINPPVLRIKVFEPLFIVGKENYAKLD 78 ... KSVQVFGKKKTAIAVCLCKEGKGMIRVNGVPLDLINPPVLRIKVFEPLFIVGKENYA...KLD Sbjct: 1 ... KSVQVFGKKKTAIAVCLCKEGKGMIRVNGVPLDLINPPVLRIKVFEPLFIVGKENYAKLD 60 ... Query... putative [Entamoeba histolytica HM-1:IMSS] ... Length = 139 ... Query: 19 ... KSVQVFGKKKTAIAVCLCKEGKGMIRVN

  12. ORF Alignment: EHA1 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available otein [Entamoeba histolytica HM-1:IMSS] ... Length = 113 ... Query: 129 SGHTSTATTHSISFTGTGNSIGKSNATNFKVT...GSIPTLDISKPTTNIKVRFIDGKQKVFK 188 ... SGHTSTATTHSISFTGTGNSIGKSNATNFKVTGSIPTLDISKPTTNIKVRFIDGKQKVFK Sbjct: 1 ... SGHTSTATTHSISFTGTGNSIGKSNATNFKVTGSIPTLDISKPTTNIKVRFIDGKQKVFK 60 ...

  13. Improved tolerance of maize (Zea mays L.) to heavy metals by colonization of a dark septate endophyte (DSE) Exophiala pisciphila

    International Nuclear Information System (INIS)

    Li, T.; Liu, M.J.; Zhang, X.T.; Zhang, H.B.; Sha, T.; Zhao, Z.W.

    2011-01-01

    Dark septate endophytes (DSE) are ubiquitous and abundant in stressful environments including heavy metal (HM) stress. However, our knowledge about the roles of DSE in improving HM tolerance of their host plants is poor. In this study, maize (Zea mays L.) was inoculated with a HM tolerant DSE strain Exophiala pisciphila H93 in lead (Pb), zinc (Zn), and cadmium (Cd) contaminated soils. E. pisciphila H93 successfully colonized and formed typical DSE structures in the inoculated maize roots. Colonization of E. pisciphila H93 alleviated the deleterious effects of excessive HM supplements and promoted the growth of maize (roots and shoots) under HM stress conditions, though it significantly decreased the biomass of inoculated maize under no HM stress. Further analysis showed that the colonization of E. pisciphila H93 improved the tolerance of maize to HM by restricting the translocation of HM ions from roots to shoots. This study demonstrated that under higher HM stress, such a mutual symbiosis between E. pisciphila and its host (maize) may be an efficient strategy to survive in the stressful environments. - Research Highlights: →Effect of DSE (E. pisciphila) on heavy metal tolerance of maize host was studied. →DSE alleviated the deleterious effect of excessive heavy metals on maize. →DSE restricted the transfer of heavy metals from the roots to shoots in maize. →DSE colonization improved the tolerance of their host plants to heavy metals.

  14. ORF Alignment: EHA1 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ve [Entamoeba histolytica HM-1:IMSS] ... Length = 179 ... Query: 8 ... ERSLMLNGKLYDSTVPELAHDRESCCEKIIDFNCERN...AQKRLEMLKDIVGSLGENSCILP 67 ... ERSLMLNGKLYDSTVPELAHDRESCCEKIIDFNCERNAQKRLEMLKDIVGSLGENSCILP Sbjct: ...1 ... ERSLMLNGKLYDSTVPELAHDRESCCEKIIDFNCERNAQKRLEMLKDIVGSLGENSCILP 60 ... Query: 128 E

  15. Distribution and features of hematological malignancies in Eastern Morocco: a retrospective multicenter study over 5 years.

    Science.gov (United States)

    Elidrissi Errahhali, Mounia; Elidrissi Errahhali, Manal; Boulouiz, Redouane; Ouarzane, Meryem; Bellaoui, Mohammed

    2016-02-25

    Hematological malignancies (HM) are a public health problem. The pattern and distribution of diagnosed hematological cancers vary depending on age, sex, geography, and ethnicity suggesting the involvement of genetic and environmental factors for the development of these diseases. To our knowledge, there is no published report on HM in the case of Eastern Morocco. In this report we present for the first time the overall pattern of HM for this region. Retrospective descriptive study of patients diagnosed with HM between January 2008 and December 2012 in three centres in Eastern Morocco providing cancer diagnosis, treatment or palliative care services. The FAB (French-American-British) classification system has been taken into account in the analysis of myeloid and lymphoid neoplasms. In this study, a total of 660 cases of HM were registered between January 2008 and December 2012. Overall, 6075 cases of cancers all sites combined were registered during this study period, indicating that HM account for around 10.9 % (660/6075) of all cancers recorded. Among the 660 registered cases of HM, 53 % were males and 47 % were females, with a male to female ratio of 1.1. Thus, overall, men are slightly more affected with HM than women. By contrast, a female predominance was observed in the case of Hodgkin's lymphoma (HL), myeloproliferative neoplasms (MPN), acute myeloid leukemia (AML) and the myelodysplastic syndrome (MDS). HM occur at a relatively young age, with an overall median age at diagnosis of 54 years. Non-Hodgkin's lymphoma (NHL) was the most common HM accounting for 29.7 % of all HM, followed by HL, MPN, multiple myelomas (MM), chronic lymphocytic leukemia (CLL), AML, MDS, acute lymphoblastic leukemia (ALL), and Waldenström macroglobulinemia (WM). The majority of HM cases have been observed among patients aged 60 years and over (40.4 % of HM). Among this age group, NHL was the most common HM. In adolescents, HL was the most frequent HM. This study provided for the

  16. Hydatidiform mole resulting from sexual violence

    Directory of Open Access Journals (Sweden)

    Drezett Jefferson

    2012-02-01

    Full Text Available Abstract Background Hydatidiform mole (HM is characterized by abnormal proliferation of human trophoblast with producers functioning tissues of human chorionic gonadotropin. It can evolve with ovarian cysts tecaluteínicos, hypertension of pregnancy or hyperthyroidism. The incidence of HM is variable and its etiology poorly known, associated with nutritional factors, environmental, age, parity, history of HM, oral contraceptives, smoking, consanguinity or defects in germ cells. There is no reference in literature on HM resulting from sexual violence, objective of this report. Method Description of two cases of HM among 1146 patients with pregnancy resulting from sexual violence treated at Hospital Pérola Byington, São Paulo, from July 1994 to August 2011. Results The cases affected young, white, unmarried, low educated and low parity women. Sexual violence was perpetrated by known offenders unrelated to the victims, under death threat. Ultrasound and CT of the pelvis showed bulky uterus compatible with HM without myometrial invasion. One case was associated with theca lutein cysts. The two cases were diagnosed in the second trimester of pregnancy and evolved with hyperthyroidism. There was no hypertension, disease recurrence, metastasis or sexually transmitted infection. Conclusion The incidence of HM was 1:573 pregnancies resulting from rape, within the range estimated for Latin American countries. Trophoblastic material can be preserved to identify the violence perpetrator, considering only the paternal HM chromosomes. History of sexual violence should be investigated in cases of HM in the first half of adolescence and women in a vulnerable condition.

  17. Hipertermia maligna no Brasil: análise da atividade do hotline em 2009

    Directory of Open Access Journals (Sweden)

    Helga Cristina Almeida da Silva

    2013-02-01

    Full Text Available JUSTIFICATIVA E OBJETIVOS: Hipertermia maligna (HM é doença farmacogenética, com reação hipermetabólica anormal a anestésicos halogenados e/ou relaxantes musculares despolarizantes. Desde 1991 há um serviço hotline de atendimento telefônico para HM no Brasil, disponível 24 horas por dia, em São Paulo. Este artigo analisa a atividade do serviço brasileiro de hotline para HM em 2009. MÉTODOS: Análise prospectiva de todas chamadas telefônicas paria maligna (HM é doença farmacogenética, com reação hipermetabólica anormal a anestésicos halogenados e/ou relaxantes musculares despolarizantes. Desde 1991 há um serviço hotline de atendimento telefônico para HM no Brasil, disponível 24 horas por dia, em São Paulo. Este art go analisa a at vidade do serviço brasileiro de hotline para HM em 2009a o serviço brasileiro de hotline para HM, de janeiro a dezembro de 2009. RESULTADOS: Foram recebidas 22 ligações; 21 provenientes do Sul-Sudeste do Brasil e uma do Norte. Quinze eram pedidos de informações gerais sobre HM. Sete foram suspeitas de crises agudas de HM, das quais duas não foram consideradas como HM. Nas cinco crises compatíveis com HM, todos os pacientes receberam anestésicos inalatórios halogenados (2 isoflurano, 3 sevoflurano e um usou também succinilcolina; havia quatro homens e uma mulher, com média de idade de 18 anos (2-27. Problemas descritos nas cinco crises de HM: taquicardia (cinco, aumento do gás carbônico expirado (quatro, hipertermia (três, acidemia (um, rabdomiólise (um e mioglobinúria (um. Um paciente recebeu dantrolene. Todos os cinco pacientes com crises de HM foram seguidos em unidade de terapia intensiva e recuperaram-se sem sequelas. A suscetibilidade à HM foi posteriormente confirmada em dois pacientes por meio do teste de contratura muscular in vitro. CONCLUSÕES: O número de chamadas por ano no serviço brasileiro de hotline para HM ainda é reduzido. As características das crises

  18. Industry Raps OSHA's Proposed Cancer Policy

    Science.gov (United States)

    Chemical and Engineering News, 1978

    1978-01-01

    Presents the response of the American Industrial Health Council (AIHC) to the Occupational Safety and Health Administration's (OSHA's) genetic proposal for regulating chemical carcinogens in industry. (HM)

  19. Alleviation of Heavy Metal Stress in Plants and Remediation of Soil by Rhizosphere Microorganisms

    Directory of Open Access Journals (Sweden)

    Jitendra Mishra

    2017-09-01

    Full Text Available Increasing concentration of heavy metals (HM due to various anthropogenic activities is a serious problem. Plants are very much affected by HM pollution particularly in contaminated soils. Survival of plants becomes tough and its overall health under HM stress is impaired. Remediation of HM in contaminated soil is done by physical and chemical processes which are costly, time-consuming, and non-sustainable. Metal–microbe interaction is an emerging but under-utilized technology that can be exploited to reduce HM stress in plants. Several rhizosphere microorganisms are known to play essential role in the management of HM stresses in plants. They can accumulate, transform, or detoxify HM. In general, the benefit from these microbes can have a vast impact on plant’s health. Plant–microbe associations targeting HM stress may provide another dimension to existing phytoremediation and rhizoremediation uses. In this review, applied aspects and mechanisms of action of heavy metal tolerant-plant growth promoting (HMT-PGP microbes in ensuring plant survival and growth in contaminated soils are discussed. The use of HMT-PGP microbes and their interaction with plants in remediation of contaminated soil can be the approach for the future. This low input and sustainable biotechnology can be of immense use/importance in reclaiming the HM contaminated soils, thus increasing the quality and yield of such soils.

  20. Rotorcraft Diagnostics, Phase I

    Data.gov (United States)

    National Aeronautics and Space Administration — A versatile self-sustained health management (HM) solution comprising of lightweight, power efficient, portable hardware and highly accurate analytic and reasoning...

  1. ORF Alignment: EHA1 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available 0063 [Entamoeba histolytica HM-1:IMSS] ... Length = 201 ... Query: 34 ... VGFIPTHQEIPYKEDPNYMFSKLNDVIPRTMNV...IINFYIPICVIAIISIYQKNIEKGLTV 93 ... VGFIPTHQEIPYKEDPNYMFSKLNDVIPRTMNVIINFYIPICVIAIISIYQKNIEKGLTV Sbjct...: 8 ... VGFIPTHQEIPYKEDPNYMFSKLNDVIPRTMNVIINFYIPICVIAIISIYQKNIEKGLTV 67 ... Query: 154

  2. ORF Alignment: EHA1 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available protein LSm2, putative [Entamoeba ... histolytica HM-1:IMSS] ... Length = 69 ... Query: 5 ... SFFKTLIGKEVVVELKNDVI...ITGTLIAVDQMLNIKLNNLKCDATLFPQIQTMTDCFIRGN 64 ... SFFKTLIGKEVVVELKNDVIITGTLIAVDQMLNIKLNNLKC...DATLFPQIQTMTDCFIRGN Sbjct: 1 ... SFFKTLIGKEVVVELKNDVIITGTLIAVDQMLNIKLNNLKCDATLFPQIQTMTDCFIRGN 60 ...

  3. ORF Alignment: EHA1 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available Entamoeba histolytica HM-1:IMSS] ... Length = 170 ... Query: 24 ... VDAPTQKLRKPSVWATLRADDGGVITVLQLSKDKYTIGRSGNNDVI...ISNNVSCSRKQCSI 83 ... VDAPTQKLRKPSVWATLRADDGGVITVLQLSKDKYTIGRSGNNDVIISNNVSCSRKQCSI Sbjct: 21 ... ...VDAPTQKLRKPSVWATLRADDGGVITVLQLSKDKYTIGRSGNNDVIISNNVSCSRKQCSI 80 ... Query: 144 YSIIK

  4. ORF Alignment: EHA1 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available yme, putative [Entamoeba histolytica ... HM-1:IMSS] ... Length = 145 ... Query: 7 ... IALMRLTADLKTMLTDPP...VGISSGPIDESNLYFWQATIAGPENSPFEGGLFELRLTFSDE 66 ... IALMRLTADLKTMLTDPPVGISSGPIDESNLYFWQATIAGPENSPF...EGGLFELRLTFSDE Sbjct: 1 ... IALMRLTADLKTMLTDPPVGISSGPIDESNLYFWQATIAGPENSPFEGGLFELRL

  5. ORF Alignment: EHA1 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available t00003 [Entamoeba histolytica HM-1:IMSS] ... Length = 365 ... Query: 252 LPFEMKYQDLIKEIGKHKIYNHFMKIIIDRN...NVFNSLFKQIKHSEKWDRLFKIEFKHEQG 311 ... LPFEMKYQDLIKEIGKHKIYNHFMKIIIDRNNVFNSLFKQIKHSEKWDRLFKIEFKHEQG Sbjct: 1 ... LPFEM

  6. ORF Alignment: EHA1 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available putative [Entamoeba histolytica HM-1:IMSS] ... Length = 228 ... Query: 96 ... VRENMEDVISTCHLERNKDLVGVFDGHNG...DSAARIAATLLKQDTKNYTLLDDIHFIDLFN 155 ... VRENMEDVISTCHLERNKDLVGVFDGHNGDSAARIAATLLKQDTKNYTLLDDIHFIDLFN Sbjct: 1 ... VRENMEDVISTC

  7. ORF Alignment: EHA1 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available 2B delta subunit, putative [Entamoeba ... histolytica HM-1:IMSS] ... Length = 249 ... Query: 363 KASKLTQSSECI...PL------------------------XXXXXXXXXXXXATAQTVSSNI 398 ... KASKLTQSSECIPL ... ... ... ATAQTVSSNI Sbjct: 1 ... KASKLTQSSECIPLIEENVKLLEHARTITVGMNNVRKFIFM

  8. ORF Alignment: EHA1 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available 2B delta subunit, putative [Entamoeba ... histolytica HM-1:IMSS] ... Length = 249 ... Query: 248 KASKLTQSSECI...PLIEENVKLLEHARTITVGMNNVRKFIFMKNQSIENIIATAQTVSSNI 307 ... KASKLTQSSECIPLIEENVKLLEHARTITVGM...NNVRKFIFMKNQSIENIIATAQTVSSNI Sbjct: 1 ... KASKLTQSSECIPLIEENVKLLEHARTITVGMNNVRKFIFM

  9. Improved tolerance of maize (Zea mays L.) to heavy metals by colonization of a dark septate endophyte (DSE) Exophiala pisciphila

    Energy Technology Data Exchange (ETDEWEB)

    Li, T.; Liu, M.J.; Zhang, X.T. [Key Laboratory of Conservation and Utilization for Bioresources, Yunnan University, Kunming, 650091 Yunnan (China); Zhang, H.B. [Key Laboratory of Conservation and Utilization for Bioresources, Yunnan University, Kunming, 650091 Yunnan (China); Department of Biology, Yunnan University, Kunming, 650091 Yunnan (China); Sha, T. [Key Laboratory of Conservation and Utilization for Bioresources, Yunnan University, Kunming, 650091 Yunnan (China); Zhao, Z.W., E-mail: zhaozhw@ynu.edu.cn [Key Laboratory of Conservation and Utilization for Bioresources, Yunnan University, Kunming, 650091 Yunnan (China)

    2011-02-15

    Dark septate endophytes (DSE) are ubiquitous and abundant in stressful environments including heavy metal (HM) stress. However, our knowledge about the roles of DSE in improving HM tolerance of their host plants is poor. In this study, maize (Zea mays L.) was inoculated with a HM tolerant DSE strain Exophiala pisciphila H93 in lead (Pb), zinc (Zn), and cadmium (Cd) contaminated soils. E. pisciphila H93 successfully colonized and formed typical DSE structures in the inoculated maize roots. Colonization of E. pisciphila H93 alleviated the deleterious effects of excessive HM supplements and promoted the growth of maize (roots and shoots) under HM stress conditions, though it significantly decreased the biomass of inoculated maize under no HM stress. Further analysis showed that the colonization of E. pisciphila H93 improved the tolerance of maize to HM by restricting the translocation of HM ions from roots to shoots. This study demonstrated that under higher HM stress, such a mutual symbiosis between E. pisciphila and its host (maize) may be an efficient strategy to survive in the stressful environments. - Research Highlights: {yields}Effect of DSE (E. pisciphila) on heavy metal tolerance of maize host was studied. {yields}DSE alleviated the deleterious effect of excessive heavy metals on maize. {yields}DSE restricted the transfer of heavy metals from the roots to shoots in maize. {yields}DSE colonization improved the tolerance of their host plants to heavy metals.

  10. Summary of results for PHA glass study: Composition and property measurements

    International Nuclear Information System (INIS)

    Edwards, T.B.

    2000-01-01

    This report provides a summary of the results obtained for a limited variability study for glasses containing Precipitate Hydrolysis Aqueous, Monosodiumtitanate, and either simulated Purex or HM sludge

  11. Alterations of 5-Hydroxymethylcytosine in Human Cancers

    Directory of Open Access Journals (Sweden)

    Ali Yesilkanal

    2013-06-01

    Full Text Available Prior to 2009, 5-methylcytosine (5-mC was thought to be the only biologically significant cytosine modification in mammalian DNA. With the discovery of the TET enzymes, which convert 5-methylcytosine (5-mC to 5-hydroxymethylcytosine (5-hmC, however, intense interest has emerged in determining the biological function of 5-hmC. Here, we review the techniques used to study 5-hmC and evidence that alterations to 5-hmC physiology play a functional role in the molecular pathogenesis of human cancers.

  12. ORF Alignment: EHA1 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available rotein [Entamoeba histolytica HM-1:IMSS] ... Length = 103 ... Query: 31 ... KVVRKPACNWSVEEDRKLLDAVNKFGKSRWVEIAEFVGSRSRKQCRERYINHIS...PMIDTS 90 ... KVVRKPACNWSVEEDRKLLDAVNKFGKSRWVEIAEFVGSRSRKQCRERYINHISPMIDTS Sbjct: 1 ... KVVRKPACNWSVEEDRKLLDAVNKFGKSRWVEIAEFVGSRSRKQCRERYINHISPMIDTS 60 ...

  13. ORF Alignment: EHA1 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available tative [Entamoeba histolytica HM-1:IMSS] ... Length = 141 ... Query: 94 ... GFKTLSPYELNQMINSSKLDELFIIDVRYPY...EYNGGHVRSSMNISTETALYKELNKLFEI 153 ... GFKTLSPYELNQMINSSKLDELFIIDVRYPYEYNGGHVRSSMNISTETALYKELNKLFEI Sbjct: 1 ... GFKTLSPYELNQMINS

  14. ORF Alignment: EHA1 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available rotein, putative [Entamoeba histolytica ... HM-1:IMSS] ... Length = 204 ... Query: 7 ... QWQKAQETIFVDWIND...TLKPDIIISNLEEDLKTGVNLILLVEKLTNKHCSEKIIENPKFR 66 ... QWQKAQETIFVDWINDTLKPDIIISNLEEDLKTGVNLILLVEK...LTNKHCSEKIIENPKFR Sbjct: 1 ... QWQKAQETIFVDWINDTLKPDIIISNLEEDLKTGVNLILLVEKLTNKHCSEK

  15. ORF Alignment: EHA1 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available .t00007 [Entamoeba histolytica HM-1:IMSS] ... Length = 56 ... Query: 454 QTFEVERIVRKKIVHGNTSYLVKWKNYSSKDNTWETEDDIRT...KYGDLVDDFEKNQK 509 ... QTFEVERIVRKKIVHGNTSYLVKWKNYSSKDNTWETEDDIRTKYGDLVDDFEKNQK Sbjct: 1 ... QTFEVERIVRKKIVHGNTSYLVKWKNYSSKDNTWETEDDIRTKYGDLVDDFEKNQK 56

  16. Systematic Review on the Efficacy and Safety of Herbal Medicines for Vascular Dementia

    Directory of Open Access Journals (Sweden)

    Sui Cheung Man

    2012-01-01

    Full Text Available We present a systematic review of existing research that aims to assess the efficacy and safety of herbal medications (HM, as either monotherapy or adjunct to orthodox medications (OM, mainly comprised of cholinesterase inhibitors, for vascular dementia (VaD. We included 47 studies conducted in mainland China, each testing different HM. Of 43 HM monotherapy studies, 37 reported HM to be significantly better than OM or placebo; six reported similar efficacy between HM and OM. All four HM adjuvant studies reported significant efficacy. No major adverse events for HM were reported. Heterogeneity in diagnostic criteria, interventions and outcome measures hindered comprehensive data analysis. Studies suggested that HM can be a safe and effective treatment for VaD, either alone or in conjunction with OM. However, methodological flaws in the design of the studies limited the extent to which the results could be interpreted. Thirty most commonly used herbal constituents, including Rhizoma Chuanxiong (Chuanxiong in Chinese, Radix Polygoni Multiflori (Heshouwu in Chinese and Radix Astragali (Huangqi in Chinese. were ranked. Further multi-center trials with large sample sizes, high methodological quality and standardized HM ingredients are necessary for clinical recommendations to be made.

  17. ORF Alignment: EHA1 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available Entamoeba histolytica HM-1:IMSS] ... Length = 219 ... Query: 344 EPAQADPENTYADGEGVEKCDAGKGPVKFTIHCVNKVGTSVPVTGAKFKVIIRSN...DGNEI 403 ... EPAQADPENTYADGEGVEKCDAGKGPVKFTIHCVNKVGTSVPVTGAKFKVIIRSNDGNEI Sbjct: 1 ... ... EPAQADPENTYADGEGVEKCDAGKGPVKFTIHCVNKVGTSVPVTGAKFKVIIRSNDGNEI 60 ... Query: 464 GVEG

  18. ORF Alignment: EHA1 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available tamoeba histolytica HM-1:IMSS] ... Length = 219 ... Query: 344 EPAQADPENTYADGEGVEKCDAGKGPVKFTIHCVNKVGTAVPVTGAKFKVIIRSN...DGNEI 403 ... EPAQADPENTYADGEGVEKCDAGKGPVKFTIHCVNKVGTAVPVTGAKFKVIIRSNDGNEI Sbjct: 1 ... E...PAQADPENTYADGEGVEKCDAGKGPVKFTIHCVNKVGTAVPVTGAKFKVIIRSNDGNEI 60 ... Query: 464 GVEGGV

  19. Comprehensive evaluation of genome-wide 5-hydroxymethylcytosine profiling approaches in human DNA.

    Science.gov (United States)

    Skvortsova, Ksenia; Zotenko, Elena; Luu, Phuc-Loi; Gould, Cathryn M; Nair, Shalima S; Clark, Susan J; Stirzaker, Clare

    2017-01-01

    The discovery that 5-methylcytosine (5mC) can be oxidized to 5-hydroxymethylcytosine (5hmC) by the ten-eleven translocation (TET) proteins has prompted wide interest in the potential role of 5hmC in reshaping the mammalian DNA methylation landscape. The gold-standard bisulphite conversion technologies to study DNA methylation do not distinguish between 5mC and 5hmC. However, new approaches to mapping 5hmC genome-wide have advanced rapidly, although it is unclear how the different methods compare in accurately calling 5hmC. In this study, we provide a comparative analysis on brain DNA using three 5hmC genome-wide approaches, namely whole-genome bisulphite/oxidative bisulphite sequencing (WG Bis/OxBis-seq), Infinium HumanMethylation450 BeadChip arrays coupled with oxidative bisulphite (HM450K Bis/OxBis) and antibody-based immunoprecipitation and sequencing of hydroxymethylated DNA (hMeDIP-seq). We also perform loci-specific TET-assisted bisulphite sequencing (TAB-seq) for validation of candidate regions. We show that whole-genome single-base resolution approaches are advantaged in providing precise 5hmC values but require high sequencing depth to accurately measure 5hmC, as this modification is commonly in low abundance in mammalian cells. HM450K arrays coupled with oxidative bisulphite provide a cost-effective representation of 5hmC distribution, at CpG sites with 5hmC levels >~10%. However, 5hmC analysis is restricted to the genomic location of the probes, which is an important consideration as 5hmC modification is commonly enriched at enhancer elements. Finally, we show that the widely used hMeDIP-seq method provides an efficient genome-wide profile of 5hmC and shows high correlation with WG Bis/OxBis-seq 5hmC distribution in brain DNA. However, in cell line DNA with low levels of 5hmC, hMeDIP-seq-enriched regions are not detected by WG Bis/OxBis or HM450K, either suggesting misinterpretation of 5hmC calls by hMeDIP or lack of sensitivity of the latter methods. We

  20. Evaluación de recursos hídricos de las sierras Blanca y Mijas (Málaga

    Directory of Open Access Journals (Sweden)

    Vadillo, I.

    1997-04-01

    Full Text Available A water balance of Sierras Blanca and Mijas Hydrogeological Unit, the most important aquifer in the Costa del Sol, in the period 1990/91-1993/94, has been made. The recharge is produced by the infiltration of rain water with a total amount of 116.9 hmhm3/year/year: 60.2 hm3/year has been evapotranspirated, 56.7 hm3/year belongs to the useful rain (8 hm3/year as streamflow and 48.7 hm /year as infiltration. The discharge have been measured and gives a total amount of 62.2 hm3/year: 28.2 hm3/year by the springs and 34 hm3/year by the pumpings. The useful rain has been calculated with several methods (Turc, Coutagne, Kessler, chloride method and monthly and daily Thornwaite method -with field capacities of 25 and 50 mm-. The method that fits in a better way with the known volumes of recharge and discharge, for each one of the aquifer system and for the whole Blanca-Mijas Hydrogeological Unit, is the chloride method.Se ha realizado el balance de la Unidad Hidrogeológica Sierra Blanca-Sierra de Mijas, la más importante de la Costa del Sol, para la media del período 1990/911993/ 94. La precipitación media sobre la Unidad es de 116,9 hm3/año: 60,2 hm3/año se evapotranspiran y 56,7 hm3/año constituyen la lluvia útil (8 hm3/año de escorrentía y 48,7 hm3/año de infiltración eficaz. Las salidas controlables ascienden a 62,2 hm3/año: 28,2 hm3/año se descargan por manantiales y 34 hm3/año por bombeos. La lluvia útil se ha calculado mediante varios métodos (Turc, Coutagne, Kessler, balance de cloruros, Thornwhite diario y mensual -con capacidades de campo de 25 y 50 mm-. El método que más se adapta a los volúmenes conocidos de entradas y salidas, para cada uno de los sistemas acuíferos y para la Unidad Hidrogeológica BlancaMijas en su conjunto, es el balance de cloruros.

  1. "Breastfeeding" but not at the breast: Mothers' descriptions of providing pumped human milk to their infants via other containers and caregivers.

    Science.gov (United States)

    Felice, Julia P; Geraghty, Sheela R; Quaglieri, Caroline W; Yamada, Rei; Wong, Adriana J; Rasmussen, Kathleen M

    2017-07-01

    As pumping has become more prevalent among American women, pumped human milk (HM) is on the rise in their infants' diets in place of some or all feeding at the breast. We aimed to fill a gap in knowledge about mothers' motivations, practices and perceptions related to pumping, and about mothers' and other caregivers' motivations, practices, and perceptions related to feeding pumped HM. Results related to providing pumped HM are reported here, and results related to pumping are reported elsewhere. We conducted in-depth, semi-structured interviews among a diverse sample of mothers whose infants were fed pumped HM (n = 20), following each up to 1 year postpartum. Data were analyzed using thematic analysis with Atlas.ti. Nearly all mothers felt bottles were necessary to meet infant HM-feeding goals. Nearly all pumped HM was fed by other caregivers because mothers typically preferred and prioritized feeding at the breast for convenience and maintaining their milk supply. Infants were bottle-fed HM for several reasons that changed over time, such as mother's absence, latch difficulty, or desire to share the burden and bonding of feeding. Feeding practices differed between feeds from bottles versus at the breast; some infants were bottle-fed on schedules but fed at the breast on demand. Mothers' methods for storing, transporting, and preparing HM varied substantially and included practices associated with loss of nutrients and microbial contamination. Mothers' reasons for bottle-feeding HM may affect how much their infants are bottle-fed. Consumption of pumped HM may not provide the same benefits to infants as feeding at the breast. These findings highlight important avenues for future research into the relationships between bottle-feeding HM and infant health, growth, and developmental outcomes. © 2017 John Wiley & Sons Ltd.

  2. Breast milk nutrient content and infancy growth.

    Science.gov (United States)

    Prentice, Philippa; Ong, Ken K; Schoemaker, Marieke H; van Tol, Eric A F; Vervoort, Jacques; Hughes, Ieuan A; Acerini, Carlo L; Dunger, David B

    2016-06-01

    Benefits of human breast milk (HM) in avoiding rapid infancy weight gain and later obesity could relate to its nutrient content. We tested the hypothesis that differential HM total calorie content (TCC) or macronutrient contents may be associated with infancy growth. HM hindmilk samples were collected at ages 4-8 weeks from 614 mothers participating in a representative birth cohort, with repeated infancy anthropometry. HM triglyceride (fat), lipid analytes and lactose (carbohydrate) were measured by (1) H-NMR, and protein content by the Dumas method. TCC and %macronutrients were determined. In 614 HM samples, fat content was as follows: [median(IQR)]: 2.6 (1.7-3.6) g/100 mL, carbohydrate: 8.6 (8.2-8.8) g/100 mL, protein: 1.2 (1.1-1.2) g/100 mL; TCC: 61.8 (53.7-71.3) kcal/100 mL. HM of mothers exclusively breast feeding vs. mixed feeding was more calorific with higher %fat, lower %carbohydrate and lower %protein. Higher HM TCC was associated with lower 12-months body mass index (BMI)/adiposity, and lower 3-12 months gains in weight/BMI. HM %fat was inversely related to 3-12 months gains in weight, BMI and adiposity, whereas %carbohydrate was positively related to these measures. HM %protein was positively related to 12-months BMI. HM analysis showed wide variation in %macronutrients. Although data on milk intakes were unavailable, our findings suggest functional relevance of HM milk composition to infant growth. ©2016 The Authors. Acta Paediatrica published by John Wiley & Sons Ltd on behalf of Foundation Acta Paediatrica.

  3. [Nitrogen and water cycling of typical cropland in the North China Plain].

    Science.gov (United States)

    Pei, Hong-wei; Shen, Yan-jun; Liu, Chang-ming

    2015-01-01

    Intensive fertilization and irrigation associated increasing grain production has led to serious groundwater depletion and soil/water pollution in the North China Plain (NCP). Intensive agriculture changes the initial mass and energy balance, and also results in huge risks to the water/soil resources and food security regionally. Based on the research reports on the nitrogen cycle and water cycle in typical cropland (winter wheat and summer corn) in the NCP during the past 20 years, and the meteorological data, field experiments and surveys, we calculated the nitrogen cycle and water-cycle for this typical cropland. Annual total nitrogen input were 632 kg N . hm-2, including 523 kg N . hm-2 from commercial fertilizer, 74 kg N . hm-2 from manure, 23 kg N . hm-2 from atmosphere, and 12 kg N . hm-2 from irrigation. All of annual outputs summed to 532 kg N . hm-2 including 289 kg N . hm-2 for crop, 77 kg N . hm-2 staying in soil profile, leaching 104 kg N . hm-2, 52 kg N . hm-2 for ammonia volatilization, 10 kg N . hm-2 loss in nitrification and denitrification. Uncertainties of the individual cases and the summary process lead to the unbalance of nitrogen. For the dominant parts of the field water cycle, annual precipitation was 557 mm, irrigation was 340 mm, while 762 mm was for evapotranspiration and 135 mm was for deep percolation. Considering uncertainties in the nitrogen and water cycles, coupled experiments based on multi-disciplines would be useful for understanding mechanisms for nitrogen and water transfer processes in the soil-plant-atmosphere-continuum (SPAC) , and the interaction between nitrogen and water, as well as determining the critical threshold values for sustainability of soil and water resources in the NCP.

  4. Loss of 5-hydroxymethylcytosine is linked to gene body hypermethylation in kidney cancer.

    Science.gov (United States)

    Chen, Ke; Zhang, Jing; Guo, Zhongqiang; Ma, Qin; Xu, Zhengzheng; Zhou, Yuanyuan; Xu, Ziying; Li, Zhongwu; Liu, Yiqiang; Ye, Xiongjun; Li, Xuesong; Yuan, Bifeng; Ke, Yuwen; He, Chuan; Zhou, Liqun; Liu, Jiang; Ci, Weimin

    2016-01-01

    Both 5-methylcytosine (5mC) and its oxidized form 5-hydroxymethylcytosine (5hmC) have been proposed to be involved in tumorigenesis. Because the readout of the broadly used 5mC mapping method, bisulfite sequencing (BS-seq), is the sum of 5mC and 5hmC levels, the 5mC/5hmC patterns and relationship of these two modifications remain poorly understood. By profiling real 5mC (BS-seq corrected by Tet-assisted BS-seq, TAB-seq) and 5hmC (TAB-seq) levels simultaneously at single-nucleotide resolution, we here demonstrate that there is no global loss of 5mC in kidney tumors compared with matched normal tissues. Conversely, 5hmC was globally lost in virtually all kidney tumor tissues. The 5hmC level in tumor tissues is an independent prognostic marker for kidney cancer, with lower levels of 5hmC associated with shorter overall survival. Furthermore, we demonstrated that loss of 5hmC is linked to hypermethylation in tumors compared with matched normal tissues, particularly in gene body regions. Strikingly, gene body hypermethylation was significantly associated with silencing of the tumor-related genes. Downregulation of IDH1 was identified as a mechanism underlying 5hmC loss in kidney cancer. Restoring 5hmC levels attenuated the invasion capacity of tumor cells and suppressed tumor growth in a xenograft model. Collectively, our results demonstrate that loss of 5hmC is both a prognostic marker and an oncogenic event in kidney cancer by remodeling the DNA methylation pattern.

  5. The anti-CMS technique for genome-wide mapping of 5-hydroxymethylcytosine.

    Science.gov (United States)

    Huang, Yun; Pastor, William A; Zepeda-Martínez, Jorge A; Rao, Anjana

    2012-10-01

    5-Hydroxymethylcytosine (5hmC) is a recently discovered base in the mammalian genome, produced upon oxidation of 5-methylcytosine (5mC) in a process catalyzed by TET proteins. The biological functions of 5hmC and further oxidation products of 5mC are under intense investigation, as they are likely intermediates in DNA demethylation pathways. Here we describe a novel protocol to profile 5hmC at a genome-wide scale. This approach is based on sodium bisulfite-mediated conversion of 5hmC to cytosine-5-methylenesulfonate (CMS); CMS-containing DNA fragments are then immunoprecipitated using a CMS-specific antiserum. The anti-CMS technique is highly specific with a low background, and is much less dependent on 5hmC density than anti-5hmC immunoprecipitation (IP). Moreover, it does not enrich for CA and CT repeats, as noted for 5hmC DNA IP using antibodies to 5hmC. The anti-CMS protocol takes 3 d to complete.

  6. Atmospheric heavy metal input to forest soils in rural areas of Denmark

    DEFF Research Database (Denmark)

    Hovmand, Mads Frederik; Kemp, Kaare

    2007-01-01

    Atmospheric bulk deposition of heavy metals (HM) was measured from 1972/73 to the present time at five to ten forest sites in rural areas of Denmark. From 1979, HM in aerosols were measured at one to four forest sites. On the basis of these long-term continuous measurements, the atmospheric inputs...

  7. [An emergy-ecological footprint model based evaluation of ecological security at the old industrial area in Northeast China: A case study of Liaoning Province.

    Science.gov (United States)

    Yang, Qing; Lu, Cheng Peng; Zhou, Feng; Geng, Yong; Jing, Hong Shuang; Ren, Wan Xia; Xue, Bing

    2016-05-01

    Based on the integrated model of emergy-ecological footprint approaches, the ecological security of Liaoning Province, a typical case for the old industrial area, was quantitatively evaluated from 2003 to 2012, followed by a scenario analysis on the development trend of the ecological secu-rity by employing the gray kinetic model. The results showed that, from 2003 to 2012, the value of emergy ecological-capacity per capita in Liaoning Province decreased from 3.13 hm 2 to 3.07 hm 2 , while the emergy-ecological footprint increased from 13.88 hm 2 to 21.96 hm 2 , which indicated that the ecological deficit existed in Liaoning Province and the situation was getting worse. The ecological pressure index increased from 4.43 to 7.16 during the studied period, and the alert level of ecological security changed from light to middle level. According to the development trend, the emergy ecological capacity per capita during 2013-2022 would correspondingly decrease from 3.04 hm 2 to 2.98 hm 2 , while the emergy ecological footprint would increase from 22.72 hm 2 to 35.87 hm 2 , the ecological pressure index would increase from 7.46 to 12.04, and the ecological deficit would keep increasing and the ecological security level would slide into slightly unsafe condition. The alert level of ecological security would turn to be middle or serious, suggesting the problems in ecological safety needed to be solved urgently.

  8. Phytoscreening and phytoextraction of heavy metals at Danish polluted sites using willow and poplar trees

    DEFF Research Database (Denmark)

    Nielsen, Mette Algreen; Trapp, Stefan; Rein, Arno

    2014-01-01

    The main purpose of this study was to determine typical concentrations of heavy metals (HM) in wood from willows and poplars, in order to test the feasibility of phytoscreening and phytoextraction of HM. Samples were taken from one strongly, one moderately, and one slightly polluted site and from...

  9. [Effects of nitrogen application levels on yield and active composition content of Desmodium styracifolium].

    Science.gov (United States)

    Zhou, Jiamin; Yin, Xiaohong; Chen, Chaojun; Huang, Min; Peng, Fuyuan; Zhu, Xiaoqi

    2010-06-01

    To find out the optimal nitrogen application level of Desmodium styracifolium. A field experiment using randomized block design was carried out to study the effects of 5 nitrogen application levels (150, 187.5, 225.0, 262.5 and 300.0 kg x hm(-2)) on yield and active component content of D. styracifolium. Nitrogen application could increase the yield and contents of polysaccharide, total flavonoides and total saponins of D. styracifolium. However, the enhancing extent of the active component content and the yield were not always significant with the increase of nitrogen level. In which, the yield were not significantly different among the nitrogen application levels of 225.0, 262.5, 300.0 kg x hm(-2) the polysaccharide content was no significantly difference among the nitrogen application levels of 225.0, 262. 5 and 300.0 kg x hm(-2), the total flavonoides content under the nitrogen level of 300.0 kg x hm(-2) was significantly lower than that of 150.0 kg hm(-2) (P < 0.01), and the total saponins content under the nitrogen level of 300.0 kg x hm(-2) was no significant difference compared with that of 262.5 kg x hm(-2). The optimal nitrogen application level of D. styracifolium was 225.0-262.5 kg x hm(-2).

  10. Deontic Reasoning with Emotional Content: Evolutionary Psychology or Decision Theory?

    Science.gov (United States)

    Perham, Nick; Oaksford, Mike

    2005-01-01

    Three experiments investigated the contrasting predictions of the evolutionary and decision-theoretic approaches to deontic reasoning. Two experiments embedded a hazard management (HM) rule in a social contract scenario that should lead to competition between innate modules. A 3rd experiment used a pure HM task. Threatening material was also…

  11. Calcium - urine

    Science.gov (United States)

    ... Female urinary tract Male urinary tract Calcium urine test References Bringhurst FR, Demay MB, Kronenberg HM. Hormones and disorders of mineral metabolism. In: Melmed S, Polonsky KS, Larsen PR, Kronenberg HM, eds. Williams Textbook of Endocrinology . 13th ed. Philadelphia, PA: Elsevier; ...

  12. Physics-based simulations of the impacts forest management practices have on hydrologic response

    Science.gov (United States)

    Adrianne Carr; Keith Loague

    2012-01-01

    The impacts of logging on near-surface hydrologic response at the catchment and watershed scales were examined quantitatively using numerical simulation. The simulations were conducted with the Integrated Hydrology Model (InHM) for the North Fork of Caspar Creek Experimental Watershed, located near Fort Bragg, California. InHM is a comprehensive physics-based...

  13. Stemcell Information: SKIP000888 [SKIP Stemcell Database[Archive

    Lifescience Database Archive (English)

    Full Text Available SKIP000888 ... T cells T細胞 Normal 24HM 24HM ... 24 20-29 Male Japanese 日本人 -- No iPS cell...s from healthy human T cells ヒト健常人由来iPS細胞 human ES-like Research Grade Plasmid OCT4,SOX2,KL

  14. Comparative efficacy of herbal and synthetic methionine on ...

    African Journals Online (AJOL)

    HM) compared to synthetic methionine (SM) in the diets of domestic laying hens. The herbal methionine (Meth-o-Tas®) was supplied by Intas Pharmaceutical Limited, India. The HM and SM were added to a standard diet at 0.5 and 1.0 kg per ...

  15. 5-Hydroxymethylcytosine is a predominantly stable DNA modification

    Science.gov (United States)

    Bachman, Martin; Uribe-Lewis, Santiago; Yang, Xiaoping; Williams, Michael; Murrell, Adele; Balasubramanian, Shankar

    2014-12-01

    5-Hydroxymethylcytosine (hmC) is an oxidation product of 5-methylcytosine which is present in the deoxyribonucleic acid (DNA) of most mammalian cells. Reduction of hmC levels in DNA is a hallmark of cancers. Elucidating the dynamics of this oxidation reaction and the lifetime of hmC in DNA is fundamental to understanding hmC function. Using stable isotope labelling of cytosine derivatives in the DNA of mammalian cells and ultrasensitive tandem liquid-chromatography mass spectrometry, we show that the majority of hmC is a stable modification, as opposed to a transient intermediate. In contrast with DNA methylation, which occurs immediately during replication, hmC forms slowly during the first 30 hours following DNA synthesis. Isotopic labelling of DNA in mouse tissues confirmed the stability of hmC in vivo and demonstrated a relationship between global levels of hmC and cell proliferation. These insights have important implications for understanding the states of chemically modified DNA bases in health and disease.

  16. Effects of clay minerals, hydroxides, and timing of dissolved organic matter addition on the competitive sorption of copper, nickel, and zinc : a column experiment

    NARCIS (Netherlands)

    Refaey, Y.; Jansen, B.; Parsons, J.R.; de Voogt, P.; Bagnis, S.; Markus, A.; El-Shater, A.-H.; El-Haddad, A.-A.; Kalbitz, K.

    2017-01-01

    Infiltration of heavy metal (HM) polluted wastewater can seriously compromise soil and groundwater quality. Interactions between mineral soil components (e.g. clay minerals) and dissolved organic matter (DOM) play a crucial role in determining HM mobility in soils. In this study, the influence of

  17. A systematic review of health manpower forecasting models.

    NARCIS (Netherlands)

    Martins-Coelho, G.; Greuningen, M. van; Barros, H.; Batenburg, R.

    2011-01-01

    Context: Health manpower planning (HMP) aims at matching health manpower (HM) supply to the population’s health requirements. To achieve this, HMP needs information on future HM supply and requirement (S&R). This is estimated by several different forecasting models (FMs). In this paper, we review

  18. Evidence for strange kinetics in Hasegawa-Mima turbulent transport

    International Nuclear Information System (INIS)

    Annibaldi, S.V.; Drury, L.O'C.; Manfredi, G.; Dendy, R.O.

    2000-01-01

    We have studied the transport of test particle ensembles moving in turbulent electrostatic fields governed by the Hasegawa-Mima (HM) equation. As a result of the interplay of the linear dispersive term and the nonlinear term in the HM equation, 'strange kinetics' emerge: the poloidal particle transport undergoes a qualitative transition from diffusive, through supradiffusive, to ballistic. (author). Letter-to-the-editor

  19. Radiation response of two Harris semiconductor radiation hardened 1k CMOS RAMs

    International Nuclear Information System (INIS)

    Abare, W.E.; Huffman, D.D.; Moffett, G.E.

    1982-01-01

    This paper describes the testing of two types 1K CMOS static RAMs in various transient and steady state ionizing radiation environments. Type HM 6551R (256x4 bits) and type HM 6508R (1024x1 bit) RAMs were evaluated. The RAMs are radiation hardened versions of Harris' commercial RAMs. A brief description of the radiation hardened process is presented

  20. IdentiFINDER Laboratory Exercise

    Energy Technology Data Exchange (ETDEWEB)

    Weinmann-Smith, Robert [Los Alamos National Lab. (LANL), Los Alamos, NM (United States)

    2017-09-21

    The identiFINDER2 is an easily portable handheld NaI gamma detector. The IAEA uses the safeguards version of the identiFINDER2 and calls it the HM-5. The HM-5 has built in software to analyze the detection signal specifically for IAEA verification applications.

  1. Effect of Parental Live Weight on the Reproductive Performance of ...

    African Journals Online (AJOL)

    High mortality was obtained from HM x HF and HM x LF crosses. This study concluded that light male and light female crosses gave chicks with better post hatching performance and lowest mortality rate than all other crosses. Keywords: Parental live weight, Egg weight, Hatchability, Fertility, Crosses, Japanese quail ...

  2. Brain atrophy following hemiplegic migraine attacks

    NARCIS (Netherlands)

    Pelzer, Nadine; Hoogeveen, Evelien S.; Ferrari, Michel D.; Poll-The, Bwee Tien; Kruit, Mark C.; Terwindt, Gisela M.

    2017-01-01

    Background Patients with hemiplegic migraine (HM) may sometimes develop progressive neurological deterioration of which the pathophysiology is unknown. Patient We report a 16-year clinical and neuroradiological follow-up of a patient carrying a de novo p.Ser218Leu CACNA1A HM mutation who had nine

  3. Clinical value of iodine-123 beta-methyliodophenyl pentadecanoic acid (BMIPP) myocardial single photon emission computed tomography for predicting cardiac death among patients with chronic heart failure

    International Nuclear Information System (INIS)

    Sasaki, Ryu; Usui, Takashi; Mitani, Isao

    2003-01-01

    In the present study, the effectiveness of 123 I-β-methyliodophenyl pentadecanoic acid (BMIPP) single photon emission computed tomography (SPECT) for predicting cardiac death of patients with chronic heart failure was evaluated. Abnormalities of fatty acid metabolism are found in patients with chronic heart failure and BMIPP was developed as a tracer for scintigraphic assessment of myocardial fatty acid utilization. The study group comprised 74 patients with chronic heart failure with a left ventricular ejection fraction (LVEF) 201 Tl SPECT and BMIPP SPECT. The uptake of tracer was scored semiquantitatively from 0 (normal) to 4 (defect) in 20 segments and a total defect score (TDS) for all 20 segments was calculated. On planar images the mediastinum to heart count ratio (H/M) was calculated for the BMIPP and Tl studies, and the H/M BMIPP :H/M Tl (H/M BMIPP divided by H/M Tl ) was also calculated. The mean follow-up period was 660 days and there were 17 cases of cardiac death. Multivariate analysis identified H/M BMIPP :H/M Tl (p BMIPP :H/M Tl was situated to the left relative to LVEF. Analysis of the myocardial metabolism by BMIPP SPECT can predict the high-risk patients with chronic heart failure. (author)

  4. LOSS OF 5-HYDROXYMETHYLCYTOSINE IS AN EPIGENETIC HALLMARK OF MELANOMA

    Science.gov (United States)

    Lian, Christine Guo; Xu, Yufei; Ceol, Craig; Wu, Feizhen; Larson, Allison; Dresser, Karen; Xu, Wenji; Tan, Li; Hu, Yeguang; Zhan, Qian; Lee, Chung-wei; Hu, Di; Lian, Bill Q.; Kleffel, Sonja; Yang, Yijun; Neiswender, James; Khorasani, Abraham J.; Fang, Rui; Lezcano, Cecilia; Duncan, Lyn M.; Scolyer, Richard A.; Thompson, John F.; Kakavand, Hojabr; Houvras, Yariv; Zon, Leonard; Mihm, Martin C.; Kaiser, Ursula B.; Schatton, Tobias; Woda, Bruce A.; Murphy, George F.; Shi, Yujiang G.

    2013-01-01

    SUMMARY DNA methylation at the 5-position of cytosine (5-mC) is a key epigenetic mark critical for various biological and pathological processes. 5-mC can be converted to 5-hydroxymethylcytosine (5-hmC) by the Ten-Eleven Translocation (TET) family of DNA hydroxylases. Here we report that “loss of 5-hmC” is an epigenetic hallmark of melanoma with diagnostic and prognostic implications. Genome-wide mapping of 5-hmC reveals loss of 5-hmC landscape in the melanoma epigenome. We show that down-regulation of Isocitrate Dehydrogenase 2 (IDH2) and TET family enzymes is likely one of the mechanisms underlying 5-hmC loss in melanoma. Rebuilding the 5-hmC landscape in melanoma cells by reintroducing active TET2 or IDH2 suppresses melanoma growth and increases tumor-free survival in animal models. Thus, our study reveals a critical function of 5-hmC in melanoma development and directly links the IDH and TET activity-dependent epigenetic pathway to 5-hmC-mediated suppression of melanoma progression, suggesting a new strategy for epigenetic cancer therapy. PMID:22980977

  5. Structure of the Anthrax Research Literature

    Science.gov (United States)

    2006-01-01

    46 BARAKAT LA 2002 JAMA-J AM MED ASSOC 287 863 31 READ TD 2003 NATURE 423 81 96 IVANOVA N 2003 NATURE 423 87 73 SCOBIE HM 2003 P NATL ACAD SCI USA...Authors collier, rj 9; leppla, sh 7; young, jat 5; wigelsworth, dj 3; scobie , hm 3; mogridge, j 3; liu, sh 3; liddington, rc 3; lacy, db 3

  6. Whole blood coagulation time, haematocrit, haemoglobin and total ...

    African Journals Online (AJOL)

    The study was carried out to determine the values of whole blood coagulation time (WBCT), haematocrit (HM), haemaglobin (HB) and total protein (TP) of one hundred and eighteen apparently healthy turkeys reared under an extensive management system in Zaria. The mean values for WBCT, HM, HB and TP were 1.12 ...

  7. Effects of feeding un-extruded floating feed to African giant catfish ...

    African Journals Online (AJOL)

    This study investigated the effects of feeding two types of un-extruded floating fish feeds (HM1 and HM2 –38% CP, produced manually using available feedstuffs) and a commercial imported fish feed (Coppens – 40% CP) on growth performance and body composition of Heterobranchus longifilis over 56 days. Commercial ...

  8. Benjamin Banneker's 18th Century Astronomy

    Science.gov (United States)

    Howard, Sethanne

    2018-01-01

    Benjamin Banneker is considered to be the first African-American man of science (1731-1806), a contempory of George Washington and Thomas Jefferson. He was a self taught clock maker, mathematician, and astronomer. He owned land in Baltimore County near Ellicott City, Maryland where he farmed tobacco. He is especially known for his work on the Boundary Survey of our new Capital. Surveyors place boundary stones along the boundary of the nascent Capital. Banneker was part of the team who measured the latitutde and longitude for each stone. Using 18th century surveying techniques Banneker became part of the early history of Washington DC. He also published popular almanacs.

  9. GPS Modeling and Analysis. Summary of Research: GPS Satellite Axial Ratio Predictions

    Science.gov (United States)

    Axelrad, Penina; Reeh, Lisa

    2002-01-01

    This report outlines the algorithms developed at the Colorado Center for Astrodynamics Research to model yaw and predict the axial ratio as measured from a ground station. The algorithms are implemented in a collection of Matlab functions and scripts that read certain user input, such as ground station coordinates, the UTC time, and the desired GPS (Global Positioning System) satellites, and compute the above-mentioned parameters. The position information for the GPS satellites is obtained from Yuma almanac files corresponding to the prescribed date. The results are displayed graphically through time histories and azimuth-elevation plots.

  10. Danish TV Christmas calendars: Folklore, myth and cultural history

    DEFF Research Database (Denmark)

    Agger, Gunhild

    2013-01-01

    in which this traditional genre has succeeded in renewing itself. The so-called Pyrus series, TV 2’s Christmas calendars during the mid-1990s, exhibited folklore, myth and cultural history in a combination of entertainment and information. They were succeeded by calendars such as Jul i Valhal......This article aims at characterizing the Danish Christmas calendar as a TV institution and a meeting place for the traditions of the almanac, folklore and the history of culture. Against the background of a brief outline of the history of Danish Christmas calendars, the article explores ways...

  11. Compilation of methods in orbital mechanics and solar geometry

    Science.gov (United States)

    Buglia, James J.

    1988-01-01

    This paper contains a collection of computational algorithms for determining geocentric ephemerides of Earth satellites, useful for both mission planning and data reduction applications. Special emphasis is placed on the computation of sidereal time, and on the determination of the geocentric coordinate of the center of the Sun, all to the accuracy found in the Astronomical Almanac. The report is completely self-contained in that no requirement is placed on any external source of information, and hence, these methods are ideal for computer application.

  12. Development and Validation of a Predictive Model to Assess the Impact of Coastal Operations On Urban Scale Air Quality

    Science.gov (United States)

    2006-09-29

    originating in Los Angeles. The long ridge of ozone in the north east part of Figure 14a is due to polluted air from San Diego area that has undergone...Further north of this small ridge (2 ppbv), we find a decrease in O3 of up to 6ppb (i.e., without DoD emissions, O3 is reduced by 6ppb). This period is...ships on urban air quality. 35 6.0 References Alexis, A., P. Gaffney , C. Garcia, M. Nystrom, and R. Rood (2000), The 1999 California Almanac of

  13. Influence of Ephemeris Error on GPS Single Point Positioning Accuracy

    Science.gov (United States)

    Lihua, Ma; Wang, Meng

    2013-09-01

    The Global Positioning System (GPS) user makes use of the navigation message transmitted from GPS satellites to achieve its location. Because the receiver uses the satellite's location in position calculations, an ephemeris error, a difference between the expected and actual orbital position of a GPS satellite, reduces user accuracy. The influence extent is decided by the precision of broadcast ephemeris from the control station upload. Simulation analysis with the Yuma almanac show that maximum positioning error exists in the case where the ephemeris error is along the line-of-sight (LOS) direction. Meanwhile, the error is dependent on the relationship between the observer and spatial constellation at some time period.

  14. Perceptions of the Muslim religious leaders and their attitudes on herbal medicine in Bangladesh: a cross-sectional study

    Directory of Open Access Journals (Sweden)

    Rashid Md Aminur

    2011-09-01

    Full Text Available Abstract Background Herbal Medicines (HMs are playing major roles in the health of the millions of people worldwide. Muslim Religious Leader (MRLs, being an important component of the society with huge influence on it, could contribute a lot to promote HM. This study was aimed at evaluating perceptions of the MRLs, their satisfaction and attitudes towards HM in Bangladesh. Methods This cross-sectional study collected data from a purposive sample of 503 MRLs using an interviewer-administered structured questionnaire during December 2010 and January 2011. Main outcome measures included sociodemographic variables, MRLs' preferences in using HMs, their satisfaction and intent to use HMs in the future, and finally MRLs' attitudes toward HM use. Results Although two-fifth (40.4% of the MRLs preferred HM among different form of complementary and alternative medicines, they used orthodox medicine (OM more frequently than HM in last one year. Majority believed that HM was effective for all age groups (52.6% and both sexes (74.5%. One-third felt that HM was more effective for chronic diseases, 68.5% felt that it only promotes health, and 40.8% said it keeps them relaxed. About 98.0% of the respondents experienced 'no harm' but 'benefit' from HM; naturally, they were satisfied with HM and were willing to recommend it to others. Urban, older (>40 years, and 'single' respondents were more likely to use HM (gender and education adjusted odds ratios = 1.7 [95% confidence interval, CI = 1.1-2.6], 1.9 [95% CI = 1.3-3.0], and 1.6 [95% CI = 1.2-2.1], respectively. Overall, respondents exhibited very positive attitude towards HM with mean score of 4.2 (range, 3.7-4.6 of a 5-point Likert scale (Score 5 for strongly agree to 1 for strongly disagree. Conclusions We report adequate perceptions, satisfaction, and very positive attitudes towards HM among MRLs. Mass media had a significant contribution towards its promotion. If HM are to assume a respected place in the

  15. Maternal and infant characteristics associated with human milk feeding in very low birth weight infants.

    Science.gov (United States)

    Sisk, Paula M; Lovelady, Cheryl A; Dillard, Robert G; Gruber, Kenneth J; O'Shea, T Michael

    2009-11-01

    This study identified maternal and infant characteristics predicting human milk (HM) feeding in very low birth weight (VLBW) infants whose mothers (n = 184) participated in a study of lactation counseling and initiated milk expression. Data were collected prospectively, by maternal interview and medical record review. During hospitalization, 159 (86%) infants received at least 50% HM proportion of feedings in the first 2 weeks of life, and 114 (62%) received some HM until the day of hospital discharge. Analysis showed plan to breastfeed was the strongest predictor of initiation and duration of HM feeding. Greater than 12 years of education, respiratory distress syndrome, Apgar score >6, and female gender were significant predictors, and no perinatal hypertensive disorder, white race, and mechanical ventilation were marginal predictors of HM feeding. Women with a high-risk pregnancy should be provided education about the benefits of breastfeeding for infants who are likely to be born prematurely.

  16. Hierarchical Modulation with Vector Rotation for E-MBMS Transmission in LTE Systems

    Directory of Open Access Journals (Sweden)

    Hui Zhao

    2010-01-01

    Full Text Available Enhanced Multimedia Broadcast and Multicast Service (E-MBMS is considered of key importance for the proliferation of Long-Term Evolution (LTE network in mobile market. Hierarchical modulation (HM, which involves a “base-layer” (BL and an “enhancement-layer” (EL bit streams, is a simple technique for achieving tradeoff between service quality and radio coverage. Therefore, it is appealing for MBMS. Generally, HM suffers from the severe performance degradation of the less protected EL stream. In this paper, HM with vector rotation operation introduced to EL stream is proposed, in order to improve EL's performance. With the proper interleaving in frequency domain, this operation can exploit the inherent diversity gain from the multipath channel. In this way, HM with vector rotation can effectively enhance multimedia broadcasting on quality video and coverage. The simulation results with scalable video coding (SVC as source show the significant benefits in comparison with the conventional HM and alternative schemes.

  17. Decrease of 5-Hydroxymethylcytosine in Rat Liver with Subchronic Exposure to Genotoxic Carcinogens Riddelliine and Aristolochic Acid

    Science.gov (United States)

    Lian, Christine Guo; Xu, Shuyun; Guo, Weimin; Yan, Jian; Frank, Maximilian Y M; Liu, Robert; Liu, Cynthia; Chen, Ying; Murphy, George F.; Chen, Tao

    2018-01-01

    The level of 5-hydroxymethylcytosine (5-hmC) converted by ten-eleven translocation (TET) family is decreased in cancers. However, whether 5-hmC level is perturbed in early stages of carcinogenesis caused by genotoxic carcinogens is not defined. 5-hmC levels and TET2 expression were measured in liver of rats treated with genotoxic carcinogens, riddelliine, or aristolochic acid. Levels of 5-hmC and TET2 expression decreased in the liver of the carcinogens-treated rats. Loss of 5-hmC correlates well with documented induction of genetic mutations by the carcinogens, suggesting that TET2-mediated 5-hydroxymethylation plays an epigenetic role in early state of carcinogenesis. PMID:25154389

  18. Dynamic changes in DNA demethylation in the tree shrew (Tupaia belangeri chinensis) brain during postnatal development and aging.

    Science.gov (United States)

    Wei, Shu; Hua, Hai-Rong; Chen, Qian-Quan; Zhang, Ying; Chen, Fei; Li, Shu-Qing; Li, Fan; Li, Jia-Li

    2017-03-18

    Brain development and aging are associated with alterations in multiple epigenetic systems, including DNA methylation and demethylation patterns. Here, we observed that the levels of the 5-hydroxymethylcytosine (5hmC) ten-eleven translocation (TET) enzyme-mediated active DNA demethylation products were dynamically changed and involved in postnatal brain development and aging in tree shrews ( Tupaia belangeri chinensis ). The levels of 5hmC in multiple anatomic structures showed a gradual increase throughout postnatal development, whereas a significant decrease in 5hmC was found in several brain regions in aged tree shrews, including in the prefrontal cortex and hippocampus, but not the cerebellum. Active changes in Tet mRNA levels indicated that TET2 and TET3 predominantly contributed to the changes in 5hmC levels. Our findings provide new insight into the dynamic changes in 5hmC levels in tree shrew brains during postnatal development and aging processes.

  19. Evaluation of a Rising Plate Meter for Use in Multispecies Swards

    Directory of Open Access Journals (Sweden)

    S. Leanne Dillard

    2016-11-01

    Full Text Available The rising plate meter (RPM provides rapid estimates of herbage mass (HM. Accurate calibration of the RPM is difficult due to variability in forage management, growth, and species composition. The RPM is typically calibrated by linear regression of HM and RPM height; however, the is usually low. Curvilinear regression, with the intercept set to zero, could provide a more robust calibration equation and decrease variability in RPM estimates. Three Pennsylvania organic dairy farms grazing lactating dairy cattle on multispecies pastures were used to determine measured HM and estimated HM using a RPM. Removal of the intercept increased the adjusted of all equations between 42.8 and 89.0%. Use of quadratic and cubic regression only resulted in 0.01 to 0.02 increase in adjusted . Linear regression remains the simplest and preferred method of calibration; however, error can be reduced by setting calibration equations so that zero RPM height is associated with zero HM.

  20. Effect of pre-grazing herbage mass on dairy cow performance, grass dry matter production and output from perennial ryegrass (Lolium perenne L.) pastures.

    Science.gov (United States)

    Wims, C M; Delaby, L; Boland, T M; O'Donovan, M

    2014-01-01

    A grazing study was undertaken to examine the effect of maintaining three levels of pre-grazing herbage mass (HM) on dairy cow performance, grass dry matter (DM) production and output from perennial ryegrass (Lolium perenne L.) pastures. Cows were randomly assigned to one of three pre-grazing HM treatments: 1150 - Low HM (L), 1400 - Medium HM (M) or 2000 kg DM/ha - High HM (H). Herbage accumulation under grazing was lowest (Ppastures required more grass silage supplementation during the grazing season (+73 kg DM/cow) to overcome pasture deficits due to lower pasture growth rates (Ppasture intake, although cows grazing the L pastures had to graze a greater daily area (Ppasture reduces pasture DM production and at a system level may increase the requirement for imported feed.