WorldWideScience

Sample records for hm ii lvad

  1. LVAD pannus complicating destination therapy

    Directory of Open Access Journals (Sweden)

    Maya Ignaszewski

    2017-11-01

    Full Text Available Despite advances in technology, ventricular assist devices still experience a number of complications limiting their long-term use. We present a 73-year-old woman implanted with a left ventricular assist device (LVAD five years prior due to end-stage dilated cardiomyopathy, who died several weeks after admission to the hospital. Post-mortem examination revealed a large obstructing pannus in the LVAD inflow. As a result of increased LVAD use, complications such as infection, device thrombosis and pannus must be promptly recognized and managed appropriately to ensure the greatest chance of patient survival.

  2. Oxygenator in short-term LVAD circuit: a rescue in post-LVAD pulmonary complications.

    Science.gov (United States)

    Mohite, Prashant N; Patil, Nikhil P; Popov, Aron-Frederik; Bahrami, Toufan; Simon, Andre R

    2016-10-01

    Pulmonary complications after left ventricular assist device (LVAD) implantation, though infrequent, can be potentially catastrophic. A 62-year-old female with cardiogenic shock, supported on short-term LVAD, developed pulmonary oedema. An oxygenator was introduced into the LVAD circuit, which improved the gas exchange and, eventually, after weaning off the oxygenator, the patient received long-term LVAD. The introduction of an oxygenator into the short-term LAVD circuit is a lifesaving manoeuvre in such a situation. It offers freedom of introducing and removing the oxygenator into the LVAD circuit without opening the chest and competing for LVAD flow. © The Author(s) 2016.

  3. Agrobacterium tumefaciens-MEDIATED IN-PLANTA TRANSFORMATION OF INDONESIAN MAIZE USING pIG121Hm-Cs PLASMID CONTAINING nptII AND hpt GENES

    Directory of Open Access Journals (Sweden)

    Edy Listanto

    2017-05-01

    Full Text Available Maize (Zea mays L. productivity in Indonesia is challenged to be increased using genetic engineering. Recent advances in Agrobacterium tumefaciens-mediated in-planta transforma-tion makes it possible to transform maize with low cost, and simple method. This study aimed to confirm pIG121Hm-Cs plasmid in A. tumefaciens, and to estimate the efficiency level of  A. tumefaciens-mediated in-planta transformation of Indonesian maize by using pIG121Hm-Cs plasmid containing nptII and hpt genes. A series of studies were conducted including confirmation of gene construct of pIG121Hm-Cs plasmid in A. tumefaciens, transformation of four maize lines through A. tumefaciens-mediated in-planta technique, acclimatization of transformant plants and molecular analysis of selected plants using polymerase chain reaction (PCR. The pIG121Hm-Cs plasmid was confirmed via PCR analysis using specific primers of nptII and hpt genes and resulted 700 bp and 500 bp for fragments of nptII and hpt, respectively. After selection, acclimatization and molecular analysis steps, the efficiency levels of transformation of four maize lines were low, ranging from 3.8% to 12.8%. The level of transformation efficiency of ST-27 line was the highest accounting for 12.8% of 45 planted embryos on selection medium based on PCR analysis using specific primer for nptII gene. Overall, A. tumefaciens-mediated in planta transformation on maize floral pistil in this study proved to be successful and rapid. Therefore, this enhanced transformation method will be beneficial for Indonesian maize genetic engineering.

  4. When LVAD Patients Die: The Caregiver's Mourning.

    Science.gov (United States)

    Rossi Ferrario, Silvia; Omarini, Pierangela; Cerutti, Paola; Balestroni, Giangluigi; Omarini, Giovanna; Pistono, Massimo

    2016-05-01

    Left ventricular assist devices (LVADs) have progressively evolved, particularly in the last 10 years, to serve patients affected by severe heart failure as a bridge to transplant or destination therapy. The survival rate and quality of life of pre- and postimplant patients, as well as caregivers' perceptions and distress, are under investigation by the scientific community. But what caregivers think and feel after the loss of their loved one has not so far been examined. We contacted 16 principal caregivers of deceased LVAD patients by telephone. They were asked to evaluate their experience with LVADs and were administered a specific questionnaire about their mourning, the Caregiver Mourning Questionnaire (CMQ), to evaluate their perceptions of the physical, emotional, and social support-related problems that they had experienced during the previous 3 months. Positive aspects reported by the caregivers were the patient's overall subjective well-being and increased survival. Negative aspects were the difficulty to manage infections and the driveline, and the incomplete autonomy of the patient. Half of the caregivers reported not being preadvised about many of the problems they would face. The CMQ revealed that numerous caregivers had health problems, difficulty in sleeping, eating disorders, lack of energy, and loneliness. Use of psychotropic drugs and regrets about how they assisted their loved one also emerged. In conclusion, caregivers of LVAD patients may experience complicated mourning. Our data support in particular the need for an early intervention of palliative care which could prevent or reduce complicated mourning. Copyright © 2015 International Center for Artificial Organs and Transplantation and Wiley Periodicals, Inc.

  5. Electric smog: telemetry interference between ICD and LVAD.

    Science.gov (United States)

    Duncker, David; König, Thorben; Müller-Leisse, Johanna; Michalski, Roman; Oswald, Hanno; Schmitto, Jan D; Bauersachs, Johann; Veltmann, Christian

    2017-09-01

    Electromagnetic interferences between implantable cardioverter/defibrillators (ICD) and left ventricular assist devices (LVAD) impacting telemetry have been described in previous generations of ICD as well as LVAD, but have been predominantly overcome in current ICD generations. After introduction of a new fully magnetically levitated centrifugal continuous-flow circulatory pump, we report a case of tenacious telemetry interference between the HeartMate 3 LVAD and an ICD after battery exchange to an Iforia 5. Initialization of the initial telemetry handshake was only possible using several specific maneuvers simultaneously. In order to exclude device-device interference, we suggest to place the ICD above the LVAD before implantation and to test for possible telemetry interferences.

  6. Effects of Percutaneous LVAD Support on Right Ventricular Load and Adaptation.

    Science.gov (United States)

    Yourshaw, Jeffrey P; Mishra, Prabodh; Armstrong, M Christopher; Ramu, Bhavadharini; Craig, Michael L; Van Bakel, Adrian B; Steinberg, Daniel H; DiSalvo, Thomas G; Tedford, Ryan J; Houston, Brian A

    2018-04-30

    Both operative and hemodynamic mechanisms have been implicated in right heart failure (RHF) following surgical left ventricular assist device (LVAD) implantation. We investigated the effects of percutaneous LVAD (pLVAD; Impella®, Abiomed) support on right ventricular (RV) load and adaptation. We reviewed all patients receiving a pLVAD for cardiogenic shock at our institution between July 2014 and April 2017, including only those with pre- and post-pLVAD invasive hemodynamic measurements. Hemodynamic data was recorded immediately prior to pLVAD implantation and up to 96 h post-implantation. Twenty-five patients were included. Cardiac output increased progressively during pLVAD support. PAWP improved early post-pLVAD but did not further improve during continued support. Markers of RV adaptation (right ventricular stroke work index, right atrial pressure (RAP), and RAP to pulmonary artery wedge pressure ratio (RAP:PAWP)) were unchanged acutely implant but progressively improved during continued pLVAD support. Total RV load (pulmonary effective arterial elastance; E A ) and resistive RV load (pulmonary vascular resistance; PVR) both declined progressively. The relationship between RV load and RV adaptation (E A /RAP and E A /RAP:PAWP) was constant throughout. Median vasoactive-inotrope score declined after pLVAD placement and continued to decline throughout support. Percutaneous LVAD support in patients with cardiogenic shock did not acutely worsen RV adaptation, in contrast to previously described hemodynamic effects of surgically implanted durable LVADs. Further, RV load progressively declined during support, and the noted RV adaptation improvement was load-dependent as depicted by constant E A /RA and E A /RAP:PAWP relationships. These findings further implicate the operative changes associated with surgical LVAD implantation in early RHF following durable LVAD.

  7. Mathematical modelling of flow in disc friction LVAD pump

    Science.gov (United States)

    Medvedev, A. E.; Fomin, V. M.; Prikhodko, Yu. M.; Cherniavskiy, A. M.; Fomichev, V. P.; Fomichev, A. V.; Chekhov, V. P.; Ruzmatov, T. M.

    2017-10-01

    The need for blood circulation support systems in the treatment of chronic heart failure is constantly increasing as 20% of patients on the waiting list die every year. Despite the great need for mechanical heart support systems the use of available systems is limited by the high cost. Therefore, further research in the field of circulatory support systems is appropriate taking into account medical and technical requirements. One of the new research areas is viscous friction disk pumps for transporting liquids based on the Tesla pump principle. The experimental model of LVAD disk pump is developed. Analytical dependencies are obtained to optimize the hydraulic parameters of the pump. On their basis, the experimental model of LVAD disk pump was designed and created. The results of analytical and experimental studies of such a pump are presented.

  8. Numerical Simulation of LVAD Inflow Cannulas with Different Tip

    Directory of Open Access Journals (Sweden)

    Guang-Mao Liu

    2012-01-01

    Full Text Available The tip structure of LVAD inflow cannula is one of major factors to lead adverse events such as thrombosis and suction leading to obstruction. In this research, four kinds of tips that had been used in inflow cannulas were selected and designed. The flow field of the four inflow cannulas inserted into the apex of left ventricle (LV was numerically computed by computational fluid dynamics. The flow behavior was analyzed in order to compare the blood compatibility and suction in left ventricle and cannulas after the inflow cannulas with different tips were inserted to the apex of LV. The results showed that the cannula tip structure affected the LVAD performance. Among these four cannulas, the trumpet-tipped inflow cannula owned the best performance in smooth flow velocity distribution without backflow or low-velocity flow so that it was the best in blood compatibility. Nevertheless, the caged tipped cannula was the worst in blood compatibility. And the blunt-tipped and beveled tipped inflow cannulas may obstruct more easily than trumpet and caged tipped inflow cannulas because of their shape. The study indicated that the trumpet tip was the most preferable for the inflow cannula of long-term LVAD.

  9. Use of PTFE patch for pericardial closure after minimal invasive LVAD implantation.

    Science.gov (United States)

    Mohite, Prashant N; Sabashnikov, Anton; Popov, Aron F; Fatullayev, Javid; Simon, André R

    2016-07-01

    The left ventricular assist device (LVAD) is now a routine therapy for advanced heart failure. The thoracotomy approach for LVAD implantation, in which the left ventricle is approached through a pericardial rent, is becoming popular. We demonstrate closure of the pericardial rent with a polytetrafluoroethylene (PTFE) patch and its advantages. © The Author(s) 2015.

  10. A novel permanent maglev rotary LVAD with passive magnetic bearings.

    Science.gov (United States)

    Qian, K X; Yuan, H Y; Zeng, P; Ru, W M

    2005-01-01

    It has been widely acknowledged that permanent maglev cannot achieve stability; however, the authors have discovered that stable permanent maglev is possible under the effect of a combination of passive magnetic and nonmagnetic forces. In addition, a rotary left ventricular assist device (LVAD) with passive magnetic bearings has been developed. It is a radially driven impeller pump, having a rotor and a stator. The rotor consists of driven magnets and impeller; the motor coil and pump housing form the stator. Two passive magnetic bearings counteract the attractive force between motor coil iron core and rotor magnets; the rotor thereafter can be disaffiliated from the stator and become levitated under the action of passive magnetic and haemodynamic forces. Because of the pressure difference between the outlet and the inlet of the pump, there is a small flow passing through the gap of rotor and stator, and then entering the lower pressure area along the central hole of the rotor. This small flow comes to a full washout of all blood contacting surfaces in the motor. Moreover, a decreased Bernoulli force in the larger gap with faster flow produces a centring force that leads to stable levitation of the rotor. Resultantly, neither mechanical wear nor thrombosis will occur in the pump. The rotor position detection reveals that the precondition of levitation is a high rotating speed (over 3250 rpm) and a high flow rate (over 1 l min(-1)). Haemodynamic tests with porcine blood indicate that the device as a LVAD requires a rotating speed between 3500 and 4000 rpm for producing a blood flow of 4 - 6 l min(-1) against 100 mmHg mean pressure head. The egg-sized device has a weight of 200 g and an O.D. of 40 mm at its largest point.

  11. Numerical Analysis of Blood Damage Potential of the HeartMate II and HeartWare HVAD Rotary Blood Pumps.

    Science.gov (United States)

    Thamsen, Bente; Blümel, Bastian; Schaller, Jens; Paschereit, Christian O; Affeld, Klaus; Goubergrits, Leonid; Kertzscher, Ulrich

    2015-08-01

    Implantable left ventricular assist devices (LVADs) became the therapy of choice in treating end-stage heart failure. Although survival improved substantially and is similar in currently clinically implanted LVADs HeartMate II (HM II) and HeartWare HVAD, complications related to blood trauma are frequently observed. The aim of this study was to compare these two pumps regarding their potential blood trauma employing computational fluid dynamics. High-resolution structured grids were generated for the pumps. Newtonian flow was calculated, solving Reynolds-averaged Navier-Stokes equations with a sliding mesh approach and a k-ω shear stress transport turbulence model for the operating point of 4.5 L/min and 80 mm Hg. The pumps were compared in terms of volumes subjected to certain viscous shear stress thresholds, below which no trauma was assumed (von Willebrand factor cleavage: 9 Pa, platelet activation: 50 Pa, and hemolysis: 150 Pa), and associated residence times. Additionally, a hemolysis index was calculated based on a Eulerian transport approach. Twenty-two percent of larger volumes above 9 Pa were observed in the HVAD; above 50 Pa and 150 Pa the differences between the two pumps were marginal. Residence times were higher in the HVAD for all thresholds. The hemolysis index was almost equal for the HM II and HVAD. Besides the gap regions in both pumps, the inlet regions of the rotor and diffuser blades have a high hemolysis production in the HM II, whereas in the HVAD, the volute tongue is an additional site for hemolysis production. Thus, in this study, the comparison of the HM II and the HVAD using numerical methods indicated an overall similar tendency to blood trauma in both pumps. However, influences of turbulent shear stresses were not considered and effects of the pivot bearing in the HM II were not taken into account. Further in vitro investigations are required. Copyright © 2015 International Center for Artificial Organs and Transplantation and

  12. Application of CAD/CFD/RP-technologies for development of LVAD systems

    Directory of Open Access Journals (Sweden)

    Morozov Valentin

    2016-01-01

    Full Text Available The important problem of new Left Ventricle Assist Device (LVAD systems development is to determine their hemodynamic and functional characteristics and reduce the design time. An effective method for achieving this is the use of approaches based on the application of CAD/CFD/PR-technologies. Methods of computer modelling were applied to determine the geometrical parameters of the blood pump, and methods of finite element analysis were used for the optimization of hemodynamic parameters of the LVAD system. The geometrical modelling was carried out in the Pro/Engineer WF5. The CAE-system Ansys was used to analyze the blood flow in the chamber of the pump. The motion of the flexible walls was simulated by normal flow through rigid walls. At the final stage some models were prepared for prototyping. The critical parameters of hemodynamic gave the possibility to optimize the shape of the blood pump. The LVAD system and its components were made using various RP-technologies. The hydraulic tests for the performance investigation and the analysis of implantability for implantable systems were carried out for manufactured prototypes of LVAD systems. The manufactured components of the LVAD system are completely operability and give the possibility to estimate the critical hemodynamic and functional parameters of the LVAD system.

  13. Hospital costs fell as numbers of LVADs were increasing: experiences from Oslo University Hospital

    Directory of Open Access Journals (Sweden)

    Mishra Vinod

    2012-08-01

    Full Text Available Abstract Background The current study was undertaken to examine total hospital costs per patient of a consecutive implantation series of two 3rd generation Left Ventricle Assist Devices (LVAD. Further we analyzed if increased clinical experience would reduce total hospital costs and the gap between costs and the diagnosis related grouped (DRG-reimbursement. Method Cost data of 20 LVAD implantations (VentrAssist™ from 2005-2009 (period 1 were analyzed together with costs from nine patients using another LVAD (HeartWare™ from 2009-June 2011 (period 2. For each patient, total costs were calculated for three phases - the pre-LVAD implantation phase, the LVAD implantation phase and the post LVAD implant phase. Patient specific costs were obtained prospectively from patient records and included personnel resources, medication, blood products, blood chemistry and microbiology, imaging and procedure costs including operating room costs. Overhead costs were registered retrospectively and allocated to the specific patient by predefined allocation keys. Finally, patient specific costs and overhead costs were aggregated into total hospital costs for each patient. All costs were calculated in 2011-prices. We used regression analyses to analyze cost variations over time and between the different devices. Results The average total hospital cost per patient for the pre-LVAD, LVAD and post-LVAD for period 1 was $ 585, 513 (range 132, 640- 1 247, 299, and the corresponding DRG- reimbursement (2009 was $ 143, 192 . The mean LOS was 54 days (range 12- 127. For period 2 the total hospital cost per patient was $ 413, 185 (range 314, 540- 622, 664 and the corresponding DRG- reimbursement (2010 was $ 136, 963. The mean LOS was 49 days (range 31- 93. The estimates from the regression analysis showed that the total hospital costs, excluding device costs, per patient were falling as the number of treated patients increased. The estimate from the trend variable was -14

  14. The spectrum of HM Sagittae: a planetary nebula excited by a Wolf--Rayet star

    International Nuclear Information System (INIS)

    Brown, L.W.; Feibelman, W.A.; Hobbs, R.W.; Mccracken, C.W.

    1977-10-01

    Image tube spectrograms of HM Sagittae were obtained. More than 70 emission lines, including several broad emission features, were identified. An analysis of the spectra indicates that HM Sagittae is a planetary nebula excited by a Wolf-Rayet star. The most conspicuous Wolf-Rayet feature is that attributed to a blend of C III at 4650 A and He II at 4686 A

  15. LVAD patients' and surrogates' perspectives on SPIRIT-HF: An advance care planning discussion.

    Science.gov (United States)

    Metzger, Maureen; Song, Mi-Kyung; Devane-Johnson, Stephanie

    2016-01-01

    To describe LVAD patients' and surrogates' experiences with, and perspectives on SPIRIT-HF, an advance care planning (ACP) intervention. ACP is important for patients with LVAD, yet little is known about their experiences or those of their surrogates who have participated in ACP discussions. We used qualitative content analysis techniques to conduct a secondary analysis of 28 interviews with patients with LVAD (n = 14) and their surrogates (n = 14) who had participated in an RCT pilot study of SPIRIT-HF. Main themes from the data include: 1) sharing their HF stories was very beneficial; 2) participating in SPIRIT-HF led to greater peace of mind for patients and surrogates; 3) "one size does not fit all" when it comes to timing of ACP discussions. An understanding patient and surrogate perspectives may inform clinicians' approach to ACP discussions. Copyright © 2016 Elsevier Inc. All rights reserved.

  16. Hemorrhoids screening and treatment prior to LVAD: is it a necessity?

    Science.gov (United States)

    Skouri, Hadi; Shurrab, Mohammed; Zahnan, Jad; Deeba, Samer; Sfeir, Pierre; Gharzuddin, Walid; Haj-Yahia, Saleem

    2016-04-12

    Continuous-flow left ventricle assist devices (CF-LVADs) has become an essential modality in the management of stage D heart failure (HF) with significant improvement in survival and quality of life. Due to the durability of such devices and long term support complications such as bleeding and aortic insufficiency has emerged. Bleeding accounts for more than 20 % with the majority being from the gastrointestinal tract. The increase of bleeding tendency are mainly attributed to the loss of large von Willebrand's Factor (vWF) multimers due to shear stress with the chronic intake of anticoagulants. We are reporting two cases of patients with Stage D HF and history of hemorrhoids presenting for LVAD implantation. Many efforts that decrease bleeding related to CF-LVADs will be discussed with focus on hemorrhoids.

  17. PCI in Patients Supported With CF-LVADs: Indications, Safety, and Outcomes.

    Science.gov (United States)

    Anyanwu, Emeka C; Ota, Takeyoshi; Sayer, Gabriel; Nathan, Sandeep; Jeevanandam, Valluvan; Shah, Atman; Uriel, Nir

    2016-06-01

    Patients with heart failure supported with left ventricular assist devices (LVADs) may require coronary intervention during their support. This case series seeks to explore the indications, safety, and outcomes of percutaneous coronary intervention (PCI) in this population. Electronic medical records of patients with LVADs undergoing PCI at a large academic medical center were reviewed. Demographics, reason for PCI, procedural success, complications, and outcomes were collected. From 2010-2014, a total of 6 patients underwent PCI post LVAD implantation. Three patients had PCI in the early postimplantation period (1-3 days post LVAD implantation) while the other three received it later in the LVAD support period. Three indications for PCI were found in the reviewed cases: right ventricular failure (right coronary artery stenting), bridge to left ventricular recovery, and ventricular tachycardia (VT) storm. All patients were maintained on triple blood thinning therapy (aspirin, clopidogrel, and warfarin). There were no acute complications during the interventions; however, 2 patients died in the early intervention period and 2 died much later. The 2 deaths in the early intervention period were related to fatal gastrointestinal bleeding while on dual-antiplatelet therapy and warfarin, and intractable VT that PCI did not correct. The 2 deaths in the late postintervention period occurred due to unknown causes nearly 1 and 2 years post intervention, respectively. PCI was performed in patients with continuous-flow LVAD with several possible indications and without acute complications. The utility of PCI in this patient population, however, is likely limited by the risk of bleeding related to combined antiplatelet and anticoagulation therapies as well as lack of immediate apparent benefit. Further studies are necessary to better characterize this risk as well as quantify any potential long-term benefits.

  18. Bleeding with the artificial heart: Gastrointestinal hemorrhage in CF-LVAD patients.

    Science.gov (United States)

    Gurvits, Grigoriy E; Fradkov, Elena

    2017-06-14

    Continuous-flow left ventricular assist devices (CF-LVADs) have significantly improved outcomes for patients with end-stage heart failure when used as a bridge to cardiac transplantation or, more recently, as destination therapy. However, its implantations carries a risk of complications including infection, device malfunction, arrhythmias, right ventricular failure, thromboembolic disease, postoperative and nonsurgical bleeding. A significant number of left ventricular assist devices (LVAD) recipients may experience recurrent gastrointestinal hemorrhage, mainly due to combination of antiplatelet and vitamin K antagonist therapy, activation of fibrinolytic pathway, acquired von Willebrand factor deficiency, and tendency to develop small intestinal angiodysplasias due to increased rotary speed of the pump. Gastrointestinal bleeding in LVAD patients remains a source of increased morbidity including the need for blood transfusions, extended hospital stays, multiple readmissions, and overall mortality. Management of gastrointestinal bleeding in LVAD patients involves multidisciplinary approach in stabilizing the patients, addressing risk factors and performing structured endoluminal evaluation with focus on upper gastrointestinal tract including jejunum to find and eradicate culprit lesion. Medical and procedural intervention is largely successful and universal bleeding cessation occurs in transplanted patients.

  19. hmF2 variability over Havana

    International Nuclear Information System (INIS)

    Lazo, B.; Alazo, K.; Rodriguez, M.; Calzadilla, A.

    2003-01-01

    The hmF2 variability over Havana station (Geo. Latitude 23 deg. N, Geo Longitude 278 deg. E; Dip 54.6 deg. N; Modip: 44.8 deg. N) is presented. In this study different solar and seasonal conditions are considered. The results show that, in general, standard deviation of hmF2 is quite irregular and reaches its values at nighttimes hours. Lower and upper quartiles variability has a similar behaviour to IQ variability, showing its higher values at nighttimes too. (author)

  20. Avoidance of cellular blood product transfusions in LVAD recipients does not prevent HLA allosensitization.

    Science.gov (United States)

    Stringham, J C; Bull, D A; Fuller, T C; Kfoury, A G; Taylor, D O; Renlund, D G; Karwande, S V

    1999-02-01

    Transfusion of cellular blood products during left ventricular assist device (LVAD) implantation has been associated with HLA allosensitization, resulting in the need for a negative prospective cross-match and prolonged transplant waiting times. In order to prevent this risk, we developed a protocol to avoid transfusion of cellular blood products. The protocol included preoperative patient stabilization, perioperative recombinant erythropoietin and blood conservation strategies, and postoperative monitoring of mixed venous oxygen saturation (SVO2) to assure adequate peripheral oxygen delivery. Panel reactive antibody (PRA) was measured in all patients pre and post LVAD placement to assess HLA sensitization. Seven consecutive patients underwent LVAD implantation without transfusion of blood or platelets, one of whom expired perioperatively. Mean hematocrit was 35.2% preoperatively, and 21.8% postoperatively, reaching a nadir of 20.2%. Postoperative SVO2 was >60% in all patients. In the six survivors, mean hematocrit reach 24.3%, 27.3%, and 33.0% by postoperative day seven, fourteen, and thirty, respectively. PRA in three patients was 0% preoperatively and remained 0% until transplantation after 33, 34, and 50 days of support. In two patients, preoperative PRA was 7% and 17%, dropped to 3% and 0% after thirty days, then progressively rose to 96% and 100% after 60 and 90 days, respectively. In one other patient, preoperative PRA was 0%, remained at 0% after thirty days, then rose to 96% by 60 days. Avoiding transfusion of cellular blood products in LVAD recipients is safe and well tolerated, but does not universally protect from HLA allosensitization. Other factors may also produce sensitization, such as immunogenic components of the LVAD, soluble antigen in fresh frozen plasma, or latent sensitization which is not initially evident in critically ill and possibly anergic patients.

  1. Development of HM12 cyclotron for PET

    International Nuclear Information System (INIS)

    Morita, Takuzo; Kawama, Tetsuo; Fujii, Kazuo

    2000-01-01

    In Japan, there are at present more than 30 PET (Positron Emission Tomography) facilities. The movements of medical insurance application to the PET diagnosis using [ 18 F] FDG (2-[ 18 F]-fluoro-2-deoxy-glucose) by the Ministry of Health and Welfare are being enhanced by PET related people. Therefore, more clinical centers using PET system are expected to be built in the near future. HM12 cyclotron was developed to meet such market demands for PET, and the prototype machine has been rent to Cyclotron Radio Isotope Center (CYRIC) of Tohoku University since Oct. 1998 for their use of clinical research with positron emitters like 11 C, 13 N, 15 O and 18 F. We got many technical data of HM12 Cyclotron on the clinical base. The data was enough to establish the reliability of HM12 system operation under the clinical condition. The first commercial product of HM12 Cyclotron was delivered to National Cancer Center in March 2000. The final performance test will be finished by the end of June 2000. (author)

  2. Low values of 5-hydroxymethylcytosine (5hmC), the "sixth base," are associated with anaplasia in human brain tumors.

    Science.gov (United States)

    Kraus, Theo F J; Globisch, Daniel; Wagner, Mirko; Eigenbrod, Sabina; Widmann, David; Münzel, Martin; Müller, Markus; Pfaffeneder, Toni; Hackner, Benjamin; Feiden, Wolfgang; Schüller, Ulrich; Carell, Thomas; Kretzschmar, Hans A

    2012-10-01

    5-Methylcytosine (5 mC) in genomic DNA has important epigenetic functions in embryonic development and tumor biology. 5-Hydroxymethylcytosine (5 hmC) is generated from 5 mC by the action of the TET (Ten-Eleven-Translocation) enzymes and may be an intermediate to further oxidation and finally demethylation of 5 mC. We have used immunohistochemistry (IHC) and isotope-based liquid chromatography mass spectrometry (LC-MS) to investigate the presence and distribution of 5 hmC in human brain and brain tumors. In the normal adult brain, IHC identified 61.5% 5 hmC positive cells in the cortex and 32.4% 5 hmC in white matter (WM) areas. In tumors, positive staining of cells ranged from 1.1% in glioblastomas (GBMs) (WHO Grade IV) to 8.9% in Grade I gliomas (pilocytic astrocytomas). In the normal adult human brain, LC-MS also showed highest values in cortical areas (1.17% 5 hmC/dG [deoxyguanosine]), in the cerebral WM we measured around 0.70% 5 hmC/dG. levels were related to tumor differentiation, ranging from lowest values of 0.078% 5 hmC/dG in GBMs (WHO Grade IV) to 0.24% 5 hmC/dG in WHO Grade II diffuse astrocytomas. 5 hmC measurements were unrelated to 5 mC values. We find that the number of 5 hmC positive cells and the amount of 5 hmC/dG in the genome that has been proposed to be related to pluripotency and lineage commitment in embryonic stem cells is also associated with brain tumor differentiation and anaplasia. Copyright © 2012 UICC.

  3. HM Sagittae - a most remarkable star

    International Nuclear Information System (INIS)

    Kwok, S.

    1982-01-01

    The author summarises recent observations of HM Sagittae, a symbiotic star that displays activity in every spectral band from X-ray to radio. He concludes that it is best described as a binary system consisting of a late M giant and a hot compact object which is similar to central stars of planetary nebulae. The presence of a wind from the M giant implies that Roche-lobe overflow is not a necessary condition for mass transfer. The complex structure of the circumstellar nebula is possibly the result of wind interactions. The ongoing spectral evolution of HM Sge after its recent outburst makes it an ideal candidate to test models of the symbiotic phenomenon. (Auth.)

  4. HM Sagittae as a young planetary nebula

    International Nuclear Information System (INIS)

    Kwok, S.; Purton, C.R.

    1979-01-01

    HM Sagittae is suggested to be a very young planetary nebula recently transformed from a red-giant star through continuous mass loss. The observational data for HM Sge have been analyzed in terms of the interacting stellar wind model of planetary nebula formation. The model is in accord with virtually all the spectral data available--radio, optical, and infrared--as well as with the remarkable brightening of HM Sge observed in 1975. In particular, all three gaseous components predicted by the model are observed in the optical spectrum. The density in the newly formed shell is found to be at least 5 x 10 7 cm -3 , a value considerably higher than that found by the conventional analysis, which assumes a single-component homogeneous nebula. The radio spectrum is dominated by free-free emission from the remnant red-giant wind. The infrared spectrum suggests the presence of two dust components, one consisting of silicate grains left over from the red-giant stage and the other of grains newly formed after the 1975 brightening. The low observed shell mass is consistent with the interacting stellar wind model but is not consistent with the conventional sudden-ejection model of planetary nebula formation

  5. Towards reducing thrombogenicity of LVAD therapy: optimizing surgical and patient management strategies

    Science.gov (United States)

    Chivukula, Venkat Keshav; Lafzi, Ali; Mokadam, Nahush; Beckman, Jennifer; Mahr, Claudius; Aliseda, Alberto

    2017-11-01

    Unfavourable hemodynamics in heart failure patients implanted with left ventricular assist devices (LVAD), due to non-optimal surgical configurations and patient management, strongly influence thrombogenicity. This is consistent with the increase in devastating thromboembolic complications (specifically thrombosis and stroke) in patients, even as the risk of thrombosis inside the device decreases with modern designs. Inflow cannula and outflow graft surgical configurations have been optimized via patient-specific modeling that computes the thrombogenic potential with a combination of Eulerian (endothelial) wall shear stress and Lagrangian (platelet shear history) tracking. Using this view of hemodynamics, the benefits of intermittent aortic valve opening (promoting washout and reducing stagnant flow in the aortic valve region) have been assessed in managing the patient's residual native cardiac output. The use of this methodology to understand the contribution of the hemodynamics in the flow surrounding the LVAD itself to thrombogenesis show promise in developing holistic patient-specific management strategies to minimize stroke risk and enhance efficacy of LVAD therapy. Funded in part by an AHA postdoctoral fellowship 16POST30520004.

  6. Hemodynamic effects of various support modes of continuous flow LVADs on the cardiovascular system: A numerical study

    Science.gov (United States)

    Song, Zhiming; Gu, Kaiyun; Gao, Bin; Wan, Feng; Chang, Yu; Zeng, Yi

    2014-01-01

    Background The aim of this study was to determine the hemodynamic effects of various support modes of continuous flow left ventricular assist devices (CF-LVADs) on the cardiovascular system using a numerical cardiovascular system model. Material/Methods Three support modes were selected for controlling the CF-LVAD: constant flow mode, constant speed mode, and constant pressure head mode of CF-LVAD. The CF-LVAD is established between the left ventricular apex and the ascending aorta, and was incorporated into the numerical model. Various parameters were evaluated, including the blood assist index (BAI), the left ventricular external work (LVEW), the energy of blood flow (EBF), pulsatility index (PI), and surplus hemodynamic energy (SHE). Results The results show that the constant flow mode, when compared to the constant speed mode and the constant pressure head mode, increases LVEW by 31% and 14%, and EBF by 21% and 15%, respectively, indicating that this mode achieved the best ventricular unloading among the 3 support modes. As BAI is increased, PI and SHE are gradually decreased, whereas PI of the constant pressure head reaches the maximum value. Conclusions The study demonstrates that the continuous flow control mode of the CF-LVAD may achieve the highest ventricular unloading. In contrast, the constant rotational speed mode permits the optimal blood perfusion. Finally, the constant pressure head strategy, permitting optimal pulsatility, should optimize the vascular function. PMID:24793178

  7. Computational fluid dynamics analysis and PIV validation of a bionic vortex flow pulsatile LVAD.

    Science.gov (United States)

    Xu, Liang; Yang, Ming; Ye, Lin; Dong, Zhaopeng

    2015-01-01

    Hemocompatibility is highly affected by the flow field in Left Ventricular Assistant Devices (LVAD). An asymmetric inflow and outflow channel arrangement with a 45° intersection angle with respect to the blood chamber is proposed to approximate the vascular structure of the aorta and left atrium on the left ventricle. The structure is expected to develop uninterruptible vortex flow state which is similar to the flow state in human left ventricle. The Computational Fluid Dynamics (CFD) asymmetric model is simulated using ANSYS workbench. To validate the velocity field calculated by CFD, a Particle Image Velocimetry (PIV) experiment is conducted. The CFD results show that the proposed blood chamber could generate a shifting vortex flow that would be redirected to the aorta during ejection to form a persistent recirculating flow state, which is similar to the echocardiographic flow state in left ventricle. Both the PIV and the CFD results show the development of a persistent vortex during the pulsatile period. Comparison of the qualitative flow pattern and quantitative probed velocity histories in a pulsatile period shows a good agreement between the CFD and PIV data. The goal of developing persistent quasi intra-ventricle vortex flow state in LVAD is realized.

  8. The Legacy of Patient H.M. for Neuroscience

    Science.gov (United States)

    Squire, Larry R.

    2009-01-01

    H.M. is probably the best known single patient in the history of neuroscience. His severe memory impairment, which resulted from experimental neurosurgery to control seizures, was the subject of study for five decades until his death in December 2008. Work with H.M. established fundamental principles about how memory functions are organized in the brain. PMID:19146808

  9. ST-HM not only cranes

    CERN Document Server

    Bertone, C

    2002-01-01

    This period of LEP dismantling and LHC installation is a real challenge for the ST-HM group. The group is now following several projects to cope with the diversity of requests. Although crane design and procurement still constitutes the majority of the workload, more and more of our time is nowadays dedicated to providing alternative handling solutions. In 2001/2002, our main studies concern cranes for LHC, industrial and shielded motorised doors, the upgrade/replacement of 32 lifts and mobile cranes. The years 2002/2003 will concern mainly the study of LHC handling systems such as trailers and heavy-duty tractors, specifically tailored containers and tools. In parallel, the monorail will be extended in the injection tunnel and CNGS tunnels and a new monorail system for TOF will be installed. Since the tunnel monorail infrastructure will be used for power feed and guidance purposes only, this requires that other transport systems be studied, such as forklift trucks, industrial and telescopic hoists.

  10. HM-PAO SPECT in the diagnosis of cerebrovascular disease

    International Nuclear Information System (INIS)

    Cordes, M.; Rummeny, E.; Reissmann, M.; Fox, K.; Panitz, N.; Pfannenstiel, P.

    1987-01-01

    Single photon emission computed tomography (SPECT) after injection of 99m-Tc-HM-PAO was used to examine 34 patients whose clinical findings could not exclude a cerebrovascular disease. In all patients an X-ray computed tomography examination was inconclusive for the clinical-neurological findings. The regional cerebral bloodflow was pathologically disturbed in 10 of 34 patients in the HM-PAO SPECT examination. The detection of the regional cerebral bloodflow with HM-PAO SPECT is helpful in the diagnosis of cerebrovascular disease. (orig.) [de

  11. The Cognitive Neuroscience of Human Memory Since H.M

    OpenAIRE

    Squire, Larry R.; Wixted, John T.

    2011-01-01

    Work with patient H.M., beginning in the 1950s, established key principles about the organization of memory that inspired decades of experimental work. Since H.M., the study of human memory and its disorders has continued to yield new insights and to improve understanding of the structure and organization of memory. Here we review this work with emphasis on the neuroanatomy of medial temporal lobe and diencephalic structures important for memory, multiple memory systems, visual perception, im...

  12. The retention mechanism of technetium-99m-HM-PAO

    DEFF Research Database (Denmark)

    Neirinckx, R D; Burke, J F; Harrison, R C

    1988-01-01

    Preparations of d,l- and meso-hexamethylpropyleneamine oxime (HM-PAO) labeled with technetium-99m were added to rat brain homogenates diluted with phosphate buffer (1:10). The conversion of d,l-HM-PAO to hydrophilic forms took place with an initial rate constant of 0.12 min-1. Incubation of the b......Preparations of d,l- and meso-hexamethylpropyleneamine oxime (HM-PAO) labeled with technetium-99m were added to rat brain homogenates diluted with phosphate buffer (1:10). The conversion of d,l-HM-PAO to hydrophilic forms took place with an initial rate constant of 0.12 min-1. Incubation....... This correspondence of values supports the notion that GSH may be important for the in vivo conversion of 99mTc-labeled HM-PAO to hydrophilic forms and may be the mechanism of trapping in brain and other cells. A kinetic model for the trapping of d,l- and meso-HM-PAO in tissue is developed that is based on data...

  13. Aortic valve biomechanics during LVAD support: Implementation in a bioreactor design and preliminary testing

    Science.gov (United States)

    Jamal, Madiha

    Although Left Ventricle Assist Device (LVAD) support has enhanced the quality of life for many heart failure patients, its prolonged in-vivo implantation causes change in hemodynamics and biomechanics of the aortic heart valve eventually leading to development of aortic insufficiency (AI). The LVAD decreases pressure in the left ventricle, leading to high transvalvular pressure and reduced aortic valve opening. Our hypothesis is that the increased pressure leads to increased mechanical stretch in the aortic valve leaflets, inducing a cascade of responses that ultimately result in local tissue fibrosis and AI. The goal of this study is to investigate the mechanism behind this hypothesis using the methods of tissue engineering. A bioreactor has been built that imparts cyclic stretch and flow to small 3-D constructs of living cells cultured in a silicone membrane. The approach is to use this device for in vitro tissue culture of vascular interstitial cells (VICs) embedded in a collagen gel, which will be subjected to normal and altered stretch and shear representative of the in vivo valve biomechanics. The bioreactor was validated to measure the amount of stretch and shear it can impart to closely replicate in-vivo conditions using PIV technique and ImageJ software. Mean longitudinal strain of 0.037cm (SD= +/-0.013cm) was recorded with mean perpendicular strain being 0.0046cm (SD= +/-0.0169cm). Measured average shear stress imparted at 100ml/min was 2.735 dynes/cm2 (SD= +/-2.25 dynes/cm2) with 6.21 dynes/cm2 (SD= +/-3.35 dynes/cm2) at 200ml/min. The cells that underwent cycles of stretch and shear in the bioreactor were screened for formation of myofibroblast using techniques of immunohistochemistry. The marker used was ? smooth muscle actin (SMA) which identifies pathological differentiation of the CPCs to myofibroblast. Yhe expression of the myofibroblast phenotype is a feature of valvupathy. In case of Shear Vs Static control, the mean value for SMA expression for

  14. Partial LVAD restores ventricular outputs and normalizes LV but not RV stress distributions in the acutely failing heart in silico

    OpenAIRE

    Sack, Kevin L.; Baillargeon, Brian; Acevedo-Bolton, Gabriel; Genet, Martin; Rebelo, Nuno; Kuhl, Ellen; Klein, Liviu; Weiselthaler, Georg M.; Burkhoff, Daniel; Franz, Thomas; Guccione, Julius M.

    2016-01-01

    Purpose: Heart failure is a worldwide epidemic that is unlikely to change as the population ages and life expectancy increases. We sought to detail significant recent improvements to the Dassault Systèmes Living Heart Model (LHM) and use the LHM to compute left ventricular (LV) and right ventricular (RV) myofiber stress distributions under the following 4 conditions: (1) normal cardiac function; (2) acute left heart failure (ALHF); (3) ALHF treated using an LV assist device (LVAD) flow rate o...

  15. Myocardial changes in patients with end-stage heart failure during continuous flow left ventricular assist device support

    NARCIS (Netherlands)

    Lok, S.I.

    2013-01-01

    With respect to the clinical outcome, cf-LVADs provide sufficient ventricular unloading and circulatory support. The post-operative mortality and morbidity in our centre are comparable with other recent experiences with this device. Based on these data, Heart Mate II (HM II) LVAD therapy can be

  16. hm Reduction in Infinitary Term Graph Rewriting Systems

    DEFF Research Database (Denmark)

    Bahr, Patrick

    2017-01-01

    a corresponding theory of Böhm reduction for term graphs. Our main result is that partial order convergence in a term graph rewriting system can be truthfully and faithfully simulated by metric convergence in the Böhm extension of the system. To prove this result we generalise the notion of residuals...... that `meaningless terms' can be contracted to a fresh constant ⊥. In previous work, we have established that Böhm reduction can be instead characterised by a different mode of convergences of transfinite reductions that is based on a partial order structure instead of a metric space. In this paper, we develop...... and projections to the setting of infinitary term graph rewriting. As ancillary results we prove the infinitary strip lemma and the compression property, both for partial order and metric convergence....

  17. The Cognitive Neuroscience of Human Memory Since H.M

    Science.gov (United States)

    Squire, Larry R.; Wixted, John T.

    2011-01-01

    Work with patient H.M., beginning in the 1950s, established key principles about the organization of memory that inspired decades of experimental work. Since H.M., the study of human memory and its disorders has continued to yield new insights and to improve understanding of the structure and organization of memory. Here we review this work with emphasis on the neuroanatomy of medial temporal lobe and diencephalic structures important for memory, multiple memory systems, visual perception, immediate memory, memory consolidation, the locus of long-term memory storage, the concepts of recollection and familiarity, and the question of how different medial temporal lobe structures may contribute differently to memory functions. PMID:21456960

  18. Strategi Pemasaran Makanan Tradisional Asam Pedas Ikan Patin Khas Pekanbaru pada Restoran Pondok Patin Hm. Yunus

    OpenAIRE

    Gunawan, Dwi Yanda; Sulistyani, Andri

    2017-01-01

    Due of the Pondok Patin HM. Yunus Restaurant in Pekanbaru that capture this opportunity is Pondok Patin HM. Yunus Restaurant. The aims of this sturly are identify the implemented marketing strategy, idendify the determinals of marketing strategy forfulation, formulated new marketing strategy. Pondok Patin HM. Yunus Restaurant uses 4 p marketing mix : 1) Product 2) Price 3) Promotion 4) Place. Pondok Patin HM. Yunus restaurant was one of restaurant who providing the signature main course of Pe...

  19. 153Sm-HM for arthritic knee pain. Estimated dosimetry

    International Nuclear Information System (INIS)

    Hardy-Pérez, Alberto E.; Torres-García, Eugenio; Mitsoura, Eleni; Jiménez-Mancilla, Nallely P.; Arteaga-de-Murphy, Consuelo; Pedraza-López, Martha

    2012-01-01

    Osteoarthritis is the most common type of arthropathy and after cardiovascular diseases is the most disabling disease in developing countries. The dosimetry for the clinical application of 153-samarium-hydroxymacroaggregates ( 153 Sm-HM) for radiation synovectomy (RSV) and palliative treatment for arthritic pain, as far as we know, has not been reported. The aim of this research was to estimate the radiation dose necessary for synovial ablation and pain palliation with minimum risk to the patient. 153 Sm-HM (370 MBq) was administered intra-articularly in a patient with severe knee pain and hindered motility. Regions of interest drawn on sequential, conjugated, anterior and posterior scintigraphy images were used to obtain the respective activity. The data was entered into a knee joint histological-geometric model designed with micrometric dimensions to represent the synovial cell layers. The Monte Carlo code was used to calculate the absorbed dose in each of the 12 model-cells representing the distance from the synovial liquid to the cartilage or bone. The absorbed dose in the synovial cavity was 114 Gy which is sufficient energy for RSV. The treated patient referred little pain and higher motility with no adverse reactions. 153 Sm-HM is a potentially valid radiopharmaceutical for RSV, which effectively palliates knee pain.

  20. Association of HeartMate II left ventricular assist device flow estimate with thermodilution cardiac output.

    Science.gov (United States)

    Hasin, Tal; Huebner, Marianne; Li, Zhuo; Brown, Daniel; Stulak, John M; Boilson, Barry A; Joyce, Lyle; Pereira, Naveen L; Kushwaha, Sudhir S; Park, Soon J

    2014-01-01

    Cardiac output (CO) assessment is important in treating patients with heart failure. Durable left ventricular assist devices (LVADs) provide essentially all CO. In currently used LVADs, estimated device flow is generated by a computerized algorithm. However, LVAD flow estimate may be inaccurate in tracking true CO. We correlated LVAD (HeartMate II) flow with thermodilution CO during postoperative care (day 2-10 after implant) in 81 patients (5,616 paired measurements). Left ventricular assist device flow and CO correlated with a low correlation coefficient (r = 0.42). Left ventricular assist device readings were lower than CO measurements by approximately 0.36 L/min, trending for larger difference with higher values. Left ventricular assist device flow measurements showed less temporal variability compared with CO. Grouping for simultaneous measured blood pressure (BP device flow generally trends with measured CO, but large variability exists, hence flow measures should not be assumed to equal with CO. Clinicians should take into account variables such as high CO, BP, and opening of the aortic valve when interpreting LVAD flow readout. Direct flow sensors incorporated in the LVAD system may allow for better estimation.

  1. Virtual Mission First Results Supporting the WATER HM Satellite Concept

    Science.gov (United States)

    Alsdorf, D.; Andreadis, K.; Lettenmaier, D.; Moller, D.; Rodriguez, E.; Bates, P.; Mognard, N.; Participants, W.

    2007-12-01

    Surface fresh water is essential for life, yet we have surprisingly poor knowledge of its variability in space and time. Similarly, ocean circulation and ocean-atmosphere interactions fundamentally drive weather and climate variability, yet the global ocean current and eddy field (e.g., the Gulf Stream) that affects ocean circulation is poorly known. The Water And Terrestrial Elevation Recovery Hydrosphere Mapper satellite mission concept (WATER HM or SWOT per the NRC Decadal Survey) is a swath-based interferometric-altimeter designed to acquire elevations of ocean and terrestrial water surfaces at unprecedented spatial and temporal resolutions. WATER HM will have tremendous implications for estimation of the global water cycle, water management, ocean and coastal circulation, and assessment of many water-related impacts from climate change (e.g., sea level rise, carbon evasion, etc.). We describe a hydrological "virtual mission" (VM) for WATER HM which consists of: (a) A hydrodynamic-instrument simulation model that maps variations in water levels along river channels and across floodplains. These are then assimilated to estimate discharge and to determine trade-offs between resolutions and mission costs. (b) Measurements from satellites to determine feasibility of existing platforms for measuring storage changes and estimating discharge. First results demonstrate that: (1) Ensemble Kalman filtering of VM simulations recover water depth and discharge, reducing the discharge RMSE from 23.2% to 10.0% over an 84- day simulation period, relative to a simulation without assimilation. The filter also shows that an 8-day overpass frequency produces discharge relative errors of 10.0%, while 16-day and 32-day frequencies result in errors of 12.1% and 16.9%, respectively. (2) SRTM measurements of water surfaces along the Mississippi, Missouri, Ohio, and Amazon rivers, as well as smaller tributaries, show height standard deviations of 5 meters or greater (SRTM is the

  2. Sustainable Fashion Supply Chain: Lessons from H&M

    Directory of Open Access Journals (Sweden)

    Bin Shen

    2014-09-01

    Full Text Available Sustainability is significantly important for fashion business due to consumers’ increasing awareness of environment. When a fashion company aims to promote sustainability, the main linkage is to develop a sustainable supply chain. This paper contributes to current knowledge of sustainable supply chain in the textile and clothing industry. We first depict the structure of sustainable fashion supply chain including eco-material preparation, sustainable manufacturing, green distribution, green retailing, and ethical consumers based on the extant literature. We study the case of the Swedish fast fashion company, H&M, which has constructed its sustainable supply chain in developing eco-materials, providing safety training, monitoring sustainable manufacturing, reducing carbon emission in distribution, and promoting eco-fashion. Moreover, based on the secondary data and analysis, we learn the lessons of H&M’s sustainable fashion supply chain from the country perspective: (1 the H&M’s sourcing managers may be more likely to select suppliers in the countries with lower degrees of human wellbeing; (2 the H&M’s supply chain manager may set a higher level of inventory in a country with a higher human wellbeing; and (3 the H&M CEO may consider the degrees of human wellbeing and economic wellbeing, instead of environmental wellbeing when launching the online shopping channel in a specific country.

  3. The development of 99mTc-d, 1-HM-PAO

    International Nuclear Information System (INIS)

    Bai Lanqin; Huang Jinjie; Fan Li; Bai Suzhen; Li Guoli; Jing Hui; Xiao Lun

    1991-12-01

    The 99m Tc-d,1-HM-PAO is an ideal radiopharmaceutical for regional cerebral blood perfusion imaging. The improvement of synthesis and separation of diastereoisomers leads to obtain high purity (>99%) of d, 1-HM-PAO and meso-HM-PAO. During separation H NMR spectroscopy was used to monitor the relative composition of these two diastereoisomers that can ensure the purity of pligand of d,1-HM-PAO. The intravenous injection of 99m Tc-d,1-HM-PAO was formed by adding fresh 99m Tc washing liquor into a sterile. Pyrogen-free and freeze-dried vial. The radiochemical purity (RCP) of 99m Tc-d,1-HM-PAO was greater than 80%. From the experiments of 99m Tc-d,1-HM-PAO in mice, after two minutes of intravenously (I>V>) administration about 2.24% of injected dose (I.D.)appeared in the brain, and after 24 hours about 72% of radioactivity of injected dose still left in the brain. But for the 99m Tc-meso-HM-PAO after two minutes of i.v. administration, about 1.93% of I.D. appeared in the brain, and 24 hours later, 25% of radioactivity of I.D. was in the brain. This result shows that in the brain the radioactivity of 99m Tc-meso-HM-PAO declines faster than that of 99m Td-d,1-HM-PAO

  4. Basic and clinical evaluation of regional cerebral perfusion scintigraphy of 99mTc-HM-PAO

    International Nuclear Information System (INIS)

    Tsukatani, Yasushi; Nakamura, Kayoko; Fujii, Hiroshi

    1988-01-01

    Radiochemical purity of 99m Tc-HM-PAO decreased rapidly after preparation. 99m Tc activity of the whole brain increased rapidly after venous injection, and changed very little after 3 minutes later. 99m Tc-HM-PAO scintigram showed the wider abnormal perfusion area than CT scanning did. Hypoperfusion area found by IMP tended to be wider than that by HM-PAO. There were no side effects observed of all cases. (author)

  5. HM-PAO-SPECT in complicated migraine. Case report

    Energy Technology Data Exchange (ETDEWEB)

    Gruenwald, F.; Ruhlmann, J.; Biersack, H.J.; Durwen, H.; Penin, H.

    1988-10-01

    Three HM-PAO-SPECT investigations have been performed in a female patient with a complicated migraine. 2.5 hours after an attack with right-sided numbness and atonic hemiparesis, at the left side a reduced blood flow was seen parietotemporally and in the subcortical structures. The cerebellum showed crossed diaschisis. During a symptom-free interval the SPECT showed a slightly increased parietotemporal blood blow and a reduced right temporooccipital blood flow. During a seizure with left-sided facial spasm, unsystematic clonic movements in all extremities and a following left-sided hemiparesis, the uptake in the visual cortex was increased by 60%. In the right frontotemporal and left temporal region a slightly increased accumulation was found.

  6. [Expression and clinical significance of 5hmC in bladder urothelial carcinoma].

    Science.gov (United States)

    Li, Jie; Xu, Yuqiao; Zhang, Zhiwen; Zhang, Ming; Zhang, Zhekai; Zhang, Feng; Li, Qing

    2016-02-01

    To investigate the expression of 5-hydroxymethylcytosine (5hmC) in bladder urothelial carcinoma (UC) and its clinical significance. The expression of 5hmC in 21 cases of UC tissues and pericarcinous urinary tract epithelium was detected by immunohistochemical staining. Then the expression of 5hmC in the surgical resection of UC tissues in 92 cases was also surveyed. Non parametric U Mann-Whitney test was used to analyze the correlation between 5hmC expression and clinical data. Single factor survival analysis was performed by Kaplan-Meier test. The expression of 5hmC in normal urinary tract epithelium and UC tissues was significantly different, but there was no significant difference in the expression of 5hmC between low and high grades of UC tissues as well as between different TNM grades. Kaplan-Meier single factor survival analysis showed that there was no significant correlation between the 5hmC expression level and the survival rate or the recurrence-free survival of UC patients. The expression level of 5hmC in UC tissues is significantly lower than that in pericarcinous urinary tract epithelium. There is no correlation between the 5hmC expression and the progression, prognosis and recurrence of UC.

  7. Biosynthesis of gold nanoparticles by actinomycete Streptomyces viridogens strain HM10.

    Science.gov (United States)

    Balagurunathan, R; Radhakrishnan, M; Rajendran, R Babu; Velmurugan, D

    2011-10-01

    Biosynthesis of gold nanoparticles by Streptomycetes from Himalayan Mountain was undertaken for the first time. Out of 10 actinomycete strains tested, four strains (D10, HM10, ANS2 and MSU) showed evidence for the intracellular biosynthesis of gold nanoparticles, among which the strain HM10 showed high potency. Presence of spherical and rod shaped gold nanoparticles in mycelium of the strain HM10 was determined by transmission electron microscopy (TEM) and X-ray diffraction analysis. The average particle size ranged from 18-20 nm. UV spectral analysis indicated that the reduction of chloroauric acid (HAuCl4) occurred within 24 h of reaction period. Further, the strain HM10 showed enhanced growth at 1 and 10 mM concentration of HAuCl4. The gold nanoparticles synthesized by the strain HM10 showed good antibacterial activity against S. aureus and E. coli in well-diffusion method. The potential actinomycete HM10 strain was phenotypically characterized and identified as Streptomyces viridogens (HM10). Thus, actinomycete strain HM10 reported in this study is a newly added source for the biosynthesis of gold nanoparticles.

  8. Synthesis of the d,I-HM-PAO and formulation of nucleo-equipment for the obtention of 99m Tc-(d,I)-HM-PAO

    International Nuclear Information System (INIS)

    Lezama C, J.; Ferro F, G.; Alcazar A, P.

    1991-09-01

    Most brain imaging radiopharmaceuticals are conventional hydrophilic compounds that are excluded from entering the normal brain by an intact blood-brain barrier (BBB). Under pathologic conditions, the barrier is disrupted and radiotracer concentrates in the leisure for positive identification. 99m Tc- hexa methyl propylene amine oxime ( 99 m Tc-HM-PAO) is a newer-type lipophilic agent that enter the normal brain through an intact BBB. Studies with this agent offer the promise of measuring cerebral perfusion in the normal and diseased brain. In this paper we present the synthesis and Tc-99m labelling of d,I-HM-PAO. The synthesis of the ligand was carried out by condensation of two molecular equivalents of butanedione monoxime with one molecular equivalent of 1,3 propanediamine provided a bis imine intermediate, which was reduced with sodium borohydride to get the meso and d,I diastereoisomers of HM-PAO. Separation of these was achieved by fractional crystallization. 99m Tc-(d,I)HM-PAO was obtained by stannous ion reduction of Mo-99/Tc-99m generator eluate in the presence of the ligand. Complex radiochemical purity was determined by instant thin layer chromatography and paper chromatography. Finally, we obtained 99m Tc-(d,I)HM-PAO with a high radiochemical yield, in excess of 90%. However, for subsequent clinical studies the preparation has to be done a few minutes before application because our product has a low stability. (Author)

  9. Technetium-labeled HM-PAO studies in patients with cerebrovascular disease

    International Nuclear Information System (INIS)

    Smith, F.W.; Sharp, P.F.; Gemmell, H.; Evans, N.T.; MacDonald, A.F.

    1986-01-01

    Technetium-labeled hexamethyl-propyleneamineoxime (HM-PAO) is a promising radiopharmaceutical for the demonstration of cerebral blood flow. Twenty-four patients who had experienced either acute stroke (AS) or transient ischemic attack (TIA) were studied by x-ray CT and SPECT using technetium-labeled HM-PAO total of 26 studies. HM-PAO has a cerebral distribution similar to that of iodoamphetamine, but labeling with technetium allows good SPECT imaging on demand in any nuclear medicine department. In ten of the 16 patients who had experienced AS, findings on HM-PAO and CT studies correlated well. In six patients reduced cortical perfusion was detected on HM-PAO imaging, but only small infarcts in the internal capsule were seen on CT. In four of the eight patients who had experienced TIA, neither study revealed any abnormality. In the remaining four, areas of cortical underperfusion were seen on HM-PAO imaging, whereas the CT examination was normal. The findings in this study suggest that HM-PAO imaging is a more sensitive method for demonstrating the extent of cerebral underperfusion in cases of cerebrovascular accident

  10. Biodegradation of used engine oil by novel strains of Ochrobactrum anthropi HM-1 and Citrobacter freundii HM-2 isolated from oil-contaminated soil.

    Science.gov (United States)

    Ibrahim, Haytham M M

    2016-12-01

    Used engine oil (UEO) constitutes a serious environmental problem due to the difficulty of disposal off or reuse. Ten bacterial strains with biodegradation potential were isolated from UEO-contaminated soil sample using enrichment technique. Two strains which exhibited the highest degradation %, 51 ± 1.2 and 48 ± 1.5, respectively, were selected. Based on the morphological, biochemical characteristics and 16S rRNA sequence analysis, they were identified as Ochrobactrum anthropi HM-1 (accession no: KR360745) and Citrobacter freundii HM-2 (accession no: KR360746). The different conditions which may influence their biodegradation activity, including UEO concentration (1-6 %, v/v), inoculum size (0.5-4 %, v/v), initial pH (6-8), incubation temperature (25-45 °C), and rotation speed (0-200 rpm), were evaluated. The optimum conditions were found to be 2 % UEO, 2 % inoculum size, pH 7.5, incubation temperature 37 °C, and 150 rpm. Under the optimized conditions, strains HM-1, HM-2, and their mixture efficiently degraded UEO, they achieved 65 ± 2.2, 58 ± 2.1, and 80 ± 1.9 %, respectively, after 21 days of incubation. Biodegradation of UEO was confirmed by employing gas chromatography analysis. Gamma radiation (1.5 kGy) enhanced the degradation efficiency of irradiated bacterial mixture (95 ± 2.1 %) as compared to non-irradiated (79 ± 1.6 %). Therefore, strains HM-1 and HM-2 can be employed to develop a cost-effective method for bioremediation of used engine-oil-polluted soil.

  11. HM-PAO-SPECT of the brain in a new-born child

    Energy Technology Data Exchange (ETDEWEB)

    Gruenwald, F.; Biersack, H.J.; Bindl, L.

    1988-08-01

    HM-PAO-SPECT of the brain was performed in a 14 days old new-born child. Diencephalon, brain stem and cerebellum showed a relative high tracer accumulation; there was nearly no accumulation in the neocortex.

  12. 99mTc HM-PAO brain perfusion SPECT in brain death

    International Nuclear Information System (INIS)

    Bonetti, M.G.; Ciritella, P.; Valle, G.; Perrone, E.

    1995-01-01

    We have easily carried out and interpreted 99m Tc HM-PAO SPECT in a consecutive series of 40 comatose patients with brain damage, without discontinuing therapy. Brain death was diagnosed in 7 patients, by recognising absence of brain perfusion, as shown by no intracranial radionuclide uptake. In patients in whom perfusion was seen on brain scans, HM-PAO SPECT improved assessment of the extent of injury, which in general was larger than suggested by CT. (orig.)

  13. Variable dust obscuration in the symbiotic Mira and very slow Nova, HM Sge

    International Nuclear Information System (INIS)

    Munari, U.; Whitelock, P.A.

    1989-01-01

    New infrared photometry is presented for the symbiotic Mira, HM Sge. Using this and published data a pulsation period of 527 day is derived. In addition to the normal pulsational modulation, the light curve for HM Sge has shown a distinct fading and reddening, starting in 1985. This is interpreted as a dust-obscuration event, and its possible association with the binary orbit is discussed. (author)

  14. The novel immunotoxin HM1.24-ETA′ induces apoptosis in multiple myeloma cells

    International Nuclear Information System (INIS)

    Staudinger, M; Glorius, P; Burger, R; Kellner, C; Klausz, K; Günther, A; Repp, R; Klapper, W; Gramatzki, M; Peipp, M

    2014-01-01

    Despite new treatment modalities, the clinical outcome in a substantial number of patients with multiple myeloma (MM) has yet to be improved. Antibody-based targeted therapies for myeloma patients could make use of the HM1.24 antigen (CD317), a surface molecule overexpressed on malignant plasma cells and efficiently internalized. Here, a novel immunotoxin, HM1.24-ETA′, is described. HM1.24-ETA′ was generated by genetic fusion of a CD317-specific single-chain Fv (scFv) antibody and a truncated variant of Pseudomonas aeruginosa exotoxin A (ETA′). HM1.24-ETA′ inhibited growth of interleukin 6 (IL-6)-dependent and -independent myeloma cell lines. Half-maximal growth inhibition was observed at concentrations as low as 0.3 nM. Target cell killing occurred via induction of apoptosis and was unaffected in co-culture experiments with bone marrow stromal cells. HM1.24-ETA′ efficiently triggered apoptosis of freshly isolated/cryopreserved cells of patients with plasma cell leukemia and MM and was active in a preclinical severe combined immunodeficiency (SCID) mouse xenograft model. Importantly, HM1.24-ETA′ was not cytotoxic against CD317-positive cells from healthy tissue (monocytes, human umbilical vein endothelial cells). These results indicate that CD317 may represent a promising target structure for specific and efficient immunotoxin therapy for patients with plasma cell tumors

  15. Optimal Timing of Heart Transplant After HeartMate II Left Ventricular Assist Device Implantation.

    Science.gov (United States)

    Steffen, Robert J; Blackstone, Eugene H; Smedira, Nicholas G; Soltesz, Edward G; Hoercher, Katherine J; Thuita, Lucy; Starling, Randall C; Mountis, Maria; Moazami, Nader

    2017-11-01

    Optimal timing of heart transplantation in patients supported with second-generation left ventricular assist devices (LVADs) is unknown. Despite this, patients with LVADs continue to receive priority on the heart transplant waiting list. Our objective was to determine the optimal timing of transplantation for patients bridged with continuous-flow LVADs. A total of 301 HeartMate II LVADs (Thoratec Corp, Pleasanton, CA) were implanted in 285 patients from October 2004 to June 2013, and 86 patients underwent transplantation through the end of follow-up. Optimal transplantation timing was the product of surviving on LVAD support and surviving transplant. Three-year survival after both HeartMate II implantation and heart transplantation was unchanged when transplantation occurred within 9 months of implantation. Survival decreased as the duration of support exceeded this. Preoperative risk factors for death on HeartMate II support were prior valve operation, prior coronary artery bypass grafting, low albumin, low glomerular filtration rate, higher mean arterial pressure, hypertension, and earlier date of implant. Survival for patients without these risk factors was lowest when transplant was performed within 3 months but was relatively constant with increased duration of support. Longer duration of support was associated with poorer survival for patients with many of these risk factors. Device reimplantation, intracranial hemorrhage, and postimplant dialysis during HeartMate II support were associated with decreased survival. Survival of patients supported by the HeartMate II is affected by preoperative comorbidities and postoperative complications. Transplantation before complications is imperative in optimizing survival. Copyright © 2017 The Society of Thoracic Surgeons. Published by Elsevier Inc. All rights reserved.

  16. Enhancement of arachidonic acid signaling pathway by nicotinic acid receptor HM74A

    International Nuclear Information System (INIS)

    Tang, Yuting; Zhou, Lubing; Gunnet, Joseph W.; Wines, Pamela G.; Cryan, Ellen V.; Demarest, Keith T.

    2006-01-01

    HM74A is a G protein-coupled receptor for nicotinic acid (niacin), which has been used clinically to treat dyslipidemia for decades. The molecular mechanisms whereby niacin exerts its pleiotropic effects on lipid metabolism remain largely unknown. In addition, the most common side effect in niacin therapy is skin flushing that is caused by prostaglandin release, suggesting that the phospholipase A 2 (PLA 2 )/arachidonic acid (AA) pathway is involved. Various eicosanoids have been shown to activate peroxisome-proliferator activated receptors (PPAR) that play a diverse array of roles in lipid metabolism. To further elucidate the potential roles of HM74A in mediating the therapeutic effects and/or side effects of niacin, we sought to explore the signaling events upon HM74A activation. Here we demonstrated that HM74A synergistically enhanced UTP- and bradykinin-mediated AA release in a pertussis toxin-sensitive manner in A431 cells. Activation of HM74A also led to Ca 2+ -mobilization and enhanced bradykinin-promoted Ca 2+ -mobilization through Gi protein. While HM74A increased ERK1/2 activation by the bradykinin receptor, it had no effects on UTP-promoted ERK1/2 activation.Furthermore, UTP- and bradykinin-mediated AA release was significantly decreased in the presence of both MAPK kinase inhibitor PD 098059 and PKC inhibitor GF 109203X. However, the synergistic effects of HM74A were not dramatically affected by co-treatment with both inhibitors, indicating the cross-talk occurred at the receptor level. Finally, stimulation of A431 cells transiently transfected with PPRE-luciferase with AA significantly induced luciferase activity, mimicking the effects of PPARγ agonist rosiglitazone, suggesting that alteration of AA signaling pathway can regulate gene expression via endogenous PPARs

  17. Enhancement of arachidonic acid signaling pathway by nicotinic acid receptor HM74A

    Energy Technology Data Exchange (ETDEWEB)

    Tang, Yuting [Endocrine Therapeutics and Metabolic Disorders, Johnson and Johnson Pharmaceutical Research and Development, L.L.C., 1000 Rt. 202, Raritan, NJ 08869 (United States); Zhou, Lubing [Endocrine Therapeutics and Metabolic Disorders, Johnson and Johnson Pharmaceutical Research and Development, L.L.C., 1000 Rt. 202, Raritan, NJ 08869 (United States); Gunnet, Joseph W [Endocrine Therapeutics and Metabolic Disorders, Johnson and Johnson Pharmaceutical Research and Development, L.L.C., 1000 Rt. 202, Raritan, NJ 08869 (United States); Wines, Pamela G [Endocrine Therapeutics and Metabolic Disorders, Johnson and Johnson Pharmaceutical Research and Development, L.L.C., 1000 Rt. 202, Raritan, NJ 08869 (United States); Cryan, Ellen V [Endocrine Therapeutics and Metabolic Disorders, Johnson and Johnson Pharmaceutical Research and Development, L.L.C., 1000 Rt. 202, Raritan, NJ 08869 (United States); Demarest, Keith T [Endocrine Therapeutics and Metabolic Disorders, Johnson and Johnson Pharmaceutical Research and Development, L.L.C., 1000 Rt. 202, Raritan, NJ 08869 (United States)

    2006-06-23

    HM74A is a G protein-coupled receptor for nicotinic acid (niacin), which has been used clinically to treat dyslipidemia for decades. The molecular mechanisms whereby niacin exerts its pleiotropic effects on lipid metabolism remain largely unknown. In addition, the most common side effect in niacin therapy is skin flushing that is caused by prostaglandin release, suggesting that the phospholipase A{sub 2} (PLA{sub 2})/arachidonic acid (AA) pathway is involved. Various eicosanoids have been shown to activate peroxisome-proliferator activated receptors (PPAR) that play a diverse array of roles in lipid metabolism. To further elucidate the potential roles of HM74A in mediating the therapeutic effects and/or side effects of niacin, we sought to explore the signaling events upon HM74A activation. Here we demonstrated that HM74A synergistically enhanced UTP- and bradykinin-mediated AA release in a pertussis toxin-sensitive manner in A431 cells. Activation of HM74A also led to Ca{sup 2+}-mobilization and enhanced bradykinin-promoted Ca{sup 2+}-mobilization through Gi protein. While HM74A increased ERK1/2 activation by the bradykinin receptor, it had no effects on UTP-promoted ERK1/2 activation.Furthermore, UTP- and bradykinin-mediated AA release was significantly decreased in the presence of both MAPK kinase inhibitor PD 098059 and PKC inhibitor GF 109203X. However, the synergistic effects of HM74A were not dramatically affected by co-treatment with both inhibitors, indicating the cross-talk occurred at the receptor level. Finally, stimulation of A431 cells transiently transfected with PPRE-luciferase with AA significantly induced luciferase activity, mimicking the effects of PPAR{gamma} agonist rosiglitazone, suggesting that alteration of AA signaling pathway can regulate gene expression via endogenous PPARs.

  18. Development of 99mTc-labelled the d,1-diasteroisomer of HM-PAO for cerebral blood flow imaging

    International Nuclear Information System (INIS)

    Lun Xiao.

    1989-10-01

    The d,1-diastereoisomer of hexamethyl propyleneamine oxime (HM-PAO) was selected as the preferred ligand for Tc-99m as a radiotracer for cerebral perfusion imaging. Further improvement of the synthesis and isolation method of HM-PAO resulted in pure d,1-HM-PAO and pure meso-HM-PAO. The neutral, lipophilic Tc-99m complexes of d,1-HM-PAO and meso-HM-PAO were formed in high yield by stannous reduction of Mo-99/Tc-99m generator eluate, respectively. Two minutes following i.v. administration of Tc-99m-d,1-HM-PAO in mice, 2.24% of the injected dose appears in the brain. Little washout of the tracer is observed up to 24-hour post injection. Two minutes following i.v. administration of Tc-99m-meso-HM-PAO in mice, 1.9% of the injected dose appears in the brain. The radioactivity of Tc-99m-meso-HM-PAO declined faster than that of Tc-99m-d,1-HM-PAO did in the brain up to 24-hour post injection. 12 refs, 5 figs, 5 tabs

  19. Experimental study of per-rectal portal scintigraphy using 99mTc-HM-PAO

    International Nuclear Information System (INIS)

    Kubota, Hayato; Shinotsuka, Akira; Takenaka, Hiroki; Tamaki, Satoshi.

    1994-01-01

    Usefulness of per-rectal portal scintigraphy by 123 I-IMP has already been admitted. We assessed whether 99m Tc-HM-PAO, another agent used for cerebral blood flow scintigraphy, could be utilized for scintigraphic evaluation of the portal system. Animal experiments were carried out to evaluate the usefulness of the examination. Shunt indices obtained from per-rectal portal scintigraphy by 123 I-IMP and 99m Tc-HM-PAO in shunt models and shunt rate obtained by direct injection of 99m Tc-MAA into the inferior mesenteric vein under laparotomy were compared. Correlation coefficient of each agent with 99m Tc-MAA was 0.90 for 99m Tc-HM-PAO and 0.80 for 123 I-IMP. It was also noted that as larger quantity of the tracer could be administered in 99m Tc-HM-PAO than in 123 I-IMP, absorption from rectum was optimum and liver extraction fraction was 94.4%. Therefore, we concluded that 99m Tc-HM-PAO was useful for per-rectal portal scintigraphy. (author)

  20. Synthesis of the d,I-HM-PAO and formulation of nucleo-equipment for the obtention of {sup 99m} Tc-(d,I)-HM-PAO; Sintesis del d,I-HM-PAO y formulacion de nucleo-equipos para la obtencion de {sup 99m} Tc-(d,I)-HM-PAO

    Energy Technology Data Exchange (ETDEWEB)

    Lezama C, J; Ferro F, G; Alcazar A, P

    1991-09-15

    Most brain imaging radiopharmaceuticals are conventional hydrophilic compounds that are excluded from entering the normal brain by an intact blood-brain barrier (BBB). Under pathologic conditions, the barrier is disrupted and radiotracer concentrates in the leisure for positive identification. {sup 99m} Tc- hexa methyl propylene amine oxime ({sup 99} {sup m} Tc-HM-PAO) is a newer-type lipophilic agent that enter the normal brain through an intact BBB. Studies with this agent offer the promise of measuring cerebral perfusion in the normal and diseased brain. In this paper we present the synthesis and Tc-99m labelling of d,I-HM-PAO. The synthesis of the ligand was carried out by condensation of two molecular equivalents of butanedione monoxime with one molecular equivalent of 1,3 propanediamine provided a bis imine intermediate, which was reduced with sodium borohydride to get the meso and d,I diastereoisomers of HM-PAO. Separation of these was achieved by fractional crystallization. {sup 99m} Tc-(d,I)HM-PAO was obtained by stannous ion reduction of Mo-99/Tc-99m generator eluate in the presence of the ligand. Complex radiochemical purity was determined by instant thin layer chromatography and paper chromatography. Finally, we obtained {sup 99m} Tc-(d,I)HM-PAO with a high radiochemical yield, in excess of 90%. However, for subsequent clinical studies the preparation has to be done a few minutes before application because our product has a low stability. (Author)

  1. Comparison of acoustic fields produced by the original and upgraded HM-3 lithotripter

    Science.gov (United States)

    Zhou, Yufeng; Zhu, Songlin; Dreyer, Thomas; Liebler, Marko; Zhong, Pei

    2003-10-01

    To reduce tissue injury in shock wave lithotripsy (SWL) while maintaining satisfactory stone comminution, an original HM-3 lithotripter was upgraded by a reflector insert to suppress large intraluminal bubble expansion, which is a primary mechanism of vascular injury in SWL. The pressure waveforms produced by the original and upgraded HM-3 lithotripter were measured by using a fiber optical probe hydrophone (FOPH), which was scanned both along and transverse to the lithotripter axis at 1-mm step using a computer-controlled 3-D positioning system. At F2, the pressure waveform produced by the upgraded HM-3 lithotripter at 22 kV has a distinct dual-pulse structure, with a leading shock wave of ~45 MPa from the reflector insert and a 4-μs delayed second pulse of ~15 MPa reflected from the uncovered bottom surface of the original HM-3 reflector. The beam sizes of the original and upgraded HM-3 lithotripter are comparable in both axial and lateral directions. The pressure waveforms measured at the reflector aperture will be used as input to the KZK equation to predict the lithotripter shock wave at F2. Furthermore, bubble dynamics predicted by the Gilmore model will be compared with experimental observation by high-speed imaging. [Work supported by NIH.

  2. Characterization of biosurfactants produced by novel strains of Ochrobactrum anthropi HM-1 and Citrobacter freundii HM-2 from used engine oil-contaminated soil

    Directory of Open Access Journals (Sweden)

    Haytham M.M. Ibrahim

    2018-03-01

    Full Text Available Microbial surfactants are widely used for industrial, agricultural, food, cosmetics, pharmaceutical, and medical applications. In this study, two bacterial strains namely, Ochrobactrum anthropi HM-1 and Citrobacter freundii HM-2, previously isolated from used engine oil contaminated soil, and capable of producing biosurfactants, were used. Their cell-free culture broth showed positive results toward five screening tests (hemolysis in blood agar, drop collapse, oil displacement, emulsification activity (E24, and surface tension (ST reduction. They reduced the ST of growth medium (70 ± 0.9 to 30.8 ± 0.6 and 32.5 ± 1.3 mN/m, respectively. The biosurfactants were classified as anionic biomolecules. Based on TLC pattern and FT-IR analysis, they were designated as glycolipids (rhamnolipid. Waste frying oil was feasibly used as a cheap and dominant carbon source for biosurfactants production; 4.9 and 4.1 g/l were obtained after 96 h of incubation, respectively. Compared with non-irradiated cells, gamma-irradiated cells (1.5 kGy revealed enhanced biosurfactant production by 56 and 49% for HM-1 and HM-2, respectively. The biosurfactants showed good stability after exposure to extreme conditions [temperatures (50–100 °C for 30 min, pH (2–12 and salinity (2–10% NaCl], they retained 83 and 79.3% of their E24, respectively, after incubation for a month, under extreme conditions. Biosurfactants effectively recovered up to 70 and 67% of the residual oil, respectively, from oil-saturated sand pack columns. These biosurfactants are an interesting biotechnological product for many environmental and industrial applications. Keywords: Ochrobactrum anthropi, Citrobacter freundii, Biosurfactant, Characterization, Stability

  3. New Insights into 5hmC DNA Modification: Generation, Distribution and Function

    Directory of Open Access Journals (Sweden)

    Dong-Qiao Shi

    2017-07-01

    Full Text Available Dynamic DNA modifications, such as methylation/demethylation on cytosine, are major epigenetic mechanisms to modulate gene expression in both eukaryotes and prokaryotes. In addition to the common methylation on the 5th position of the pyrimidine ring of cytosine (5mC, other types of modifications at the same position, such as 5-hydroxymethyl (5hmC, 5-formyl (5fC, and 5-carboxyl (5caC, are also important. Recently, 5hmC, a product of 5mC demethylation by the Ten-Eleven Translocation family proteins, was shown to regulate many cellular and developmental processes, including the pluripotency of embryonic stem cells, neuron development, and tumorigenesis in mammals. Here, we review recent advances on the generation, distribution, and function of 5hmC modification in mammals and discuss its potential roles in plants.

  4. Diagnosis of infected bone and joint diseases with 99mTc-HM-PAO labeled leukocytes

    International Nuclear Information System (INIS)

    Kanegae, Kakuko; Itoh, Kazuo; Tsukamoto, Eriko; Nagao, Kazuhiko; Nakada, Kunihiro; Hurudate, Masayori

    1992-01-01

    The usefulness of 99m Tc-hexamethylpropylene amine oxime (HM-PAO) labeled leukocytes scans was studied in 15 patients with suspected infection of the bone and joints. All spot images of lesions were obtained 4 and 24 hours after injection of 70.3-236.8 MBq (a mean, 149.5 MBq). 99m Tc-HM-PAO leukocytes scans were positive in 5 patients, negative in 8, and equivocal in 2. It had a sensitivity of 83% (5/6), specificity of 100% (6/6), and accuracy of 93% (14/15) for diagnosing infections. Equivocal uptake, seen on the 4-hr image in 2 patients, became negative on the 24-hr image. In view of ready availability and simple labeling procedure, 99m Tc-HM-PAO labeled leukocytes scans can be used as one of the specific diagnostic procedures for infections. (N.K.)

  5. Investigating the Role of Interventricular Interdependence in Development of Right Heart Dysfunction During LVAD Support: A Patient-Specific Methods-Based Approach

    Directory of Open Access Journals (Sweden)

    Kevin L. Sack

    2018-05-01

    Full Text Available Predictive computation models offer the potential to uncover the mechanisms of treatments whose actions cannot be easily determined by experimental or imaging techniques. This is particularly relevant for investigating left ventricular mechanical assistance, a therapy for end-stage heart failure, which is increasingly used as more than just a bridge-to-transplant therapy. The high incidence of right ventricular failure following left ventricular assistance reflects an undesired consequence of treatment, which has been hypothesized to be related to the mechanical interdependence between the two ventricles. To investigate the implication of this interdependence specifically in the setting of left ventricular assistance device (LVAD support, we introduce a patient-specific finite-element model of dilated chronic heart failure. The model geometry and material parameters were calibrated using patient-specific clinical data, producing a mechanical surrogate of the failing in vivo heart that models its dynamic strain and stress throughout the cardiac cycle. The model of the heart was coupled to lumped-parameter circulatory systems to simulate realistic ventricular loading conditions. Finally, the impact of ventricular assistance was investigated by incorporating a pump with pressure-flow characteristics of an LVAD (HeartMate II™ operating between 8 and 12 k RPM in parallel to the left ventricle. This allowed us to investigate the mechanical impact of acute left ventricular assistance at multiple operating-speeds on right ventricular mechanics and septal wall motion. Our findings show that left ventricular assistance reduces myofiber stress in the left ventricle and, to a lesser extent, right ventricle free wall, while increasing leftward septal-shift with increased operating-speeds. These effects were achieved with secondary, potentially negative effects on the interventricular septum which showed that support from LVADs, introduces unnatural bending

  6. The importance of strategic management : A case study of H&M

    OpenAIRE

    Ding, Huiru

    2011-01-01

    Hennes & Mauritz (H&M) is a 100 billion Sweden company,engaged in designing and retailing of fashion apparel and accessories. The company offers a range of apparel, cosmetics, footwear and accessories for men, women, children and teenagers. H&M primarily operates in Europe, North America and Asia, and has a presence in over 38 countries. The company is headquartered in Stockholm, Sweden and employs approximately 87,000 people on a full-time basis. This thesis focused on the strategic...

  7. The retention of [99mTc]-d,l-HM-PAO in the human brain after intracarotid bolus injection

    DEFF Research Database (Denmark)

    Lassen, N A; Andersen, A R; Friberg, L

    1988-01-01

    [99mTc]-d,l-HM-PAO (HM-PAO) was injected rapidly into the internal carotid artery and its retention in the brain was recorded by external scintillation cameras in eight human subjects. A model is described based on three compartments: the lipophilic tracer in the blood pool of the brain, the lipo......[99mTc]-d,l-HM-PAO (HM-PAO) was injected rapidly into the internal carotid artery and its retention in the brain was recorded by external scintillation cameras in eight human subjects. A model is described based on three compartments: the lipophilic tracer in the blood pool of the brain...

  8. Great day: H.M. Queen Elizabeth II at the Calder Hall opening

    International Nuclear Information System (INIS)

    1956-01-01

    The opening of the world's first nuclear power station, Calder Hall, was a major event in the history of post-war Britain. This film describes the construction and design of the station and its opening by the Queen. It is also an interesting historical document reflecting the beliefs and aspirations of the time. (author)

  9. Die etiek van HM Kuitert na aanleiding van sy boek Suicide - wat is ...

    African Journals Online (AJOL)

    The ethics of HM Kuitert according to his book entitled. Suicide - wat is er tegen? Selfdoding in moreel perspektief. According to several publications Kuitert is criticised as a humanist. This paper tests his view on suicide to this accusation. It is found that Kuitert accepts teleology and solidarity as norms for his ethics and uses ...

  10. ULTRACAM photometry of the ultracompact binaries V407 Vul and HM Cnc

    NARCIS (Netherlands)

    Barros, S.C.C.; Marsh, T.R.; Dhillon, V.S.; Groot, P.J.; Littlefair, S.; Nelemans, G.A.; Roelofs, G.H.A.; Steeghs, D.; Wheatley, P.J.

    2007-01-01

    V407 Vul (RXJ1914.4+2456) and HM Cnc (RXJ0806.3+1527) are X-ray emitting stars with X-ray light curves that are 100 per cent modulated on periods of 569 and 321 s, respectively. These periods are thought possibly to represent the orbital periods of close pairs of white dwarfs. In this paper we

  11. Causes of the cracks in the pipeline made of the 15HM steel

    Directory of Open Access Journals (Sweden)

    Słania J.

    2017-03-01

    Full Text Available Issues referring to cracks in the pipelines made of the 15HM steel are described. Metallographic specimen of welded joints are provided. The results of impact strength tests, hardness tests and static tensile tests are given. Tests results as well as direct and indirect causes of the pipeline cracks are shown.

  12. Clinical applications of brain perfusion imaging with 99mTc-HM-PAO

    International Nuclear Information System (INIS)

    Lin Xiangtong

    1989-01-01

    200 patients with central nervous system diseases were studied with 99m Tc-HM-PAO and SPECT, including Parkinson's disease (PD) 47, Vascular headache 69, CVD 34, Epilepsy 26, Head truma 10, Brain tumor 5 and other 9 cases. Part of them have been compared with the results of MRI, X-CT and EEG. The positivity of SPECT in PD is 61.7% with decrease perfusion in local area of cerebram and basal ganglia and only 4 cases had lower perfusion in cerebellum; in headache is 46.4%, showing variable perfusion patterns; in CVD is 79.4% with decrease perfusion, luxury perfusion and the phenomenon of 'diaschsis'. In epilepsy, the abnormal foci mostly localize in temporal lobe and have close relation to the results of EEG. In brain tumor it also denotes decreased uptake of tracer. The clinicl singnificance of brain perfusion imaging with 99m Tc-HM-PAO was discussed

  13. Clinical applications of brain perfusion imaging with sup 99m Tc-HM-PAO

    Energy Technology Data Exchange (ETDEWEB)

    Xiangtong, Lin [Shanghai Medical Univ. (China). Huashan Hospital; and others

    1989-11-01

    200 patients with central nervous system diseases were studied with {sup 99m}Tc-HM-PAO and SPECT, including Parkinson's disease (PD) 47, Vascular headache 69, CVD 34, Epilepsy 26, Head truma 10, Brain tumor 5 and other 9 cases. Part of them have been compared with the results of MRI, X-CT and EEG. The positivity of SPECT in PD is 61.7% with decrease perfusion in local area of cerebram and basal ganglia and only 4 cases had lower perfusion in cerebellum; in headache is 46.4%, showing variable perfusion patterns; in CVD is 79.4% with decrease perfusion, luxury perfusion and the phenomenon of 'diaschsis'. In epilepsy, the abnormal foci mostly localize in temporal lobe and have close relation to the results of EEG. In brain tumor it also denotes decreased uptake of tracer. The clinicl singnificance of brain perfusion imaging with {sup 99m}Tc-HM-PAO was discussed.

  14. Batibo, HM

    African Journals Online (AJOL)

    Fighting A Losing Battle: Assessing The Impact Of Mother-Tongue Education Advocacy In A Hostile Environment Abstract · Vol 23 (2013) - Articles The Last Kick of a Dying Horse: Preserving Ethnic Identity in Shisukuma Greeting System Abstract · Vol 26 (2015) - Articles Ten commandments for Setswana to be a resourceful ...

  15. Brain perfusion spect imaging with sup 99m Tc-HM-PAO in Parkinson's disease

    Energy Technology Data Exchange (ETDEWEB)

    Wenzhong, Song; Xiangtong, Lin [Shanghai Medical Univ. (China). Huashan Hospital

    1991-02-01

    Forty patients with Parkinson's disease were studied using {sup 99m}Tc-HM-PAO brain perfusion SPECT. 62.5% (25 cases) showed abnormal blood perfusion. Among them 55% showed local decreased blood perfusion of cerebral cortex, 22% showed asymmetric decreased blood perfusion in basal gaglia, 10% showed decreased uptake of tracer in cerebellum. The pathophysiologic basis of the abnormality of brain blood perfusion were briefly discussed.

  16. Complete genome sequence of probiotic Bacillus coagulans HM-08: A potential lactic acid producer.

    Science.gov (United States)

    Yao, Guoqiang; Gao, Pengfei; Zhang, Wenyi

    2016-06-20

    Bacillus coagulans HM-08 is a commercialized probiotic strain in China. Its genome contains a 3.62Mb circular chromosome with an average GC content of 46.3%. In silico analysis revealed the presence of one xyl operon as well as several other genes that are correlated to xylose utilization. The genetic information provided here may help to expand its future biotechnology potential in lactic acid production. Copyright © 2016 Elsevier B.V. All rights reserved.

  17. Cerebral blood flow imaging by I-123 IMP and Tc-99m HM-PAO

    Energy Technology Data Exchange (ETDEWEB)

    Uno, Koichi; Yoshikawa, Kyosan; Minoshima, Satoshi; Imaseki, Keiko; Arimizu, Noboru; Yamaura, Akira; Uematsu, Sadao

    1988-02-01

    SPECT studies with either N-isopropyl-p-(I-123)iodo- amphetamine (I-123 IMP) or Tc-99m hexamethyl propylene amine oxime (Tc-99m HM-PAO) were cuncurrently performed in 12 patients with brain disorders, comprising cerebral infarction (7), cerebral aneurysm (one), intracranial hemorrhage (3), and subdural hematoma (one). Whereas I-123 IMP was taken up gradually into the brain, the uptake of Tc-99m-HM-PAO in the brain reached the peak immediately after the iv injection, with 90% or more remaining constant by 15 min postinjection. On early SPECT images, a high uptake of I-123 IMP was observed in the lung, and the uptake of Tc-99m HM-PAO was observed as well in the soft tissue of cervical region. In all patients except for one, decreased rCBF was observed in the lesions on both I-123 and Tc-99m SPECT scans. Both of the radiopharmaceuticals were analogous in that decreased blood flow corresponded to cerebral lesions. (Namekawa, K).

  18. MELCOR simulation of steam condensation effect on hydrogen behavior in THAI HM-2 experiment

    Energy Technology Data Exchange (ETDEWEB)

    Lee, Seongnyeon; Lee, Jung-Jae; Cho, Yong-Jin [Korea Institute of Nuclear Safety, Daejeon (Korea, Republic of); Kim, Sung Joong [Hanyang University, Seoul (Korea, Republic of)

    2015-10-15

    In this study, MELCOR simulation was carried out for THAI HM-2 experiment of OECD. As a results, stratification of hydrogen cloud was reasonably captured in MELCOR simulation. Furthermore, the pressure from simulation results in cases where mass transfer coefficient of MELCOR condensation model was modified was good agreement with the experimental results. Containment Filtered Ventilation System (CFVS) has been introduced as facility to prevent containment failure during severe accident. However, possibility of hydrogen risk has been issued due to inflow of hydrogen, condensation and removal of steam and complicated inner structure in CFVS. Preferentially benchmark work for THAI HM-2 experiment of OECD was decided to validate the methodology before detailed assessment of hydrogen risk in CFVS. The objectives of THAI HM-2 experiment were evaluation of hydrogen behavior, verification of numerical analysis tools and so on. In this paper, therefore, MELCOR simulation was carried out in comparison with the experiment results. Additionally, steam condensation effect was considered for detailed simulation. Hydrogen concentration from MELCOR results was underestimated in comparison to the experimental results.

  19. Expression of kenaf mitochondrial chimeric genes HM184 causes male sterility in transgenic tobacco plants.

    Science.gov (United States)

    Zhao, Yanhong; Liao, Xiaofang; Huang, Zhipeng; Chen, Peng; Zhou, Bujin; Liu, Dongmei; Kong, Xiangjun; Zhou, Ruiyang

    2015-08-01

    Chimeric genes resulting from the rearrangement of a mitochondrial genome were generally thought to be a causal factor in the occurrence of cytoplasmic male sterility (CMS). In the study, earlier we reported that identifying a 47 bp deletion at 3'- flanking of atp9 that was linked to male sterile cytoplasm in kenaf. The truncated fragment was fused with atp9, a mitochondrial transit signal (MTS) and/or GFP, comprised two chimeric genes MTS-HM184-GFP and MTS-HM184. The plant expression vector pBI121 containing chimeric genes were then introduced to tobacco plants by Agrobacterium-mediated T-DNA transformation. The result showed that certain transgenic plants were male sterility or semi-sterility, while some were not. The expression analysis further demonstrated that higher level of expression were showed in the sterility plants, while no expression or less expression in fertility plants, the levels of expression of semi-sterility were in between. And the sterile plant (containing MTS-HM184-GFP) had abnormal anther produced malformed/shriveled pollen grains stained negative that failed to germinate (0%), the corresponding fruits was shrunken, the semi-sterile plants having normal anther shape produced about 10-50% normal pollen grains, the corresponding fruits were not full, and the germination rate was 58%. Meanwhile these transgenic plants which altered on fertility were further analyzed in phenotype. As a result, the metamorphosis leaves were observed in the seedling stage, the plant height of transgenic plants was shorter than wild type. The growth duration of transgenic tobacco was delayed 30-45 days compared to the wild type. The copy numbers of target genes of transgenic tobacco were analyzed using the real-time quantitative method. The results showed that these transgenic plants targeting-expression in mitochondrial containing MTS-HM184-GFP had 1 copy and 2 copies, the other two plants containing MTS-HM184 both had 3 copies, but 0 copy in wild type. In

  20. Cerebral uptake and retention of 99Tcsup(m)-hexamethylpropyleneamine oxime (99Tcsup(m)-HM-PAO)

    International Nuclear Information System (INIS)

    Holmes, R.A.; Chaplin, S.B.; Royston, K.G.; Missouri Univ., Columbia

    1985-01-01

    A new radiopharmaceutical, 99 Tcsup(m)-hexamethylpropyleneamine oxime ( 99 Tcsup(m)-HM-PAO) is described. This agent displays considerable promise for imaging cerebral blood flow. In studies in rats and one human volunteer, 99 Tcsup(m)-HM-PAO demonstrates good brain uptake, prolonged retention of activity in the brain, and slow regional redistribution. These properties suggest that this new radiopharmaceutical is ideal for single photon emission tomographic (SPECT) imaging of cerebral blood flow. (author)

  1. Description and advantages of the new and dry total mercury CEM HM 14000 trust

    Energy Technology Data Exchange (ETDEWEB)

    Kasajanow, J.

    2002-07-01

    A series of 24 overheads/slides outline the presentation giving details of the design and operation of the continuous emission monitor - the Total Mercury CEM HM 1400TR produced by the Durag Group. The monitor is suitable for measuring mercury emitted from power plants. The principle components of the monitor, the thermocatalytic reactor, and the dual beam UV detector are described, along with the calibration. Also the Portable Total Mercury CEM and the Total Mercury CEM 1500 for liquids are pictured. The presentation was made by Verewa, part of the Durag Group.

  2. Precision temperature monitoring (PTM) and Humidity monitoring (HM) sensors of the CMS electromagnetic calorimeter

    CERN Multimedia

    2006-01-01

    A major aspect for the ECAL detector control is the monitoring of the system temperature and the verification that the required temperature stability of the crystal volume and the APDs, expected to be (18 ± 0.05)C, is achieved. The PTM is designed to read out thermistors, placed on both the front and back of the crystals, with a relative precision better than 0.01 C. In total there are ten sensors per supermodule. The humidity level in the electronics compartment is monitored by the HM system and consists of one humidity sensor per module.

  3. A study of 99mTc-HM-PAO brain SPECT in the senile parkinson's disease

    International Nuclear Information System (INIS)

    Chen Wenxin; Lin Xiangtong; Song Wenzhong; Liu Yongchang

    1996-01-01

    Thirty-three cases of senile Parkinson's disease (PD) imaged by 99m Tc-HM-PAO brain SPECT were reported. 66.7% of the patients had cortical hypoperfusion and 18.2% showed asymmetrical hypoperfusion in the basal ganglia. Such a finding was not related with the Hoehn-Yahr stage and the laterality of motor symptoms. If complicated with dementia, the SPECT brain imaging showed similar pattern in Alzheimer's disease with diffuse hypoperfusion in cortical area reflecting widespread pathological changes in tremor paralysis

  4. The pharmacotherapy of the HeartMate II, a continuous flow left ventricular assist device, in patients with advanced heart failure: integration of disease, device, and drug.

    Science.gov (United States)

    Jennings, Douglas L; Chambers, Rachel M; Schillig, Jessica M

    2010-10-01

    Advanced heart failure continues to be a significant cause of morbidity and mortality in the US. Patients with advanced heart failure have a poor prognosis without cardiac transplantation. The use of left ventricular assist devices (LVADs) as destination therapy for these patients is therefore expected to increase in the coming years as technology advances. The HeartMate II, a continuous flow implantable device, is currently the only LVAD that has been approved by the Food and Drug Administration for destination therapy in patients with advanced heart failure. The pharmacotherapy associated with this device is very complex and, therefore, the need for expertly trained clinical pharmacists to care for this expanding patient population will also likely increase. Unfortunately, most pharmacists are unfamiliar with the effect of LVADs on the physiology and pharmacotherapy of a patient's heart failure. The purpose of this article is to give clinical pharmacists an introduction to the most common pharmacotherapeutic issues for patients with LVADs and present practical solutions for managing common drug therapy problems.

  5. Extraction of [99mTc]-d,l-HM-PAO across the blood-brain barrier

    DEFF Research Database (Denmark)

    Andersen, A R; Friberg, H; Knudsen, K B

    1988-01-01

    The initial extraction (E) across the blood-brain barrier (BBB) of [99mTc]-d,l-HM-PAO after intracarotid injection was measured in 14 Wistar rats and 6 patients using the double indicator, single injection method with Na-24 as the cotracer. In both series, cerebral blood flow (CBF) was measured...... was increased from 20 to 120 microliters, while using a 120 microliters bolus containing 10% albumin resulted in a decrease in E. This suggests that HM-PAO binding to albumin is not totally and rapidly reversible during a single passage through brain capillaries and that binding to blood elements may reduce...... the apparent extraction across brain capillaries. In patients using a bolus of 1 ml saline, E decreased linearly with increasing CBF (r = -0.81, p less than 0.001). For a CBF of 0.59 ml/g/min and an average apparent E of 0.72, an apparent PS product of 0.76 ml/g/min was calculated.(ABSTRACT TRUNCATED AT 250...

  6. Interaction of Zn(II) with hematite nanoparticles and microparticles: Part 2. ATR-FTIR and EXAFS study of the aqueous Zn(II)/oxalate/hematite ternary system.

    Science.gov (United States)

    Ha, Juyoung; Trainor, Thomas P; Farges, François; Brown, Gordon E

    2009-05-19

    Sorption of Zn(II) to hematite nanoparticles (HN) (av diam=10.5 nm) and microparticles (HM) (av diam=550 nm) was studied in the presence of oxalate anions (Ox2-(aq)) in aqueous solutions as a function of total Zn(II)(aq) to total Ox2-(aq) concentration ratio (R=[Zn(II)(aq)]tot/[Ox2-(aq)]tot) at pH 5.5. Zn(II) uptake is similar in extent for both the Zn(II)/Ox/HN and Zn(II)/Ox/HM ternary systems and the Zn(II)/HN binary system at [Zn(II)(aq)](tot)system than for the Zn(II)/Ox/HM ternary and the Zn(II)/HN and Zn(II)/HM binary systems at [Zn(II)(aq)]tot>4 mM. In contrast, Zn(II) uptake for the Zn(II)/HM binary system is a factor of 2 greater than that for the Zn(II)/Ox/HM and Zn(II)/Ox/HN ternary systems and the Zn(II)/HN binary system at [Zn(II)(aq)]totternary system at both R values examined (0.16 and 0.68), attenuated total reflectance Fourier transform infrared (ATR-FTIR) results are consistent with the presence of inner-sphere oxalate complexes and outer-sphere ZnOx(aq) complexes, and/or type A ternary complexes. In addition, extended X-ray absorption fine structure (EXAFS) spectroscopic results suggest that type A ternary surface complexes (i.e., >O2-Zn-Ox) are present. In the Zn(II)/Ox/HN ternary system at R=0.15, ATR-FTIR results indicate the presence of inner-sphere oxalate and outer-sphere ZnOx(aq) complexes; the EXAFS results provide no evidence for inner-sphere Zn(II) complexes or type A ternary complexes. In contrast, ATR-FTIR results for the Zn/Ox/HN sample with R = 0.68 are consistent with a ZnOx(s)-like surface precipitate and possibly type B ternary surface complexes (i.e., >O2-Ox-Zn). EXAFS results are also consistent with the presence of ZnOx(s)-like precipitates. We ascribe the observed increase of Zn(II)(aq) uptake in the Zn(II)/Ox/HN ternary system at [Zn(II)(aq)]tot>or=4 mM relative to the Zn(II)/Ox/HM ternary system to formation of a ZnOx(s)-like precipitate at the hematite nanoparticle/water interface.

  7. Technetium-99m HM-PAO-SPECT study of regional cerebral perfusion in early Alzheimer's disease

    International Nuclear Information System (INIS)

    Perani, D.; Di Piero, V.; Vallar, G.

    1988-01-01

    Regional cerebral perfusion was evaluated by single photon emission computed tomography (SPECT) using technetium-99m hexamethylpropyleneamine oxime ([/sup 99m/Tc]HM-PAO) in sixteen patients with Alzheimer's disease (AD) in early clinical phase and in 16 healthy elderly controls. In all patients transmission computed tomography (TCT) and/or magnetic resonance imaging (MRI) did not show focal brain abnormalities. Relative to normal subjects, AD patients showed significant reductions in cortical/cerebellar activity ratio: cortical perfusion was globally depressed with the largest reductions in frontal and posterior temporo-parietal cortices. Asymmetries of relative perfusion between cerebral hemispheres were also demonstrated when language was affected or visuospatial functions were unevenly impaired. In patients with early AD, SPECT provides functional information to be compared with clinical and psychometric data

  8. ähm vs. niinku - Verzögerungssignale in deutschen und finnischen Diskussionen

    Directory of Open Access Journals (Sweden)

    Margarethe Olbertz-Siitonen

    2015-05-01

    Full Text Available Dieser Beitrag beschäftigt sich kontrastiv mit dem Gebrauch von Verzögerungssignalen in deutschen und finnischen Seminardiskussionen. Die voranalytische  Durchsicht der Videomitschnitte zeigte, dass die deutschen Studenten unvergleichlich  häufiger die Verzögerungspartikeln äh und ähm  einsetzten als ihre finnischen Kommilitonen, die in ähnlicher Funktion v.a. die Partikel niinku ('sozusagen' benutzten. Diese  Beobachtung ist insofern von Bedeutung, als es meist die finnischen Gesprächsteilnehmer sind, die in deutsch-finnischen Kontaktsituationen auf eine Fremdsprache (Deutsch  zurückgreifen müssen: Möglicherweise steht finnischen Gesprächspartnern in der Interaktion mit deutschen Muttersprachlern keine deutsche Entsprechung für niinku zur Ver- fügung. Gegebenenfalls resultierende Kommunikationsprobleme sollten dementsprechend nicht vornehmlich interkulturell, sondern interlingual bewertet werden.

  9. Use of [/sup 99m/Tc]-HM-PAO in the diagnosis of primary degenerative dementia

    International Nuclear Information System (INIS)

    Testa, H.J.; Snowden, J.S.; Neary, D.; Shields, R.A.; Burjan, A.W.; Prescott, M.C.; Northen, B.; Goulding, P.

    1988-01-01

    The clinical value of single photon emission computed tomography (SPECT) in the differential diagnosis of dementia due to cerebral atrophy was evaluated by comparing the pattern of distribution [/sup 99m/Tc]-HM-PAO in three dementing conditions. Imaging was carried out in 26 patients with suspected Alzheimer's disease, 14 with dementia of the frontal-lobe type, and 13 with progressive supranuclear palsy. Images were evaluated and reported without knowledge of clinical diagnosis with respect to regions of reduced uptake of tracer. Reduced uptake in the posterior cerebral hemispheres was characteristic of Alzheimer's disease, while selective anterior hemisphere abnormalities characterized both dementia of the frontal-lobe type and progressive supranuclear palsy. The latter conditions could be distinguished on the basis of the appearance of integrity of the rim of the frontal cortex. The technique has an important role in the differentiation of degenerative dementias

  10. Radiolabelling of sperm cells with 99mTc-HM-PAO

    International Nuclear Information System (INIS)

    Balogh, L.; Szasz, F.; Janoki, Gy.; Zoldag, L.; Huszenicza, Gy.

    1992-01-01

    The study of the influence of labelling volume on the labelling efficiency showed decreased yield when the volume was increased. The survival rate was unchanged over 0.5 ml of reaction volume. During labelling procedure only a few cells (6%) survived in the incubation volume was less than 0.4 ml. Changing the incubation time the radiolabelling yield increased for 10 minutes, and thereafter practically did not change. The optimum conditions of sperm labelling yielded a high labelling efficiency (70-80%) and survival rate (50-60%). The 99m Tc-HM-PAO labelled sperm cells seem to be suitable to study the in vivo and in vitro sperm transport. (author) 14 refs.; 5 figs.; 2 tabs

  11. The contrast of fast fashion giants Zara, H&M and Uniqlo

    OpenAIRE

    Uriarte Elizaga, Leire

    2016-01-01

    El presente trabajo se centra en la comparación de tres grandes compañías de lo que se conoce como fast fashion o moda rápida. Estas tres compañías son la española Zara, la sueca H&M y la japonesa UNIQLO. Para ello, primero se introduce cada una de las marcas, comentando brevemente su historia para después hablar de la filosofía (misión, visión y valores) y situación financiera de cada una de ellas. A continuación se analiza el modelo de negocio que tiene cada una de las compañ...

  12. 99mTc-HM-PAO SPECT of epileptic patients showing focal paroxysm on electroencephalography

    International Nuclear Information System (INIS)

    Takaishi, Yasuko; Hashimoto, Kiyoshi; Fujino, Osamu; Kamayachi, Satoshi; Fujita, Takehisa; Enokido, Hisashi; Komatsuzaki, Hideki; Kawakami, Yasuhiko; Hirayama, Tsunenori

    1995-01-01

    The usefulness of 99m Tc-HM-PAO SPECT in diagnosing epilepsy was studied. The subjects were 33 epileptic patients, ranging in age from 5 years and 5 months to 28 years and 3 months, who showed focal paroxysm on electroencephalograms. Lowered accumulation site was found on SPECT in 19 patients. Four patients with abnormal findings on X-ray CT or MRI showed lowered accumulation and focal paroxysm at the same site. Of 29 patients with normal X-ray CT or MRI findings, 15 (52%) showed lowered accumulation. Five patients showed a focal paroxysm at the site of lowered accumulation. In 8 patients the focal paroxysm site was partly coincided with the accumulation site. In some patients the focal site predicted by the findings of clinical symptoms and the lowered accumulation site coincided. SPECT is therefore a useful method in diagnosing a focal site in epilepsy and considered to reflect the severity of disease. (Y.S.)

  13. Assessing the Influence of Fashion Clothing Advertising on Women's Consumer Behaviour in Finland; a case study of H&M

    OpenAIRE

    Hamed Abu Adab, Sari

    2012-01-01

    This study will provide a framework for analysing the current advertising and marketing patterns in women’s consumer behaviour in Finland. Swedish clothing retailer Hennes&Mauritz (H&M) was chosen as a case study since it is considered to be well-known in Finland; in 2010 average sales were astonishingly around 243million euros (H&M 2012). As this research is considered to be a broad topic, this study will focus on women in Finland aged 16-35 and above. This study will use various research m...

  14. The Relationship between Ionospheric Slab Thickness and the Peak Density Height, hmF2

    Science.gov (United States)

    Meehan, J.; Sojka, J. J.

    2017-12-01

    The electron density profile is one of the most critical elements in the ionospheric modeling-related applications today. Ionosphere parameters, hmF2, the height of the peak density layer, and slab thickness, the ratio of the total electron content, TEC, to the peak density value, NmF2, are generally obtained from any global sounding observation network and are easily incorporated into models, theoretical or empirical, as numerical representations. Slab thickness is a convenient one-parameter summary of the electron density profile and can relate a variety of elements of interest that effect the overall electron profile shape, such as the neutral and ionospheric temperatures and gradients, the ionospheric composition, and dynamics. Using ISR data from the 2002 Millstone Hill ISR data campaign, we found, for the first time, slab thickness to be correlated to hmF2. For this, we introduce a new ionospheric index, k, which ultimately relates electron density parameters and can be a very useful tool for describing the topside ionosphere shape. Our study is an initial one location, one season, 30-day study, and future work is needed to verify the robustness of our claim. Generally, the ionospheric profile shape, requires knowledge of several ionospheric parameters: electron, ion and neutral temperatures, ion composition, electric fields, and neutral winds, and is dependent upon seasons, local time, location, and the level of solar and geomagnetic activity; however, with this new index, only readily-available, ionospheric density information is needed. Such information, as used in this study, is obtained from a bottomside electron density profile provided by an ionosonde, and TEC data provided by a local, collocated GPS receiver.

  15. 75 FR 34117 - Proposed CERCLA Section 122(h) Cost Recovery Settlement for the H.M. Quackenbush, Inc. Superfund...

    Science.gov (United States)

    2010-06-16

    ... and majority shareholder of H.M. Quackenbush, Inc., to pay EPA, in nine annual installments, $225,000.00, plus interest, for EPA's past response costs incurred at the Site. The Settling Party also agrees to pay $75,000.00 pursuant to a settlement with the Village of Herkimer into an interest-bearing...

  16. Geen recht de moed te verliezen. Leven en werken van dr. H.M. de Lange (1919-2001)

    NARCIS (Netherlands)

    Witte-Rang, M.E.

    2008-01-01

    This study deals with the contribution of the Dutch economist Dr. H.M. de Lange to the ecumenical debate on social-ethics. To this end, the first part gives a description of the work of De Lange. Through the individual De Lange the study provides an insight in the worldwide ecumenical movement and

  17. Positive allosteric modulation of the human metabotropic glutamate receptor 4 (hmGluR4) by SIB-1893 and MPEP

    DEFF Research Database (Denmark)

    Mathiesen, Jesper Mosolff; Svendsen, Nannette; Bräuner-Osborne, Hans

    2003-01-01

    We have identified 2-methyl-6-(2-phenylethenyl)pyridine (SIB-1893) and 2-methyl-6-phenylethynyl pyridine hydrochloride (MPEP) as positive allosteric modulators for the hmGluR4. SIB-1893 and MPEP enhanced the potency and efficacy of L-2-amino-4-phophonobutyrate (L-AP4) in guanosine 5'-O-(3-[(35)S...

  18. HM{sup +}–RG complexes (M = group 2 metal; RG = rare gas): Physical vs. chemical interactions

    Energy Technology Data Exchange (ETDEWEB)

    Harris, Joe P.; Dodson, Hannah; Wright, Timothy G., E-mail: Tim.Wright@nottingham.ac.uk [School of Chemistry, University of Nottingham, University Park, Nottingham NG7 2RD (United Kingdom); Breckenridge, W. H. [Department of Chemistry, University of Utah, Salt Lake City, Utah 84112 (United States)

    2015-04-21

    Previous work on the HM{sup +}–He complexes (M = Be–Ra) has been extended to the cases of the heavier rare gas atoms, HM{sup +}–RG (RG = Ne–Rn). Optimized geometries and harmonic vibrational frequencies have been calculated using MP2 theory and quadruple-ζ quality basis sets. Dissociation energies for the loss of the rare gas atom have been calculated at these optimized geometries using coupled cluster with single and double excitations and perturbative triples, CCSD(T)theory, extrapolating interaction energies to the basis set limit. Comparisons are made between the present data and the previously obtained helium results, as well as to those of the bare HM{sup +} molecules; furthermore, comparisons are made to the related M{sup +}–RG and M{sup 2+}–RG complexes. Partial atomic charge analyses have also been undertaken, and these used to test a simple charge-induced dipole model. Molecular orbital diagrams are presented together with contour plots of the natural orbitals from the quadratic configuration with single and double excitations (QCISD) density. The conclusion is that the majority of these complexes are physically bound, with very little sharing of electron density; however, for M = Be, and to a lesser extent M = Mg, some evidence for chemical effects is seen in HM{sup +}–RG complexes involving RG atoms with the higher atomic numbers.

  19. Use of technetium-99m-HM-PAO in the assessment of patients with dementia and other neuropsychiatric conditions

    International Nuclear Information System (INIS)

    Smith, F.W.; Besson, J.A.; Gemmell, H.G.; Sharp, P.F.

    1988-01-01

    One hundred fourteen patients suffering from neuropsychiatric conditions have been studied using 99mTc-labeled hexamethylpropyleneamine oxime (HM-PAO) and single photon emission computed tomography (SPECT). Ninety-one patients had a firm clinical diagnosis while 23 were examined without knowledge of the clinical diagnosis. Of the 91 patients, 51 were suffering from dementia, 25 multi-infarct type and 26 Alzheimer's disease. In 19 of the Alzheimer's patients, a characteristic pattern of decreased perfusion in the parieto-occipital regions was demonstrated while those with multi-infarct type showed varying degrees of irregular uptake in the cerebral cortex. These appearances are similar to those shown with positron emission tomography (PET) and we believe that HM-PAO will provide a widely available method for identifying patients with Alzheimer's disease. Twenty-nine patients were suffering from diseases involving the basal ganglia. Fifteen patients with Parkinson's disease showed no significant abnormality in basal ganglia uptake, while 7 or 8 patients with Huntington's disease who had full examinations showed decreased uptake in the caudate nuclei. Similarly, four of six patients with other basal ganglia diseases showed impaired uptake by basal ganglia, and it is concluded that HM-PAO may be useful for the diagnosis and management of this type of patient. Twenty-three patients received HM-PAO imaging as part of their diagnostic work-up; in 19 of them, detailed follow-up was obtained, which indicated that in 7 cases the result of the HM-PAO scan altered the clinical diagnosis and in 9 cases resulted in a change in management. In the remaining 13 cases, the study was found to be helpful in confirming the diagnosis

  20. Improved Approach With Subcostal Exchange of the HeartMate II Left Ventricular Assist Device: Difference in On and Off Pump?

    Science.gov (United States)

    Gaffey, Ann C; Chen, Carol W; Chung, Jennifer J; Phillips, Emily; Wald, Joyce; Williams, Matthew L; Low, David W; Acker, Michael A; Atluri, Pavan

    2017-11-01

    The HeartMate II (St. Jude Medical, Inc, St. Paul, MN [previously Thoratec]) left ventricular assist device (LVAD) exchange has traditionally involved a redo sternotomy. Alternate minimally invasive subcostal approaches have the advantage of avoiding sternal reentry, excessive bleeding, and prolonged recovery. This retrospective review included patients who underwent an exchange from May 2009 to March 2016. The patients were divided into three cohorts: (1) redo sternotomy, (2) subcostal approach involving cardiopulmonary bypass (CPB) (ON-CPB SC), and (3) subcostal approach off the CPB pump (OFF-CPB SC). Data pertaining to patients' baseline characteristics and outcomes were collected and analyzed. From May 1, 2009 to July 31, 2016, 33 HeartMate II LVAD exchanges were performed. There were 11 redo sternotomies and 22 subcostal exchanges, 12 of which were in the OFF-CPB SC group. There was no significant difference among the groups in terms of age (p = 0.75), sex (p = 0.95), and indication for exchange (p = 0.94). There was a higher red blood cell transfusion requirement within the sternotomy cohort (p rates were equivalent among the cohorts. Exchange of the HeartMate II LVAD can be accomplished with significantly improved recovery time and transfusion requirement through a less invasive subcostal approach when compared with sternotomy. The subcostal approach can be performed safely both on and off cardiopulmonary bypass. Copyright © 2017 The Society of Thoracic Surgeons. Published by Elsevier Inc. All rights reserved.

  1. Single-cell 5hmC sequencing reveals chromosome-wide cell-to-cell variability and enables lineage reconstruction

    NARCIS (Netherlands)

    Mooijman, Dylan; Dey, Siddharth S; Boisset, Jean-Charles; Crosetto, Nicola; van Oudenaarden, Alexander

    2016-01-01

    The epigenetic DNA modification 5-hydroxymethylcytosine (5hmC) has crucial roles in development and gene regulation. Quantifying the abundance of this epigenetic mark at the single-cell level could enable us to understand its roles. We present a single-cell, genome-wide and strand-specific 5hmC

  2. SPECT with [99mTc]-d,l-hexamethyl-propylene amine oxime (HM-PAO) compared with regional cerebral blood flow measured by PET

    DEFF Research Database (Denmark)

    Yonekura, Y; Nishizawa, S; Mukai, Thomas Søgaard

    1988-01-01

    In order to validate the use of technetium-99m-d,l-hexamethylpropyleneamine oxime (HM-PAO) as a flow tracer, a total of 21 cases were studied with single photon emission computerized tomography (SPECT), and compared to regional cerebral blood flow (rCBF) measured by position emission tomography...... (PET) using the oxygen-15 CO2 inhalation technique. Although HM-PAO SPECT and rCBF PET images showed a similar distribution pattern the HM-PAO SPECT image showed less contrast between high and low activity flow regions than the rCBF image and a nonlinear relationship between HM-PAO activity and r......CBF was shown. Based on the assumption of flow-dependent backdiffusion of HM-PAO from the brain, we applied a "linearization algorithm" to correct the HM-PAO SPECT images. The corrected HM-PAO SPECT images revealed a good linear correlation with rCBF (r = 0.901, p less than 0.001). The results indicated HM-PAO...

  3. Normal Control Study of Cerebral Blood Flow by 99mTc HM-PAO SPECT

    International Nuclear Information System (INIS)

    Koong, Sung Soo; Moon, Dae Hyuk; Lee, Bum Woo; Lee, Kyung Han

    1989-01-01

    Regional cerebral perfusion was evaluated in 15 normal controls by single photon emission computed tomography using 99m Tc HM-PAO. For quantitative analysis, 13 pairs of homologous region of interest (ROI) were drawn on three transverse slices matching the vascular territories and cerebral cortices, and normal values of 3 semiquantitative indices including 'Right to left ratio' (R/L ratio), 'Regional index' (RI), and 'Region to cerebellum ratio (R/cbll ratio) were calculated. Mean values of R/L ratios of homologous regions were ranged from 0.985 to 1.023, and mean ± 2 s.d. of all regions did not exceed 11% of mean. Significant difference of Rls (mean count per voxel of a ROI/mean count per voxel of total ROls) between regions were found (p<0.001) with highest values in occipital cortex and cerebellum. After attenuation correction, Rls in deep gray, cranial portion of anterior cerebral artery and vascular territories in the 2nd slice increased significantly (p<0.05-0.001) hut vise versa in other ROIs. Region to cerebellum ratios also showed regional difference similar to Rls.

  4. [/sup 99m/Tc]-HM-PAO SPECT in Parkinson's disease

    International Nuclear Information System (INIS)

    Pizzolato, G.; Dam, M.; Borsato, N.; Saitta, B.; Da Col, C.; Perlotto, N.; Zanco, P.; Ferlin, G.; Battistin, L.

    1988-01-01

    Thirty-six patients affected by Parkinson's disease were studied using single photon emission computed tomography (SPECT) and [/sup 99m/Tc]-HM-PAO as a tracer. The scanning procedure was performed 16-24 h after discontinuation of specific therapy. Tracer activity ratios were determined in 10 pairs of cerebellar, cortical, and subcortical regions. Data were compared with those of 10 age-matched controls. Most of the regions examined did not show any relevant change between parkinsonian and control subjects. Notably, mean activity in striatal regions were similar in the two groups. Increased activity in caudate-putamen was found in patients who were on chronic DOPA therapy. Side-to-side asymmetries in the basal ganglia increased with the severity of the disease. Significant reductions of tracer uptake, from control values, were observed bilaterally in the parietal cortex. These deficits were more pronounced in patients with mental deterioration and in subjects who had been chronically treated with anticholinergic drugs. Parietal perfusion deficits in parkinsonian patients resemble those described in Alzheimer's dementia. These findings suggest that the heterogeneous alterations of regional cerebral blood flow (rCBF) in parkinsonian patients reflect the multifactorial pathophysiology of the disease

  5. SPET with sup 99m Tc-HM PAO in the study of classic migraine. La SPET con sup 99m Tc-HM PAO nello studio dell'emicrania classica

    Energy Technology Data Exchange (ETDEWEB)

    Stiglich, F; Bonomo, F; Barbonetti, C; Di Lorenzo, I; Bottinelli, G [Ospedale Civile, Sondrio (Italy). Div. di Medicina Nucleare e Radioterapia; Tomaiolo, S [Ospedale Civile, Sondrio (Italy). Div. di Neurologia; Campani, R; Bottinelli, O [Pavia Univ. (Italy). Ist. di Radiologia

    1991-01-01

    Five patients presenting with migraine attacks underwent Electroencephalography (EEC), Computed Tomography (CT) and Single Photon Emission Tomography (SPET) with {sup 99m}Tc-HM PAO. EEG qand SPET were subsequently repeated in the intercritical period. We observed that two patients only showed non-specific abnormalities in EEG; scans were in all patients; all subjects exhibited diffuse cortical hypoperfusion. A strong correlation was always found between clinical presentation and hemispheric impairment. One patient exhibited asymmetrical perfusion between cerebellum hemispheres; intercritical SPET showed homogeneous distrubution of the radio-tracer in 4 patients. In the last one minimal residual hypoperfusion was observed, although less marked than in the acute phase. Therefore SPET with {sup 99m}Tc-HM PAO can be reasonably employed as the examination of choice when a migrain attack is clinically suspected, because of its reproducibility and reliability. It can be easily performed in every nuclear medical center supplied with modern tomographic cameras.

  6. Quantitative measurement of regional cerebral blood flow using {sup 99m}Tc-HM-PAO SPECT

    Energy Technology Data Exchange (ETDEWEB)

    Tanaka, Hisashi; Nakamura, Yusaku; Yagi, Yuji; Miura, Kosuke; Takahashi, Mitsuo [Kinki Univ., Osaka-Sayama, Osaka (Japan)

    1994-10-01

    This study examined a simple method for measuring the regional cerebral blood flow (rCBF) using {sup 99m}Tc-HM-PAO SPECT. The mean CBF (mCBF) was determined by the Patlack plot method and rCBF was calculated with Lassen`s correction algorithm, as reported by Matsuda et al. The cerebral hemisphere was employed as the reference region for Lassen`s correction. The reference RI count rate was calculated from the left cerebral hemisphere at the basal ganglia level and the correction factor {alpha} was fixed at 2.0. As a result, rCBF could be measured more easily than by Matsuda`s method. The contribution of age, laterality and gender to the CBF of normal subjects were studied. The mCBF value of 26 normal subjects was 53.8{+-}6.4 ml/100 g/min and showed a significant correlation with advancing age (R=0.644, p=0.0004, n=26). The mean values for rCBF of the cerebellum, frontal area, temporal area, occipital area and parietal area were 77.3{+-}6.6 ml/100 g/min, 70.2{+-}9.1 ml/100 g/min, 72.3{+-}7.5 ml/100 g/min, 71.8{+-}6.2 ml/100 g/min and 73.8{+-}8.6 ml/100 g/min, respectively. There were no gender or laterality differences in the mCBF or respective rCBF values. Each of the above listed regions, except for the occipital area, demonstrated a significant correlation with advancing age. The most remarkable decrease in rCBF with age was noted in the frontal area (R=0.757, p=0.001, n=26). (author).

  7. Quantitative measurement of regional cerebral blood flow using 99mTc-HM-PAO SPECT

    International Nuclear Information System (INIS)

    Tanaka, Hisashi; Nakamura, Yusaku; Yagi, Yuji; Miura, Kosuke; Takahashi, Mitsuo

    1994-01-01

    This study examined a simple method for measuring the regional cerebral blood flow (rCBF) using 99m Tc-HM-PAO SPECT. The mean CBF (mCBF) was determined by the Patlack plot method and rCBF was calculated with Lassen's correction algorithm, as reported by Matsuda et al. The cerebral hemisphere was employed as the reference region for Lassen's correction. The reference RI count rate was calculated from the left cerebral hemisphere at the basal ganglia level and the correction factor α was fixed at 2.0. As a result, rCBF could be measured more easily than by Matsuda's method. The contribution of age, laterality and gender to the CBF of normal subjects were studied. The mCBF value of 26 normal subjects was 53.8±6.4 ml/100 g/min and showed a significant correlation with advancing age (R=0.644, p=0.0004, n=26). The mean values for rCBF of the cerebellum, frontal area, temporal area, occipital area and parietal area were 77.3±6.6 ml/100 g/min, 70.2±9.1 ml/100 g/min, 72.3±7.5 ml/100 g/min, 71.8±6.2 ml/100 g/min and 73.8±8.6 ml/100 g/min, respectively. There were no gender or laterality differences in the mCBF or respective rCBF values. Each of the above listed regions, except for the occipital area, demonstrated a significant correlation with advancing age. The most remarkable decrease in rCBF with age was noted in the frontal area (R=0.757, p=0.001, n=26). (author)

  8. E072/ST-HM - A dynamic maintenance strategie to meet the requirements of the LHC installation

    OpenAIRE

    Böttcher, O

    2003-01-01

    The new ST-HM contract E072 for the maintenance of transport and handling equipment is designed to obtain the high operating reliability as required for the LHC installation and to respect the situation of limited resources at CERN at the same time. The contract is based on a dynamic maintenance strategy. It contains a flexible maintenance contingent that is essential to prepare the equipment for extremely important and critical utilization phases that will come up during the LHC installation...

  9. Is green the new black? : the impact of sustainability on brand : Conscious Fashion, a case study on H&M

    OpenAIRE

    Ehrsam, Melanie Michelle

    2016-01-01

    The fast-fashion industry has been criticized along the years for its lack of environmental and social ethics. In this frame we find H&M, the world’s second largest fashion retailer. The Swedish fast-fashion retailer has set its goal towards making fashion sustainable and has launched in 2011 its sustainable clothing line “Conscious”. The present dissertation aims to discover the potential of sustainable fashion in changing consumers’ attitude towards the brand. For this matter...

  10. Studies for labelling of leukocytes with sup 99m Tc-HM-PAO in vitro and animal experiments

    Energy Technology Data Exchange (ETDEWEB)

    Zhaoxiang, Gu; Xiangtong, Lin [Shanghai Medical Univ. (China). Huashan Hospital

    1989-05-01

    A technigue for in vitro labelling of human leukocytes with {sup 99m}Tc-HM-PAO is described. The percentage of labelled leukocytes is 43.0 +- 5.0 (mean +- SD, n = 6). Cell function was not impaired by the labelling procedure. Sterility and exclusion of bacterial endotoxins in the final cell suspensions were demonstrated. In experiments on dogs with abscess, scintigraphic imaging showed accumulation of radioactivity in inflammation lesions, indicating the viability of the labelled leukocytes.

  11. The class characteristic mark of the H&M Mul-T-Lock picking tool in toolmarks examination.

    Science.gov (United States)

    Volkov, Nikolai; Finkelstein, Nir; Novoselsky, Yehuda; Tsach, Tsadok

    2014-07-01

    Mul-T-Lock is a high security lock cylinder distinguished by the use of a telescoping "pin-in-pin"-tumbler design. Picking the Mul-T-Lock cylinder with a traditional picking tool is highly complicated because it can get stuck between the inner and outer pins. The H&M Mul-T-Lock picking tool was designed to overcome this problem and facilitate the picking of the "pin-in-pin" cylinder. The purpose of this research is to determine whether H&M Mul-T-Lock picking tool leaves class characteristic mark and whether it can be distinguished from traditional picking tools marks and from regular key marks. It also describes and determines the class characteristic mark left on telescopic pins, its origin, recurrence, and its benefit to the toolmarks examiner. When receiving a Mul-T-Lock from a crime scene, a toolmarks examiner can quickly determine whether or not it was picked by an H&M Mul-T-Lock picking tool by noticing the class characteristic mark which this typical tool leaves. © 2014 American Academy of Forensic Sciences.

  12. Special applications of [sup 99m]Tc-HM-PAO SPECT in the evaluation of cerebral hemodynamics

    Energy Technology Data Exchange (ETDEWEB)

    Kobayashi, Shigeki; Kageyama, Yuhsuke (Chiba Emergency Medical Center (Japan)); Namba, Hiroki (and others)

    1991-12-01

    [sup 99m]Tc-HM-PAO has been widely used as a brain-perfusion tracer. It is known that this lipophilic tracer crosses the blood-brain barrier with a high-pass extraction fraction, is deposited in the brain proportional to the cerebral blood flow, and shows a nearly constant maintenance of the regional distribution over several hours. Taking advantage of these characteristics of the tracer, we evaluated changes in the cerebral blood flow before and after recanalization therapy in the acute stage of stroke. Recent advances in catheterization technique have made it possible to introduce a catheter superselectively into smaller cerebral vessels, such as anterior, middle, and posterior cerebral arteries and external carotid artery branches. We ourselves evaluated the areas and concentrations of anti-cancer agents by injecting HM-PAO through the microcatheter used for superselective intra-arterial chemotherapy. We also visualized the areas supplied by the grafted vessels after bypass surgery for ischemic cerebrovascular diseases by the superselective infusion of HM-PAO. We found these techniques to be useful in clinical neurosurgery. (author).

  13. Benchmark on hydrogen distribution in a containment based on the OECD-NEA THAI HM-2 experiment

    International Nuclear Information System (INIS)

    Schwarz, S.; Fischer, K.; Bentaib, A.

    2009-01-01

    Within the course of a hypothetical severe accident in a nuclear power plant, hydrogen can be generated in the primary circuit and released into the containment. Considering the possibility of a deflagration, the simulation of the hydrogen distribution in the containment by computer codes is of major importance. In order to create a data base for code validation, several distribution experiments using helium and hydrogen have been performed in the German THAI (Thermal-Hydraulics, Hydrogen, Aerosols, Iodine) facility. They started with the ISP-47 test TH13 and were followed by the HM (Hydrogen-Helium Material Scaling Tests) series. The objectives of the HM Tests are to confirm the transferability of existing helium distribution test data to hydrogen distribution problems, to understand the processes that lead to the formation and dissolution of a light cloud stratification. The test HM-2 was chosen for a code benchmark. During the first phase of test HM-2 a light gas cloud consisting of hydrogen and nitrogen was established in the upper half of the facility. In the second phase steam was injected at a lower position inducing a rising steam - nitrogen plume. The plume did not break through the cloud, because its density was higher than the density of the cloud. Therefore the cloud was gradually dissolved from its bottom. Eleven organisations performed 'blind' calculations to the HM-2 experiment. The lumped parameter (LP) codes ASTEC, COCOSYS and MELCOR and the CFD codes FLUENT, GASFLOW and GOTHIC were used. The main phenomena were natural convection, interaction between the rising plume and the light gas cloud, steam condensation on walls, fog behaviour and the heat up of the walls. The experimental data of the first phase had been published and the atmospheric stratification was simulated reasonably well. The data from the second phase stayed concealed until the simulated results were submitted. The thermal-hydraulic phenomena were predicted well by several LP- and

  14. Ton H.M. van Schaik and Karin Strengers-Olde Kalter, Het Arme Roomse Leven. Geschiedenis van de katholieke caritas in de stad Utrecht

    Directory of Open Access Journals (Sweden)

    Joost van Genabeek

    2017-07-01

    Full Text Available Ton H.M. van Schaik and Karin Strengers-Olde Kalter, Het Arme Roomse Leven. Geschiedenis van de katholieke caritas in de stad Utrecht (Hilversum: Verloren, 2016, 276 pp., isbn 978 90 8704 578 4.

  15. Role of SPECT (HM-PAO, Tc99mRc) and ultrasound (TCD) in the instrumental diagnostic approach to the comprehension of reversible ischemic symptoms

    International Nuclear Information System (INIS)

    Liboni, W.; Baggiore, P.; Chianale, G.; Marta, G.; Castellano, G.; Cornaglia, G.

    1989-01-01

    The relation between variations of cerebral and acute neurologic events, followed by partial or total recovery, has been investigated with SPECT HM-PAO and with ultrasound (TRANSCRANIAL DOPPLER). (H.W.). 3 refs.; 2 figs.; 2 tabs

  16. Interaction of HmC1q with leech microglial cells: involvement of C1qBP-related molecule in the induction of cell chemotaxis

    Directory of Open Access Journals (Sweden)

    Tahtouh Muriel

    2012-02-01

    Full Text Available Abstract Background In invertebrates, the medicinal leech is considered to be an interesting and appropriate model to study neuroimmune mechanisms. Indeed, this non-vertebrate animal can restore normal function of its central nervous system (CNS after injury. Microglia accumulation at the damage site has been shown to be required for axon sprouting and for efficient regeneration. We characterized HmC1q as a novel chemotactic factor for leech microglial cell recruitment. In mammals, a C1q-binding protein (C1qBP alias gC1qR, which interacts with the globular head of C1q, has been reported to participate in C1q-mediated chemotaxis of blood immune cells. In this study, we evaluated the chemotactic activities of a recombinant form of HmC1q and its interaction with a newly characterized leech C1qBP that acts as its potential ligand. Methods Recombinant HmC1q (rHmC1q was produced in the yeast Pichia pastoris. Chemotaxis assays were performed to investigate rHmC1q-dependent microglia migration. The involvement of a C1qBP-related molecule in this chemotaxis mechanism was assessed by flow cytometry and with affinity purification experiments. The cellular localization of C1qBP mRNA and protein in leech was investigated using immunohistochemistry and in situ hybridization techniques. Results rHmC1q-stimulated microglia migrate in a dose-dependent manner. This rHmC1q-induced chemotaxis was reduced when cells were preincubated with either anti-HmC1q or anti-human C1qBP antibodies. A C1qBP-related molecule was characterized in leech microglia. Conclusions A previous study showed that recruitment of microglia is observed after HmC1q release at the cut end of axons. Here, we demonstrate that rHmC1q-dependent chemotaxis might be driven via a HmC1q-binding protein located on the microglial cell surface. Taken together, these results highlight the importance of the interaction between C1q and C1qBP in microglial activation leading to nerve repair in the medicinal

  17. Interaction of HmC1q with leech microglial cells: involvement of C1qBP-related molecule in the induction of cell chemotaxis.

    Science.gov (United States)

    Tahtouh, Muriel; Garçon-Bocquet, Annelise; Croq, Françoise; Vizioli, Jacopo; Sautière, Pierre-Eric; Van Camp, Christelle; Salzet, Michel; Nagnan-le Meillour, Patricia; Pestel, Joël; Lefebvre, Christophe

    2012-02-22

    In invertebrates, the medicinal leech is considered to be an interesting and appropriate model to study neuroimmune mechanisms. Indeed, this non-vertebrate animal can restore normal function of its central nervous system (CNS) after injury. Microglia accumulation at the damage site has been shown to be required for axon sprouting and for efficient regeneration. We characterized HmC1q as a novel chemotactic factor for leech microglial cell recruitment. In mammals, a C1q-binding protein (C1qBP alias gC1qR), which interacts with the globular head of C1q, has been reported to participate in C1q-mediated chemotaxis of blood immune cells. In this study, we evaluated the chemotactic activities of a recombinant form of HmC1q and its interaction with a newly characterized leech C1qBP that acts as its potential ligand. Recombinant HmC1q (rHmC1q) was produced in the yeast Pichia pastoris. Chemotaxis assays were performed to investigate rHmC1q-dependent microglia migration. The involvement of a C1qBP-related molecule in this chemotaxis mechanism was assessed by flow cytometry and with affinity purification experiments. The cellular localization of C1qBP mRNA and protein in leech was investigated using immunohistochemistry and in situ hybridization techniques. rHmC1q-stimulated microglia migrate in a dose-dependent manner. This rHmC1q-induced chemotaxis was reduced when cells were preincubated with either anti-HmC1q or anti-human C1qBP antibodies. A C1qBP-related molecule was characterized in leech microglia. A previous study showed that recruitment of microglia is observed after HmC1q release at the cut end of axons. Here, we demonstrate that rHmC1q-dependent chemotaxis might be driven via a HmC1q-binding protein located on the microglial cell surface. Taken together, these results highlight the importance of the interaction between C1q and C1qBP in microglial activation leading to nerve repair in the medicinal leech.

  18. Evaluation of [sup 99m]Tc-HM-PAO thigh accumulation in patients with cerebro-vascular disease

    Energy Technology Data Exchange (ETDEWEB)

    Nishigaki, Hiroshi; Adachi, Itaru; Komori, Tsuyoshi; Tatsu, Yoshimitsu; Hisada, Youichi; Sueyoshi, Kouzou; Narabayashi, Isamu (Osaka Medical College, Takatsuki (Japan))

    1993-06-01

    Technetium-99m d,l-hexamethyl-propyleneamine oxime ([sup 99m]Tc-HM-PAO) cerebral SPECT and whole body scintigraphy (WBS) were performed in 5 patients without cerebro-vascular disease (CVD) (Group 1), 31 patients with CVD but not hemiparesis (Group 2) and 18 patients with CVD and hemiparesis (Group 3). Four ROIs were drawn manually around the whole body (WB), brain (Br), right and left thigh (Th). We calculated some ratios: the total counts in the brain over the total counts in the whole body (Br/WB), the total counts in the thigh over the total counts in the whole body (Th/WB) and the mean counts in the thigh over the mean counts in the brain (Th/Br).The Br/WB was 6.9[+-]1.8%, rt-Th/WB was 4.9[+-]2.1%, lt-Th/WB was 5.1[+-]1.3% and Th/Br was 0.46[+-]0.17 in group 1. Whole body scintigraphies in group 1 revealed clear and similar images between right and left thigh. The Br/WB was 6.7[+-]1.4%, Th/WB of paretic side was 4.6[+-]1.0%, Th/WB of non-paretic side was 5.8[+-]1.2% and Th/Br was 0.47[+-]0.18 in group 3. The Th/WB in non paretic side was significantly higher than that in paretic side (p<0.01). The thigh images in group 3 revealed clear differences between paretic and non-paretic thighes. In conclusion we could acquire the clear thigh images with [sup 99m]Tc-HM-PAO. It was possible that we evaluated not only cerebral perfusion but also muscle atrophy and/or perfusion in patients with CVD using [sup 99m]Tc-HM-PAO. (author).

  19. Evaluation of 99mTc-HM-PAO thigh accumulation in patients with cerebro-vascular disease

    International Nuclear Information System (INIS)

    Nishigaki, Hiroshi; Adachi, Itaru; Komori, Tsuyoshi; Tatsu, Yoshimitsu; Hisada, Youichi; Sueyoshi, Kouzou; Narabayashi, Isamu

    1993-01-01

    Technetium-99m d,l-hexamethyl-propyleneamine oxime ( 99m Tc-HM-PAO) cerebral SPECT and whole body scintigraphy (WBS) were performed in 5 patients without cerebro-vascular disease (CVD) (Group 1), 31 patients with CVD but not hemiparesis (Group 2) and 18 patients with CVD and hemiparesis (Group 3). Four ROIs were drawn manually around the whole body (WB), brain (Br), right and left thigh (Th). We calculated some ratios: the total counts in the brain over the total counts in the whole body (Br/WB), the total counts in the thigh over the total counts in the whole body (Th/WB) and the mean counts in the thigh over the mean counts in the brain (Th/Br). The Br/WB was 6.9±1.8%, rt-Th/WB was 4.9±2.1%, lt-Th/WB was 5.1±1.3% and Th/Br was 0.46±0.17 in group 1. Whole body scintigraphies in group 1 revealed clear and similar images between right and left thigh. The Br/WB was 6.7±1.4%, Th/WB of paretic side was 4.6±1.0%, Th/WB of non-paretic side was 5.8±1.2% and Th/Br was 0.47±0.18 in group 3. The Th/WB in non paretic side was significantly higher than that in paretic side (p 99m Tc-HM-PAO. It was possible that we evaluated not only cerebral perfusion but also muscle atrophy and/or perfusion in patients with CVD using 99m Tc-HM-PAO. (author)

  20. Single photon emission tomography using sup(99m)Tc-HM-PAO in the investigation of dementia

    Energy Technology Data Exchange (ETDEWEB)

    Neary, D; Snowden, J S; Shields, R A; Burjan, A W.I.; Northen, B; Macdermott, N; Prescott, M C; Testa, H J

    1987-09-01

    Single photon emission tomographic imaging of the brain using sup(99m)Tc HM-PAO was carried out in patients with a clinical diagnosis of Alzheimer's disease, non-Alzheimer frontal-lobe dementia, and progressive supranuclear palsy. Independent assessment of reductions in uptake revealed posterior hemisphere abnormalities in the majority of the Alzheimer group, and selective anterior hemisphere abnormalities in both other groups. The findings were consistent with observed patterns of mental impairment. The imaging technique has potential value in the differential diagnosis of primary cerebral atrophy.

  1. Assessment of the arterial input curve for [99mTc]-d,l-HM-PAO by rapid octanol extraction

    DEFF Research Database (Denmark)

    Andersen, A R; Friberg, H; Lassen, N A

    1988-01-01

    The in vitro conversion of the lipophilic molecule [99mTc]-d,l-hexamethylpropyleneamine oxime [( 99mTc]-d,l-HM-PAO) to a hydrophilic form was studied in saline, plasma, and blood at 37 degrees C by paper chromatography and by octanol extraction. The octanol:saline ratio was 79.9. From this value...... and the corresponding octanol: plasma and octanol:blood partitioning values, an estimate of the transport of the lipophilic compound by various components of blood was made: 20% is carried in hemoglobin, 53% by the plasma proteins and 27% by the water phases of the red blood cell and plasma. Octanol extraction provided...

  2. Sandvik's HM 150 roller in action on the world's largest conveyor bridge in the Lusatia region; Sandvik HM 150 auf der weltgroessten Foerderbruecke in der Lausitz im Einsatz

    Energy Technology Data Exchange (ETDEWEB)

    Waliczek, Sven; Raddatz, Ulrich [Sandvik Mining and Construction Central Europe GmbH, Essen (Germany)

    2010-09-15

    Prince Herrmann Ludwig Heinrich von Pueckler-Muskau, a landscape gardening genius, built the Muskau Park in the Lusatia region in 1817 - it is part of a UNESCO world heritage site today. In the same era, 1850, the first lignite was mined in the region and still today, Vattenfall, the Swedish company, extracts lignite without subsidies - in Jaenschwalde among other places, one out of the five opencast mines currently in operation. As one of the largest employers and apprenticing companies in East Germany, Vattenfall currently employs almost 8000 employees and about 800 apprentices. Sandvik Mining and Construction also plays a leading role - in the literal sense. At the Jaenschwalde location there are 320 sets of 5-roller garlands of HM150 formed rollers in action on the overburden conveyor bridge AFB 60m (Figure 1) - on belt five, the main belt conveyor (belt type 3000 ST3000-18:8, idler spacing approx. 800 mm) and on belt eight, the stockpile belt conveyor (belt type 2750 ST2500-18:8, idler spacing approx. 800 mm). It all began in the spring of 2004. Bernhard Hofmayer, Production Manager at Sandvik, introduced the HM150 formed roller to Vattenfall. The engineers were impressed by the completely new design and the innovative assembly technique. The discussion about the advantages and disadvantages of the component optimised formed roller were ready to begin. (orig.)

  3. Analysis Of Factors Causing Delays On Harun Nafsi - Hm Rifadin Street In Samarinda East Kalimantan Maintenance Project

    Directory of Open Access Journals (Sweden)

    Fadli

    2017-12-01

    Full Text Available This study aims to identify analyze and describe the factors that affect the project maintenance delay on Harun Nafsi - HM. Rifadin Street in Samarinda East Kalimantan. This research uses qualitative research method by utilizing questionnaires. The 30 participating respondents consist of 14 project implementers and 16 field implementers. The data are analyzed by descriptive statistical technique factor analysis and linear regression analysis. The results show that the factors influencing the delay of maintenance project of Harun Nafis - HM Rifadin Street include 1 time factor and workmanship factor 2 human resources and natural factors 3 geographical conditions late approval plans change and labor strikes and 4 non-optimal working levels and changes in the scope of the project during the work are still ongoing. Based on multiple linear regression analysis coefficient of determination value of 0.824 is obtained. It means that the four factors studied affect 82.4 of project delays and the rest of 27.6 is influenced by other variables out of this study. The results of this study also indicate that the dominant factor for road maintenance project delays is the fourth factor of the factors mentioned. The effort that the contractor needs to undertake is not to expand the employment contract if the project is underway or the contractor does not have the capability to complete another project.

  4. 99mTc-ECD and 99mTc-HM-PAO SPECT in five patients with MELAS

    International Nuclear Information System (INIS)

    Katagiri, Shinako; Nishimaki, Hiroshi; Kitano, Masashi; Horiike, Shigeharu; Kan, Shinichi; Ishii, Katsumi; Matsubayashi, Takashi; Sakai, Fumihiko

    1998-01-01

    Cerebral perfusion was studied in five patients with mitochondrial encephalomyopathy with lactic acidosis and stroke-like episodes syndrome (MELAS), using single photon emission computed tomography (SPECT) with 99m Tc-ethyl cysteinate dimer ( 99m Tc-ECD) or 99m Tc-hexamethyl propyleneamine oxime ( 99m Tc-HM-PAO). In four cases, regional cerebral blood flow (rCBF) was evaluated by the method reported by Mastuda et al. Immediately after the stroke-like episodes, accumulation of the tracer was relatively increased in the temporooccipital lobe, and also increased rCBF was shown in the same area. However, the region showed decreased radioactivity at the chronic stage, and rCBF decreased also. These findings are consistent with positron emission tomography (PET) at the acute stage and autopsy. 99m Tc-ECD SPECT and 99m Tc-HM-PAO SPECT may be useful in the diagnosis and assessment of the progress of the MELAS. (author)

  5. Comparison of Tc-99m HM-PAO SPECT brain scan and x-ray CT in the detection of brain metastases

    International Nuclear Information System (INIS)

    Abdel-Dayem, H.M.; Sadek, S.; Sahwell, A.; Kubasek, H.; El-Sayed, M.; Ziada, G.; Mobarak, L.; Al-Huda, F.; Omar, Y.T.

    1986-01-01

    Tc-99m HM-PAO imaging was compared with x-ray CT in 14 patients with known or suspected brain metastases. Both studies were done within 3 days of each other. Static and single photon emission CT (SPECT) images were acquired after intravenous injection of 13 mCi of Tc-99m HM-PAO. All 14 patients underwent static and SPECT Tc-99m HM-PAO imaging and x-ray CT. Studies were positive in 7, 12, and 10 patients, respectively, by static, SPECT, and x-ray CT imaging, and negative in 7, 2, and 2. The number of lesions identified was 0 (static imaging), 32 (SPECT), and 26(x-ray CT). There were no ''suspicious'' studies by any modality. This study indicates that Tc-99m HM-PAO SPECT cerebral blood flow imaging is more sensitive than x-ray CT for detecting brain metastases, that biplane imaging is not sensitive and SPECT is essential, and that for Tc-99m HM-PAO SPECT brain imaging to regain its importance with respect to x-ray CT, acquisition time must be 10 minutes or less and determination of percentage brain uptake of the injected dose, and of regional distribution, is necessary

  6. Epigenomic Co-localization and Co-evolution Reveal a Key Role for 5hmC as a Communication Hub in the Chromatin Network of ESCs

    Directory of Open Access Journals (Sweden)

    David Juan

    2016-02-01

    Full Text Available Summary: Epigenetic communication through histone and cytosine modifications is essential for gene regulation and cell identity. Here, we propose a framework that is based on a chromatin communication model to get insight on the function of epigenetic modifications in ESCs. The epigenetic communication network was inferred from genome-wide location data plus extensive manual annotation. Notably, we found that 5-hydroxymethylcytosine (5hmC is the most-influential hub of this network, connecting DNA demethylation to nucleosome remodeling complexes and to key transcription factors of pluripotency. Moreover, an evolutionary analysis revealed a central role of 5hmC in the co-evolution of chromatin-related proteins. Further analysis of regions where 5hmC co-localizes with specific interactors shows that each interaction points to chromatin remodeling, stemness, differentiation, or metabolism. Our results highlight the importance of cytosine modifications in the epigenetic communication of ESCs. : 5-hydroxymethylcytosine (5hmC plays a key role in the epigenomic communication network of embryonic stem cells. Juan et al. build a communication network based in co-localization of epigenomic data and literature. The analysis of the network and its components reveals that proteins reading and editing 5hmC co-evolve and serve as links between diverse molecular processes.

  7. Contributions for Repositioning a Regional Strategy for Healthy Municipalities, Cities and Communities (HM&C): Results of a Pan-American Survey

    Science.gov (United States)

    Rice, Marilyn; Vizzotti, Carlos; Frassia, Romina; Vizzotti, Pablo; Akerman, Marco

    2010-01-01

    This article presents the results of the 1st Regional Survey of Healthy Municipalities, Cities and Communities (HM&C) carried out in 2008 by the Pan American Health Organization (PAHO) and ISALUD University of Argentina. It discusses the responses obtained from 12 countries in the Americas Region. Key informants in Argentina, Brazil, Chile, Colombia, Costa Rica, Cuba, Mexico, Paraguay, Peru, and Uruguay were selected and encouraged to answer the survey, while informants from Canada and Honduras answered voluntarily and were included in this analysis. The discussion of the results of the Survey provides insight into the current status of HM&C in the Region and suggests key topics for repositioning the Regional strategy relative to: (1) the conceptual identity and tools for HM&C; (2) challenging areas in the implementation process (scale, legal framework, and development of capacities); (3) related strategies and participatory processes such as the ways citizen empowerment in governance is supported; (4) the need to monitor and assess the impact of the HM&C strategy on the health and quality of life of the populations involved; and (5) the need for developing a strategic research and training agenda. The analysis and discussion of these results aims to provide useful input for repositioning the strategy in the Region and contributing to the emergence of a second generation of concepts and tools capable of meeting the developing priorities and needs currently faced by the HM&C strategy. PMID:20532989

  8. Coupled HM modelling of the mine-by test at Meuse-Haute-Marne (MHM) URL France

    International Nuclear Information System (INIS)

    Yildizdag, K.; Shao, H.; Hesser, J.; Soennke, J.; Noiret, A.

    2012-01-01

    Document available in extended abstract form only. In order to test the feasibility of disposing High-Level and Long-Lived Wastes (HLW-LL) in Callovo- Oxfordian clay formation (COx), the French National Radioactive Waste Management Agency (ANDRA) has carried out scientific and engineering investigations in the Meuse-Haute-Marne Underground Research Laboratory (URL) since November 1999. The COx (Figure 1) is of a special interest because of its very favourable characteristics for being a possible host rock for the disposal of radioactive waste. The project OHZ (Observation and Monitoring of the EDZ) was initiated in 2008 by ANDRA. In the framework of this project, a Mine-by experiment was performed in the niche GCS. The excavation was started on 29.01.2008. Displacement and pore pressure evolution during the excavation was measured by different sensors. Within the cooperation between BGR and ANDRA numerical calculations have been done using the code RockFlow to understand the hydraulic and mechanical (HM) coupling mechanisms of Callovo-Oxfordian clay-stone observed during the Mine-by experiment. Modelling results: With regard to the bedding of COx a transverse isotropy approach was applied. Thus the anisotropy effects caused by the bedding have been considered in coupled HM models (Massmann, 2009). Intensive parameter studies in comparison with measured deformation and pore pressure data have been conducted to reduce modelling uncertainties. Fully saturated models yield very precise results in the far field wherein excavation effect has its lower impact. Rapid decline of pore pressure and continuously increasing deformation subsequent to excavation in the near field could not be interpreted even taking shrinkage and partially saturation into consideration. During the Mine-by test, overpressures on sidewalls and reduced pressures on roof and floor were measured due to the mechanical effect on pore pressure which is induced by the bedding. Good agreement between

  9. Die etiek van HM Kuitert na aanleiding van sy boek Suicide - wat is er tegen? Selfdoding in moreel perspectief

    Directory of Open Access Journals (Sweden)

    R. M. Naudé

    1988-01-01

    Full Text Available The ethics of HM Kuitert according to his book entitled. Suicide - wat is er tegen? Selfdoding in moreel perspektief According to several publications Kuitert is criticised as a humanist. This paper tests his view on suicide to this accusation. It is found that Kuitert accepts teleology and solidarity as norms for his ethics and uses it as a method for his arguments against suicide. His goal is to offer an ethic which is acceptable for the Christian and the non-Christian. This results in outonomy with less emphasis on the theological argument against suicide. The result of this study is that the ethics of Kuitert cannot be described as mere humanism. Outonomy is judged as a form of theonomy.

  10. FAKTOR- FAKTOR UTAMA PEMBENTUK PREFERENSI MASYARAKAT MENYIKAPI PELEBARAN JALAN H.M. SUWIGNYO TERHADAP PROSPEK ASET PRIBADI

    Directory of Open Access Journals (Sweden)

    Muhammad Hidayat

    2015-07-01

    Full Text Available The broadening of H.M. Suwignyo Street have triggered the street corridor expansion. The property's owners take benefit from the increasing of asset value. They will have choices to manage and determine preferences for the asset. This study was aimed to find out the prominent factors that determine asset's owner preferences toward street broadening consequences. In first phase, analysis is performed qualitatively to construct the quantitative instruments for next research. Data are gathered from observation and semi-structured interview to informans. Data are categorised and codified with the result as initial hypotheses, which indicate community preferences to employ the property asset. The result showed that the social strata of asset's owner; asset tangible and intangible value comprehension; economic motif; gentrification; and the intervening factor/ government role are the prominent factors

  11. LEVERAGE OF THE COMMERCIAL SUCCESS OF FASHION TRADEMARKS ZARA AND H&M ON THE GLOBAL MARKET

    OpenAIRE

    Djakovič, Vesna

    2011-01-01

    Podjetje Zara in H&M sta vsekakor vsem poznani modni blagovni znamki, specializirani predvsem z oblačili, namenjeni v največji meri ženskam, vsekakor pa tudi moškim in otrokom. Glavni kupec ene kot druge znamke je mlajša populacija med 15 in 45 let. Obe znamki veljata za srednje kakovostni in s tem omogočata dosego nakupa širšemu segmentu. Njuni izdelki so primerni za študente, mlade družine, poslovneže ipd. Obe se poslužujeta različnih tržnih poti, tržnega komuniciranja in lastnih inovativni...

  12. Comparison of ionospheric F2 peak parameters foF2 and hmF2 with IRI2001 at Hainan

    Science.gov (United States)

    Wang, X.; Shi, J. K.; Wang, G. J.; Gong, Y.

    2009-06-01

    Monthly median values of foF2, hmF2 and M(3000)F2 parameters, with quarter-hourly time interval resolution for the diurnal variation, obtained with DPS4 digisonde at Hainan (19.5°N, 109.1°E; Geomagnetic coordinates: 178.95°E, 8.1°N) are used to investigate the low-latitude ionospheric variations and comparisons with the International Reference Ionosphere (IRI) model predictions. The data used for the present study covers the period from February 2002 to April 2007, which is characterized by a wide range of solar activity, ranging from high solar activity (2002) to low solar activity (2007). The results show that (1) Generally, IRI predictions follow well the diurnal and seasonal variation patterns of the experimental values of foF2, especially in the summer of 2002. However, there are systematic deviation between experimental values and IRI predictions with either CCIR or URSI coefficients. Generally IRI model greatly underestimate the values of foF2 from about noon to sunrise of next day, especially in the afternoon, and slightly overestimate them from sunrise to about noon. It seems that there are bigger deviations between IRI Model predictions and the experimental observations for the moderate solar activity. (2) Generally the IRI-predicted hmF2 values using CCIR M(3000)F2 option shows a poor agreement with the experimental results, but there is a relatively good agreement in summer at low solar activity. The deviation between the IRI-predicted hmF2 using CCIR M(3000)F2 and observed hmF2 is bigger from noon to sunset and around sunrise especially at high solar activity. The occurrence time of hmF2 peak (about 1200 LT) of the IRI model predictions is earlier than that of observations (around 1500 LT). The agreement between the IRI hmF2 obtained with the measured M(3000)F2 and the observed hmF2 is very good except that IRI overestimates slightly hmF2 in the daytime in summer at high solar activity and underestimates it in the nighttime with lower values near

  13. [Evaluation of the analyzer of hematology Beckman Coulter® HmX™ in the university hospital of Oran].

    Science.gov (United States)

    Zmouli, N; Moulasserdoun, K; Seghier, F

    2013-11-01

    The choice of an automaton of haematology is a determining stage, which has to take into account at the same time the quality of the results and the economic imperatives: workload, structure and organization of the laboratory. [corrected] It is in this spirit that we estimated during a period of 3 months the analyzer of haematology: the HmX™ Coulter with boatman of samples of the company Beckman. This automaton realizes the blood numeration, the formula leukocytic and the reticulocyte count. At first, we estimated the appropriate characteristics of device. Secondly, we estimated the relevance, the sensibility and the specificity of the alarms by comparing with the reference method, which is the optical microscopy. For that purpose, 125 blood smears resulting from service of haematology and from resuscitation were examined in optical microscopy. The technical tests were realized according to the recommendations of the International committee for evaluation of automatons of haematology. The analytical performances were satisfactory in particular the big interval of linearity and the absence of contamination. As regards the evaluation of the alarms system: rate of rejection is 63%, the sensibility 86%, the specificity 70%, the positive predictive value 80%, the negative predictive value 78% and the efficiency 80%. The alarms myelaemia and atypical lymphocytes were never sources of false negatives. The alarms erythroblasts and platelet aggregates did not engendered positive forgery. The blast cell alarm was responsible for a single case of false negative. The faithfulness of automaton is satisfactory: the absence of contamination, the big interval of linearity for the leukocytes, the red blood cells and the platelets as well as a good relevance of the alarms with regard to the anomalies found on the peripheral blood smear. From the user-friendliness and practicability point of view, the HmX™ Coulter was deeply appreciated. Copyright © 2013 Elsevier Masson SAS. All

  14. A Subject-Based Aspect Report on Provision in Scotland's Colleges by HM Inspectors on Behalf of the Scottish Funding Council: Hospitality and Tourism

    Science.gov (United States)

    Her Majesty's Inspectorate of Education, 2010

    2010-01-01

    The HM Inspectorate of Education publication, "External quality arrangements for Scotland's colleges, September 2008," specifies that HMIE will produce a number of subject aspect reports over the four years 2008-12. These reports complement in a subject specific context the generic evaluations of learning and teaching in HMIE's reports…

  15. Comparison of Tc-99m HM-PAO and I-123 IMP cerebral SPECT images in Alzheimer's disease and multi-infarct dementia

    Energy Technology Data Exchange (ETDEWEB)

    Gemmell, H G; Sharp, P F; Besson, J A.O.; Ebmeier, K P; Smith, F W

    1988-10-01

    SPECT images of the brain can be obtained using either /sup 123/I labelled amines or /sup 99m/Tc-hexamethylpropyleneamineoxime (HM-PAO). Both materials produce images which are blood flow dominated and so appear similar in normal subjects, although the respective mechanisms of uptake are not yet finally established. It seems likely, however, that the different mechanisms of uptake are responsible for recent reports of some differences seen in images obtained with the two types of agent in patients with cerebral pathology, mainly cerebrovascular disease. In this study, 12 demented patients, 6 with dementia of the Alzheimer type (DAT) and 6 with multi infarct dementia (MID), were imaged with /sup 123/I-isopropylamphetamine (IMP) and /sup 99m/Tc-HM-PAO and the images compared. Significantly more lesions were seen with IMP than HM-PAO (P < 0.02); out of a possible 120 sites, 41 lesions were seen with IMP compared to 28 with HM-PAO, 23 being seen with both agents. However, it is concluded that either agent can be used for the differential diagnosis of dementia, a task for which the new cerebral blood flow agents seem well suited.

  16. Cumulative vibratory indices and the H/M ratio of the soleus H-reflex: a quantitative study in control and spastic subjects

    NARCIS (Netherlands)

    Ongerboer de Visser, B. W.; Bour, L. J.; Koelman, J. H.; Speelman, J. D.

    1989-01-01

    Suppression of the soleus (Sol) H-reflex recruitment curve by Achilles tendon vibration and the ratio of maximum Sol H-reflex (Hmax) to maximum M-response (H/M ratio) have been studied by means of computer processing on the basis of peak-to-peak (P-P) and area values in 46 controls and in 16 spastic

  17. Array-based assay detects genome-wide 5-mC and 5-hmC in the brains of humans, non-human primates, and mice.

    Science.gov (United States)

    Chopra, Pankaj; Papale, Ligia A; White, Andrew T J; Hatch, Andrea; Brown, Ryan M; Garthwaite, Mark A; Roseboom, Patrick H; Golos, Thaddeus G; Warren, Stephen T; Alisch, Reid S

    2014-02-13

    Methylation on the fifth position of cytosine (5-mC) is an essential epigenetic mark that is linked to both normal neurodevelopment and neurological diseases. The recent identification of another modified form of cytosine, 5-hydroxymethylcytosine (5-hmC), in both stem cells and post-mitotic neurons, raises new questions as to the role of this base in mediating epigenetic effects. Genomic studies of these marks using model systems are limited, particularly with array-based tools, because the standard method of detecting DNA methylation cannot distinguish between 5-mC and 5-hmC and most methods have been developed to only survey the human genome. We show that non-human data generated using the optimization of a widely used human DNA methylation array, designed only to detect 5-mC, reproducibly distinguishes tissue types within and between chimpanzee, rhesus, and mouse, with correlations near the human DNA level (R(2) > 0.99). Genome-wide methylation analysis, using this approach, reveals 6,102 differentially methylated loci between rhesus placental and fetal tissues with pathways analysis significantly overrepresented for developmental processes. Restricting the analysis to oncogenes and tumor suppressor genes finds 76 differentially methylated loci, suggesting that rhesus placental tissue carries a cancer epigenetic signature. Similarly, adapting the assay to detect 5-hmC finds highly reproducible 5-hmC levels within human, rhesus, and mouse brain tissue that is species-specific with a hierarchical abundance among the three species (human > rhesus > mouse). Annotation of 5-hmC with respect to gene structure reveals a significant prevalence in the 3'UTR and an association with chromatin-related ontological terms, suggesting an epigenetic feedback loop mechanism for 5-hmC. Together, these data show that this array-based methylation assay is generalizable to all mammals for the detection of both 5-mC and 5-hmC, greatly improving the utility of mammalian model systems

  18. Genome-Wide Mapping of 5mC and 5hmC Identified Differentially Modified Genomic Regions in Late-Onset Severe Preeclampsia: A Pilot Study.

    Directory of Open Access Journals (Sweden)

    Lisha Zhu

    Full Text Available Preeclampsia (PE is a leading cause of perinatal morbidity and mortality. However, as a common form of PE, the etiology of late-onset PE is elusive. We analyzed 5-methylcytosine (5mC and 5-hydroxymethylcytosine (5hmC levels in the placentas of late-onset severe PE patients (n = 4 and normal controls (n = 4 using a (hydroxymethylated DNA immunoprecipitation approach combined with deep sequencing ([h]MeDIP-seq, and the results were verified by (hMeDIP-qPCR. The most significant differentially methylated regions (DMRs were verified by MassARRAY EppiTYPER in an enlarged sample size (n = 20. Bioinformatics analysis identified 714 peaks of 5mC that were associated with 403 genes and 119 peaks of 5hmC that were associated with 61 genes, thus showing significant differences between the PE patients and the controls (>2-fold, p<0.05. Further, only one gene, PTPRN2, had both 5mC and 5hmC changes in patients. The ErbB signaling pathway was enriched in those 403 genes that had significantly different 5mC level between the groups. This genome-wide mapping of 5mC and 5hmC in late-onset severe PE and normal controls demonstrates that both 5mC and 5hmC play epigenetic roles in the regulation of the disease, but work independently. We reveal the genome-wide mapping of DNA methylation and DNA hydroxymethylation in late-onset PE placentas for the first time, and the identified ErbB signaling pathway and the gene PTPRN2 may be relevant to the epigenetic pathogenesis of late-onset PE.

  19. FLUENT calculations of the hydrogen distribution in a containment during the OECD-NEA THAI HM-2 experiment

    International Nuclear Information System (INIS)

    Visser, D.C.; Komen, E.M.J.; Houkema, M.; Siccama, N.B.; Kyttaelae, Juha; Huhtanen, Risto; Takasuo, Eveliina

    2009-01-01

    Hydrogen may be released into the containment atmosphere of a nuclear power plant during a severe accident. Locally, high hydrogen concentrations may be reached that can possibly cause fast deflagration or even detonation and put the integrity of the containment at risk. Therefore, the distribution and mixing of hydrogen is an important safety issue for nuclear power plants. Computer codes can be applied to predict the hydrogen distribution in the containment within the course of a hypothetical severe accident and get an estimate of the local hydrogen concentration in the various zones of the containment. In this way the risk associated with the hydrogen safety issue can be determined, and safety related measurements and procedures could be assessed. In order to validate the existing computer codes in the context of hydrogen distribution in the containment of a nuclear power plant, experimental benchmark studies have been performed in the German Thermal-hydraulics, Hydrogen, Aerosols and Iodine (THAI) facility in the framework of the OECD-NEA THAI project. In order to demonstrate the capabilities of the commercial Computational Fluid Dynamics (CFD) code FLUENT the THAI HM-2 test was simulated independently by NRG and VTT. In the first phase of the HM-2 test a stratified hydrogen rich light gas layer was established in the upper part of the THAI containment. In the second phase steam was injected at a lower position inducing a rising plume that gradually dissolved the stratified hydrogen-rich layer from below. Thermo-dynamic phenomena like natural convection, mixing, condensation, heat transfer and distribution in different zones that are expected in severe accidents are involved. The calculated results by NRG and VTT (on hydrogen concentration, temperature, pressure and flow velocity) are compared to the experimental results. The most important differences between the CFD model of NRG and VTT are the computational mesh, condensation model and treatment of the solid

  20. In Silico Modeling and Functional Interpretations of Cry1Ab15 Toxin from Bacillus thuringiensis BtB-Hm-16

    Directory of Open Access Journals (Sweden)

    Sudhanshu Kashyap

    2013-01-01

    Full Text Available The theoretical homology based structural model of Cry1Ab15 δ-endotoxin produced by Bacillus thuringiensis BtB-Hm-16 was predicted using the Cry1Aa template (resolution 2.25 Å. The Cry1Ab15 resembles the template structure by sharing a common three-domain extending conformation structure responsible for pore-forming and specificity determination. The novel structural differences found are the presence of β0 and α3, and the absence of α7b, β1a, α10a, α10b, β12, and α11a while α9 is located spatially downstream. Validation by SUPERPOSE and with the use of PROCHECK program showed folding of 98% of modeled residues in a favourable and stable orientation with a total energy Z-score of −6.56; the constructed model has an RMSD of only 1.15 Å. These increments of 3D structure information will be helpful in the design of domain swapping experiments aimed at improving toxicity and will help in elucidating the common mechanism of toxin action.

  1. Media Fill Test for validation of autologous leukocytes separation and labelling by (99m)Tc-HmPAO.

    Science.gov (United States)

    Urbano, Nicoletta; Modoni, Sergio; Schillaci, Orazio

    2013-01-01

    Manufacturing of sterile products must be carried out in order to minimize risks of microbiological contamination. White blood cells (WBC) labelled with (99m)Tc-exametazime ((99m)Tc-hexamethylpropyleneamine oxime; (99m)Tc-HMPAO) are being successfully applied in the field of infection/inflammation scintigraphy for many years. In our radiopharmacy lab, separation and labelling of autologous leukocytes with (99m)Tc-HMPAO were performed in a laminar flow cabinet not classified and placed in a controlled area, whereas (99m)Tc-HMPAO radiolabelling procedure was carried out in a hot cell with manipulator gloves. This study was conducted to validate this process using a Media Fill simulation test. The study was performed using sterile Tryptic Soy Broth (TSB) in place of active product, reproducing as closely as possible the routine aseptic production process with all the critical steps, as described in the our internal standard operative procedures (SOP). The final vials containing the media of each processed step were then incubated for 14 days and examined for the evidence of microbial growth. No evidence of turbidity was observed in all the steps assayed by the Media Fill. In the separation and labelling of autologous leukocytes with (99m)Tc-HmPAO, Media-Fill test represents a reliable tool to validate the aseptic process. Copyright © 2013 Elsevier Inc. All rights reserved.

  2. Functional regional cerebral blood flow SPECT using 99mTc-HM-PAO by speech memory tasks

    International Nuclear Information System (INIS)

    Tohyama, Junko

    1993-01-01

    Using single photon emission computed tomography (SPECT) with Tc-99m HA-PAO, changes in regional cerebral blood flow (rCBF) by giving word memory and Miyake's tasks were determined for localizatin of speech memory function. Twice injection method of Tc-99m HM-PAO was used to obtain subtraction SPECT images; and positioning of the 1st and 2nd SPECT was determined by phantom study. To prevent artifacts and changes in rCBF as far as possible, the subjects were informed word fluency and Miyake's tasks sufficiently. When giving word fluency approach, an increase in rCBF was observed in both the operculum and the supratemporal convolution of dominant hemisphere. When giving Miyake's approach, it was observed predominantly in the supratemporal convolution of dominant hemisphere. Although it was also observed in the base of frontal lobe and operculum, there was no bilateral difference. An increased rCBF in the basal nucleus was more clearly observed by Miyake's than word fluency tasks without bilateral differences. There was no definitive increase in rCBF in the Papez's circuit responsible for memory and emotion by either word fluency or Miyake's tasks. In mentally mild disorder patients, an increased rCBF was observed in the same areas as those in normal subjects. In such patients having a decreased rCBF at rest, an increased rCBF was seen in the contralateral hemisphere and the surrounding areas of the lesions, suggesting compensatory mechanism. (N.K.) 65 refs

  3. Bax/Tubulin/Epithelial-Mesenchymal Pathways Determine the Efficacy of Silybin Analog HM015k in Colorectal Cancer Cell Growth and Metastasis

    Directory of Open Access Journals (Sweden)

    Haneen Amawi

    2018-05-01

    Full Text Available The inhibition of apoptosis, disruption of cellular microtubule dynamics, and over-activation of the epithelial mesenchymal transition (EMT, are involved in the progression, metastasis, and resistance of colorectal cancer (CRC to chemotherapy. Therefore, the design of a molecule that can target these pathways could be an effective strategy to reverse CRC progression and metastasis. In this study, twelve novel silybin derivatives, HM015a-HM015k (15a−15k and compound 17, were screened for cytotoxicity in CRC cell lines. Compounds HM015j and HM015k (15k and 15j significantly decreased cell proliferation, inhibited colony formation, and produced cell cycle arrest in CRC cells. Furthermore, 15k significantly induced the formation of reactive oxygen species and apoptosis. It induced the cleavage of the intrinsic apoptotic protein (Bax p21 to its more efficacious fragment, p18. Compound 15k also inhibited tubulin expression and disrupted its structure. Compound 15k significantly decreased metastatic LOVO cell migration and invasion. Furthermore, 15k reversed mesenchymal morphology in HCT116 and LOVO cells. Additionally, 15k significantly inhibited the expression of the mesenchymal marker N-cadherin and upregulated the expression of the epithelial marker, E-cadherin. Compound 15k inhibited the expression of key proteins known to induce EMT (i.e., DVL3, β-catenin, c-Myc and upregulated the anti-metastatic protein, cyclin B1. Overall, in vitro, 15k significantly inhibited CRC progression and metastasis by inhibiting apoptosis, tubulin activity and the EMT pathways. Overall, these data suggest that compound 15k should be tested in vivo in a CRC animal model for further development.

  4. Performance-oriented packaging: A guide to identifying and designing. Identifying and designing hazardous materials packaging for compliance with post HM-181 DOT Regulations

    International Nuclear Information System (INIS)

    1994-08-01

    With the initial publication of Docket HM-181 (hereafter referred to as HM-181), the U.S. Department of Energy (DOE), Headquarters, Transportation Management Division decided to produce guidance to help the DOE community transition to performance-oriented packagings (POP). As only a few individuals were familiar with the new requirements, elementary guidance was desirable. The decision was to prepare the guidance at a level easily understood by a novice to regulatory requirements. This document identifies design development strategies for use in obtaining performance-oriented packagings that are not readily available commercially. These design development strategies will be part of the methodologies for compliance with post HM-181 U.S. Department of Transportation (DOT) packaging regulations. This information was prepared for use by the DOE and its contractors. The document provides guidance for making decisions associated with designing performance-oriented packaging, and not for identifying specific material or fabrication design details. It does provide some specific design considerations. Having a copy of the regulations handy when reading this document is recommended to permit a fuller understanding of the requirements impacting the design effort. While this document is not written for the packaging specialist, it does contain guidance important to those not familiar with the new POP requirements

  5. Combination with a defucosylated anti-HM1.24 monoclonal antibody plus lenalidomide induces marked ADCC against myeloma cells and their progenitors.

    Directory of Open Access Journals (Sweden)

    Takeshi Harada

    Full Text Available The immunomodulatory drug lenalidomide (Len has drawn attention to potentiate antibody-dependent cellular cytotoxicity (ADCC-mediated immunotherapies. We developed the defucosylated version (YB-AHM of humanized monoclonal antibody against HM1.24 (CD317 overexpressed in multiple myeloma (MM cells. In this study, we evaluated ADCC by YB-AHM and Len in combination against MM cells and their progenitors. YB-AHM was able to selectively kill via ADCC MM cells in bone marrow samples from patients with MM with low effector/target ratios, which was further enhanced by treatment with Len. Interestingly, Len also up-regulated HM1.24 expression on MM cells in an effector-dependent manner. HM1.24 was found to be highly expressed in a drug-resistant clonogenic "side population" in MM cells; and this combinatory treatment successfully reduced SP fractions in RPMI 8226 and KMS-11 cells in the presence of effector cells, and suppressed a clonogenic potential of MM cells in colony-forming assays. Collectively, the present study suggests that YB-AHM and Len in combination may become an effective therapeutic strategy in MM, warranting further study to target drug-resistant MM clonogenic cells.

  6. 2011 HM{sub 102}: DISCOVERY OF A HIGH-INCLINATION L5 NEPTUNE TROJAN IN THE SEARCH FOR A POST-PLUTO NEW HORIZONS TARGET

    Energy Technology Data Exchange (ETDEWEB)

    Parker, Alex H.; Holman, Matthew J.; McLeod, Brian A. [Harvard-Smithsonian Center for Astrophysics, 60 Garden Street, Cambridge, MA 02138 (United States); Buie, Marc W.; Borncamp, David M.; Spencer, John R.; Stern, S. Alan [Southwest Research Institute, 6220 Culebra Road, San Antonio, TX 78238 (United States); Osip, David J. [Carnegie Observatories, Las Campanas Observatory, Casilla 601, La Serena (Chile); Gwyn, Stephen D. J.; Fabbro, Sebastian; Kavelaars, J. J. [Canadian Astronomy Data Centre, National Research Council of Canada, 5071 W. Saanich Road, Victoria, BC V9E 2E7 (Canada); Benecchi, Susan D.; Sheppard, Scott S. [Department of Terrestrial Magnetism, Carnegie Institute of Washington, 5251 Broad Branch Road NW, Washington, DC 20015 (United States); Binzel, Richard P.; DeMeo, Francesca E. [Massachusetts Institute of Technology, 77 Massachusetts Avenue, Cambridge, MA 02139 (United States); Fuentes, Cesar I.; Trilling, David E. [Department of Physics and Astronomy, Northern Arizona University, S San Francisco St, Flagstaff, AZ 86011 (United States); Gay, Pamela L. [Center for Science, Technology, Engineering and Mathematics (STEM) Research, Education, and Outreach, Southern Illinois University, 1220 Lincoln Dr, Carbondale, IL 62901 (United States); Petit, Jean-Marc [CNRS, UTINAM, Universite de Franche Comte, Route de Gray, F-25030 Besancon Cedex, (France); Tholen, David J., E-mail: aparker@cfa.harvard.edu [Institute for Astronomy, University of Hawaii, 2680 Woodlawn Dr, Honolulu, HI 96822 (United States); and others

    2013-04-15

    We present the discovery of a long-term stable L5 (trailing) Neptune Trojan in data acquired to search for candidate trans-Neptunian objects for the New Horizons spacecraft to fly by during an extended post-Pluto mission. This Neptune Trojan, 2011 HM{sub 102}, has the highest inclination (29. Degree-Sign 4) of any known member of this population. It is intrinsically brighter than any single L5 Jupiter Trojan at H{sub V} {approx} 8.18. We have determined its gri colors (a first for any L5 Neptune Trojan), which we find to be similar to the moderately red colors of the L4 Neptune Trojans, suggesting similar surface properties for members of both Trojan clouds. We also present colors derived from archival data for two L4 Neptune Trojans (2006 RJ{sub 103} and 2007 VL{sub 305}), better refining the overall color distribution of the population. In this document we describe the discovery circumstances, our physical characterization of 2011 HM{sub 102}, and this object's implications for the Neptune Trojan population overall. Finally, we discuss the prospects for detecting 2011 HM{sub 102} from the New Horizons spacecraft during its close approach in mid- to late-2013.

  7. The Aorta-Gonad-Mesonephros Organ Culture Recapitulates 5hmC Reorganization and Replication-Dependent and Independent Loss of DNA Methylation in the Germline.

    Science.gov (United States)

    Calvopina, Joseph Hargan; Cook, Helene; Vincent, John J; Nee, Kevin; Clark, Amander T

    2015-07-01

    Removal of cytosine methylation from the genome is critical for reprogramming and transdifferentiation and plays a central role in our understanding of the fundamental principles of embryo lineage development. One of the major models for studying cytosine demethylation is the mammalian germ line during the primordial germ cell (PGC) stage of embryo development. It is now understood that oxidation of 5-methylcytosine (5mC) to 5-hydroxymethylcytosine (5hmC) is required to remove cytosine methylation in a locus-specific manner in PGCs; however, the mechanisms downstream of 5hmC are controversial and hypothesized to involve either active demethylation or replication-coupled loss. In the current study, we used the aorta-gonad-mesonephros (AGM) organ culture model to show that this model recapitulates germ line reprogramming, including 5hmC reorganization and loss of cytosine methylation from Snrpn and H19 imprinting control centers (ICCs). To directly address the hypothesis that cell proliferation is required for cytosine demethylation, we blocked PI3-kinase-dependent PGC proliferation and show that this leads to a G1 and G2/M cell cycle arrest in PGCs, together with retained levels of cytosine methylation at the Snrpn ICC, but not at the H19 ICC. Taken together, the AGM organ culture model is an important tool to evaluate mechanisms of locus-specific demethylation and the role of PI3-kinase-dependent PGC proliferation in the locus-specific removal of cytosine methylation from the genome.

  8. 2011 HM102: DISCOVERY OF A HIGH-INCLINATION L5 NEPTUNE TROJAN IN THE SEARCH FOR A POST-PLUTO NEW HORIZONS TARGET

    International Nuclear Information System (INIS)

    Parker, Alex H.; Holman, Matthew J.; McLeod, Brian A.; Buie, Marc W.; Borncamp, David M.; Spencer, John R.; Stern, S. Alan; Osip, David J.; Gwyn, Stephen D. J.; Fabbro, Sébastian; Kavelaars, J. J.; Benecchi, Susan D.; Sheppard, Scott S.; Binzel, Richard P.; DeMeo, Francesca E.; Fuentes, Cesar I.; Trilling, David E.; Gay, Pamela L.; Petit, Jean-Marc; Tholen, David J.

    2013-01-01

    We present the discovery of a long-term stable L5 (trailing) Neptune Trojan in data acquired to search for candidate trans-Neptunian objects for the New Horizons spacecraft to fly by during an extended post-Pluto mission. This Neptune Trojan, 2011 HM 102 , has the highest inclination (29.°4) of any known member of this population. It is intrinsically brighter than any single L5 Jupiter Trojan at H V ∼ 8.18. We have determined its gri colors (a first for any L5 Neptune Trojan), which we find to be similar to the moderately red colors of the L4 Neptune Trojans, suggesting similar surface properties for members of both Trojan clouds. We also present colors derived from archival data for two L4 Neptune Trojans (2006 RJ 103 and 2007 VL 305 ), better refining the overall color distribution of the population. In this document we describe the discovery circumstances, our physical characterization of 2011 HM 102 , and this object's implications for the Neptune Trojan population overall. Finally, we discuss the prospects for detecting 2011 HM 102 from the New Horizons spacecraft during its close approach in mid- to late-2013.

  9. pH-regulated metal-ligand switching in the HM loop of ATP7A: a new paradigm for metal transfer chemistry.

    Science.gov (United States)

    Kline, Chelsey D; Gambill, Benjamin F; Mayfield, Mary; Lutsenko, Svetlana; Blackburn, Ninian J

    2016-08-01

    Cuproproteins such as PHM and DBM mature in late endosomal vesicles of the mammalian secretory pathway where changes in vesicle pH are employed for sorting and post-translational processing. Colocation with the P1B-type ATPase ATP7A suggests that the latter is the source of copper and supports a mechanism where selectivity in metal transfer is achieved by spatial colocation of partner proteins in their specific organelles or vesicles. In previous work we have suggested that a lumenal loop sequence located between trans-membrane helices TM1 and TM2 of the ATPase, and containing five histidines and four methionines, acts as an organelle-specific chaperone for metallation of the cuproproteins. The hypothesis posits that the pH of the vesicle regulates copper ligation and loop conformation via a mechanism which involves His to Met ligand switching induced by histidine protonation. Here we report the effect of pH on the HM loop copper coordination using X-ray absorption spectroscopy (XAS), and show via selenium substitution of the Met residues that the HM loop undergoes similar conformational switching to that found earlier for its partner PHM. We hypothesize that in the absence of specific chaperones, HM motifs provide a template for building a flexible, pH-sensitive transfer site whose structure and function can be regulated to accommodate the different active site structural elements and pH environments of its partner proteins.

  10. cobalt (ii), nickel (ii)

    African Journals Online (AJOL)

    DR. AMINU

    Department of Chemistry Bayero University, P. M. B. 3011, Kano, Nigeria. E-mail: hnuhu2000@yahoo.com. ABSTRACT. The manganese (II), cobalt (II), nickel (II) and .... water and common organic solvents, but are readily soluble in acetone. The molar conductance measurement [Table 3] of the complex compounds in.

  11. Tour of the stands at the UK@CERN industrial exhibition with the Director-General and H.E. Mr Simon Featherstone, HM Ambassador to Switzerland, hosted by Mrs. Jan Fillingham MBE, Head of Exhibitions, BEAMA

    CERN Multimedia

    Claudia Marcelloni

    2006-01-01

    Tour of the stands at the UK@CERN industrial exhibition with the Director-General and H.E. Mr Simon Featherstone, HM Ambassador to Switzerland, hosted by Mrs. Jan Fillingham MBE, Head of Exhibitions, BEAMA

  12. Opportunistic Infections (OIs) in Patients with Hematologic Malignancies (HM) Treated with Bruton’s Tyrosine Kinase (BTK) and Phosphoinositide 3 Kinase (PI3K) Inhibitors: An 8-Year Retrospective Cohort Study

    OpenAIRE

    Issa, Nicolas; Arbona-Haddad, Esther; Nevett-Fernandez, Alexandra; Prestes, Daniel; Liakos, Alexis; Woolley, Ann; Hammond, Sarah; Brown, Jennifer; Baden, Lindsey; Marty, Francisco

    2017-01-01

    Abstract Background: BTK and PI3K inhibitors are increasingly used for treatment in patients with HM. OIs when these agents were used as first line therapy signaled an increased level of immunosuppression beyond what was expected from the mechanism of action of these drugs. The epidemiology of OIs in the setting of BTK and PI3K inhibitor use has not been characterized. Methods: We retrospectively studied a cohort of patients with HM who received BTK (ibrutinib, acalabrutinib, spebrutinib) or ...

  13. CBF tomograms with [/sup 99m/Tc-HM-PAO in patients with dementia (Alzheimer type and HIV) and Parkinson's disease--initial results

    International Nuclear Information System (INIS)

    Costa, D.C.; Ell, P.J.; Burns, A.; Philpot, M.; Levy, R.

    1988-01-01

    We present preliminary data on the utility of functional brain imaging with [99mTc]-d,l-HM-PAO and single photon emission computed tomography (SPECT) in the study of patients with dementia of the Alzheimer type (DAT), HIV-related dementia syndrome, and the on-off syndrome of Parkinson's disease. In comparison with a group of age-matched controls, the DAT patients revealed distinctive bilateral temporal and posterior parietal deficits, which correlate with detailed psychometric evaluation. Patients with amnesia as the main symptom (group A) showed bilateral mesial temporal lobe perfusion deficits (p less than 0.02). More severely affected patients (group B) with significant apraxia, aphasia, or agnosia exhibited patterns compatible with bilateral reduced perfusion in the posterior parietal cortex, as well as reduced perfusion to both temporal lobes, different from the patients of the control group (p less than 0.05). SPECT studies of HIV patients with no evidence of intracraneal space occupying pathology showed marked perfusion deficits. Patients with Parkinson's disease and the on-off syndrome studied during an on phase (under levodopa therapy) and on another occasion after withdrawal of levodopa (off) demonstrated a significant change in the uptake of [99mTc]-d,l-HM-PAO in the caudate nucleus (lower on off) and thalamus (higher on off). These findings justify the present interest in the functional evaluation of the brain of patients with dementia. [99mTc]-d,l-HM-PAO and regional cerebral blood flow (rCBF)/SPECT appear useful and highlight individual disorders of flow in a variety of neuropsychiatric conditions

  14. CBF tomograms with (/sup 99m/Tc-HM-PAO in patients with dementia (Alzheimer type and HIV) and Parkinson's disease--initial results

    Energy Technology Data Exchange (ETDEWEB)

    Costa, D.C.; Ell, P.J.; Burns, A.; Philpot, M.; Levy, R.

    1988-12-01

    We present preliminary data on the utility of functional brain imaging with (99mTc)-d,l-HM-PAO and single photon emission computed tomography (SPECT) in the study of patients with dementia of the Alzheimer type (DAT), HIV-related dementia syndrome, and the on-off syndrome of Parkinson's disease. In comparison with a group of age-matched controls, the DAT patients revealed distinctive bilateral temporal and posterior parietal deficits, which correlate with detailed psychometric evaluation. Patients with amnesia as the main symptom (group A) showed bilateral mesial temporal lobe perfusion deficits (p less than 0.02). More severely affected patients (group B) with significant apraxia, aphasia, or agnosia exhibited patterns compatible with bilateral reduced perfusion in the posterior parietal cortex, as well as reduced perfusion to both temporal lobes, different from the patients of the control group (p less than 0.05). SPECT studies of HIV patients with no evidence of intracraneal space occupying pathology showed marked perfusion deficits. Patients with Parkinson's disease and the on-off syndrome studied during an on phase (under levodopa therapy) and on another occasion after withdrawal of levodopa (off) demonstrated a significant change in the uptake of (99mTc)-d,l-HM-PAO in the caudate nucleus (lower on off) and thalamus (higher on off). These findings justify the present interest in the functional evaluation of the brain of patients with dementia. (99mTc)-d,l-HM-PAO and regional cerebral blood flow (rCBF)/SPECT appear useful and highlight individual disorders of flow in a variety of neuropsychiatric conditions.

  15. Empleo de metodos numericos para el ajuste de los coeficientes de difusividad (D) y convectivo de transferencia de masa (hm) en el secado de alimentos

    OpenAIRE

    Arranz Saiz, Francisco Javier; Correa Hernando, Eva Cristina; Jiménez Ariza, Heidi Tatiana; Diezma Iglesias, Belen; Garcia-Herrero, Javier; Robla Villalba, José Ignacio; Barreiro Elorza, Pilar

    2011-01-01

    Los modelos matemáticos de transferencia de humedad desde el alimento al medio circundante durante el proceso de secado dependen de dos parámetros: coeficiente de difusividad efectiva D y coeficiente convectivo de transferencia de masa hm, cuya determinación experimental se basa en la consideración de un sistema difusivo sencillo de solución analítica bien conocida. Para el caso, que aquí nos ocupa, de difusión monodimensional en una lámina infinita de grosor 2l, la solución analítica de ...

  16. Propuesta de un modelo de un sistema de gestión de calidad, basado en la Norma ISO 9001:2008 en el Hotel HM Internacional

    OpenAIRE

    Riera Peralta, Patricia; Naranjo Navarrete, Pierina

    2013-01-01

    El propósito de la presente tesis es diseñar un Modelo de un Sistema de Gestión de Calidad basado en Norma ISO 9001-2008, para que el hotel HM Internacional pueda competir con otros servicios hoteleros en diferentes partes del mundo, ofreciendo un servicio de calidad que aumente la satisfacción del cliente, incremente la rentabilidad del negocio y disminuya los costos. La tesis comienza planteando el problema del área de recepción, describiendo la metodología de la investigación a seguir pa...

  17. Purificación y caracterización parcial de una toxina (Hm3 del veneno de Hadruroides mauryi (Francke y Soleglad, 1980 (Scorpiones, Iuridae

    Directory of Open Access Journals (Sweden)

    Luz Velásquez

    2013-06-01

    Full Text Available Se ha purificado una toxina (Hm3 del veneno del escorpión Hadruroides mauryi, por cromatografía de intercambio iónico en CM-Sephadex C-25 con buffer acetato de amonio 0,05M, pH 7. La toxina produce contracción y parálisis en la extremidad inoculada de ratones albinos y se caracteriza por ser de naturaleza básica y tener un peso molecular de 4,5 kDa. Después de 45 minutos de ser inoculada en el músculo gastrocnemius de ratones albinos, Hm3 (30,4 µg aumenta los niveles plasmáticos de creatina kinasa desde 252,6 UI/L hasta 3779,3 UI/L y de lactato deshidrogenasa, desde 142,7 UI/L hasta 248,2 UI/L; igualmente incrementa los niveles de calcio intramuscular desde 34,1 nmoles hasta 69,3 nmoles. Esta toxina carece de actividad proteolítica y fosfolipásica.

  18. Bioethanol Production from Sugarcane Bagasse by a Novel Brazilian Pentose Fermenting Yeast Scheffersomyces shehatae UFMG-HM 52.2: Evaluation of Fermentation Medium

    Directory of Open Access Journals (Sweden)

    F. A. F. Antunes

    2014-01-01

    Full Text Available Bioconversion of hemicellulosic sugars into second generation (2G ethanol plays a pivotal role in the overall success of biorefineries. In this study, ethanol production performance of a novel xylose-fermenting yeast, Scheffersomyces shehatae UFMG-HM 52.2, was evaluated under batch fermentation conditions using sugarcane bagasse (SB hemicellulosic hydrolysate as carbon source. Dilute acid hydrolysis of SB was performed to obtain sugarcane bagasse hemicellulosic hydrolysate (SBHH. It was concentrated, detoxified, and supplemented with nutrients in different formulations to prepare the fermentation medium to the yeast evaluation performance. S. shehatae UFMG-HM 52.2 (isolated from Brazilian Atlantic rain forest ecosystem was used in fermentations carried out in Erlenmeyer flasks maintained in a rotator shaker at 30°C and 200 rpm for 72 h. The use of a fermentation medium composed of SBHH supplemented with 5 g/L ammonium sulfate, 3 g/L yeast extract, and 3 g/L malt extract resulted in 0.38 g/g of ethanol yield and 0.19 g L.h of volumetric productivity after 48 h of incubation time.

  19. On the condition of UO{sub 2} nuclear fuel irradiated in a PWR to a burn-up in excess of 110 MWd/kgHM

    Energy Technology Data Exchange (ETDEWEB)

    Restani, R.; Horvath, M. [Paul Scherrer Institut, CH-5232, Villigen PSI (Switzerland); Goll, W. [AREVA GmbH, P.O. Box 1109, DE-91001 Erlangen (Germany); Bertsch, J.; Gavillet, D.; Hermann, A. [Paul Scherrer Institut, CH-5232, Villigen PSI (Switzerland); Martin, M., E-mail: matthias.martin@psi.ch [Paul Scherrer Institut, CH-5232, Villigen PSI (Switzerland); Walker, C.T. [The Grange, 66 High Street, Swinderby, Lincoln LN6 9LU (United Kingdom)

    2016-12-01

    Post-irradiation examination results are presented for UO{sub 2} fuel from a PWR fuel rod that had been irradiated to an average burn-up of 105 MWd/kgHM and showed high fission gas release of 42%. The radial distribution of xenon and the partitioning of fission gas between bubbles and the fuel matrix was investigated using laser ablation inductively coupled plasma mass spectrometry (LA-ICP-MS) and electron probe microanalysis. It is concluded that release from the fuel at intermediate radial positions was mainly responsible for the high fission gas release. In this region thermal release had occurred from the high burn-up structure (HBS) at some point after the sixth irradiation cycle. The LA-ICP-MS results indicate that gas release had also occurred from the HBS in the vicinity of the pellet periphery. It is shown that the gas pressure in the HBS pores is well below the pressure that the fuel can sustain. - Highlights: • Gas retention measured by laser ablation induction coupled plasma mass spectrometry. • Thermal release from the high burn structure responsible for high gas release. • At a pellet burn-up of 115 MWd/kgHM the high burn-up structure is still evolving. • The gas pressure in HBS pores is well below the pressure that the fuel can sustain.

  20. Variation of hmF2 and NmF2 deduced from DPS-4 over Multan (Pakistan) and their comparisons with IRI-2012 & IRI-2016 during the deep solar minimum between cycles 23 & 24

    Science.gov (United States)

    Ameen, Muhammad Ayyaz; Khursheed, Haqqa; Jabbar, Mehak Abdul; Ali, Muneeza Salman; Chishtie, Farrukh

    2018-04-01

    We report the results of ionospheric measurements from DPS-4 installed at Multan (Geog coord. 30.18°N, 71.48°E, dip 47.4°). The variations in F2-layer maximum electron density NmF2 and its peak height hmF2 are studied during the deep solar minimum between cycles 23 & 24 i.e 2008-2009 with comparisons conducted with the International Reference Ionosphere (IRI) versions 2012 & 2016. We find that the hmF2 observations peak around the pre-sunrise and sunrise hours depending on the month. Seasonally, the daytime variation of NmF2 is higher in the Equinox and Summer, while daytime hmF2 are slightly higher in the Equinox and Winter. High values of hmF2 around midnight are caused by an increase of upward drifts produced by meridional winds. The ionosphere over Multan, which lies at the verge of low and mid latitude, is affected by both E × B drifts and thermospheric winds as evident from mid-night peaks and near-sunrise dips in hmF2. The results of the comparison of the observed NmF2 and hmF2 for the year 2008-2009 with the IRI-2012 (both NmF2 and hmF2) and IRI-2016 (only hmF2) estimates indicate that for NmF2, IRI-2012 with Consultative Committee International Radio (CCIR) option produces values in better agreement with observed data. Whereas, for hmF2, IRI-2016 with both International Union of Radio Science (URSI) and CCIR SHU-2015 options, predicts well for nighttime hours throughout the year. However, the IRI-2012 with CCIR option produces better agreement with data during daytime hours. Furthermore, IRI-2012 with CCIR option gives better results during Equinox months, whereas, IRI-2016 with both URSI and CCIR SHU-2015 options predict well for Winter and Summer.

  1. Cranial MR imaging and cerebral 99mTc HM-PAO-SPECT in patients with subacute or chronic severe closed head injury and normal CT examinations

    International Nuclear Information System (INIS)

    Prayer, L.; Wimberger, D.; Oder, W.; Kramer, J.; Schindler, E.; Podreka, I.; Imhof, H.

    1993-01-01

    Eighteen patients in the subacute or chronic state following severe closed head injury with normal cranial CT scans were examined by MR and 99m Tc HM-PAO SPECT. Correlations were sought between these 2 imaging modalities and the clinical outcome, as defined by the Glasgow Outcome Scale (GOX) score. Both MR and SPECT revealed cerebral damage in all patients examined but structural and functional alterations did not coincide topographically in 64.9% of lesions. Nevertheless, complementary injury patterns suggesting poor recovery were found; cortical contusions and diffuse axonal injury (MR) in conjunction with cortical and thalamic hypoperfusion (SPECT) were noticed in 8 out of 12 patients with unfavorable outcome (GOS = III and IV). The synthesis of MR and SPECT information clearly enhanced the ability both to accurately assess posttraumatic brain damage and to improve patients' outcome prediction. (au) (18 refs.)

  2. Cranial MR imaging and cerebral 99mTc HM-PAO-SPECT in patients with subacute or chronic severe closed head injury and normal CT examinations

    International Nuclear Information System (INIS)

    Prayer, L.; Wimberger, D.; Oder, W.; Kramer, J.; Schindler, E.; Podreka, I.; Imhof, H.

    1993-01-01

    Eighteen patients in the subacute or chronic state following severe closed head injury with normal cranial CT scans were examined by MR and 99m Tc HM-PAO SPECT. Correlations were sought between these 2 imaging modalities and the clinical outcome, as defined by the Glasgow Outcome Scale (GOS) score. Both MR and SPECT revealed cerebral damage in all patients examined but structural and functional alterations did not coincide topographically in 64.9% of lesions. Nevertheless, complementary injury patterns suggesting poor recovery were found; cortical contusions and diffuse axonal injury (MR) in conjunction with cortical and thalamic hypoperfusion (SPECT) were noticed in 8 out of 12 patients with unfavorable outcome (GOS=III and IV). The synthesis of MR and SPECT information clearly enhanced the ability both to accurately assess posttraumatic brain damage and to improve patients' outcome prediction. (orig.)

  3. On the thermal conductivity of UO2 nuclear fuel at a high burn-up of around 100 MWd/kgHM

    International Nuclear Information System (INIS)

    Walker, C.T.; Staicu, D.; Sheindlin, M.; Papaioannou, D.; Goll, W.; Sontheimer, F.

    2006-01-01

    A study of the thermal conductivity of a commercial PWR fuel with an average pellet burn-up of 102 MWd/kgHM is described. The thermal conductivity data reported were derived from the thermal diffusivity measured by the laser flash method. The factors determining the fuel thermal conductivity at high burn-up were elucidated by investigating the recovery that occurred during thermal annealing. It was found that the thermal conductivity in the outer region of the fuel was much higher than it would have been if the high burn-up structure were not present. The increase in thermal conductivity is a consequence of the removal of fission products and radiation defects from the fuel lattice during recrystallisation of the fuel grains (an integral part of the formation process of the high burn-up structure). The gas porosity in the high burn-up structure lowers the increase in thermal conductivity caused by recrystallisation

  4. Cranial MR imaging and cerebral [sup 99m]Tc HM-PAO-SPECT in patients with subacute or chronic severe closed head injury and normal CT examinations

    Energy Technology Data Exchange (ETDEWEB)

    Prayer, L.; Wimberger, D.; Oder, W.; Kramer, J.; Schindler, E.; Podreka, I.; Imhof, H.

    1993-11-01

    Eighteen patients in the subacute or chronic state following severe closed head injury with normal cranial CT scans were examined by MR and [sup 99m]Tc HM-PAO SPECT. Correlations were sought between these 2 imaging modalities and the clinical outcome, as defined by the Glasgow Outcome Scale (GOX) score. Both MR and SPECT revealed cerebral damage in all patients examined but structural and functional alterations did not coincide topographically in 64.9% of lesions. Nevertheless, complementary injury patterns suggesting poor recovery were found; cortical contusions and diffuse axonal injury (MR) in conjunction with cortical and thalamic hypoperfusion (SPECT) were noticed in 8 out of 12 patients with unfavorable outcome (GOS = III and IV). The synthesis of MR and SPECT information clearly enhanced the ability both to accurately assess posttraumatic brain damage and to improve patients' outcome prediction. (au) (18 refs.).

  5. Fission gas release behaviour of a 103 GWd/t{sub HM} fuel disc during a 1200 °C annealing test

    Energy Technology Data Exchange (ETDEWEB)

    Noirot, J., E-mail: jean.noirot@cea.fr [CEA, DEN, DEC, Cadarache, F-13108 St. Paul Lez Durance (France); Pontillon, Y. [CEA, DEN, DEC, Cadarache, F-13108 St. Paul Lez Durance (France); Yagnik, S. [EPRI, P.O. Box 10412, Palo Alto, CA 94303-0813 (United States); Turnbull, J.A. [Independent Consultant (United Kingdom); Tverberg, T. [IFE, P.O. Box 173, NO-1751 Halden (Norway)

    2014-03-15

    Within the Nuclear Fuel Industry Research (NFIR) program, several fuel variants, in the form of thin circular discs, were irradiated in the Halden Boiling Water Reactor (HBWR) to a range of burn-ups ∼100 GWd/t{sub HM}. The design of the assembly was similar to that used in other HBWR programs: the assembly contained several rods with fuel discs sandwiched between Mo discs, which limited temperature gradients within the fuel discs. One such rod contained standard grain UO{sub 2} discs (3D grain size = 18 μm) reaching a burn-up of 103 GWd/t{sub HM}. After the irradiation, the gas release upon rod puncturing was measured to be 2.9%. Detailed characterizations of one of these irradiated UO{sub 2} discs, using electron probe microanalysis (EPMA), scanning electron microscopy (SEM) and secondary ion mass spectrometry (SIMS), were performed in a CEA Cadarache hot laboratory. Examination revealed the high burn-up structure (HBS) formation throughout the whole of the disc, also the fission gas distribution within this HBS, with a very high proportion of the gas in the HBS bubbles. A sibling disc was submitted to a temperature transient up to 1200 °C in the out-of-pile (OOP) annealing test device “Merarg” at a relatively low temperature ramp rate (0.2 °C/s). In addition to the total gas release during this annealing test, the release peaks throughout the temperature range were monitored. The fuel was then characterized with the same microanalysis techniques as before the annealing test to investigate the effects of this test on the microstructure of the fuel and on the fission gases. It provided valuable insights into fission gas localization and the release behaviour in UO{sub 2} fuel with high burn-up structure (HBS)

  6. Copper (II)

    African Journals Online (AJOL)

    CLEMENT O BEWAJI

    Valine (2 - amino - 3 – methylbutanoic acid), is a chemical compound containing .... Stability constant (Kf). Gibb's free energy. ) (. 1. −. ∆. Mol. JG. [CuL2(H2O)2] ... synthesis and characterization of Co(ii), Ni(ii), Cu (II), and Zn(ii) complexes with ...

  7. Efficacy of second generation lithotriptors: a multicenter comparative study of 2,206 extracorporeal shock wave lithotripsy treatments with the Siemens Lithostar, Dornier HM4, Wolf Piezolith 2300, Direx Tripter X-1 and Breakstone lithotriptors

    NARCIS (Netherlands)

    Bierkens, A. F.; Hendrikx, A. J.; de Kort, V. J.; de Reyke, T.; Bruynen, C. A.; Bouve, E. R.; Beek, T. V.; Vos, P.; Berkel, H. V.

    1992-01-01

    Extracorporeal shock wave lithotripsy (ESWL) has become the treatment of choice for urinary calculi. The good results of the first generation Dornier HM3 lithotriptor stimulated the development of second generation machines. A multicenter trial is presented involving the Siemens Lithostar, Dornier

  8. Review of the Contribution of the Scottish Science Centres Network to Formal and Informal Science Education: Report of Follow-Through Visits by HM Inspectorate of Education--June 2009

    Science.gov (United States)

    Her Majesty's Inspectorate of Education, 2009

    2009-01-01

    In 2006, the Scottish Executive's Enterprise, Transport and Lifelong Learning Department (SEETLLD) asked HM Inspectorate of Education (HMIE) to carry out a review of the four Scottish science centres--Glasgow Science Centre (GSC), Our Dynamic Earth (ODE) in Edinburgh, Satrosphere Science Centre in Aberdeen, and Sensation Science Centre in Dundee.…

  9. Perfil bioquímico do soro de frangos de corte alimentados com dieta suplementada com alfa-amilase de Cryptococcus flavus e Aspergillus niger HM2003 Biochemichal serum profile of broilers fed diets suplemented with alfa-amylase from Cryptococcus flavus and Aspergillus niger HM2003

    Directory of Open Access Journals (Sweden)

    Cibele Silva Minafra

    2010-12-01

    Full Text Available Avaliou-se o perfil bioquímico do soro de frangos de corte alimentados com a enzima α-amilase produzida por dois microrganismos. Produziram-se dois extratos, um com a-amilase obtida a partir de Cryptococcus flavus em meio de levedura comercial e outro com Aspergillus niger HM2003 em meio de proteína de soja e amido comercial, com atividade de 9,58 U/mL e 10,0 U/mL, respectivamente. Utilizaram-se 360 pintos de corte Cobb 500 de 1 dia de idade e com 49,72 ± 0,68 g de peso vivo inicial. As aves foram alojadas em baterias e foram criadas até os 21 dias de idade. Foram utilizados três dietas, cada uma com cinco repetições de 12 aves, em delineamento inteiramente casualizado. A primeira dieta (basal foi formulada sem adição de enzima e as outras duas receberam a suplementação de a-amilase produzida por cultivo de Cryptococcus flavus e Aspergillus niger HM2003. Dietas à base de milho e soja foram formuladas em duas fases: pré-inicial (1-7 dias e inicial (8-21 dias. Na fase pré-inicial, foram observados os seguintes valores médios para cálcio (6,90 e 5,99 mg/dL, proteína plasmática (2,0 e 2,50 g/dL e fosfatase alcalina (979,98 e 974,66 UI/L, respectivamente para Cryptococcus flavus e Aspergillus niger HM2003. A dieta acrescida de a-amilase obtida a partir de Aspergillus niger HM2003 determinou maior concentração sérica de fósforo. Na fase inicial, os resultados significativos relacionaram-se a potássio quando avaliadas dietas com adição de a-amilase pelas duas fontes. A incorporação das enzimas testadas não proporciona alterações metabólicas ou toxicidade nos animais.It was evaluated the biochemical serum profile of broilers fed rations supplemented with α-amylase produced by two microorganisms. Two extracts were produced, one was produced with a-amylase obtained from Cryptococcus flavus in a commercial yeast-based medium and the other with Aspergillus niger HM2003 produced in soybean protein and commercial starch medium

  10. Improved regional-scale groundwater representation by the coupling of the mesoscale Hydrologic Model (mHM v5.7) to the groundwater model OpenGeoSys (OGS)

    Science.gov (United States)

    Jing, Miao; Heße, Falk; Kumar, Rohini; Wang, Wenqing; Fischer, Thomas; Walther, Marc; Zink, Matthias; Zech, Alraune; Samaniego, Luis; Kolditz, Olaf; Attinger, Sabine

    2018-06-01

    Most large-scale hydrologic models fall short in reproducing groundwater head dynamics and simulating transport process due to their oversimplified representation of groundwater flow. In this study, we aim to extend the applicability of the mesoscale Hydrologic Model (mHM v5.7) to subsurface hydrology by coupling it with the porous media simulator OpenGeoSys (OGS). The two models are one-way coupled through model interfaces GIS2FEM and RIV2FEM, by which the grid-based fluxes of groundwater recharge and the river-groundwater exchange generated by mHM are converted to fixed-flux boundary conditions of the groundwater model OGS. Specifically, the grid-based vertical reservoirs in mHM are completely preserved for the estimation of land-surface fluxes, while OGS acts as a plug-in to the original mHM modeling framework for groundwater flow and transport modeling. The applicability of the coupled model (mHM-OGS v1.0) is evaluated by a case study in the central European mesoscale river basin - Nägelstedt. Different time steps, i.e., daily in mHM and monthly in OGS, are used to account for fast surface flow and slow groundwater flow. Model calibration is conducted following a two-step procedure using discharge for mHM and long-term mean of groundwater head measurements for OGS. Based on the model summary statistics, namely the Nash-Sutcliffe model efficiency (NSE), the mean absolute error (MAE), and the interquartile range error (QRE), the coupled model is able to satisfactorily represent the dynamics of discharge and groundwater heads at several locations across the study basin. Our exemplary calculations show that the one-way coupled model can take advantage of the spatially explicit modeling capabilities of surface and groundwater hydrologic models and provide an adequate representation of the spatiotemporal behaviors of groundwater storage and heads, thus making it a valuable tool for addressing water resources and management problems.

  11. Modification of the Assessment of Life Habits (LIFE-Hm) to consider personalized satisfaction with participation in activities and roles: results from a construct validity study with older adults.

    Science.gov (United States)

    Roy-Bouthot, Kathleen; Filiatrault, Patrick; Caron, Cyndi; Gagnon, Maxime; Prémont, Stéphanie; Levasseur, Mélanie

    2014-01-01

    Participation, defined as a person's involvement in activities and roles, is a primary intervention goal in rehabilitation. To achieve client-centered practice, rehabilitation professionals need to go beyond objective accomplishment criteria and consider satisfaction with and the importance of participation in activities and roles. To our knowledge, no instrument considers accomplishment, satisfaction and importance of activities and roles, and allows numerical scoring and comparison. The objectives of this study were to modify the Assessment of Life Habits questionnaire (LIFE-Hm) to consider personalized satisfaction (satisfaction weighted by importance) with participation in activities and roles, and to: (1) examine its convergent validity with quality of life (QOL) and (2) compare the associations between QOL on the one hand and, satisfaction (LIFE-H) and personalized satisfaction (LIFE-Hm) with participation on the other. A descriptive cross-sectional study was conducted with 84 older adults, average age 76 years, with different functional autonomy levels. Quality of life was associated with personalized satisfaction for all categories of activities and roles (r = 0.45 to 0.75; p study found good construct validity of the LIFE-Hm with QOL. Personalization can add value in achieving client-centered practice. Implications for Rehabilitation The LIFE-Hm becomes the first instrument available in English and French that allows comparison between individuals and informs rehabilitation professionals about the level of accomplishment, satisfaction and personalized satisfaction with participation in activities and roles. Personalized satisfaction can add value in achieving client-centered practice as it considers not only how satisfying activities and roles are for the person, but also the importance that these activities and roles have for her/him. The LIFE-Hm offers the advantage of systematically identifying activities and roles which are not satisfactory but

  12. NmF2 and hmF2 measurements at 95° E and 127° E around the EIA northern crest during 2010-2014

    Science.gov (United States)

    Kalita, Bitap Raj; Bhuyan, Pradip Kumar; Yoshikawa, Akimasa

    2015-11-01

    The characteristics of the F2 layer parameters NmF2 and hmF2 over Dibrugarh (27.5° N, 95° E, 17° N geomagnetic, 43° dip) measured by a Canadian Advanced Digital Ionosonde (CADI) for the period of August 2010 to July 2014 are reported for the first time from this low mid-latitude station lying within the daytime peak of the longitudinal wave number 4 structure of equatorial anomaly (EIA) around the northern edge of anomaly crest. Equinoctial asymmetry is clearly observed at all solar activity levels whereas the midday winter anomaly is observed only during high solar activity years and disappears during the temporary dip in solar activity in 2013 but forenoon winter anomaly can be observed even at moderate solar activity. The NmF2/hmF2 variations over Dibrugarh are compared with that of Okinawa (26.5° N, 127° E, 17° N geomagnetic), and the eastward propagation speed of the wave number 4 longitudinal structure from 95° E to 127° E is estimated. The speed is found to be close to the theoretical speed of the wave number 4 (WN4) structure. The correlation of daily NmF2 over Dibrugarh and Okinawa with solar activity exhibits diurnal and seasonal variations. The highest correlation in daytime is observed during the forenoon hours in equinox. The correlation of daily NmF2 (linear or non-linear) with solar activity exhibits diurnal variation. A tendency for amplification with solar activity is observed in the forenoon and late evening period of March equinox and the postsunset period of December solstice. NmF2 saturation effect is observed only in the midday period of equinox. Non-linear variation of neutral composition at higher altitudes and variation of recombination rates with solar activity via temperature dependence may be related to the non-linear trend. The noon time maximum NmF2 over Dibrugarh exhibits better correlation with equatorial electrojet (EEJ) than with solar activity and, therefore, new low-latitude NmF2 index is proposed taking both solar

  13. (II) complexes

    African Journals Online (AJOL)

    activities of Schiff base tin (II) complexes. Neelofar1 ... Conclusion: All synthesized Schiff bases and their Tin (II) complexes showed high antimicrobial and ...... Singh HL. Synthesis and characterization of tin (II) complexes of fluorinated Schiff bases derived from amino acids. Spectrochim Acta Part A: Molec Biomolec.

  14. Novel elastic, lattice dynamics and thermodynamic properties of metallic single-layer transition metal phosphides: 2H-M 2P (Mo2P, W2P, Nb2P and Ta2P)

    Science.gov (United States)

    Yin, Jiuren; Wu, Bozhao; Wang, Yanggang; Li, Zhimi; Yao, Yuanpeng; Jiang, Yong; Ding, Yanhuai; Xu, Fu; Zhang, Ping

    2018-04-01

    Recently, there has been a surge of interest in the research of two-dimensional (2D) phosphides due to their unique physical properties and wide applications. Transition metal phosphides 2H-M 2Ps (Mo2P, W2P, Nb2P and Ta2P) show considerable catalytic activity and energy storage potential. However, the electronic structure and mechanical properties of 2D 2H-M 2Ps are still unrevealed. Here, first-principles calculations are employed to investigate the lattice dynamics, elasticity and thermodynamic properties of 2H-M 2Ps. Results show that M 2Ps with lower stiffness exhibit remarkable lateral deformation under unidirectional loads. Due to the largest average Grüneisen parameter, single-layer Nb2P has the strongest anharmonic vibrations, resulting in the highest thermal expansion coefficient. The lattice thermal conductivities of Ta2P, W2P and Nb2P contradict classical theory, which would predict a smaller thermal conductivity due to the much heavier atom mass. Moreover, the calculations also demonstrate that the thermal conductivity of Ta2P is the highest as well as the lowest thermal expansion, owing to its weak anharmonic phonon scattering and the lowest average Grüneisen parameter. The insight provided by this study may be useful for future experimental and theoretical studies concerning 2D transition metal phosphide materials.

  15. Simulación con Monte Carlo para dosimetría de 153Samario-HM en un modelo anatómico geométrico de rodilla humana

    Directory of Open Access Journals (Sweden)

    Hardy Pérez Alberto Ernesto

    2010-01-01

    Full Text Available El 153Sm-hm es una nueva opción para realizar sinovectomía por radiación, que actualmente se encuentra en valoración. Este trabajo tiene como objetivo calcular la dosis absorbida en tejidos articulares proporcionada por la administración de 153Sm-hm intraarticular, utilizando la simulación de Monte Carlo, en una propuesta de un modelo simplificado anatómico geométrico de la articulación de la rodilla. Esto con el propósito de aportar datos que apoyen la administración segura y eficaz del radiofármaco en estudio a pacientes con enfermedad reumática de la articulación de la rodilla. Se concluye que la actividad administrada de 153Sm-hm por vía intra-articular es de 370 MBq para conseguir una dosis absorbida en membrana sinovial de 110 Gy, considerada como la dosis de ablación de la mencionada membrana.

  16. Ambient hemolysis and activation of coagulation is different between HeartMate II and HeartWare left ventricular assist devices.

    Science.gov (United States)

    Birschmann, Ingvild; Dittrich, Marcus; Eller, Thomas; Wiegmann, Bettina; Reininger, Armin J; Budde, Ulrich; Strüber, Martin

    2014-01-01

    Thromboembolic and bleeding events in patients with a left ventricular assist device (LVAD) are still a major cause of complications. Therefore, the balance between anti-coagulant and pro-coagulant factors needs to be tightly controlled. The principle hypothesis of this study is that different pump designs may have an effect on hemolysis and activation of the coagulation system. Referring to this, the HeartMate II (HMII; Thoratec Corp, Pleasanton, CA) and the HeartWare HVAD (HeartWare International Inc, Framingham, MA) were investigated. For 20 patients with LVAD support (n = 10 each), plasma coagulation, full blood count, and clinical chemistry parameters were measured. Platelet function was monitored using platelet aggregometry, platelet function analyzer-100 system ( Siemens, Marburg, Germany), vasodilator-stimulated phosphoprotein phosphorylation assay, immature platelet fraction, platelet-derived microparticles, and von Willebrand diagnostic. Acquired von Willebrand syndrome could be detected in all patients. Signs of hemolysis, as measured by lactate dehydrogenase levels (mean, 470 U/liter HMII, 250 U/liter HVAD; p < 0.001), were more pronounced in the HMII patients. In contrast, D-dimer analysis indicated a significantly higher activation of the coagulation system in HVAD patients (mean, 0.94 mg/liter HMII, 2.01 mg/liter HVAD; p < 0.01). The efficacy of anti-platelet therapy using clopidogrel was not sufficient in more than 50% of the patients. Our results support the finding that all patients with rotary blood pumps suffered from von Willebrand syndrome. In addition, a distinct footprint of effects on hemolysis and the coagulation system can be attributed to different devices. As a consequence, the individual status of the coagulation system needs to be controlled in long-term patients. © 2013 Published by International Society for the Heart and Lung Transplantation on behalf of International Society for Heart and Lung Transplantation.

  17. Muscle- and pneumatic-powered counterpulsating LVADs: a pilot study.

    Science.gov (United States)

    Wilde, J C; van Loon, J; Bishop, N D; Shelton, A D; Marten, C; Kolff, W J; Stephenson, L; Baciewicz, F; Nakajima, H; Thomas, G

    1994-03-01

    There is a worldwide interest in supporting the failing heart with a skeletal muscle by either wrapping it around the natural heart (dynamic cardiomyoplasty) or by constructing a skeletal muscle ventricle (SMV) used for counterpulsation. Conventional cardiomyoplasty in many clinics carries an operative mortality rate of 15-20% partly because it requires 6 weeks to train the muscle to contract continually. A flexible, pear-shaped blood pump with an inflatable air chamber was designed and made around which a muscle can be wrapped. The advantage of our design is that it can also be driven by pneumatic power, immediately supporting the circulation of a seriously ill patient while that patient is still on the operating table. After a period of time to allow for revascularization and the subsequent training of the muscle, the external pneumatic power can be gradually discontinued. Then the assisted patient becomes tether-free. If, at any time, the muscle power fails, the pneumatic-powered mechanism can be reactivated. In the preferred approach, the blood pump is connected to the aorta for diastolic counterpulsation. A muscle can either be wrapped around the blood pump directly, or around one of two separate muscle pouches connected to the blood pump. To facilitate surgery, a large pouch is inserted under the musculus latissimus dorsi, which is connected to a blood pump. When stimulated, the muscle will contract over the pouch compressing it and providing power to the blood pump. If it is found that the pressure generated in the pouch cannot meet the aortic blood pressure, it can be augmented by using a pressure amplifier.(ABSTRACT TRUNCATED AT 250 WORDS)

  18. Left ventricular assist device (lvad design features: literature review

    Directory of Open Access Journals (Sweden)

    Yu. V. Bogdanova

    2014-01-01

    Full Text Available More than 8 million people in our country suffer from heart failure. About one million of these people die each year [1]. The problem of ventricular assist device creating - a mechanical device used for partial or complete replacement of heart function - is investigated for a long time (according to [2] just in our country since the 1970s. Today plenty of encouraging results are received. There is a number of VAD models which are successfully applied to patients with heart failure. After implantation, patients conduct a way of life that is normal in many respects: they are in the family, often they have an opportunity to work in their former specialty. Some of them live with the device about 8 years [3].According to [4] for 2010 the estimated total number of long-term devices implanted in the United States per year is over 1,700 (the population of the U.S. is 305 million, compared with over 430 per year in Europe (the population of Europe is 731 million. Unfortunately, people who need a heart transplant are much more.The principle of VAD is that being connected to the left ventricle with one cannula and to the ascending aorta with the other cannula the pump fully or partially replaces the function of the natural heart. This scheme allows the use of VAD in two ways: as a "bridge to transplantation" when the device is used temporarily until the donor heart is found, and a "bridge to recovery", when through the use of VAD the function of the heart muscle is recovered.VAD system can be divided into three subsystems: blood pump, power supply system and control system (Fig. 1.Each subsystem can be the subject of separate study. Special role in the development of VAD plays medical side of the issue. Successful research and development require interaction with qualified professionals in this field. The development of VAD is a multidisciplinary problem which demands fulfilment of a number of requirements.One of the most active programs in implantation of long-term systems of artificial circulatory support is guided by German Heart Center in Berlin (DHZB [3].The well-known VAD commercial models were created by Berlin Heart (Germany, HeartWare Int. (USA, Thoratec (USA, Abiomed Inc. (USA etc.Works devoted to VAD systems can be classified in field of research, according to the above subsystems. Concerning the blood pump - a large number of works is devoted to the study of blood behavior in the pump chamber: to modeling questions [6-24], with an emphasis on red blood cells damage - hemolysis [10, 20, 23, 27-32]. Much less works are devoted to the research of rotor (impeller dynamics of the blood pump [33-36]. Application of magnetic bearings in VAD and magnetic levitation control tasks of are addressed in [33-39]. Biomedical part of design, associated with the selection and development of biocompatible materials is considered in [26, 32, 40-43]. Features of power supply systems and control of VAD mode work are given in works [26, 44-50].The integrated approach to VAD development with an emphasis on design phases is presented in the works [7, 51]. In [2] the problem of artificial heart creation in Russia on 2006 is clearly reflected. The most comprehensive systematic review of existing VAD systems with description of specifications is given in the work [54], as well as in [24, 26, 55-57]. Brief review of existing methodologies and approaches to the design of artificial heart (AH and circulatory support system (CSS are presented in the works [58, 59]. The problem of creation of mechatronic modules of AH and CSS systems is studied in [60, 61].With the purpose of further research in the development of VAD system, this work is the study of up to date problem state. The main part of the work consists of three sections. The first section is devoted to the study of blood pump. The second and the third sections are devoted to power supply system and control system respectively. Based on this analysis, the requirements to VAD development are generalized, main issues are underlined and new solutions are proposed in conclusion.Purpose of investigation.The work is devoted to studying the features of VAD design with the purpose of further research on their optimization and improvement.

  19. TBscore II

    DEFF Research Database (Denmark)

    Rudolf, Frauke; Lemvik, Grethe; Abate, Ebba

    2013-01-01

    Abstract Background: The TBscore, based on simple signs and symptoms, was introduced to predict unsuccessful outcome in tuberculosis patients on treatment. A recent inter-observer variation study showed profound variation in some variables. Further, some variables depend on a physician assessing...... them, making the score less applicable. The aim of the present study was to simplify the TBscore. Methods: Inter-observer variation assessment and exploratory factor analysis were combined to develop a simplified score, the TBscore II. To validate TBscore II we assessed the association between start...

  20. Pb II

    African Journals Online (AJOL)

    Windows User

    This investigation describes the use of non-living biomass of Aspergillus caespitosus for removal of ... Pb(II) production has exceeded 3.5 million tons per year. It has been used in the ... This biomass was selected after screening a wide range of microbes. .... prolonged, which proved better biopolymer in metal uptake (Gadd ...

  1. Single photon emission computed tomography with [[sup 99]Tc]-HM-PAO and [[sup 123]I]-IBZM in Alzheimer's disease and dementia of frontal type; Preliminary results

    Energy Technology Data Exchange (ETDEWEB)

    Frisoni, G.B.; Bianchetti, A.; Trabucchi, M. (Alzheimer' s Disease Care Unit, Ist. S. Cuore-FBF, Brescia (Italy)); Pizzolato, G.; Battistin, L. (Neurology Clinic, University Padua, Padua (Italy)); Chierichetti, F.; Ferlin, G. (Nuclear Medicine, Castelfranco Veneto Hospital, Treviso (Italy))

    1994-03-01

    Dementia of frontal type (DFT) is a fairly common degenerative disease distinct from Alzheimer's disease (AD), whose reportedly distinctive instrumental feature is frontal lobe hypoperfusion on SPECT. We evaluated the cortical dopaminergic system in 6AD, 5 DFT, and 6 control subjects with SPECT and both [[sup 99]Tc]-HM-PAO, a perfusion tracer, and [[sup 123]I]-IBZM, a D2 postsynaptic ligand. Both in AD and DFT patients, [[sup 99]Tc]-HM-PAO SPECT showed a relative frontal hypoperfusion. On the contrary, [[sup 123]I]-IBZM SPECT showed significantly reduced ligand uptake in superior frontal regions of DFT (0.89 [+-] 0.08 relative to control subjects) as compared to AD patients (0.97 [+-] 0.02; difference of means: 0.08, 95% confidence Interval 0.004 to 0.156; p = 0.041). Results suggest more marked involvement of the frontal cortical dopaminergic system in DFT than in AD patients. (au) (24 refs.).

  2. UO2 fuel behaviour at rod burn-ups up to 105 MWd/kgHM. A review of 10 years of high burn-up examinations commissioned by AREVA NP

    International Nuclear Information System (INIS)

    Goll, W.; Hoffmann, P.B.; Hellwig, C.; Sauser, W.; Spino, J.; Walker, C.T.

    2007-01-01

    Irradiation experience gained on fuel rods with burn-ups greater than 60 MWd/kgHM irradiated in the Nuclear Power Plant Goesgen, Switzerland, is described. Emphasis is placed on the fuel behaviour, which has been analysed by hot cell examinations at the Institute for Transuranium Elements and the Paul-Scherrer-Institute. Above 60 MWd/kgHM, the so-called high burn-up structure (HBS) forms and the fission gas release increases with burn-up and rod power. Examinations performed in the outer region of the fuel revealed that most if not all of the fission gas created was retained in the HBS, even at 25% porosity. Furthermore, the HBS has a relatively low swelling rate, greatly increased plasticity, and its thermal conductivity is higher than expected from the porosity. The post-irradiation examinations showed that the HBS has no detrimental effects on the performance of stationary irradiated PWR fuel irradiated to the high burn-ups that can be achieved with 5 wt% U-235 enrichment. On the contrary, the HBS results in fuel performance that is generally better than it would have been if the HBS had not formed. (orig.)

  3. Small Diameter Bomb Increment II (SDB II)

    Science.gov (United States)

    2015-12-01

    Selected Acquisition Report (SAR) RCS: DD-A&T(Q&A)823-439 Small Diameter Bomb Increment II (SDB II) As of FY 2017 President’s Budget Defense... Bomb Increment II (SDB II) DoD Component Air Force Joint Participants Department of the Navy Responsible Office References SAR Baseline (Production...Mission and Description Small Diameter Bomb Increment II (SDB II) is a joint interest United States Air Force (USAF) and Department of the Navy

  4. ' - HY'PERc;~.Lc;Et§a'.IA'"'0i§' M“AL'IGNAN'CY' _(H_.HM) 'US'!N'G ...

    African Journals Online (AJOL)

    sfsintillafion counter LKB Rabbrzta, with tritium. ¢ff1c:i<-zncyof 30%. _. Results i _ l _. Pre!_ii_”cra£ion_€m=as 'asses&ed'_using the DZ_\\_¥A and t_k1yn1i_dine ( incerporation assays. Resulzg were expresséd as_ % <_$0ntrQ1'f0I_ each experiment. _Data- are M +1'-l SE_M_of fcur cxpcziznflfits. Data were analyzed by ...

  5. Tomo II

    OpenAIRE

    Llano Zapata, José Eusebio

    2015-01-01

    Memorias, histórico, físicas, crítico, apologéticas de la América Meridional con unas breves advertencias y noticias útiles, a los que de orden de Su Majestad hubiesen de viajar y describir aquellas vastas regiones. Reino Vegetal, Tomo II. Por un anónimo americano en Cádiz por los años de 1757. Muy Señor mío, juzgo que los 20 artículos del libro que remití a Vuestra Merced le habrán hecho formar el concepto que merece la fecundidad de aquellos países en las producciones minerales. Y siendo es...

  6. ORF Alignment: EHA1 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available GVPLDLINPPVLRIKVFEPLFIVGKENYAKLD 78 ... KSVQVFGKKKTAIAVCLCKEGKGMIRVNGVPLDLINPPVLRIKVFEPLFIVGKENYA...KLD Sbjct: 1 ... KSVQVFGKKKTAIAVCLCKEGKGMIRVNGVPLDLINPPVLRIKVFEPLFIVGKENYAKLD 60 ... Query... putative [Entamoeba histolytica HM-1:IMSS] ... Length = 139 ... Query: 19 ... KSVQVFGKKKTAIAVCLCKEGKGMIRVN

  7. ORF Alignment: EHA1 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available otein [Entamoeba histolytica HM-1:IMSS] ... Length = 113 ... Query: 129 SGHTSTATTHSISFTGTGNSIGKSNATNFKVT...GSIPTLDISKPTTNIKVRFIDGKQKVFK 188 ... SGHTSTATTHSISFTGTGNSIGKSNATNFKVTGSIPTLDISKPTTNIKVRFIDGKQKVFK Sbjct: 1 ... SGHTSTATTHSISFTGTGNSIGKSNATNFKVTGSIPTLDISKPTTNIKVRFIDGKQKVFK 60 ...

  8. ORF Alignment: EHA1 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ve [Entamoeba histolytica HM-1:IMSS] ... Length = 179 ... Query: 8 ... ERSLMLNGKLYDSTVPELAHDRESCCEKIIDFNCERN...AQKRLEMLKDIVGSLGENSCILP 67 ... ERSLMLNGKLYDSTVPELAHDRESCCEKIIDFNCERNAQKRLEMLKDIVGSLGENSCILP Sbjct: ...1 ... ERSLMLNGKLYDSTVPELAHDRESCCEKIIDFNCERNAQKRLEMLKDIVGSLGENSCILP 60 ... Query: 128 E

  9. ORF Alignment: EHA1 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available 0063 [Entamoeba histolytica HM-1:IMSS] ... Length = 201 ... Query: 34 ... VGFIPTHQEIPYKEDPNYMFSKLNDVIPRTMNV...IINFYIPICVIAIISIYQKNIEKGLTV 93 ... VGFIPTHQEIPYKEDPNYMFSKLNDVIPRTMNVIINFYIPICVIAIISIYQKNIEKGLTV Sbjct...: 8 ... VGFIPTHQEIPYKEDPNYMFSKLNDVIPRTMNVIINFYIPICVIAIISIYQKNIEKGLTV 67 ... Query: 154

  10. ORF Alignment: EHA1 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available protein LSm2, putative [Entamoeba ... histolytica HM-1:IMSS] ... Length = 69 ... Query: 5 ... SFFKTLIGKEVVVELKNDVI...ITGTLIAVDQMLNIKLNNLKCDATLFPQIQTMTDCFIRGN 64 ... SFFKTLIGKEVVVELKNDVIITGTLIAVDQMLNIKLNNLKC...DATLFPQIQTMTDCFIRGN Sbjct: 1 ... SFFKTLIGKEVVVELKNDVIITGTLIAVDQMLNIKLNNLKCDATLFPQIQTMTDCFIRGN 60 ...

  11. ORF Alignment: EHA1 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available Entamoeba histolytica HM-1:IMSS] ... Length = 170 ... Query: 24 ... VDAPTQKLRKPSVWATLRADDGGVITVLQLSKDKYTIGRSGNNDVI...ISNNVSCSRKQCSI 83 ... VDAPTQKLRKPSVWATLRADDGGVITVLQLSKDKYTIGRSGNNDVIISNNVSCSRKQCSI Sbjct: 21 ... ...VDAPTQKLRKPSVWATLRADDGGVITVLQLSKDKYTIGRSGNNDVIISNNVSCSRKQCSI 80 ... Query: 144 YSIIK

  12. ORF Alignment: EHA1 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available yme, putative [Entamoeba histolytica ... HM-1:IMSS] ... Length = 145 ... Query: 7 ... IALMRLTADLKTMLTDPP...VGISSGPIDESNLYFWQATIAGPENSPFEGGLFELRLTFSDE 66 ... IALMRLTADLKTMLTDPPVGISSGPIDESNLYFWQATIAGPENSPF...EGGLFELRLTFSDE Sbjct: 1 ... IALMRLTADLKTMLTDPPVGISSGPIDESNLYFWQATIAGPENSPFEGGLFELRL

  13. ORF Alignment: EHA1 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available t00003 [Entamoeba histolytica HM-1:IMSS] ... Length = 365 ... Query: 252 LPFEMKYQDLIKEIGKHKIYNHFMKIIIDRN...NVFNSLFKQIKHSEKWDRLFKIEFKHEQG 311 ... LPFEMKYQDLIKEIGKHKIYNHFMKIIIDRNNVFNSLFKQIKHSEKWDRLFKIEFKHEQG Sbjct: 1 ... LPFEM

  14. ORF Alignment: EHA1 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available putative [Entamoeba histolytica HM-1:IMSS] ... Length = 228 ... Query: 96 ... VRENMEDVISTCHLERNKDLVGVFDGHNG...DSAARIAATLLKQDTKNYTLLDDIHFIDLFN 155 ... VRENMEDVISTCHLERNKDLVGVFDGHNGDSAARIAATLLKQDTKNYTLLDDIHFIDLFN Sbjct: 1 ... VRENMEDVISTC

  15. ORF Alignment: EHA1 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available 2B delta subunit, putative [Entamoeba ... histolytica HM-1:IMSS] ... Length = 249 ... Query: 363 KASKLTQSSECI...PL------------------------XXXXXXXXXXXXATAQTVSSNI 398 ... KASKLTQSSECIPL ... ... ... ATAQTVSSNI Sbjct: 1 ... KASKLTQSSECIPLIEENVKLLEHARTITVGMNNVRKFIFM

  16. ORF Alignment: EHA1 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available 2B delta subunit, putative [Entamoeba ... histolytica HM-1:IMSS] ... Length = 249 ... Query: 248 KASKLTQSSECI...PLIEENVKLLEHARTITVGMNNVRKFIFMKNQSIENIIATAQTVSSNI 307 ... KASKLTQSSECIPLIEENVKLLEHARTITVGM...NNVRKFIFMKNQSIENIIATAQTVSSNI Sbjct: 1 ... KASKLTQSSECIPLIEENVKLLEHARTITVGMNNVRKFIFM

  17. ORF Alignment: EHA1 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available rotein [Entamoeba histolytica HM-1:IMSS] ... Length = 103 ... Query: 31 ... KVVRKPACNWSVEEDRKLLDAVNKFGKSRWVEIAEFVGSRSRKQCRERYINHIS...PMIDTS 90 ... KVVRKPACNWSVEEDRKLLDAVNKFGKSRWVEIAEFVGSRSRKQCRERYINHISPMIDTS Sbjct: 1 ... KVVRKPACNWSVEEDRKLLDAVNKFGKSRWVEIAEFVGSRSRKQCRERYINHISPMIDTS 60 ...

  18. ORF Alignment: EHA1 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available tative [Entamoeba histolytica HM-1:IMSS] ... Length = 141 ... Query: 94 ... GFKTLSPYELNQMINSSKLDELFIIDVRYPY...EYNGGHVRSSMNISTETALYKELNKLFEI 153 ... GFKTLSPYELNQMINSSKLDELFIIDVRYPYEYNGGHVRSSMNISTETALYKELNKLFEI Sbjct: 1 ... GFKTLSPYELNQMINS

  19. ORF Alignment: EHA1 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available rotein, putative [Entamoeba histolytica ... HM-1:IMSS] ... Length = 204 ... Query: 7 ... QWQKAQETIFVDWIND...TLKPDIIISNLEEDLKTGVNLILLVEKLTNKHCSEKIIENPKFR 66 ... QWQKAQETIFVDWINDTLKPDIIISNLEEDLKTGVNLILLVEK...LTNKHCSEKIIENPKFR Sbjct: 1 ... QWQKAQETIFVDWINDTLKPDIIISNLEEDLKTGVNLILLVEKLTNKHCSEK

  20. ORF Alignment: EHA1 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available .t00007 [Entamoeba histolytica HM-1:IMSS] ... Length = 56 ... Query: 454 QTFEVERIVRKKIVHGNTSYLVKWKNYSSKDNTWETEDDIRT...KYGDLVDDFEKNQK 509 ... QTFEVERIVRKKIVHGNTSYLVKWKNYSSKDNTWETEDDIRTKYGDLVDDFEKNQK Sbjct: 1 ... QTFEVERIVRKKIVHGNTSYLVKWKNYSSKDNTWETEDDIRTKYGDLVDDFEKNQK 56

  1. ORF Alignment: EHA1 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available Entamoeba histolytica HM-1:IMSS] ... Length = 219 ... Query: 344 EPAQADPENTYADGEGVEKCDAGKGPVKFTIHCVNKVGTSVPVTGAKFKVIIRSN...DGNEI 403 ... EPAQADPENTYADGEGVEKCDAGKGPVKFTIHCVNKVGTSVPVTGAKFKVIIRSNDGNEI Sbjct: 1 ... ... EPAQADPENTYADGEGVEKCDAGKGPVKFTIHCVNKVGTSVPVTGAKFKVIIRSNDGNEI 60 ... Query: 464 GVEG

  2. ORF Alignment: EHA1 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available tamoeba histolytica HM-1:IMSS] ... Length = 219 ... Query: 344 EPAQADPENTYADGEGVEKCDAGKGPVKFTIHCVNKVGTAVPVTGAKFKVIIRSN...DGNEI 403 ... EPAQADPENTYADGEGVEKCDAGKGPVKFTIHCVNKVGTAVPVTGAKFKVIIRSNDGNEI Sbjct: 1 ... E...PAQADPENTYADGEGVEKCDAGKGPVKFTIHCVNKVGTAVPVTGAKFKVIIRSNDGNEI 60 ... Query: 464 GVEGGV

  3. Influence of regenerative heat treatment on structure and properties of G20CrMo2 - 5 (L20HM cast steel

    Directory of Open Access Journals (Sweden)

    G. Golański

    2008-03-01

    Full Text Available Thc papcr prcscnts rcsuSts or rcscarch on thc influence of rcgcncratic hcat treatment on thc structurc and propcrtics [hardncss. impactcncrgy or L2O11M cnst stccl. Invcstipatcd material was taken from outer fmmc of a turbinc which was scrviccd for t 67 424 hours a! thctcmpcrauirc or 535 "C and prcssurc or 12.75 MPa. In psi-operating condition ~hicnv cstigntcd cast steel was cl~aracteri~cbdy low impactcncrpy of II I ant1 hart3ncss of 139HV30. Analysis uF the irlflue~~uuel ;lustcniriz;~ti on pariimctcrs (tcrnpcr;lturc and lime has rcvealcd rhntat thc tcinpcr;~turcr angc o f 895 + 955 "C (i-e. h3 - +I IO + 70 "C.fo r both 3 and 5 hours of holtl timc. rhc ohtaincd grain sizc amounls to 20+ 2511m. I has hccn pmved that tempcred bainitic-rcrri~ica nd remit ic-hainiric-pearlit ic stn~cturco f thc invcstigatcd cast stccl msurcs highimpact cncrgy, i.c. KV > 1001. as well a5 hardncss. i.e. 11Y30. just at thc tcrnpcmturc of OXl "C. 'I'crnpcmliirc or 7110 "C causcs i'~tnhcrincrclrsc of impact cncrgy along with a slight dccrcasc of hardncss. Morcovcr. it has hccn concludd that nppl ying oS under-annealinginstcad or tcmpcring. nflcr standardizalion. guarantees scquircd impact cncrgy of KY r 271.

  4. Cd(II), Cu(II)

    African Journals Online (AJOL)

    user

    Depending on the way goethite was pretreated with oxalic acid, affinity for Cd(II) varied ...... Effects and mechanisms of oxalate on Cd(II) adsorption on goethite at different ... precipitation, surfactant mediation, hydrothermal and micro-emulsion.

  5. Cu(II) AND Zn(II)

    African Journals Online (AJOL)

    Preferred Customer

    SYNTHESIS OF 2,2-DIMETHYL-4-PHENYL-[1,3]-DIOXOLANE USING ZEOLITE. ENCAPSULATED Co(II), Cu(II) AND Zn(II) COMPLEXES. B.P. Nethravathi1, K. Rama Krishna Reddy2 and K.N. Mahendra1*. 1Department of Chemistry, Bangalore University, Bangalore-560001, India. 2Department of Chemistry, Government ...

  6. Elizabeth II uus kunstigalerii

    Index Scriptorium Estoniae

    1999-01-01

    Tähistamaks oma troonile asumise 50. aastapäeva, avab Elizabeth II 6. II 2002 Buckinghami palees uue kunstigalerii, mis ehitatakse palee tiibhoonena. Arhitekt John Simpson. Elizabeth II kunstikogust

  7. Synthesis and characterisation of Cu(II), Ni(II), Mn(II), Zn(II) and VO(II ...

    Indian Academy of Sciences (India)

    Unknown

    Synthesis and characterisation of Cu(II), Ni(II), Mn(II), Zn(II) and VO(II) Schiff base complexes derived from o-phenylenediamine and acetoacetanilide. N RAMAN*, Y PITCHAIKANI RAJA and A KULANDAISAMY. Department of Chemistry, VHNSN College, Virudhunagar 626 001, India e-mail: ra_man@123india.com.

  8. 78 FR 65453 - Hazardous Materials: Corrections and Response to Administrative Appeals (HM-215K, HM-215L, HM...

    Science.gov (United States)

    2013-10-31

    ... energy storage capacity less than or equal to 10 Wh, provided in special provision of A186 of the ICAO TI... Division 4.1 (Flammable Solid) material for transportation by motor vehicle, rail car, vessel, or cargo... transportation by motor vehicle, rail car, vessel, or cargo-only aircraft, subject to the following conditions...

  9. Eesti Kunstnikkude Rühm / Reet Mark

    Index Scriptorium Estoniae

    Mark, Reet, 1965-

    2010-01-01

    Kubism enne rühma. Valga-Pensa taustaga sõbrad. Rakvere-Tallinna taustaga sõbrad. EKR kõrgaeg 1924-25. Lahkumised. Tallinlaste kõrghetked. Vaated kunstile. Tegevuse vaibumine pärast 1928. aastat

  10. Comparison of midlatitude ionospheric F region peak parameters and topside Ne profiles from IRI2012 model prediction with ground-based ionosonde and Alouette II observations

    Science.gov (United States)

    Gordiyenko, G. I.; Yakovets, A. F.

    2017-07-01

    The ionospheric F2 peak parameters recorded by a ground-based ionosonde at the midlatitude station Alma-Ata [43.25N, 76.92E] were compared with those obtained using the latest version of the IRI model (http://omniweb.gsfc.nasa.gov/vitmo/iri2012_vitmo.html). It was found that for the Alma-Ata (Kazakhstan) location, the IRI2012 model describes well the morphology of seasonal and diurnal variations of the ionospheric critical frequency (foF2) and peak density height (hmF2) monthly medians. The model errors in the median foF2 prediction (percentage deviations between the median foF2 values and their model predictions) were found to vary approximately in the range from about -20% to 34% and showed a stable overestimation in the median foF2 values for daytime in January and July and underestimation for day- and nighttime hours in the equinoctial months. The comparison between the ionosonde hmF2 and IRI results clearly showed that the IRI overestimates the nighttime hmF2 values for March and September months, and the difference is up to 30 km. The daytime Alma-Ata hmF2 data were found to be close to the IRI predictions (deviations are approximately ±10-15 km) in winter and equinoctial months, except in July when the observed hmF2 values were much more (from approximately 50-200 km). The comparison between the Alouette foF2 data and IRI predictions showed mixed results. In particular, the Alouette foF2 data showed a tendency to be overestimated for daytime in winter months similar to the ionosonde data; however, the overestimated foF2 values for nighttime in the autumn equinox were in disagreement with the ionosonde observations. There were large deviations between the observed hmF2 values and their model predictions. The largest deviations were found during winter and summer (up to -90 km). The comparison of the Alouette II electron density profiles with those predicted by the adapted IRI2012 model in the altitude range hmF2 of the satellite position showed a great

  11. (II) COMPLEX COMPOUND

    African Journals Online (AJOL)

    user

    electrochemical sensors, as well as in various chromatographic ... were carried out using Jenway pH meter Model 3320 and a conductivity ... Figure 1: the proposed molecular structure of the copper (II) Schiff base complex. M = Cu (II) or Mn (II).

  12. and copper(II)

    Indian Academy of Sciences (India)

    Unknown

    (II) and copper(II)–zinc(II) complexes. SUBODH KUMAR1, R N PATEL1*, P V KHADIKAR1 and. K B PANDEYA2. 1 Department of Chemistry, APS University, Rewa 486 003, India. 2 CSJM University, Kanpur 208 016, India e-mail: (R N Patel) ...

  13. Validation of KENOREST with LWR-PROTEUS phase II samples

    Energy Technology Data Exchange (ETDEWEB)

    Wagner, M.; Kilger, R.; Pautz, A.; Zwermann, W. [GRS, Garching (Germany); Grimm, P.; Vasiliev, A.; Ferroukhi, H. [Paul Scherrer Institut, Villigen (Switzerland)

    2012-11-01

    In order to broaden the validation basis of the reactivity and nuclide inventory code KENOREST two samples of the LWR-PROTEUS phase II program have been calculated and compared to the experimental results. In general most nuclides are reproduced very well and agree within about ten percent with the experiment. Some already known problems, the overprediction of metallic fission products and the underprediction of the higher curium isotopes, have been confirmed. One of the largest uncertainties in the calculation was the burnup of the samples due to differences between a core simulation of the fuel vendor and the burnup determined from the measured values of the burnup indicator Nd-148. Two different models taking into account the environment for a peripheral fuel rod have been studied. The more detailed model included the three direct neighbor fuel assemblies depleted along with the fuel rod of interest. The influence on the results has been found to be very small. Compared to the uncertainties from the burnup, this effect can be considered negligible. The reason for the low influence was basically that the spectrum did not get considerably harder with increasing burnup beyond about 20GWd/tHM. Since the sample reached burnups far beyond that value, an effect could not be seen. In the near future an update of the used libraries is planned and it will be very interesting to study the effect on the results, especially for Curium. (orig.)

  14. Pius II. a utrakvismus

    OpenAIRE

    Šimek, Milan

    2009-01-01

    Milan Šimek Pius II. a utrakvismus Pius II. and utraquism Based on sources work - out, the thesis aims the description and analysis of the attitude alternation of Enea Sylvio Piccolomini - Pius II to the utraquism. The conclusions stress the postulate that Pius II. did not change that attitude, but just did not succed in quelling the utraquist movement. In the sense of political background that finally led to fatal dissention among both leaders, king Jiří of Poděbrady and pope Pius II.

  15. Complexes of cobalt(II), nickel(II), copper(II), zinc(II), cadmium(II) and dioxouranium(II) with thiophene-2-aldehydethiosemicarbazone

    International Nuclear Information System (INIS)

    Singh, Balwan; Misra, Harihar

    1986-01-01

    Metal complexes of thiosemicarbazides have been known for their pharmacological applications. Significant antitubercular, fungicidal and antiviral activities have been reported for thiosemicarbazides and their derivatives. The present study describes the systhesis and characterisation of complexes of Co II , Cu II , Zn II ,Cd II and UO II with thiosemicarbazone obtained by condensing thiophene-2-aldehyde with thiosemicarbazide. 17 refs., 2 tables. (author)

  16. ORF Alignment: EHA1 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available 6, putative [Entamoeba histolytica ... HM-1:IMSS] ... Length = 122 ... Query: 26 ... LQRRKGMIRVNGVPLDLINPPVLRIKVFEPLFIVGKENYA...KLDLKIRVTGGGQVAQAYAI 85 ... LQRRKGMIRVNGVPLDLINPPVLRIKVFEPLFIVGKENYAKLDLKIRV...TGGGQVAQAYAI Sbjct: 1 ... LQRRKGMIRVNGVPLDLINPPVLRIKVFEPLFIVGKENYAKLDLKIRVTGGGQVAQAYAI 60 ... Query: 146 YR 147 ... YR Sbjct: 121 YR 122

  17. Chemistry and the Internal Combustion Engine II: Pollution Problems.

    Science.gov (United States)

    Hunt, C. B.

    1979-01-01

    Discusses pollution problems which arise from the use of internal combustion (IC) engines in the United Kingdom (UK). The IC engine exhaust emissions, controlling IC engine pollution in the UK, and some future developments are also included. (HM)

  18. ORF Alignment: EHA1 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available tein [Entamoeba histolytica HM-1:IMSS] ... Length = 131 ... Query: 3 ... FEYLDHPADVILHSWGQNIIEAFENAAAGMFNFMSDLT...NIDATSYEEALVKFLDSWLCIF 62 ... FEYLDHPADVILHSWGQNIIEAFENAAAGMFNFMSDLTNIDATSYEEALVKFLDSWLCIF Sbjct...: 1 ... FEYLDHPADVILHSWGQNIIEAFENAAAGMFNFMSDLTNIDATSYEEALVKFLDSWLCIF 60 ... Query: 123 DQTHIHILLDI 133 ... DQTHIHILLDI Sbjct: 121 DQTHIHILLDI 131

  19. Quininium tetrachloridozinc(II

    Directory of Open Access Journals (Sweden)

    Li-Zhuang Chen

    2009-10-01

    Full Text Available The asymmetric unit of the title compound {systematic name: 2-[hydroxy(6-methoxyquinolin-1-ium-4-ylmethyl]-8-vinylquinuclidin-1-ium tetrachloridozinc(II}, (C20H26N2O2[ZnCl4], consists of a double protonated quininium cation and a tetrachloridozinc(II anion. The ZnII ion is in a slightly distorted tetrahedral coordination environment. The crystal structure is stabilized by intermolecular N—H...Cl and O—H...Cl hydrogen bonds.

  20. Burkina Faso - BRIGHT II

    Data.gov (United States)

    Millennium Challenge Corporation — Millennium Challenge Corporation hired Mathematica Policy Research to conduct an independent evaluation of the BRIGHT II program. The three main research questions...

  1. Study of diffuse H II regions potentially forming part of the gas streams around Sgr A*

    Science.gov (United States)

    Armijos-Abendaño, J.; López, E.; Martín-Pintado, J.; Báez-Rubio, A.; Aravena, M.; Requena-Torres, M. A.; Martín, S.; Llerena, M.; Aldás, F.; Logan, C.; Rodríguez-Franco, A.

    2018-05-01

    We present a study of diffuse extended ionized gas towards three clouds located in the Galactic Centre (GC). One line of sight (LOS) is towards the 20 km s-1 cloud (LOS-0.11) in the Sgr A region, another LOS is towards the 50 km s-1 cloud (LOS-0.02), also in Sgr A, while the third is towards the Sgr B2 cloud (LOS+0.693). The emission from the ionized gas is detected from Hnα and Hmβ radio recombination lines (RRLs). Henα and Hemβ RRL emission is detected with the same n and m as those from the hydrogen RRLs only towards LOS+0.693. RRLs probe gas with positive and negative velocities towards the two Sgr A sources. The Hmβ to Hnα ratios reveal that the ionized gas is emitted under local thermodynamic equilibrium conditions in these regions. We find a He to H mass fraction of 0.29±0.01 consistent with the typical GC value, supporting the idea that massive stars have increased the He abundance compared to its primordial value. Physical properties are derived for the studied sources. We propose that the negative velocity component of both Sgr A sources is part of gas streams considered previously to model the GC cloud kinematics. Associated massive stars with what are presumably the closest H II regions to LOS-0.11 (positive velocity gas), LOS-0.02, and LOS+0.693 could be the main sources of ultraviolet photons ionizing the gas. The negative velocity components of both Sgr A sources might be ionized by the same massive stars, but only if they are in the same gas stream.

  2. cobalt(II), nickel(II)

    Indian Academy of Sciences (India)

    Unknown

    procedures. The supporting electrolyte, NaClO4 used in the voltammetric experiment was purchased from. Sigma. IR spectra were recorded in KBr medium on .... (13⋅6). L = Schiff base ligand form of one broad band envelope. The electronic spectra of Co(II) complex showed two spin-allowed transitions at 17856 and ...

  3. Nuclear physics II

    International Nuclear Information System (INIS)

    Elze, T.

    1988-01-01

    This script consisting of two parts contains the matter of the courses Nuclear Pyhsics I and II, as they were presented in the winter term 1987/88 and summer term 1988 for students of physics at Frankfurt University. In the present part II the matter of the summer term is summarized. (orig.) [de

  4. World War II Homefront.

    Science.gov (United States)

    Garcia, Rachel

    2002-01-01

    Presents an annotated bibliography that provides Web sites focusing on the U.S. homefront during World War II. Covers various topics such as the homefront, Japanese Americans, women during World War II, posters, and African Americans. Includes lesson plan sources and a list of additional resources. (CMK)

  5. Biologically active new Fe(II, Co(II, Ni(II, Cu(II, Zn(II and Cd(II complexes of N-(2-thienylmethylenemethanamine

    Directory of Open Access Journals (Sweden)

    C. SPÎNU

    2008-04-01

    Full Text Available Iron(II, cobalt(II, nickel (II, copper (II, zinc(II and cadmium(II complexes of the type ML2Cl2, where M is a metal and L is the Schiff base N-(2-thienylmethylenemethanamine (TNAM formed by the condensation of 2-thiophenecarboxaldehyde and methylamine, were prepared and characterized by elemental analysis as well as magnetic and spectroscopic measurements. The elemental analyses suggest the stoichiometry to be 1:2 (metal:ligand. Magnetic susceptibility data coupled with electronic, ESR and Mössbauer spectra suggest a distorted octahedral structure for the Fe(II, Co(II and Ni(II complexes, a square-planar geometry for the Cu(II compound and a tetrahedral geometry for the Zn(II and Cd(II complexes. The infrared and NMR spectra of the complexes agree with co-ordination to the central metal atom through nitrogen and sulphur atoms. Conductance measurements suggest the non-electrolytic nature of the complexes, except for the Cu(II, Zn(II and Cd(II complexes, which are 1:2 electrolytes. The Schiff base and its metal chelates were screened for their biological activity against Escherichia coli, Staphylococcus aureus and Pseudomonas aeruginosa and the metal chelates were found to possess better antibacterial activity than that of the uncomplexed Schiff base.

  6. Evolved H II regions

    International Nuclear Information System (INIS)

    Churchwell, E.

    1975-01-01

    A probable evolutionary sequence of H II regions based on six distinct types of observed objects is suggested. Two examples which may deviate from this idealized sequence, are discussed. Even though a size-mean density relation of H II regions can be used as a rough indication of whether a nebula is very young or evolved, it is argued that such a relation is not likely to be useful for the quantitative assignment of ages to H II regions. Evolved H II regions appear to fit into one of four structural types: rings, core-halos, smooth structures, and irregular or filamentary structures. Examples of each type are given with their derived physical parameters. The energy balance in these nebulae is considered. The mass of ionized gas in evolved H II regions is in general too large to trace the nebula back to single compact H II regions. Finally, the morphological type of the Galaxy is considered from its H II region content. 2 tables, 2 figs., 29 refs

  7. Preliminary PBFA II design

    International Nuclear Information System (INIS)

    Johnson, D.L.; VanDevender, J.P.; Martin, T.H.

    1980-01-01

    The upgrade of Sandia National Laboratories particle beam fusion accelerator, PBFA I, to PBFA II presents several interesting and challenging pulsed power design problems. PBFA II requires increasing the PBFA I output parameters from 2 MV, 30 TW, 1 MJ to 4 MV, 100 TW, 3.5 MJ with the constraint of using much of the same PBFA I hardware. The increased PBFA II output will be obtained by doubling the number of modules (from 36 to 72), increasing the primary energy storage (from 4 MJ to 15 MJ), lowering the pulse forming line (PFL) output impedance, and adding a voltage doubling network

  8. Mn(II), Zn(II) and VO(II) Schiff

    Indian Academy of Sciences (India)

    Home; Journals; Journal of Chemical Sciences; Volume 113; Issue 3. Synthesis and characterisation of Cu(II), Ni(II), Mn(II), Zn(II) and VO(II) Schiff base complexes derived from o-phenylenediamine and acetoacetanilide. N Raman Y Pitchaikani Raja A Kulandaisamy. Inorganic Volume 113 Issue 3 June 2001 pp 183-189 ...

  9. The Belle II Experiment

    CERN Document Server

    Kahn, J

    2017-01-01

    Set to begin data taking at the end of 2018, the Belle II experiment is the next-generation B-factory experiment hosted at KEK in Tsukuba, Japan. The experiment represents the cumulative effort from the collaboration of experimental and detector physics, computing, and software development. Taking everything learned from the previous Belle experiment, which ran from 1998 to 2010, Belle II aims to probe deeper than ever before into the field of heavy quark physics. By achieving an integrated luminosity of 50 ab−1 and accumulating 50 times more data than the previous experiment across its lifetime, along with a rewritten analysis framework, the Belle II experiment will push the high precision frontier of high energy physics. This paper will give an overview of the key components and development activities that make the Belle II experiment possible.

  10. Factor II assay

    Science.gov (United States)

    ... this page: //medlineplus.gov/ency/article/003674.htm Factor II assay To use the sharing features on ... M. is also a founding member of Hi-Ethics and subscribes to the principles of the Health ...

  11. Factor II deficiency

    Science.gov (United States)

    ... this page: //medlineplus.gov/ency/article/000549.htm Factor II deficiency To use the sharing features on ... M. is also a founding member of Hi-Ethics and subscribes to the principles of the Health ...

  12. Ni(II

    African Journals Online (AJOL)

    Preferred Customer

    analytical chemistry, catalysis, electrochemistry, ring-opening metathesis ... Ethanol was dried over anhydrous copper(II) sulfate and distilled over metallic sodium. ... All bacteria were inoculated into Nutrient Broth (Difco) and incubated for 24 h ...

  13. NNDSS - Table II. Vibriosis

    Data.gov (United States)

    U.S. Department of Health & Human Services — NNDSS - Table II. Vibriosis - 2017. In this Table, provisional cases of selected notifiable diseases (≥1,000 cases reported during the preceding year), and selected...

  14. Disruption Rose Tinted II

    OpenAIRE

    Livingstone, Andrew

    2009-01-01

    'Disruption - Rose Tinted II' continues to engage narratives of historical English china as previously explored in the work 'Rose Tinted'. This work engages the sleepy rural idyll which is overlaid with visual contemporary social commentary.

  15. NNDSS - Table II. Vibriosis

    Data.gov (United States)

    U.S. Department of Health & Human Services — NNDSS - Table II. Vibriosis - 2018. In this Table, provisional cases of selected notifiable diseases (≥1,000 cases reported during the preceding year), and selected...

  16. Gamble II Facility

    Data.gov (United States)

    Federal Laboratory Consortium — FUNCTION: Gamble II produces a high-voltage (2 MV), high-current (1 MA), short (100 ns) pulse of energy of either positive or negative polarity. This terawatt power...

  17. Leo II PC

    Data.gov (United States)

    Kansas Data Access and Support Center — LEO II is a second-generation software system developed for use on the PC, which is designed to convert location references accurately between legal descriptions and...

  18. Tokapole II device

    International Nuclear Information System (INIS)

    Sprott, J.G.

    1978-05-01

    A discussion is given of the design and operation of the Tokapole II device. The following topics are considered: physics considerations, vacuum vessel, poloidal field, ring and support design, toroidal field, vacuum system, initial results, and future plans

  19. copper(II)

    Indian Academy of Sciences (India)

    Unknown

    bis(2,2,6,6-tetramethyl-3,5-heptadionato)copper(II) ... Abstract. Equilibrium concentrations of various condensed and gaseous phases have been thermodyna- ... phere, over a wide range of substrate temperatures and total reactor pressures.

  20. Digital optical computer II

    Science.gov (United States)

    Guilfoyle, Peter S.; Stone, Richard V.

    1991-12-01

    OptiComp is currently completing a 32-bit, fully programmable digital optical computer (DOC II) that is designed to operate in a UNIX environment running RISC microcode. OptiComp's DOC II architecture is focused toward parallel microcode implementation where data is input in a dual rail format. By exploiting the physical principals inherent to optics (speed and low power consumption), an architectural balance of optical interconnects and software code efficiency can be achieved including high fan-in and fan-out. OptiComp's DOC II program is jointly sponsored by the Office of Naval Research (ONR), the Strategic Defense Initiative Office (SDIO), NASA space station group and Rome Laboratory (USAF). This paper not only describes the motivational basis behind DOC II but also provides an optical overview and architectural summary of the device that allows the emulation of any digital instruction set.

  1. SPEAR II performance

    International Nuclear Information System (INIS)

    Paterson, J.M.

    1975-01-01

    The single beam and colliding beam performance of the SLAC electron-positron storage ring SPEAR II is described. The sevenfold increase in harmonic number in SPEAR II in comparison to SPEAR I has made significant changes in single beam behavior. Strong synchrobetatron resonances and a new transverse instability are observed, and our first studies of these phenomena are described. Measurements on current dependent bunch lengthening are presented. (auth)

  2. Computing at Belle II

    International Nuclear Information System (INIS)

    Kuhr, Thomas

    2012-01-01

    Belle II, a next-generation B-factory experiment, will search for new physics effects in a data sample about 50 times larger than the one collected by its predecessor, the Belle experiment. To match the advances in accelerator and detector technology, the computing system and the software have to be upgraded as well. The Belle II computing model is presented and an overview of the distributed computing system and the offline software framework is given.

  3. Nsls-II Boster

    Science.gov (United States)

    Gurov, S. M.; Akimov, A. V.; Akimov, V. E.; Anashin, V. V.; Anchugov, O. V.; Baranov, G. N.; Batrakov, A. M.; Belikov, O. V.; Bekhtenev, E. A.; Blum, E.; Bulatov, A. V.; Burenkov, D. B.; Cheblakov, P. B.; Chernyakin, A. D.; Cheskidov, V. G.; Churkin, I. N.; Davidsavier, M.; Derbenev, A. A.; Erokhin, A. I.; Fliller, R. P.; Fulkerson, M.; Gorchakov, K. M.; Ganetis, G.; Gao, F.; Gurov, D. S.; Hseuh, H.; Hu, Y.; Johanson, M.; Kadyrov, R. A.; Karnaev, S. E.; Karpov, G. V.; Kiselev, V. A.; Kobets, V. V.; Konstantinov, V. M.; Kolmogorov, V. V.; Korepanov, A. A.; Kramer, S.; Krasnov, A. A.; Kremnev, A. A.; Kuper, E. A.; Kuzminykh, V. S.; Levichev, E. B.; Li, Y.; Long, J. De; Makeev, A. V.; Mamkin, V. R.; Medvedko, A. S.; Meshkov, O. I.; Nefedov, N. B.; Neyfeld, V. V.; Okunev, I. N.; Ozaki, S.; Padrazo, D.; Petrov, V. V.; Petrichenkov, M. V.; Philipchenko, A. V.; Polyansky, A. V.; Pureskin, D. N.; Rakhimov, A. R.; Rose, J.; Ruvinskiy, S. I.; Rybitskaya, T. V.; Sazonov, N. V.; Schegolev, L. M.; Semenov, A. M.; Semenov, E. P.; Senkov, D. V.; Serdakov, L. E.; Serednyakov, S. S.; Shaftan, T. V.; Sharma, S.; Shichkov, D. S.; Shiyankov, S. V.; Shvedov, D. A.; Simonov, E. A.; Singh, O.; Sinyatkin, S. V.; Smaluk, V. V.; Sukhanov, A. V.; Tian, Y.; Tsukanova, L. A.; Vakhrushev, R. V.; Vobly, P. D.; Utkin, A. V.; Wang, G.; Wahl, W.; Willeke, F.; Yaminov, K. R.; Yong, H.; Zhuravlev, A.; Zuhoski, P.

    The National Synchrotron Light Source II is a third generation light source, which was constructed at Brookhaven National Laboratory. This project includes a highly-optimized 3 GeV electron storage ring, linac preinjector, and full-energy synchrotron injector. Budker Institute of Nuclear Physics built and delivered the booster for NSLS-II. The commissioning of the booster was successfully completed. This paper reviews fulfilled work by participants.

  4. Hemodynamic deterioration precedes onset of ventricular tachyarrhythmia after Heartmate II implantation.

    Science.gov (United States)

    Yaksh, Ameeta; Kik, Charles; Knops, Paul; Zwiers, Korinne; van Ettinger, Maarten J B; Manintveld, Olivier C; de Wijs, Marcel C J; van der Kemp, Peter; Bogers, Ad J J C; de Groot, Natasja M S

    2016-07-08

    Early postoperative ventricular tachyarrhythmia (PoVT) after left ventricular assist device (LVAD) implantation are common and associated with higher mortality-rates. At present, there is no data on initiation of these PoVT and the role of alterations in cardiac hemodynamics. A LVAD was implanted in a patient with end-stage heart failure due to a ischemic cardiomyopathy. Alterations in cardiac rhythm and hemodynamics preceding PoVT-episodes during the first five postoperative days were examined by using continuous recordings of cardiac rhythm and various hemodynamic parameters. All PoVT (N=120) were monomorphic, most often preceded by short-long-short-sequences or regular SR and initiated by ventricular runs. Prior to PoVT, mean arterial pressure decreased; heart rate and ST-segments deviations increased. PoVT are caused by different underlying electrophysiological mechanisms. Yet, they are all monomorphic and preceded by hemodynamic deterioration due to myocardial ischemia.

  5. Theoretical study of heavy metal Cd, Cu, Hg, and Ni(II) adsorption on the kaolinite(0 0 1) surface

    Energy Technology Data Exchange (ETDEWEB)

    Zhao, Jian, E-mail: zhaojian0209@aliyun.com [Institute of Applied Physics and Computational Mathematics, PO Box 8009, Beijing 100088 (China); State Key Laboratory of Geomechanics and Deep Underground Engineering, China University of Mining and Technology, Beijing 100083 (China); He, Man-Chao [State Key Laboratory of Geomechanics and Deep Underground Engineering, China University of Mining and Technology, Beijing 100083 (China)

    2014-10-30

    Highlights: • We investigated the adsorption of Cd, Cu, Hg, and Ni(II) on kaolinite(0 0 1) surface. • The adsorption capabilities of the kaolinite for HM atoms were Ni > Cu > Cd > Hg(II). • The adsorption energy increases with the coverage for Cd, Cu, and Hg(II) atoms. • The adsorption energy decreases with the coverage for Ni(II) atoms. - Abstract: Heavy metal pollution is currently of great concern because it has been recognized as a potential threat to air, water, and soil. Adsorption was one of the most popular methods for the removal of heavy metal. The adsorption of heavy metal Cd, Cu, Hg, and Ni(II) atoms on the hydroxylated (0 0 1) surface of kaolinite was investigated using density-functional theory within the generalized gradient approximation and a supercell approach. The coverage dependence of the adsorption structures and energetics were systematically studied for a wide range of coverage Θ [from 0.11 to 1.0 monolayers (ML)] and adsorption sites. The most stable among all possible adsorption sites for Cd(II) atom was the two-fold bridge site followed by the one-fold top site, and the top site was the most favorite adsorption site for Cu and Ni(II) atoms, while the three-fold hollow site was the most stable adsorption site for Hg(II) atom followed by the two-fold bridge site. The adsorption energy increases with the coverage for Cd, Cu, and Hg(II) atoms, thus indicating the higher stability of surface adsorption and a tendency to the formation of adsorbate islands (clusters) with increasing the coverage. However, the adsorption energy of Ni(II) atoms decreases when increasing the coverage. The adsorption capabilities of the kaolinite clay for the heavy metal atoms were in the order of Ni > Cu > Cd > Hg(II). The other properties of the Cd, Cu, Hg, and Ni(II)/kaolinite(0 0 1) system including the different charge distribution, the lattice relaxation, and the electronic density of states were also studied and discussed in detail.

  6. Theoretical study of heavy metal Cd, Cu, Hg, and Ni(II) adsorption on the kaolinite(0 0 1) surface

    International Nuclear Information System (INIS)

    Zhao, Jian; He, Man-Chao

    2014-01-01

    Highlights: • We investigated the adsorption of Cd, Cu, Hg, and Ni(II) on kaolinite(0 0 1) surface. • The adsorption capabilities of the kaolinite for HM atoms were Ni > Cu > Cd > Hg(II). • The adsorption energy increases with the coverage for Cd, Cu, and Hg(II) atoms. • The adsorption energy decreases with the coverage for Ni(II) atoms. - Abstract: Heavy metal pollution is currently of great concern because it has been recognized as a potential threat to air, water, and soil. Adsorption was one of the most popular methods for the removal of heavy metal. The adsorption of heavy metal Cd, Cu, Hg, and Ni(II) atoms on the hydroxylated (0 0 1) surface of kaolinite was investigated using density-functional theory within the generalized gradient approximation and a supercell approach. The coverage dependence of the adsorption structures and energetics were systematically studied for a wide range of coverage Θ [from 0.11 to 1.0 monolayers (ML)] and adsorption sites. The most stable among all possible adsorption sites for Cd(II) atom was the two-fold bridge site followed by the one-fold top site, and the top site was the most favorite adsorption site for Cu and Ni(II) atoms, while the three-fold hollow site was the most stable adsorption site for Hg(II) atom followed by the two-fold bridge site. The adsorption energy increases with the coverage for Cd, Cu, and Hg(II) atoms, thus indicating the higher stability of surface adsorption and a tendency to the formation of adsorbate islands (clusters) with increasing the coverage. However, the adsorption energy of Ni(II) atoms decreases when increasing the coverage. The adsorption capabilities of the kaolinite clay for the heavy metal atoms were in the order of Ni > Cu > Cd > Hg(II). The other properties of the Cd, Cu, Hg, and Ni(II)/kaolinite(0 0 1) system including the different charge distribution, the lattice relaxation, and the electronic density of states were also studied and discussed in detail

  7. II-VI semiconductor compounds

    CERN Document Server

    1993-01-01

    For condensed matter physicists and electronic engineers, this volume deals with aspects of II-VI semiconductor compounds. Areas covered include devices and applications of II-VI compounds; Co-based II-IV semi-magnetic semiconductors; and electronic structure of strained II-VI superlattices.

  8. About APPLE II Operation

    International Nuclear Information System (INIS)

    Schmidt, T.; Zimoch, D.

    2007-01-01

    The operation of an APPLE II based undulator beamline with all its polarization states (linear horizontal and vertical, circular and elliptical, and continous variation of the linear vector) requires an effective description allowing an automated calculation of gap and shift parameter as function of energy and operation mode. The extension of the linear polarization range from 0 to 180 deg. requires 4 shiftable magnet arrrays, permitting use of the APU (adjustable phase undulator) concept. Studies for a pure fixed gap APPLE II for the SLS revealed surprising symmetries between circular and linear polarization modes allowing for simplified operation. A semi-analytical model covering all types of APPLE II and its implementation will be presented

  9. VATICANO II CONCILIO DOCTRINAL?

    Directory of Open Access Journals (Sweden)

    Horacio Bojorge

    1970-01-01

    Full Text Available It is a century since the army of Victor Manuel invaded Rome and put an end to Vatican I. In this article we try to understand Vatican II linking it to the previous circumtances and binding it to its doctrinal and pastoral character. Vatican II omitted many subjects that seemed important, e. g. not giving any dogmatic definitions. Contrasting with the Tridentine and Vatican I, that were mostly doctrinal, Vatican II was pastoral. But it was also doctrinal as were the two previous also pastoral. The Constitution "Dei Verbum" brings forth the intentions that led John XXIII to summon the Council in 5-8-1962. The world looked confused and agitated. What could the Church do?

  10. Datalogger usando nios ii

    OpenAIRE

    Campoverde Rugel, Luis Enrique; Velásquez Vargas, Washington Adrián; Ponguillo, Ronald

    2013-01-01

    El presente proyecto consiste en la implementación de un Datalogger utilizando el microprocesador NIOS II el cual fue embebido en el FPGA CYCLONE II que se encuentra integrada en la tarjeta de desarrollo ALTERA DE2, el cual obtiene datos de distintos sensores y los almacena en una tarjeta SD Card. Para la realización del proyecto se aplican cuatro etapas. La primera etapa está basada en obtener los datos mediante el uso de sensores y la transmisión usando un PIC, la siguiente etapa se basa...

  11. Results from SAGE II

    International Nuclear Information System (INIS)

    Nico, J.S.

    1994-01-01

    The Russian-American Gallium solar neutrino Experiment (SAGE) began the second phase of operation (SAGE II) in September of 1992. Monthly measurements of the integral flux of solar neutrinos have been made with 55 tonnes of gallium. The K-peak results of the first nine runs of SAGE II give a capture rate of 66 -13 +18 (stat) -7 +5 (sys) SNU. Combined with the SAGE I result of 73 -16 +18 (stat) -7 5 (sys) SNU, the capture rate is 69 -11 +11 (stat) -7 +5 (sys) SNU. This represents only 52%--56% of the capture rate predicted by different Standard Solar Models

  12. Information on Asse II

    International Nuclear Information System (INIS)

    2014-01-01

    The brochure published by BfS describes the actual situation of Asse II with respect to the debate on an interim storage and the status of the realization of a final repository search law. During the visit of the new environment minister Hendricks in the underground facility repository Asse II the issue interim storage site and the retrieval of the corroded casks with radioactive waste were discussed. The challenges for BFS include the acceleration of the retrieval process and the safety of the procedure.

  13. TJ-II project

    International Nuclear Information System (INIS)

    Alejaldre, C.; Gozalo, J.J.A.; Perez, J.B.; Magaria, F.C.; Diaz, J.R.C.; Perez, J.G.; Lopez-Fraguas, A.; Garcia, L.; Krivenski, V.I.; Martin, R.; Navarro, A.P.; Perea, A.; Rodriguez-Yunta, A.; Ayza, M.S.; Varias, A.

    1990-01-01

    The TJ-II device is a medium-size helical-axis stellarator to be built in Madrid. Its main characteristics are potential for high-beta operation; flexibility, i.e., its rotational transform can be varied over a wide range and its shear to some extent; and bean-shaped plasma cross section. The latest understanding of TJ-II physics in the fields of electron cyclotron resonance heating, transport, and magneto-hydrodynamics, and the engineering solutions introduced in its final design are discussed

  14. ECLESIOLOGIA DO VATICANO II

    Directory of Open Access Journals (Sweden)

    Víctor Codina

    2013-01-01

    Full Text Available Não se pode compreender a eclesiologia do Vaticano II sem conhecer a vida, o estilo pastoral e o carisma de João XXIII, que convocou o Concílio e abriu o caminho em direção a uma nova configuração eclesial que acabava com séculos de uma Igreja de Cristandade. O Vaticano II implica uma transição de uma Igreja clerical a uma Igreja Povo de Deus, povo de batizados. A passagem de uma Igreja juridicista e legalista a uma Igreja Mistério de comunhão em Cristo. Mudar de uma Igreja triunfalista e ligada ao poder mundano a uma Igreja vivificada pela força renovadora do Espírito. A Igreja está a caminho rumo ao Reino de Deus juntamente com todos os cristãos e com toda a humanidade. A recepção do Vaticano II supõe uma conversão pastoral: voltar ao Evangelho e abrir-se aos novos sinais dos tempos seguindo o Espírito que inspirou João XXIII. ABSTRACT: You cannot understand the Ecclesiology of Vatican II without knowing the life, the pastoral style and the charisma of John XXIII, who convened the Council and opened the way toward a new ecclesial setting that ended centuries of a church of Christendom. The Vatican II involves a transition from a clerical Church to a “People (baptized people of God” Church. The Vatican II implies the passage from a juridical and legalistic Church to a Church as the Mystery of the communion in Christ. The Vatican II implies the change from a triumphalistic Church and connected to worldly power to a Church vivified by the renewing force of the Spirit. The Church is on its way toward the Kingdom of God together with all Christians and all mankind. The reception of the Vatican II supposes a pastoral conversion: a return to the Gospel and openness to new signs of the times following the Spirit that inspired John XXIII.

  15. Galaxy S II

    CERN Document Server

    Gralla, Preston

    2011-01-01

    Unlock the potential of Samsung's outstanding smartphone with this jargon-free guide from technology guru Preston Gralla. You'll quickly learn how to shoot high-res photos and HD video, keep your schedule, stay in touch, and enjoy your favorite media. Every page is packed with illustrations and valuable advice to help you get the most from the smartest phone in town. The important stuff you need to know: Get dialed in. Learn your way around the Galaxy S II's calling and texting features.Go online. Browse the Web, manage email, and download apps with Galaxy S II's 3G/4G network (or create you

  16. Calculus II For Dummies

    CERN Document Server

    Zegarelli, Mark

    2012-01-01

    An easy-to-understand primer on advanced calculus topics Calculus II is a prerequisite for many popular college majors, including pre-med, engineering, and physics. Calculus II For Dummies offers expert instruction, advice, and tips to help second semester calculus students get a handle on the subject and ace their exams. It covers intermediate calculus topics in plain English, featuring in-depth coverage of integration, including substitution, integration techniques and when to use them, approximate integration, and improper integrals. This hands-on guide also covers sequences and series, wit

  17. Design Report for a 19-pin carbide test-bundle in a ring-subassembly of the test zone of KNK II/2

    International Nuclear Information System (INIS)

    Haefner, H.E.

    1982-03-01

    This report describes a 19-rod carbide test bundle in an annular oxide ring element placed at the position 201 of the test zone in the second core of KNK II as well as its behavior during the period of operation. The selected fuel rod concept includes low pellet density and a relatively large gap width as well as helium bonding between fuel and cladding. Characteristic design and operation data are: rod diameter 8.5 mm, pellet diameter 7.0 mm, maximum nominal linear rating 800 W/cm, maximum nominal burnup 70 MWd/kgHM. This report exclusively deals with the carbide test bundle and its individual components; it describes methods, criteria and results concerning the design. The annular carrier element with its head and foot is treated in a separate report. The loadability of the test bundle and its individual components is demonstrated by generally valid standards for strength criteria [de

  18. Periodontics II: Course Proposal.

    Science.gov (United States)

    Dordick, Bruce

    A proposal is presented for Periodontics II, a course offered at the Community College of Philadelphia to give the dental hygiene/assisting student an understanding of the disease states of the periodontium and their treatment. A standardized course proposal cover form is given, followed by a statement of purpose for the course, a list of major…

  19. Workshop 96. Part II

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1996-12-31

    Part II of the seminar proceedings contains contributions in various areas of science and technology, among them materials science in mechanical engineering, materials science in electrical, chemical and civil engineering, and electronics, measuring and communication engineering. In those areas, 6 contributions have been selected for INIS. (P.A.).

  20. Experiment CATETO II

    International Nuclear Information System (INIS)

    Hendriks, J.A.; Freudenreich, W.E.

    1994-03-01

    In the irradiation experiment CATETO II different reduced activation (RA) steels will be irradiated up to 2.5 dpa at a temperature of 300 C. The results of the calculation of the nuclear constants, the reactivity effect, and the activity of the steel samples are presented. (orig.)

  1. Amorphous iron (II) carbonate

    DEFF Research Database (Denmark)

    Sel, Ozlem; Radha, A.V.; Dideriksen, Knud

    2012-01-01

    Abstract The synthesis, characterization and crystallization energetics of amorphous iron (II) carbonate (AFC) are reported. AFC may form as a precursor for siderite (FeCO3). The enthalpy of crystallization (DHcrys) of AFC is similar to that of amorphous magnesium carbonate (AMC) and more...

  2. Workshop 96. Part II

    International Nuclear Information System (INIS)

    1995-12-01

    Part II of the seminar proceedings contains contributions in various areas of science and technology, among them materials science in mechanical engineering, materials science in electrical, chemical and civil engineering, and electronics, measuring and communication engineering. In those areas, 6 contributions have been selected for INIS. (P.A.)

  3. UNISIST II: Special Report.

    Science.gov (United States)

    Hattery, Lowell H., Ed.

    1979-01-01

    The major part of this report of the Intergovernmental Conference on Scientific and Technical Information (UNISIST II), held in Paris May 28-June 1, 1979, focuses on three sets of recommendations which were unanimously approved after combining the recommendations proposed by various groups and blocs: (1) recommendations to the United Nations…

  4. Photosystem II and photoinhibition

    NARCIS (Netherlands)

    Feikema, Willem Onno

    2006-01-01

    Plants harvest light energy and convert it into chemical energy. Light absorption by photosystems I and II (PSI and PSII) results in charge separations in their reaction centers (RCs), initiating a chain of redox reactions with PSI generating the reducing power for CO2 assimilation into sugars, and

  5. European Telecommunications Satellite II (EUTELSAT II)

    Science.gov (United States)

    Laemmel, G.; Brittinger, P.

    1991-01-01

    EUTELSAT II is a regional public telecommunications system for Europe. The services which will be provided are telephone and television. The satellites will be placed at a geostationary orbit within the arcs of 6 degrees east to 19 degrees east or 26 degrees to 36 degrees east. The designed lifetime is 7 years. After separation of the satellites from the launch vehicles, telemetry, telecommand, and ranging will be performed within the S-band frequencies. After positioning of the satellite at its final geostationary orbit, the Ku-band telecommunication equipment will be activated. From this time on, all satellite control operations will be performed in Ku-band. The Deep Space Network (DSN) will support the transfer and drift orbit mission phases. The coverage will consist of the 26-m antennas at Goldstone and Canberra as prime support for the transfer and drift orbits. Maximum support will consist of a 7-day period, plus 14 days of contingency support. Information is given in tabular form for DSN support, frequency assignments, telemetry, command, and tracking support responsibility.

  6. Effect of tip clearance on wall shear stress of an axial LVAD

    Science.gov (United States)

    Sarath, S.; Vikas, R.

    2017-09-01

    Wall shear stress is a crucial parameter used for blood damage analysis, and typically a value of 400 Pa is set as a limit. Tip clearance is a major factor contributing to hemolysis and pump efficiency. In this study, different tip gap configurations are used to analyse the wall shear stress developed on the blade surface of a constant thickness blade design, and a varying thickness blade design using CFD analysis. It was found that, for a particular geometry, as the clearance gap reduces, flow rate over the high wall shear stress area decreases even though the high wall shear stress span is found to extend. For each design, the optimum clearance gap is iteratively attained, keeping the maximum WSS as a limiting factor. Thus a better pump designs is obtained, whose leakage flow patterns are lower than that of the initial design, hence also leading to higher pump efficiency.

  7. Advanced strategies for end-stage heart failure: combining regenerative approaches with LVAD, a new horizon?

    Directory of Open Access Journals (Sweden)

    Cheyenne eTseng

    2015-04-01

    Full Text Available Despite the improved treatment of cardiovascular diseases the population with end-stage heart failure is progressively growing. The scarcity of the gold standard therapy, heart transplantation, demands novel therapeutic approaches. For patients awaiting transplantation ventricular assist devices have been of great benefit on survival. To allow explantation of the assist device and obviate heart transplantation, sufficient and durable myocardial recovery is necessary. However, explant rates so far are low. Combining mechanical circulatory support with regenerative therapies such as cell(-based therapy and biomaterials might give rise to improved long-term results. Although synergistic effects are suggested with mechanical support and stem cell therapy, evidence in both preclinical and clinical setting is lacking. This review focuses on advanced and innovative strategies for the treatment of end-stage heart failure and furthermore appraises clinical experience with combined strategies.

  8. Validation of a CFD methodology for positive displacement LVAD analysis using PIV data.

    Science.gov (United States)

    Medvitz, Richard B; Reddy, Varun; Deutsch, Steve; Manning, Keefe B; Paterson, Eric G

    2009-11-01

    Computational fluid dynamics (CFD) is used to asses the hydrodynamic performance of a positive displacement left ventricular assist device. The computational model uses implicit large eddy simulation direct resolution of the chamber compression and modeled valve closure to reproduce the in vitro results. The computations are validated through comparisons with experimental particle image velocimetry (PIV) data. Qualitative comparisons of flow patterns, velocity fields, and wall-shear rates demonstrate a high level of agreement between the computations and experiments. Quantitatively, the PIV and CFD show similar probed velocity histories, closely matching jet velocities and comparable wall-strain rates. Overall, it has been shown that CFD can provide detailed flow field and wall-strain rate data, which is important in evaluating blood pump performance.

  9. Ni (II) and Cu(II) complexes of

    African Journals Online (AJOL)

    ADOWIE PERE

    ABSTRACT: The objective of this study is to investigate the antimicrobial activity of novel. Schiff base metal complexes. The resistance of micro-organisms to classical antimicrobial compounds poses a challenge to effective management and treatment of some diseases. In line with this, copper (II), nickel (II) and cobalt (II) ...

  10. Transport phenomena II essentials

    CERN Document Server

    REA, The Editors of

    2012-01-01

    REA's Essentials provide quick and easy access to critical information in a variety of different fields, ranging from the most basic to the most advanced. As its name implies, these concise, comprehensive study guides summarize the essentials of the field covered. Essentials are helpful when preparing for exams, doing homework and will remain a lasting reference source for students, teachers, and professionals. Transport Phenomena II covers forced convention, temperature distribution, free convection, diffusitivity and the mechanism of mass transfer, convective mass transfer, concentration

  11. Information on Asse II

    International Nuclear Information System (INIS)

    2015-01-01

    The information brochure on Asse II describes the situation in the repository for radioactive wastes that was closed by law due to the violations of safety standards. The discussed topics include the necessity of waste retrieval, the problems with public anxiety and public information, the hazard of an uncontrolled water ingress (worst case scenario), the work sites in the cavern, man-machine interactions and the cost of the project.

  12. Information on Asse II

    International Nuclear Information System (INIS)

    2014-01-01

    The information on Asse II include the following topics: The image and what is behind - the barrier building Dammjoch built 1914; Fact finding - underground explorations; concept for a site comparison; Learning from experiences - the final repository projects Asse, Gorleben and Morsleben show what should not be done; At first drilling - thereafter building - progress of the recovery duct; The retrieval can only go on in dialogue with the public.

  13. Heat transfer II essentials

    CERN Document Server

    REA, The Editors of

    1988-01-01

    REA's Essentials provide quick and easy access to critical information in a variety of different fields, ranging from the most basic to the most advanced. As its name implies, these concise, comprehensive study guides summarize the essentials of the field covered. Essentials are helpful when preparing for exams, doing homework and will remain a lasting reference source for students, teachers, and professionals. Heat Transfer II reviews correlations for forced convection, free convection, heat exchangers, radiation heat transfer, and boiling and condensation.

  14. Numerical analysis II essentials

    CERN Document Server

    REA, The Editors of; Staff of Research Education Association

    1989-01-01

    REA's Essentials provide quick and easy access to critical information in a variety of different fields, ranging from the most basic to the most advanced. As its name implies, these concise, comprehensive study guides summarize the essentials of the field covered. Essentials are helpful when preparing for exams, doing homework and will remain a lasting reference source for students, teachers, and professionals. Numerical Analysis II covers simultaneous linear systems and matrix methods, differential equations, Fourier transformations, partial differential equations, and Monte Carlo methods.

  15. Review on technology II

    International Nuclear Information System (INIS)

    Mroziewicz, B.

    1986-01-01

    The most important requirements for the spectral properties of photodetectors are reviewed with particular attention to the fiber optics applications. Data on a number of materials are collected and presented. Pros and cons are pointed out for each type of photodetector-photoconductor, p-i-n photodiode and APD. A review is given of the relevant papers presented in the poster session 'Technology II' of the Symposium

  16. Algebra & trigonometry II essentials

    CERN Document Server

    REA, Editors of

    2012-01-01

    REA's Essentials provide quick and easy access to critical information in a variety of different fields, ranging from the most basic to the most advanced. As its name implies, these concise, comprehensive study guides summarize the essentials of the field covered. Essentials are helpful when preparing for exams, doing homework and will remain a lasting reference source for students, teachers, and professionals. Algebra & Trigonometry II includes logarithms, sequences and series, permutations, combinations and probability, vectors, matrices, determinants and systems of equations, mathematica

  17. EASI graphics - Version II

    International Nuclear Information System (INIS)

    Allensworth, J.A.

    1984-04-01

    EASI (Estimate of Adversary Sequence Interruption) is an analytical technique for measuring the effectiveness of physical protection systems. EASI Graphics is a computer graphics extension of EASI which provides a capability for performing sensitivity and trade-off analyses of the parameters of a physical protection system. This document reports on the implementation of the Version II of EASI Graphics and illustrates its application with some examples. 5 references, 15 figures, 6 tables

  18. BeII** revisited

    International Nuclear Information System (INIS)

    Fischer, C.F.

    1982-01-01

    Doubly excited 1s2snl and 1s2pnl quartet states of BeII** are readily populated in beam-foil experiments and line-rich spectra have been obtained covering 600 to 5500 A wavelength range. In spite of several theoretical calculations a substantial number of observed lines have not been identified. The quartet system in BeII is an intersting one from a theoretical point of view. Three electron systems are simple enough that a fairly high level of accuracy is attainable without the calculations becoming horrendous. The important correlation effects are between the outer two electrons and, to a good approximation, the three-electrons system may be treated as a two-electron system outside a 1s-core. The multi-configuration Hartree-Fock (MCHF) method has been used successfully in a number of studies. Programs are under development that take into account the non-orthogonality of orbitals in the initial and final state, and allow for some non-orthogonal orbitals in a wavefunction expansion. LS dependent relativistic effects are also included. A study of BeII** was undertaken to evaluate the MCHF techniques being developed and to assit in the identification of observed lines. Most of the earlier calculations concentrated on the lower-lying levels. In this work particular attention was given to the more highly-excited states, though calculations for lower-lying states had to be repeated in order to predict life-times

  19. What is LAMPF II

    International Nuclear Information System (INIS)

    Thiessen, H.A.

    1982-08-01

    The present conception of LAMPF II is a high-intensity 16-GeV synchrotron injected by the LAMPF 800-MeV H - beam. The proton beam will be used to make secondary beams of neutrinos, muons, pions, kaons, antiprotons, and hyperons more intense than those of any existing or proposed accelerator. For example, by taking maximum advantage of a thick target, modern beam optics, and the LAMPF II proton beam, it will be possible to make a negative muon beam with nearly 100% duty factor and nearly 100 times the flux of the existing Stopped Muon Channel (SMC). Because the unique features of the proposed machine are most applicable to beams of the same momentum as LAMPF (that is, < 2 GeV/c), it may be possible to use most of the experimental areas and some of the auxiliary equipment, including spectrometers, with the new accelerator. The complete facility will provide improved technology for many areas of physics already available at LAMPF and will allow expansion of medium-energy physics to include kaons, antiprotons, and hyperons. When LAMPF II comes on line in 1990 LAMPF will have been operational for 18 years and a major upgrade such as this proposal will be reasonable and prudent

  20. What is LAMPF II

    Energy Technology Data Exchange (ETDEWEB)

    Thiessen, H.A.

    1982-08-01

    The present conception of LAMPF II is a high-intensity 16-GeV synchrotron injected by the LAMPF 800-MeV H/sup -/ beam. The proton beam will be used to make secondary beams of neutrinos, muons, pions, kaons, antiprotons, and hyperons more intense than those of any existing or proposed accelerator. For example, by taking maximum advantage of a thick target, modern beam optics, and the LAMPF II proton beam, it will be possible to make a negative muon beam with nearly 100% duty factor and nearly 100 times the flux of the existing Stopped Muon Channel (SMC). Because the unique features of the proposed machine are most applicable to beams of the same momentum as LAMPF (that is, < 2 GeV/c), it may be possible to use most of the experimental areas and some of the auxiliary equipment, including spectrometers, with the new accelerator. The complete facility will provide improved technology for many areas of physics already available at LAMPF and will allow expansion of medium-energy physics to include kaons, antiprotons, and hyperons. When LAMPF II comes on line in 1990 LAMPF will have been operational for 18 years and a major upgrade such as this proposal will be reasonable and prudent.

  1. Thermal Degradation of Complexes Derived from Cu (II) Groundnut (Arachis hypogaea) and Sesame (Sesamum indicum) Soaps

    Science.gov (United States)

    Joram, Anju; Sharma, Rashmi; Sharma, Arun kumar

    2018-05-01

    The complexes have been synthesized from Cu (II) soaps of groundnut (Arachis hypogaea) and sesame (Sesamum indicum) oils, with ligand containing nitrogen and sulfur atoms like 2-amino-6-methyl benzothiazole. The complexes were greenish brown in color. In order to study TGA, first characterized them by elemental analysis, and spectroscopic technique such as IR, NMR and ESR. From the analytical data, the stoichiometry's of the complexes have been observed to be 1:1 (metal:ligand). These complexes have been thermally analyzed using TGA techniques to determine their energy of activation. These complexes show three step thermal degradation corresponding to fatty acid components of the edible oils and each complex has three decomposition steps in the range of 439-738 K. Various equations like Coats-Redfern (CR), Horowitz-Metzger (HM) and Broido equations (BE) were applied to evaluate the energy of activation. The values of energy of activation are observed to be in the following order for both copper groundnut benzothiazole (CGB) and copper sesame benzothiazole (CSeB) complexes: CGB > CSeB. CGB is observed to be more stable than CSeB due to its higher activation energy. The above studies would provide significant information regarding the applications of synthesized agrochemicals and their safe removal through parameters obtained in degradation curves and its relation with energy.

  2. Average [O II] nebular emission associated with Mg II absorbers: dependence on Fe II absorption

    Science.gov (United States)

    Joshi, Ravi; Srianand, Raghunathan; Petitjean, Patrick; Noterdaeme, Pasquier

    2018-05-01

    We investigate the effect of Fe II equivalent width (W2600) and fibre size on the average luminosity of [O II] λλ3727, 3729 nebular emission associated with Mg II absorbers (at 0.55 ≤ z ≤ 1.3) in the composite spectra of quasars obtained with 3 and 2 arcsec fibres in the Sloan Digital Sky Survey. We confirm the presence of strong correlations between [O II] luminosity (L_{[O II]}) and equivalent width (W2796) and redshift of Mg II absorbers. However, we show L_{[O II]} and average luminosity surface density suffer from fibre size effects. More importantly, for a given fibre size, the average L_{[O II]} strongly depends on the equivalent width of Fe II absorption lines and found to be higher for Mg II absorbers with R ≡W2600/W2796 ≥ 0.5. In fact, we show the observed strong correlations of L_{[O II]} with W2796 and z of Mg II absorbers are mainly driven by such systems. Direct [O II] detections also confirm the link between L_{[O II]} and R. Therefore, one has to pay attention to the fibre losses and dependence of redshift evolution of Mg II absorbers on W2600 before using them as a luminosity unbiased probe of global star formation rate density. We show that the [O II] nebular emission detected in the stacked spectrum is not dominated by few direct detections (i.e. detections ≥3σ significant level). On an average, the systems with R ≥ 0.5 and W2796 ≥ 2 Å are more reddened, showing colour excess E(B - V) ˜ 0.02, with respect to the systems with R < 0.5 and most likely trace the high H I column density systems.

  3. Algebra II workbook for dummies

    CERN Document Server

    Sterling, Mary Jane

    2014-01-01

    To succeed in Algebra II, start practicing now Algebra II builds on your Algebra I skills to prepare you for trigonometry, calculus, and a of myriad STEM topics. Working through practice problems helps students better ingest and retain lesson content, creating a solid foundation to build on for future success. Algebra II Workbook For Dummies, 2nd Edition helps you learn Algebra II by doing Algebra II. Author and math professor Mary Jane Sterling walks you through the entire course, showing you how to approach and solve the problems you encounter in class. You'll begin by refreshing your Algebr

  4. Synthesis and spectroscopic studies of biologically active tetraazamacrocyclic complexes of Mn(II, Co(II, Ni(II, Pd(II and Pt(II

    Directory of Open Access Journals (Sweden)

    Monika Tyagi

    2014-01-01

    Full Text Available Complexes of Mn(II, Co(II, Ni(II, Pd(II and Pt(II were synthesized with the macrocyclic ligand, i.e., 2,3,9,10-tetraketo-1,4,8,11-tetraazacycoletradecane. The ligand was prepared by the [2 + 2] condensation of diethyloxalate and 1,3-diamino propane and characterized by elemental analysis, mass, IR and 1H NMR spectral studies. All the complexes were characterized by elemental analysis, molar conductance, magnetic susceptibility measurements, IR, electronic and electron paramagnetic resonance spectral studies. The molar conductance measurements of Mn(II, Co(II and Ni(II complexes in DMF correspond to non electrolyte nature, whereas Pd(II and Pt(II complexes are 1:2 electrolyte. On the basis of spectral studies an octahedral geometry has been assigned for Mn(II, Co(II and Ni(II complexes, whereas square planar geometry assigned for Pd(II and Pt(II. In vitro the ligand and its metal complexes were evaluated against plant pathogenic fungi (Fusarium odum, Aspergillus niger and Rhizoctonia bataticola and some compounds found to be more active as commercially available fungicide like Chlorothalonil.

  5. Removal of Ni (II), Co (II) and Pb (II) ions from aqueous media using ...

    African Journals Online (AJOL)

    Removal of Ni (II), Co (II) and Pb (II) ions from aqueous media using Starch ... The results showed that 0.025 % loaded SSMNPs gave the optimal sorption ... constants (Lagergren and Pseudo-2nd-order) for Ni2+ and Co2+ adsorption were ... Langmuir correlation coefficients showed a better fit for the adsorption isotherms.

  6. Electronics II essentials

    CERN Document Server

    REA, The Editors of

    2012-01-01

    REA's Essentials provide quick and easy access to critical information in a variety of different fields, ranging from the most basic to the most advanced. As its name implies, these concise, comprehensive study guides summarize the essentials of the field covered. Essentials are helpful when preparing for exams, doing homework and will remain a lasting reference source for students, teachers, and professionals. Electronics II covers operational amplifiers, feedback and frequency compensation of OP amps, multivibrators, logic gates and families, Boolean algebra, registers, counters, arithmet

  7. Engineering mathematics-II

    CERN Document Server

    Ganesh, A

    2009-01-01

    About the Book: This book Engineering Mathematics-II is designed as a self-contained, comprehensive classroom text for the second semester B.E. Classes of Visveswaraiah Technological University as per the Revised new Syllabus. The topics included are Differential Calculus, Integral Calculus and Vector Integration, Differential Equations and Laplace Transforms. The book is written in a simple way and is accompanied with explanatory figures. All this make the students enjoy the subject while they learn. Inclusion of selected exercises and problems make the book educational in nature. It shou

  8. Thermodynamics II essentials

    CERN Document Server

    REA, The Editors of

    2013-01-01

    REA's Essentials provide quick and easy access to critical information in a variety of different fields, ranging from the most basic to the most advanced. As its name implies, these concise, comprehensive study guides summarize the essentials of the field covered. Essentials are helpful when preparing for exams, doing homework and will remain a lasting reference source for students, teachers, and professionals. Thermodynamics II includes review of thermodynamic relations, power and refrigeration cycles, mixtures and solutions, chemical reactions, chemical equilibrium, and flow through nozzl

  9. Physics II for dummies

    CERN Document Server

    Holzner, Steven

    2010-01-01

    A plain-English guide to advanced physics. Does just thinking about the laws of motion make your head spin? Does studying electricity short your circuits? Physics II For Dummies walks you through the essentials and gives you easy-to-understand and digestible guidance on this often intimidating course. Thanks to this book, you don?t have to be Einstein to understand physics. As you learn about mechanical waves and sound, forces and fields, electric potential and electric energy, and much more, you?ll appreciate the For Dummies law: The easier we make it, the faster you'll understand it!

  10. Physical chemistry II essentials

    CERN Document Server

    REA, The Editors of

    1992-01-01

    REA's Essentials provide quick and easy access to critical information in a variety of different fields, ranging from the most basic to the most advanced. As its name implies, these concise, comprehensive study guides summarize the essentials of the field covered. Essentials are helpful when preparing for exams, doing homework and will remain a lasting reference source for students, teachers, and professionals. Physical Chemistry II includes reaction mechanisms, theoretical approaches to chemical kinetics, gravitational work, electrical and magnetic work, surface work, kinetic theory, collisional and transport properties of gases, statistical mechanics, matter and waves, quantum mechanics, and rotations and vibrations of atoms and molecules.

  11. Graphics gems II

    CERN Document Server

    Arvo, James

    1991-01-01

    Graphics Gems II is a collection of articles shared by a diverse group of people that reflect ideas and approaches in graphics programming which can benefit other computer graphics programmers.This volume presents techniques for doing well-known graphics operations faster or easier. The book contains chapters devoted to topics on two-dimensional and three-dimensional geometry and algorithms, image processing, frame buffer techniques, and ray tracing techniques. The radiosity approach, matrix techniques, and numerical and programming techniques are likewise discussed.Graphics artists and comput

  12. Thin film processes II

    CERN Document Server

    Kern, Werner

    1991-01-01

    This sequel to the 1978 classic, Thin Film Processes, gives a clear, practical exposition of important thin film deposition and etching processes that have not yet been adequately reviewed. It discusses selected processes in tutorial overviews with implementation guide lines and an introduction to the literature. Though edited to stand alone, when taken together, Thin Film Processes II and its predecessor present a thorough grounding in modern thin film techniques.Key Features* Provides an all-new sequel to the 1978 classic, Thin Film Processes* Introduces new topics, and sever

  13. Statistics II essentials

    CERN Document Server

    Milewski, Emil G

    2012-01-01

    REA's Essentials provide quick and easy access to critical information in a variety of different fields, ranging from the most basic to the most advanced. As its name implies, these concise, comprehensive study guides summarize the essentials of the field covered. Essentials are helpful when preparing for exams, doing homework and will remain a lasting reference source for students, teachers, and professionals. Statistics II discusses sampling theory, statistical inference, independent and dependent variables, correlation theory, experimental design, count data, chi-square test, and time se

  14. Data structures II essentials

    CERN Document Server

    Smolarski, Dennis C

    2012-01-01

    REA's Essentials provide quick and easy access to critical information in a variety of different fields, ranging from the most basic to the most advanced. As its name implies, these concise, comprehensive study guides summarize the essentials of the field covered. Essentials are helpful when preparing for exams, doing homework and will remain a lasting reference source for students, teachers, and professionals. Data Structures II includes sets, trees, advanced sorting, elementary graph theory, hashing, memory management and garbage collection, and appendices on recursion vs. iteration, alge

  15. Computer science II essentials

    CERN Document Server

    Raus, Randall

    2012-01-01

    REA's Essentials provide quick and easy access to critical information in a variety of different fields, ranging from the most basic to the most advanced. As its name implies, these concise, comprehensive study guides summarize the essentials of the field covered. Essentials are helpful when preparing for exams, doing homework and will remain a lasting reference source for students, teachers, and professionals. Computer Science II includes organization of a computer, memory and input/output, coding, data structures, and program development. Also included is an overview of the most commonly

  16. Synthesis and spectral studies of manganese(II), cobalt(II), nickel(II), copper(II), zinc(II), cadmium(II) and mercury(II) complexes of 4-oxo-4H-1-benzopyran-3-carboxaldehyde hydrazone derivatives

    International Nuclear Information System (INIS)

    Nawar, N.; Khattab, M.A.; Bekheit, M.M.; El-Kaddah, A.H.

    1996-01-01

    A few complexes of Mn(II), Co(II), Ni(II), Cu(II), Zn(II), Cd(II) and Hg(II) with 4-oxo-4H-1-benzopyran-3-(carboxaldehyde-4-chlorobenzylhydrazone) (BCBH) and 4-oxo-4H-1-benzopyran-3-(carboxaldehyde-4-methylbenzylhydrazone) (BMBH) have been synthesised and characterized by elemental analysis, molar conductivities, magnetic measurements and infrared (IR) and visible spectral studies. The IR spectra show that BCBH and BMBH behave as bidentate ligands either in the keto or enol form. (author). 24 refs., 2 tabs

  17. ORF Alignment: EHA1 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available EHA1 253.m00087 >1gntA 1 549 4 539 e-171 ... gb|EAL51411.1| hydroxylamine reductase, ...putative [Entamoeba histolytica HM-1:IMSS] ... gb|EAL44619.1| hydroxylamine reductase, putative ...

  18. ORF Alignment: EHA1 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available EHA1 8.m00410 >1gntA 1 549 4 539 e-171 ... gb|EAL51411.1| hydroxylamine reductase, pu...tative [Entamoeba histolytica HM-1:IMSS] ... gb|EAL44619.1| hydroxylamine reductase, putative ...

  19. MAGIICAT III. Interpreting self-similarity of the circumgalactic medium with virial mass using Mg II absorption

    Energy Technology Data Exchange (ETDEWEB)

    Churchill, Christopher W.; Trujillo-Gomez, Sebastian; Nielsen, Nikole M. [New Mexico State University, Las Cruces, NM 88003 (United States); Kacprzak, Glenn G. [Swinburne University of Technology, Victoria 3122 (Australia)

    2013-12-10

    In Churchill et al., we used halo abundance matching applied to 182 galaxies in the Mg II Absorber-Galaxy Catalog (MAGIICAT) and showed that the mean Mg II λ2796 equivalent width follows a tight inverse-square power law, W{sub r} (2796)∝(D/R {sub vir}){sup –2}, with projected location relative to the galaxy virial radius and that the Mg II absorption covering fraction is effectively invariant with galaxy virial mass, M {sub h}, over the range 10.7 ≤ log M {sub h}/M {sub ☉} ≤ 13.9. In this work, we explore multivariate relationships between W{sub r} (2796), virial mass, impact parameter, virial radius, and the theoretical cooling radius that further elucidate self-similarity in the cool/warm (T = 10{sup 4}-10{sup 4.5} K) circumgalactic medium (CGM) with virial mass. We show that virial mass determines the extent and strength of the Mg II absorbing gas such that the mean W{sub r} (2796) increases with virial mass at fixed distance while decreasing with galactocentric distance for fixed virial mass. The majority of the absorbing gas resides within D ≅ 0.3 R {sub vir}, independent of both virial mass and minimum absorption threshold; inside this region, and perhaps also in the region 0.3 < D/R {sub vir} ≤ 1, the mean W{sub r} (2796) is independent of virial mass. Contrary to absorber-galaxy cross-correlation studies, we show there is no anti-correlation between W{sub r} (2796) and virial mass. We discuss how simulations and theory constrained by observations support self-similarity of the cool/warm CGM via the physics governing star formation, gas-phase metal enrichment, recycling efficiency of galactic scale winds, filament and merger accretion, and overdensity of local environment as a function of virial mass.

  20. Evaluation of the computerized procedures Manual II (COPMA II)

    International Nuclear Information System (INIS)

    Converse, S.A.

    1995-11-01

    The purpose of this study was to evaluate the effects of a computerized procedure system, the Computerized Procedure Manual II (COPMA-II), on the performance and mental workload of licensed reactor operators. To evaluate COPMA-II, eight teams of two operators were trained to operate a scaled pressurized water reactor facility (SPWRF) with traditional paper procedures and with COPMA-II. Following training, each team operated the SPWRF under normal operating conditions with both paper procedures and COPMA-II. The teams then performed one of two accident scenarios with paper procedures, but performed the remaining accident scenario with COPMA-II. Performance measures and subjective estimates of mental workload were recorded for each performance trial. The most important finding of the study was that the operators committed only half as many errors during the accident scenarios with COPMA-II as they committed with paper procedures. However, time to initiate a procedure was fastest for paper procedures for accident scenario trials. For performance under normal operating conditions, there was no difference in time to initiate or to complete a procedure, or in the number of errors committed with paper procedures and with COPMA-II. There were no consistent differences in the mental workload ratings operators recorded for trials with paper procedures and COPMA-II

  1. RTNS-II utilization

    International Nuclear Information System (INIS)

    Doran, D.G.; Panayotou, N.F.; Powell, R.W.

    1979-12-01

    The objective of the several RTNS-II irradation programs is to maximize information gained from the small test volume available in this unique irradiation facility for application in the fusion materials program. While this facility provides the highest 14 MeV neutron flux available, the flux is generally too low and the irradiation volume too small for testing of engineering materials. Emphasis, therefore, is on identifying damage mechanisms of high energy neutrons and correlating them quantitatively with effects produced by fission neutrons. The information gained will be used to evaluate and calibrate damage and correlation models under development. The scope of the program includes in-situ experiments, postirradiation experiments, irradiation temperatures ranging from 4 0 K to 1,000 0 K, and fluences ranging from 3 x 10 16 to about 3 x 10 19 n/cm 2

  2. Belle II Software

    International Nuclear Information System (INIS)

    Kuhr, T; Ritter, M

    2016-01-01

    Belle II is a next generation B factory experiment that will collect 50 times more data than its predecessor, Belle. The higher luminosity at the SuperKEKB accelerator leads to higher background levels and requires a major upgrade of the detector. As a consequence, the simulation, reconstruction, and analysis software must also be upgraded substantially. Most of the software has been redesigned from scratch, taking into account the experience from Belle and other experiments and utilizing new technologies. The large amount of experimental and simulated data requires a high level of reliability and reproducibility, even in parallel environments. Several technologies, tools, and organizational measures are employed to evaluate and monitor the performance of the software during development. (paper)

  3. Inside ISIS II

    CERN Multimedia

    1981-01-01

    ISIS stands for Identification of Secondaries by Ionization Sampling. It was a drift chamber with an active volume of about 40 m3 built by Oxford University as a particle identifier for the European Hybrid Spectrometer (EHS). The photo shows the electrostatic grading structure and the central anode-wire plane, with Roger Giles standing just under it (Annual Report 1981 p. 57, Fig. 4). ISIS-II differed from the prototype ISIS-I only in the depth of the track (4 m instead of 1 m) thus extending the momentum range for particle identification to 50 GeV/c. See Nucl. Instr. and Meth. 224 (1984) 396, and Nucl. Instr. and Meth. 258 (1987) 26.

  4. Water radiological surveillance (II)

    International Nuclear Information System (INIS)

    Pablo San Martin de, M.

    2008-01-01

    This paper summarizes the characteristics of the Environmental Surveillance Radiological Networks (ESRN) currently operating in CEDEX. In the first part, the Spanish Continental Waters ESRN has been presented. This second one describes Spanish Costal Waters ESRN and the High Sensitivity Networks in Continental and Marine Waters. It also presents the Radiological Surveillance of Drinking Waters that CEDEX carries out in waters of public consumption management by the Canal de Isabel II (CYII) and by the Mancomunity of Canals Taibilla (M.C.T.). The legislation applicable in each case is reviewed as well. Due to its extension the article has been divided into two parts. As Spanish Continental Waters ESRN has been reviewed in the first part, the others ESRN are discussed in this second one. (Author) 10 refs

  5. PEP-II Alignment

    CERN Document Server

    Gaydosh, M

    2003-01-01

    The PEP-II Asymmetric B-factory consists of two independent storage rings, one located atop the other in the 2200m-circumference PEP tunnel. The high-energy ring, which stores a 9-GeV electron beam, is an upgrade of the existing PEP collider. It re-utilizes all of the PEP magnets and incorporates a state-of-the-art copper vacuum chamber and a new RF system capable of supporting a one-amp stored beam. The low-energy ring, which stores 3.1-GeV positrons, is new construction. Injection is achieved by extracting electrons and positrons at collision energies from the SLC and transporting them each in a dedicated bypass line. The low-emittance SLC beams will be used for the injection process.

  6. Stage II Seminoma

    International Nuclear Information System (INIS)

    Sagerman, R.H.; Kotlove, D.J.; Regine, W.; Chung, C.T.; King, G.A.; Dalai, P.S.

    1988-01-01

    Between 1966 and 1985, 32 patients with stage II (21 A,11 B) testicular seminoma were treated with postorchiectomy irradiation to the retroperitoneal and ipsilateral iliac nodes; 28 received elective mediastinal-supraclavicular irradiation. The median follow-up was 8 1/2 years; 29 patients were followed up for over 3 years and 24 for over 5 years. Twenty-eight patients remain alive and well and four have die, two of a second primary cancer. Two patients developed recurrent seminoma in the mediastinum; these patients showed a variant lymphangiographic pattern. Both remain well after further irradiation or irradiation plus chemotherapy. A third patient developed nonseminomatous ''recurrence'' in the radiation field and is well after chemotherapy

  7. Phase II Final Report

    Energy Technology Data Exchange (ETDEWEB)

    Schuknecht, Nate [Project Manager; White, David [Principle Investigator; Hoste, Graeme [Research Engineer

    2014-09-11

    The SkyTrough DSP will advance the state-of-the-art in parabolic troughs for utility applications, with a larger aperture, higher operating temperature, and lower cost. The goal of this project was to develop a parabolic trough collector that enables solar electricity generation in the 2020 marketplace for a 216MWe nameplate baseload power plant. This plant requires an LCOE of 9¢/kWhe, given a capacity factor of 75%, a fossil fuel limit of 15%, a fossil fuel cost of $6.75/MMBtu, $25.00/kWht thermal storage cost, and a domestic installation corresponding to Daggett, CA. The result of our optimization was a trough design of larger aperture and operating temperature than has been fielded in large, utility scale parabolic trough applications: 7.6m width x 150m SCA length (1,118m2 aperture), with four 90mm diameter × 4.7m receivers per mirror module and an operating temperature of 500°C. The results from physical modeling in the System Advisory Model indicate that, for a capacity factor of 75%: The LCOE will be 8.87¢/kWhe. SkyFuel examined the design of almost every parabolic trough component from a perspective of load and performance at aperture areas from 500 to 2,900m2. Aperture-dependent design was combined with fixed quotations for similar parts from the commercialized SkyTrough product, and established an installed cost of $130/m2 in 2020. This project was conducted in two phases. Phase I was a preliminary design, culminating in an optimum trough size and further improvement of an advanced polymeric reflective material. This phase was completed in October of 2011. Phase II has been the detailed engineering design and component testing, which culminated in the fabrication and testing of a single mirror module. Phase II is complete, and this document presents a summary of the comprehensive work.

  8. Effect of Cu(II), Cd(II) and Zn(II) on Pb(II) biosorption by algae Gelidium-derived materials.

    Science.gov (United States)

    Vilar, Vítor J P; Botelho, Cidália M S; Boaventura, Rui A R

    2008-06-15

    Biosorption of Pb(II), Cu(II), Cd(II) and Zn(II) from binary metal solutions onto the algae Gelidium sesquipedale, an algal industrial waste and a waste-based composite material was investigated at pH 5.3, in a batch system. Binary Pb(II)/Cu(II), Pb(II)/Cd(II) and Pb(II)/Zn(II) solutions have been tested. For the same equilibrium concentrations of both metal ions (1 mmol l(-1)), approximately 66, 85 and 86% of the total uptake capacity of the biosorbents is taken by lead ions in the systems Pb(II)/Cu(II), Pb(II)/Cd(II) and Pb(II)/Zn(II), respectively. Two-metal results were fitted to a discrete and a continuous model, showing the inhibition of the primary metal biosorption by the co-cation. The model parameters suggest that Cd(II) and Zn(II) have the same decreasing effect on the Pb(II) uptake capacity. The uptake of Pb(II) was highly sensitive to the presence of Cu(II). From the discrete model it was possible to obtain the Langmuir affinity constant for Pb(II) biosorption. The presence of the co-cations decreases the apparent affinity of Pb(II). The experimental results were successfully fitted by the continuous model, at different pH values, for each biosorbent. The following sequence for the equilibrium affinity constants was found: Pb>Cu>Cd approximately Zn.

  9. Aerospace Systems Monitor, Phase II

    Data.gov (United States)

    National Aeronautics and Space Administration — Proposal Title: Aerospace Systems Monitor PHASE 1 Technical Abstract: This Phase II STTR project will continue development and commercialization of the Aerospace...

  10. Lead (II) and nickel (II) adsorption kinetics from aqueous metal ...

    African Journals Online (AJOL)

    This paper discusses the kinetics of lead (II) and Nickel (II) ions adsorption from aqueous solutions using chemically modified and unmodified agricultural adsorbents at 28°C, pH 6.2 and 0.01M NaCl ionic strength. The removal of the two metals were found to increase with increase in chemical modification, the sequence ...

  11. Fuel and fuel pin behaviour in a high burnup fast breeder fuel subassembly: Results of destructive post-irradiation examinations of the KNK II/1 fuel subassembly NY-205

    International Nuclear Information System (INIS)

    Patzer, G.

    1991-05-01

    The report gives a summarizing overview of the design characteristics, of the irradiation history and of the results of the destructive post-irradiation examinations of the fuel pins of the high-burnup fuel subassembly NY-205 of the KNK II first core. This element was operated for about 10 years and reached a maximum local burnup of 175 MWd/kg(HM) and a maximum neutron dose of 67 dpa-NRT. The main design data of this subassembly agree with those of the SNR 300 Mark-Ia, and it reached more than twice of the burnup and a similar neutron dose as foreseen for the SNR 300 fuel subassemblies [de

  12. Solar Type II Radio Bursts and IP Type II Events

    Science.gov (United States)

    Cane, H. V.; Erickson, W. C.

    2005-01-01

    We have examined radio data from the WAVES experiment on the Wind spacecraft in conjunction with ground-based data in order to investigate the relationship between the shocks responsible for metric type II radio bursts and the shocks in front of coronal mass ejections (CMEs). The bow shocks of fast, large CMEs are strong interplanetary (IP) shocks, and the associated radio emissions often consist of single broad bands starting below approx. 4 MHz; such emissions were previously called IP type II events. In contrast, metric type II bursts are usually narrowbanded and display two harmonically related bands. In addition to displaying complete dynamic spectra for a number of events, we also analyze the 135 WAVES 1 - 14 MHz slow-drift time periods in 2001-2003. We find that most of the periods contain multiple phenomena, which we divide into three groups: metric type II extensions, IP type II events, and blobs and bands. About half of the WAVES listings include probable extensions of metric type II radio bursts, but in more than half of these events, there were also other slow-drift features. In the 3 yr study period, there were 31 IP type II events; these were associated with the very fastest CMEs. The most common form of activity in the WAVES events, blobs and bands in the frequency range between 1 and 8 MHz, fall below an envelope consistent with the early signatures of an IP type II event. However, most of this activity lasts only a few tens of minutes, whereas IP type II events last for many hours. In this study we find many examples in the radio data of two shock-like phenomena with different characteristics that occur simultaneously in the metric and decametric/hectometric bands, and no clear example of a metric type II burst that extends continuously down in frequency to become an IP type II event. The simplest interpretation is that metric type II bursts, unlike IP type II events, are not caused by shocks driven in front of CMEs.

  13. Recent results from AMANDA II

    International Nuclear Information System (INIS)

    Hanson, K.; Ahrens, J.; Bai, X.; Barwick, S.W.; Becka, T.; Becker, K.-H.; Bernardini, E.; Bertrand, D.; Binon, F.; Biron, A.; Boeser, S.; Botner, O.; Bouhali, O.; Burgess, T.; Carius, S.; Castermans, T.; Chen, A.; Chirkin, D.; Conrad, J.; Cooley, J.; Cowen, D.F.; Davour, A.; De Clercq, C.; De Young, T.; Desiati, P.; Dewulf, J.-P.; Doksus, P.; Ekstroem, P.; Feser, T.; Gaisser, T.K.; Gaug, M.; Gerhardt, L.; Goldschmidt, A.; Hallgren, A.; Halzen, F.; Hanson, K.; Hardtke, R.; Hauschildt, T.; Hellwig, M.; Herque, P.; Hill, G.C.; Hulth, P.O.; Hundertmark, S.; Jacobsen, J.; Karle, A.; Koci, B.; Koepke, L.; Kuehn, K.; Kowalski, M.; Lamoureux, J.I.; Leich, H.; Leuthold, M.; Lindahl, P.; Liubarsky, I.; Madsen, J.; Marciniewski, P.; Matis, H.S.; McParland, C.P.; Minaeva, Y.; Miocinovic, P.; Morse, R.; Nahnhauer, R.; Neunhoeffer, T.; Niessen, P.; Nygren, D.R.; Ogelman, H.; Olbrechts, Ph.; Perez de los Heros, C.; Pohl, A.C.; Price, P.B.; Przybylski, G.T.; Rawlins, K.; Resconi, E.; Rhode, W.; Ribordy, M.; Richter, S.; Rodriguez Martino, J.; Ross, D.; Sander, H.-G.; Schmidt, T.; Schneider, D.; Schwarz, R.; Silvestri, A.; Solarz, M.; Spiczak, G.M.; Spiering, C.; Steele, D.; Steffen, P.; Stokstad, R.G.; Sudhoff, P.; Sulanke, K.-H.; Taboada, I.; Thollander, L.; Tilav, S.; Walck, C.; Weinheimer, C.; Wiebusch, C.H.; Wiedemann, C.; Wischnewski, R.; Wissing, H.; Woschnagg, K.; Yodh, G.; Young, S.

    2003-01-01

    We present new data taken with the AMANDA-II neutrino telescope array. The AMANDA-II upgrade was completed at the beginning of 2000. It significantly extends the sensitivity of the 10-string AMANDA-B10 detector to high- and ultrahigh-energy neutrino fluxes into regions of interest for probing current astrophysical models which remain unexplored by other experiments

  14. Synthesis, characterization and thermal studies of nickel (II), copper (II), zinc (II) and cadmium (II) complexes with some mixed ligands

    International Nuclear Information System (INIS)

    Mitra, Samiran; Kundu, Parimal; Singh, Rajkumar Bhubon

    1998-01-01

    Dichloro-(DCA) and trichloroacetate(TCA) -cyclic ligand morpholine (Morph)/thiomorpholine (Tmorph)/methylmorpholine (Mmorph)/dimethyl-piperazine (DMP) complexes of nickel (II), copper (II), zinc (II) and cadmium (II) with the compositions [Ni(tmorph) 2 (DCA) 2 ], [Ni(tmorph) 2 (TCA) 2 ].2H 2 O, [Cu(DMP) 2 (TCA) 2 ],[ML 2 X 2 ].nH 2 O where M=Zn II or Cd II , L=Morph, DMP or tmorph and X=DCA or TCA and n=O except in case of [Cd (Morph) 2 (TCA) 2 ] where n=1 have been synthesised. Some intermediate complexes have been isolated by temperature arrest technique (pyrolysis) and characterised. Configurational and conformational changes have been studied by elemental analyses, IR and electronic spectra, magnetic moment data (in the case of Ni(II) and Cu(II) complexes) and thermal analysis. E a * , ΔH, and ΔS for the decomposition reaction of these complexes are evaluated and the stability of the complexes with respect to activation energy has also been compared. The linear correlation has been found between E a * and ΔS for the decomposition of the complexes. (author)

  15. Dust in H II regions

    International Nuclear Information System (INIS)

    Isobe, S.

    1977-01-01

    Several pieces of evidence indicate that H II regions may contain dust: 1) the continuum light scattered by dust grains (O'Dell and Hubbard, 1965), 2) thermal radiation from dust grains at infrared wavelengths (Ney and Allen, 1969), 3) the abnormal helium abundance in some H II regions (Peimbert and Costero, 1969), etc. Although observations of the scattered continuum suggest that the H II region cores may be dust-free, dust grains and gas must be well mixed in view of the infrared observations. This difficulty may be solved by introducing globules with sizes approximately 0.001 pc. These globules and the molecular clouds adjacent to H II regions are the main sources supplying dust to H II regions. (Auth.)

  16. RTNS-II operations guidebook

    International Nuclear Information System (INIS)

    Heikkinen, D.W.

    1985-01-01

    This guidebook is intended to provide training criteria, procedures and guidelines for operation of the RTNS-II neutron sources and ancilliary equipment. Use of this document requires full knowledge of the RTNS-II Facility Safety Procedure (FSP) and any Operational Safety Procedures (OSP) in effect. The RTNS-II FSP defines the hazards which may be encountered at RTNS-II and defines the procedures which must be followed in performing any task including operations. The purpose of this document is to provide a central source of detailed information concerning systems and equipment used in operating the RTNS-II neutron sources on a day-to-day basis. All members of the Operations Group are expected to be familiar with its contents. It is also intended to be used in training new members of the Operations Group

  17. BEPC II positron source

    International Nuclear Information System (INIS)

    Pei Guoxi; Sun Yaolin; Liu Jintong; Chi Yunlong; Liu Yucheng; Liu Nianzong

    2006-01-01

    BEPC II-an upgrade project of the Beijing Electron Positron Collider (BEPC) is a factory type of e + e - collider. The fundamental requirements for its injector linac are the beam energy of 1.89 GeV for on-energy injection and a 40 mA positron beam current at the linac end with a low beam emittance of 1.6 μm and a low energy spread of ±0.5% so as to guarantee a higher injection rate (≥50 mA/min) to the storage ring. Since the positron flux is proportional to the primary electron beam power on the target, the authors will increase the electron gun current from 4A to 10A by using a new electron gun system and increase the primary electron energy from 120 MeV to 240 MeV. The positron source itself is an extremely important system for producing more positrons, including a positron converter target chamber, a 12kA flux modulator, the 7m focusing module with DC power supplies and the support. The new positron production linac from the electron gun to the positron source has been installed into the tunnel. In what follows, the authors will emphasize the positron source design, manufacture and tests. (authors)

  18. Dark matter detection - II

    International Nuclear Information System (INIS)

    Zacek, Viktor

    2015-01-01

    The quest for the mysterious missing mass of the universe has become one of the big challenges of today's particle physics and cosmology. Astronomical observations show that only 1% of the matter of the universe is luminous. Moreover there is now convincing evidence that 85% of all gravitationally observable matter in the universe is of a new exotic kind, different from the 'ordinary' matter surrounding us. In a series of three lectures we discuss past, recent and future efforts made world-wide to detect and/or decipher the nature of Dark Matter. In Lecture I we review our present knowledge of the Dark Matter content of the Universe and how experimenters search for it's candidates; In Lecture II we discuss so-called 'direct detection' techniques which allow to search for scattering of galactic dark matter particles with detectors in deep-underground laboratories; we discuss the interpretation of experimental results and the challenges posed by different backgrounds; In Lecture III we take a look at the 'indirect detection' of the annihilation of dark matter candidates in astrophysical objects, such as our sun or the center of the Milky Way; In addition we will have a look at efforts to produce Dark Matter particles directly at accelerators and we shall close with a look at alternative nonparticle searches and future prospects. (author)

  19. Textos sobre Sostenibilidad II

    Directory of Open Access Journals (Sweden)

    Ciudades para un futuro más sostenible http://habitat.aq.upm.es

    2004-12-01

    This issue assembles a selection of articles publicly available on the website Ciudades para un Futuro más Sostenible (CF+S: http://habitat.aq.upm.es. This selection was originally used as a printed companion guide to the public lecture series on ‘‘Sustainability in the Architecture and Urban Project’’, held on March 2004 and organized by the Madrid School of Architecture within the Initiative for a more Sustainable Architecture and Urbanism (IAU+S. The compilation an overall vision on sustainability presents to average audience. The basic criterion to select these articles was therefore a pedagogical one, including those simpler and clearer papers dealing with all main topics in CF+S. However, due to space limitations, many excellent articles available on the website are unfortunately not included within this selection. CF+S was created in 1996 as a partnership between the Spanish Ministry of Works and Madrid School of Architecture. The objective was to translate into Spanish and publish the experiences selected at the International Award for Best Practices in Improving the Living Environment, organized by United Nations after the Istanbul Conference on Human Settlements (Habitat II. CF+S aims to gather documents concerning any kind of actions and experiences both on the territory and the city actually improving people’s living conditions according to the sustainability concept in its strongest sense. It also offers papers, reports and theoretical reflections on the state of and the possible alternatives to urban development nowadays.

  20. Crystal Structure of Rat Carnitine Palmitoyltransferase II (CPT-II)

    Energy Technology Data Exchange (ETDEWEB)

    Hsiao,Y.; Jogl, G.; Esser, V.; Tong, L.

    2006-01-01

    Carnitine palmitoyltransferase II (CPT-II) has a crucial role in the {beta}-oxidation of long-chain fatty acids in mitochondria. We report here the crystal structure of rat CPT-II at 1.9 Angstroms resolution. The overall structure shares strong similarity to those of short- and medium-chain carnitine acyltransferases, although detailed structural differences in the active site region have a significant impact on the substrate selectivity of CPT-II. Three aliphatic chains, possibly from a detergent that is used for the crystallization, were found in the structure. Two of them are located in the carnitine and CoA binding sites, respectively. The third aliphatic chain may mimic the long-chain acyl group in the substrate of CPT-II. The binding site for this aliphatic chain does not exist in the short- and medium-chain carnitine acyltransferases, due to conformational differences among the enzymes. A unique insert in CPT-II is positioned on the surface of the enzyme, with a highly hydrophobic surface. It is likely that this surface patch mediates the association of CPT-II with the inner membrane of the mitochondria.

  1. Options Study - Phase II

    Energy Technology Data Exchange (ETDEWEB)

    R. Wigeland; T. Taiwo; M. Todosow; W. Halsey; J. Gehin

    2010-09-01

    The Options Study has been conducted for the purpose of evaluating the potential of alternative integrated nuclear fuel cycle options to favorably address the issues associated with a continuing or expanding use of nuclear power in the United States. The study produced information that can be used to inform decisions identifying potential directions for research and development on such fuel cycle options. An integrated nuclear fuel cycle option is defined in this study as including all aspects of the entire nuclear fuel cycle, from obtaining natural resources for fuel to the ultimate disposal of used nuclear fuel (UNF) or radioactive wastes. Issues such as nuclear waste management, especially the increasing inventory of used nuclear fuel, the current uncertainty about used fuel disposal, and the risk of nuclear weapons proliferation have contributed to the reluctance to expand the use of nuclear power, even though it is recognized that nuclear power is a safe and reliable method of producing electricity. In this Options Study, current, evolutionary, and revolutionary nuclear energy options were all considered, including the use of uranium and thorium, and both once-through and recycle approaches. Available information has been collected and reviewed in order to evaluate the ability of an option to clearly address the challenges associated with the current implementation and potential expansion of commercial nuclear power in the United States. This Options Study is a comprehensive consideration and review of fuel cycle and technology options, including those for disposal, and is not constrained by any limitations that may be imposed by economics, technical maturity, past policy, or speculated future conditions. This Phase II report is intended to be used in conjunction with the Phase I report, and much information in that report is not repeated here, although some information has been updated to reflect recent developments. The focus in this Options Study was to

  2. National Energy Plan II

    Energy Technology Data Exchange (ETDEWEB)

    None

    1979-01-01

    This volume contains the Administration's second National Energy Plan, as required by section 801 of the Department of Energy Organization Act (Public Law 95-91). A second volume will contain an assessment of the environmental trends associated with the energy futures reported here. Detailed appendices to the Plan will be published separately. The eight chapters and their subtitles are: Crisis and Uncertainty in the World Energy Future (The Immediate Crisis and the Continuing Problem, The Emergence of the Energy Problem, The Uncertainties of the World Energy Future, World Oil Prices, Consequences for the U.S.); The U.S. Energy Future: The Implications for Policy (The Near-, Mid-, and Long-Term, The Strategy in Perspective); Conservation (Historical Changes in Energy Use, Post-Embargo Changes - In Detail, Conservation Policies and Programs, The Role of Conservation); Oil and Gas (Oil, Natural Gas); Coal and Nuclear (Coal, Nuclear, Policy for Coal and Nuclear Power); Solar and Other Inexhaustible Energy Sources (Solar Energy, Geothermal, Fusion, A Strategy for Inexhaustible Resources); Making Decisions Promptly and Fairly (Managing Future Energy Crises: Emergency Planning, Managing the Current Shortfall: The Iranian Response Plan, Managing the Long-Term Energy Problem: The Institutional Framework, Fairness in Energy Policy, Public Participation in the Development of Energy Policy); and NEP-II and the Future (The Second National Energy Plan and the Nation's Energy Future, The Second National Energy Plan and the Economy, Employment and Energy Policy, The Second National Energy Plan and Individuals, The Second National Energy Plan and Capital Markets, and The Second National Energy Plan and the Environment). (ERA citation 04:041097)

  3. Stiffnites. Part II

    Directory of Open Access Journals (Sweden)

    Maria Teresa Pareschi

    2011-06-01

    Full Text Available

    The dynamics of a stiffnite are here inferred. A stiffnite is a sheet-shaped, gravity-driven submarine sediment flow, with a fabric made up of marine ooze. To infer stiffnite dynamics, order of magnitude estimations are used. Field deposits and experiments on materials taken from the literature are also used. Stiffnites can be tens or hundreds of kilometers wide, and a few centimeters/ meters thick. They move on the sea slopes over hundreds of kilometers, reaching submarine velocities as high as 100 m/s. Hard grain friction favors grain fragmentation and formation of triboelectrically electrified particles and triboplasma (i.e., ions + electrons. Marine lipids favor isolation of electrical charges. At first, two basic assumptions are introduced, and checked a posteriori: (a in a flowing stiffnite, magnetic dipole moments develop, with the magnetization proportional to the shear rate. I have named those dipoles as Ambigua. (b Ambigua are ‘vertically frozen’ along stiffnite streamlines. From (a and (b, it follows that: (i Ambigua create a magnetic field (at peak, >1 T. (ii Lorentz forces sort stiffnite particles into two superimposed sheets. The lower sheet, L+, has a sandy granulometry and a net positive electrical charge density. The upper sheet, L–, has a silty muddy granulometry and a net negative electrical charge density; the grains of sheet L– become finer upwards. (iii Faraday forces push ferromagnetic grains towards the base of a stiffnite, so that a peak of magnetic susceptibility characterizes a stiffnite deposit. (iv Stiffnites harden considerably during their motion, due to magnetic confinement. Stiffnite deposits and inferred stiffnite characteristics are compatible with a stable flow behavior against bending, pinch, or other macro instabilities. In the present report, a consistent hypothesis about the nature of Ambigua is provided.

  4. Kursk Operation Simulation and Validation Exercise - Phase II (KOSAVE II)

    National Research Council Canada - National Science Library

    Bauman, Walter

    1998-01-01

    ... (KOSAVE) Study (KOSAVE II) documents, in this report a statistical record of the Kursk battle, as represented in the KDB, for use as both a standalone descriptive record for historians, and as a baseline for a subsequent Phase...

  5. RTNS-II [Rotating Target Neutron Source II] operational summary

    International Nuclear Information System (INIS)

    Heikkinen, D.W.

    1988-09-01

    The Rotating Target Neutron Source II facility (RTNS-II) operated for over nine years. Its purpose was to provide high intensities of 14 MeV neutrons for materials studies in the fusion energy program. For the period from 1982-1987, the facility was supported by both the US (Department of Energy) and Japan (Ministry of Education, Culture, and Science). RTNS-II contains two accelerator-based neutron sources which use the T(d,n) 4 He reaction. In this paper, we will summarize the operational history of RTNS-II. Typical operating parameters are given. In addition, a brief description of the experimental program is presented. The current status and future options for the facility are discussed. 7 refs., 5 tabs

  6. Chemical speciation of Pb(II, Cd(II, Hg(II, Co(II, Ni(II, Cu(II and Zn(II binary complexes of l-methionine in 1,2-propanediol-water mixtures

    Directory of Open Access Journals (Sweden)

    M. Padma Latha

    2007-04-01

    Full Text Available Chemical speciation of Pb(II, Cd(II, Hg(II, Co(II, Ni(II, Cu(II and Zn(II complexes of L-methionine in 0.0-60 % v/v 1,2-propanediol-water mixtures maintaining an ionic strength of 0.16 M at 303 K has been studied pH metrically. The active forms of ligand are LH2+, LH and L-. The predominant species detected are ML, MLH, ML2, ML2H, ML2H2 and MLOH. Models containing different numbers of species were refined by using the computer program MINIQUAD 75. The best-fit chemical models were arrived at based on statistical parameters. The trend in variation of complex stability constants with change in the dielectric constant of the medium is explained on the basis of electrostatic and non-electrostatic forces.

  7. New instruments at IPNS: POSY II and SAD II

    International Nuclear Information System (INIS)

    Crawford, R.K.; Felcher, G.P.; Kleb, R.; Epperson, J.E.; Thiyagarajan, P.

    1988-01-01

    Three new instruments are currently in varying degrees of development/construction at IPNS. One of these, the Glass, Liquid, and Amorphous Materials Diffractometer (GLAD) is the subject of a separate paper in these Proceedings, and so will not be discussed further here. The other two, a second neutron reflectometer (POSY II) and a second small-angle diffractometer (SAD II) are described briefly below. 5 refs., 1 fig., 1 tab

  8. Integrated Procurement Management System, Version II

    Science.gov (United States)

    Collier, L. J.

    1985-01-01

    Integrated Procurement Management System, Version II (IPMS II) is online/ batch system for collecting developing, managing and disseminating procurementrelated data at NASA Johnson Space Center. Portions of IPMS II adaptable to other procurement situations.

  9. Bose Condensate in He II

    International Nuclear Information System (INIS)

    Svensson, E.C.

    1984-01-01

    The Condensate Saga, now halfway through its fifth decade, is reviewed. The recent neutron-scattering work which has at last convincingly established that there is indeed a Bose Condensate in He II is described

  10. Tier II Chemical Storage Facilities

    Data.gov (United States)

    Iowa State University GIS Support and Research Facility — Facilities that store hazardous chemicals above certain quantities must submit an annual emergency and hazardous chemical inventory on a Tier II form. This is a...

  11. Penetrating Internet Information Services (IIS).

    African Journals Online (AJOL)

    PROF. O. E. OSUAGWU

    2013-12-01

    Dec 1, 2013 ... Information Services (IIS) packages have been presented. Note that while some of ... encompasses a variety of services including FTP, SMTP ..... for Web-based Distributed Authoring ... denial-of-service vulnerabilities we have.

  12. Coordination compounds of cobalt(II), nickel(II), copper(II), and zinc(II) with pantothenic acid

    Energy Technology Data Exchange (ETDEWEB)

    Shabilalov, A.A.; Yunuskhodzhaev, A.N.; Khodzhaev, O.F.; Azizov, M.A.

    1986-11-01

    The compounds Ni(PANA - H)/sub 2/ x 4H/sub 2/O (PANA stands for pantothenic acid, and - H indicates a deprotonated ligand), Cu(PANA - H)/sub 2/ x 2H/sub 2/O, Zn(PANA - H)/sub 2/ x H/sub 2/O, Co(PANA - H)Cl x H/sub 2/O, and Ni(PANA - H)Cl x 3H/sub 2/O have been synthesized on the basis of pantothenic acid and Co(II), Ni(II), Cu(II), and Zn(II) salts in aqueous media. The compounds have been identified by elemental and x-ray diffraction analysis. Some physicochemical properties (solubility, melting point, molar conductivity) of the compounds obtained have been studied. The structure of the compounds isolated has been established on the basis of an analysis of their IR, ESR, and electronic spectra, as well as derivatograms.

  13. Lunar Health Monitor, Phase II

    Data.gov (United States)

    National Aeronautics and Space Administration — During the Phase II Lunar Health Monitor program, Orbital Research will develop a second generation wearable sensor suite for astronaut physiologic monitoring. The...

  14. Australia; Basel II Implementation Assessment

    OpenAIRE

    International Monetary Fund

    2010-01-01

    The key findings of Australia’s BASEL II implementation assessment are presented. The Australian Prudential Regulation Authority (APRA) allocated sufficient resources, including highly skilled staff, prior to the Basel II start date, and the outcome has been a robust and high-quality implementation that has built upon and substantially strengthened the risk-management capabilities of major banks. The quality of leadership and commitment by all involved has been instrumental in the success of ...

  15. Pb(II), Cd(II) and Zn(II) adsorption on low grade manganese ore ...

    African Journals Online (AJOL)

    Low grade manganese ore (LMO) of Orissa containing 58.37% SiO2, 25.05% MnO2, 8.8% Al2O3, and 5.03% Fe2O3 as the main constituents was taken to study its adsorption behaviour for Pb(II), Cd(II) and Zn(II) from aqueous solutions. The XRD studies showed the crystalline phases to be quartz, ß-MnO2, d-MnO2 and ...

  16. H, HM, and THM-C processes in natural barriers

    Energy Technology Data Exchange (ETDEWEB)

    Javeri, V.; Le, T.T.; Cui, Y.J.; Delage, P.; Li, X.J.; Wieczorek, K.; Jockwer, N.; Romero, E.; Lima, A.; Gens, A.; Li, X.L.; Francois, B.; Nuth, M.; Laloui, L.; Chen, W.; Jia, S.; Yu, H.; Wu, G.; Li, X.; Bernier, F.; Tan, X.; Wu, G.; Jia, S.; Giot, R.; Hoxha, D.; Giraud, A.; Homand, F.; Su, K.; Chavant, C.; Duveau, G.; Jia, Y.; Shao, J.F.; Peron, H.; Laloui, L.; Hueckel, T.; Hu, L.B.; Auvray, C.; Lequiller, B.; Cuisinier, O.; Ferber, V.; Cui, Y.J.; Deneele, D.; Uhlig, L.; Jobmann, M.; Polster, M.; Vaunat, J.; Garrite, B.; Wileveau, Y.; Sato, H.; Jacinto, A.; Sanchez, M.; Ledesma, A.; Morel, J.; Balland, C.; Armand, G.; Nguyen Minh, D.; Vales, F.; Pham, Q.T.; Gharbi, H.; Mokni, N.; Olivella, S.; Li, X.; Smets, St.; Valcke, E.; Karnland, O.; Nilsson, U.; Olsson, S.; Sellin, P.; Fernandez, A.M.; Melon, A.M.; Villar, M.V.; Turrero, M.J.; Garitte, B.; Guimaraes, L.D.N.; Gens, A.; Mayor, J.C.; Koliji, A.; Laloui, L.; Vulliet, L.; Hamdi, N.; Marzouki, A.; Srasra, E.; Cuss, R.J.; Harrington, J.F.; Noy, D.J.; Birchall, D.J.; Marschall, P.; Mallet, A.; Ababou, R.; Matray, J.M.; Renaud, V.; Maison, T.; Enachescu, C.; Frieg, B.; Rohs, St.; Paris, B.; Robinet, J.C.; Bui, T.D.; Barnichon, J.D.; Plas, F.; Klubertanz, G.; Folly, M.; Hufschmied, P.; Frank, E

    2007-07-01

    This session gathers 30 articles (posters) dealing with: the three Dimensional analyses of combined gas, heat and nuclide transport in a repository considering coupled thermo-hydro geomechanical processes; the experimental study on the thermo-hydro-mechanical behaviour of boom clay; hydraulic in-situ measurements in the Opalinus clay in the frame of a heater test performed at the Mont Terri URL; the hydro-mechanical behaviour of natural boom clay in controlled-suction tests; a constitutive approach to address the thermal and hydric impacts in the concept of deep radioactive waste repositories; the numerical analysis on stability of boom clay tunnel by shield construction; a thermo-hydro-mechanical model for clay in unsaturated conditions; the 3D modelling of TER experiment accounting for fully anisotropic thermo-poro-elastic behaviour; the hydro-mechanical modeling of shaft excavation in Meuse/Haute-Marne laboratory; the modelling of drying damage in engineered and natural clay barriers for nuclear waste disposal; the elasto-viscoplastic behaviour of Meuse/Haute-Marne argillite: laboratory tests and modelling; the long-term behaviour of a lime treated soil under percolation conditions; the stress redistribution and hydro-mechanical effects due to excavation and drilling operations in TER experiment; a thermodynamic model on swelling of bentonite buffer and backfill materials; the 3D analysis of a heating test in the Opalinus clay; the THM analysis of a 'mock-up' laboratory experiment using a double-structure expansive model; the measurement of the effect of re-confinement on rock properties around a slot; a laboratory Study of desaturation - re-saturation effects on a clay-stone; the deformation induced by dissolution of salts in porous media; the bentonite swelling pressure in pure water and saline solutions; the mineralogy and sealing properties of various bentonites and smectite-rich clay materials; the evaluation of the geochemical processes occurring in the Opalinus clay formation subjected to a ventilation test; a Soil structure considerations in description of compacted and natural clay behaviour; the hydro-mechanical behaviour of Tunisian clayey soil used as discharge site of acidic waste; the Consolidation and rebound properties of Opalinus clay: a long-term, fully-drained test; the multidimensional modeling of a poro-elastic medium: identification of the behaviour of a clay formation from a stochastic representation of piezometric fluctuations; various approaches for the comprehension of the time-dependent behaviour of Callovo-Oxfordian argilite; a new approach of estimating the influence of drilling mud on the borehole pressure history; the thermo-chemical-hydro-mechanical modelling: contributions to the assessment of the long term behaviour of a nuclear waste disposal in a deep clay formation; and the impact of thermal load on the far field and galleries of a repository.

  17. H, HM, and THM-C processes in engineered barriers

    Energy Technology Data Exchange (ETDEWEB)

    Cui, Y.J.; Tang, A.M.; Loiseau, C.; Delage, P.; Polak, M.; Souli, H.; Fleureau, J.M.; Wu, P.L.; Tien, Y.M.; Romero, E.; LI, Xiang Ling; Tanaka, Y.; Hasegawa, T.; Nakamura, K.; Sahara, F.; Murakami, T.; Kobayashi, I.; Mihara, M.; Ohi, T.; Lu, J.D.; Huang, W.H.; Lee, W.Y.; Sui, I.H.; Villar, M.V.; Sanchez, M.; Gens, A.; Samper, J.; Lu, C.; Montenegro, L.; Birgersson, M.; Karnland, O.; Nilsson, U.; Akesson, M.; Kristensson, O.; Gatabin, C.; Yang, C.R.; Huang, W.H.; Hsiao, T.H.; Dueck, A.; Lonnqvist, M.; Goudarzi, R.; Borgesson, L.; Fernandez, A.M.; Rivas, P.; Melon, A.M.; Villar, M.V.; Ferrow, E.; Bender Koch, Ch.; Suzuki, S.; Sazarashi, M.; Takegahara, T.; Takao, H.; Tanai, K.; Matsumoto, K.; Gatabin, C.; Touze, G.; Imbert, C.; Guillot, W.; Billaud, P

    2007-07-01

    This session gathers 24 articles (posters) dealing with: determining water permeability of a compacted bentonite sand mixture under confined and free-swell conditions; the model prediction of engineered barrier system effectiveness in the fracture at laboratory scale; the changes in the hydraulic properties of a smectite in presence of chromium; the wall friction and ejection behaviour of bentonite-base buffer material; the thermo-hydro-mechanical behaviour of a large scale mock-up test 'Ophelie' in Belgium: laboratory characterization and numerical modelling; modeling swelling characteristics and permeability of several compacted bentonite affected by saline water; modelling for the long-term Mechanical and Hydraulic behaviour of bentonite-based materials considering chemical transitions; the coupled thermal-hydro analysis on partially saturated bentonite; the behaviour of a bentonite barrier in the laboratory: experimental results up to 8 years and numerical simulation; a coupled hydrogeochemical calculations of the interactions of corrosion products and bentonite; the freezing in saturated bentonite: a thermodynamic approach; the mechanical modeling of MX-80: Development of constitutive laws; the mechanical modeling of MX-80 - Quick tools for BBM parameter analysis; TBT{sub 3} Mock-up test-experimental and model results; the suction characteristics of two compacted bentonite; the retention curves and volume change properties of unsaturated MX-80 bentonite: a laboratory study; humidity induced swelling and water absorption rate of highly compacted bentonite; unconfined compression tests on bentonite samples exposed to high temperature during long time in the field test lot; the thermophysical properties of bentonite; the geochemistry and mineralogy of a bentonite subjected to heating and hydration in an in-situ test after five years operation; the LOT project, long term test of buffer material at Aespoe: a Moessbauer spectroscopic study; the self-sealing properties of buffer material under saline condition; a study on extrusion behaviour of buffer material into fractures using X-ray Ct method; and the ESDRED Project, module 1: selection and THM characterisation of the buffer material.

  18. 5. H.M. Majeed Reincarnation, Predestination and Moral ...

    African Journals Online (AJOL)

    REGINALDS

    The article also reveals some serious philosophical difficulties which this Akan conception of moral ... life are believed to be determined or fixed in advance. ... 1 I do not suggest that Indian philosophy may not have a position similar to this.

  19. UK HSE Training of HM Radiation Specialist Inspectors

    International Nuclear Information System (INIS)

    Nattres, E.; Barrett, J. A.

    2004-01-01

    HSE's mission is to ensure that risks to people's health and safety from work activities are properly controlled. Radiation Specialist Inspectors make an essential contribution to HSE's objectives through the application of their professional skills and knowledge. The role of the Radiation Specialist Inspector includes inspection work in the field to ensure compliance by employers with the Health and Safety at Work etc Act 1974, Ionising Radiations Regulations 1999 and associated legislation. They also contribute to research, and the development of technical policy, legislation, standards, and guidance on protection against the possible harm from exposure to electromagnetic fields, optical or ionizing radiation. This paper explains how Radiation Specialist Inspectors are trained. It starts with the recruitment process, with an emphasis on recruiting people who have already gained relevant experience from radiation work practices in previous employments. The interview process is explored, which includes both technical and behavioural interviews, making a presentation and completing a personality questionnaire. The initial twelve months training is then discussed in detail, including the six months as a general Health and Safety Inspector where inspector' skills and techniques' are developed by practical involvement in inspection, followed by a challenging six months with a Radiation Specialist group. The programme for this period is designed to broaden and develop skills and knowledge within the radiation protection specialist. After the initial twelve months probationary period, new Inspectors are expected to confirm and establish themselves in their role of Radiation Specialist Inspectors. However, it does not end there, continuing professional development to ensure that Inspectors have cutting edge knowledge of the latest advances within the radiation field and health and safety as a whole is essential and will be discussed in more detail. (Author) 6 refs

  20. Effectiveness of radiation control program for Dornier HM3 lithotriptor

    International Nuclear Information System (INIS)

    Griffith, D.P.; Gleeson, M.J.; Politis, G.; Glaze, S.

    1989-01-01

    Radiation exposure during extracorporeal shock-wave lithotripsy (ESWL) was calculated using a worst-case method in 135 randomly selected patients. The patients were divided into four groups according to body weight: small (less than 140 pounds), medium (141-180 pounds), large (181-220 pounds), and very large (greater than 220 pounds). Average skin exposure was found to be 15.2 R (from 1.2 to 95.6 R). After implementation of a radiation awareness program radiation exposure was calculated in 128 cases (matched for body weight and stone burden) and average exposure was 9.5 R (from 0.9 to 33.4 R) with a reduction of 20, 37, 33, and 62 percent for each group, respectively. Radiation exposure reduction was primarily due to a reduction in the number of radiographic snapshots taken as a result of preferential use of special-mode fluoroscopic stills. 21 references

  1. Effectiveness of radiation control program for Dornier HM3 lithotriptor

    Energy Technology Data Exchange (ETDEWEB)

    Griffith, D.P.; Gleeson, M.J.; Politis, G.; Glaze, S.

    1989-01-01

    Radiation exposure during extracorporeal shock-wave lithotripsy (ESWL) was calculated using a worst-case method in 135 randomly selected patients. The patients were divided into four groups according to body weight: small (less than 140 pounds), medium (141-180 pounds), large (181-220 pounds), and very large (greater than 220 pounds). Average skin exposure was found to be 15.2 R (from 1.2 to 95.6 R). After implementation of a radiation awareness program radiation exposure was calculated in 128 cases (matched for body weight and stone burden) and average exposure was 9.5 R (from 0.9 to 33.4 R) with a reduction of 20, 37, 33, and 62 percent for each group, respectively. Radiation exposure reduction was primarily due to a reduction in the number of radiographic snapshots taken as a result of preferential use of special-mode fluoroscopic stills. 21 references.

  2. Cr(III,Mn(II,Fe(III,Co(II,Ni(II,Cu(II and Zn(II Complexes with Diisobutyldithiocarbamato Ligand

    Directory of Open Access Journals (Sweden)

    Mohammad Tarique

    2011-01-01

    Full Text Available The synthesis of sulphur and nitrogen containing dithiocarbamato ligand derived from diisobutylamine as well as its coordination compounds with 3d series transition metals is presented. These synthesized compounds were characterized on the basis of elemental analysis, conductometric measurements and IR spectral studies. The analytical data showed the stoichiometry 1:2 and 1:3 for the compounds of the types ML2 {M=Mn(II, Co(II, Ni(II, Cu(II and Zn(II} and M'L3{M'=Cr(III and Fe(III} respectively. The conductometric measurements proved the non-electrolytic behaviour of all the compounds. The bidentate nature of dithiocarbamato moiety was confirmed on the basis of IR spectral data.

  3. Mu2e-II Injection from PIP-II

    Energy Technology Data Exchange (ETDEWEB)

    Neuffer, David [Fermilab

    2018-04-26

    We discuss injection of 800 MeV proton beam from PIP-II into the production target for Mu2e-II, assuming a targeting and μ production scenario similar to mu2e. The incoming beam trajectory must be modified from the mu2e parameters to match the focusing fields. Adding a vertical deflection at injection enables the injected beam to reach the target. Other differences from the mu2e system must be considered, including changes in the target structure, the radiation shielding and beam dump/absorber. H- beam should be stripped to p+. Other variations are discussed.

  4. The CDF SVX II upgrade for the Tevatron Run II

    International Nuclear Information System (INIS)

    Bortoletto, Daniela

    1997-01-01

    A microstrip silicon detector SVX II has been proposed for the upgrade of CDF to be installed in 1999 for Run II of the Tevatron. Three barrels of five layers of double-sided silicon microstrip detectors will cover the interaction region. A description of the project status will be presented. Emphasis will be given to the R and D program for silicon sensors which includes capacitance minimization, the study of coupling capacitor integrity, the operation of the detectors in conjunction with the SVXH and SVX2 readout chips in two beam tests and the determination of the detectors performance deterioration due to radiation damage

  5. EBR-II Data Digitization

    Energy Technology Data Exchange (ETDEWEB)

    Yoon, Su-Jong [Idaho National Lab. (INL), Idaho Falls, ID (United States); Rabiti, Cristian [Idaho National Lab. (INL), Idaho Falls, ID (United States); Sackett, John [Idaho National Lab. (INL), Idaho Falls, ID (United States)

    2014-08-01

    1. Objectives To produce a validation database out of those recorded signals it will be necessary also to identify the documents need to reconstruct the status of reactor at the time of the beginning of the recordings. This should comprehends the core loading specification (assemblies type and location and burn-up) along with this data the assemblies drawings and the core drawings will be identified. The first task of the project will be identify the location of the sensors, with respect the reactor plant layout, and the physical quantities recorded by the Experimental Breeder Reactor-II (EBR-II) data acquisition system. This first task will allow guiding and prioritizing the selection of drawings needed to numerically reproduce those signals. 1.1 Scopes and Deliverables The deliverables of this project are the list of sensors in EBR-II system, the identification of storing location of those sensors, identification of a core isotopic composition at the moment of the start of system recording. Information of the sensors in EBR-II reactor system was summarized from the EBR-II system design descriptions listed in Section 1.2.

  6. RTNS-II: present status

    International Nuclear Information System (INIS)

    Heikkinen, D.W.; Logan, C.M.

    1980-10-01

    The present status of the RTNS-II facility is described and typical operating parameters are given. A brief discussion is given of the methods used in production of the TiT 2 targets as well as their performance and tritium handling at RTNS-II. The various types of non-interactive beam diagnostics presently in use at the neutron sources are outlined. The on-line computer system which provides a time history of an irradiation and records target performance is described. Examples are listed of several representative experimental programs which have been carried out thus far at RTNS-II. These include both active and passive experiments. Finally, several of the major improvements to the facility made since the beginning of the experimental program are given

  7. STARFIRE-II studies. Summary

    International Nuclear Information System (INIS)

    Baker, C.C.; Brooks, J.N.; Ehst, D.A.; Smith, D.L.; Sze, D.K.

    1985-01-01

    The US Department of Energy's Office of Fusion Energy has initiated several studies during FY-1985 called Tokamak Power System Studies (TPSS). The TPSS is being carried out by several laboratories, universities and industry with the general objective of developing innovative physics and technology concepts to improve the commercial attractiveness of tokamak power reactors. The effort of Argonne National Laboratory, entitled STARFIRE-II, is an effort to update and improve STARFIRE, which was the last comprehensive conceptual design study in the US of a commercial tokamak power plant. The STARFIRE-II effort has developed a number of goals in order to improve fusion commercial power plants based in part on several recent studies. The primary goals for STARFIRE-II are listed

  8. First results from SAGE II

    International Nuclear Information System (INIS)

    Abdurashitov, J.N.; Faizov, E.L.; Gavrin, V.N.

    1994-01-01

    The Russian-American Gallium solar neutrino Experiment (SAGE) began the second phase of operation (SAGE II) in September of 1992. Monthly measurements of the integral flux of solar neutrinos have been made with 55 tonnes of gallium. The K-peak results of the first five runs of SAGE II give a capture rate of 76 -18 +21 (stat) -7 +5 (sys) SNU. combined with the SAGE I result, the capture rate is 74 -12 +13 (stat) -7 +5 (sys) SNU. This represents only 56%--60% of the capture rate predicted by different Standard Solar Models

  9. Facilities design for TIBER II

    International Nuclear Information System (INIS)

    Thomson, S.L.; Blevins, J.D.

    1987-01-01

    This paper describes the conceptual design of the reactor building and reactor maintenance building for the TIBER II tokamak. These buildings are strongly influenced by the reactor configuration, and their characterization allows a better understanding of the economic and technical implications of the reactor design. Key features of TIBER II that affect the facilities design are the small size and compact arrangement, the use of an external vacuum vessel, and the complete reliance on remote maintenance. The building design incorporates requirements for equipment layout, maintenance operations and equipment, safety, and contamination control. 4 figs

  10. First results from SAGE II

    International Nuclear Information System (INIS)

    Aburashitov, J.N.; Faizov, E.L.; Gavrin, V.N.; Gusev, A.O.; Kalikhov, A.V.; Knodel, T.V.; Knyshenko, I.I.; Kornoukhov, V.N.; Mirmov, I.N.; Pshukov, A.M.; Shalagin, A.M.; Shikhin, A.A.; Timofeyev, P.V.; Veretenkin, E.P.; Vermul, V.M.; Zatsepin, G.T.; Bowles, T.J.; Nico, J.S.; Teasdale, W.A.; Wark, D.L.; Wilkerson, J.F.; Cleveland, B.T.; Daily, T.; Davis, R. Jr.; Lande, K.; Lee, C.K.; Wildenhain, P.W.; Elliott, S.R.; Cherry, M.L.

    1995-01-01

    The Russian-American Gallium solar neutrino Experiment (SAGE) began the second phase of operation (SAGE II) in September of 1992. Monthly measurements of the integral flux of solar neutrinos have been made with 55 tonnes of gallium. The K-peak results of the first five runs of SAGE II give a capture rate of 76 +21 -18 (stat) +5 -7 (sys) SNU. Combined with the SAGE I result, the capture rate is 74 +13 -12 (stat) +5 -7 (sys) SNU. This represents only 56%--60% of the capture rate predicted by different Standard Solar Models. copyright 1995 American Institute of Physics

  11. Extinction of H II regions

    International Nuclear Information System (INIS)

    Israel, F.P.; Kennicutt, R.C.

    1980-01-01

    Visual extinction of H II regions in nine nearby galaxies as derived from the ratio of the radio continuum emission to H-alpha emission is systematically larger than visual extinction deduced from the Balmer lines alone, if one assumes a value Av/E(B-V) 3. An optically-limited sample of about 30 extragalactic H II regions has a mean extinction of 1.7 m in the visual while about 1.2 m is not seen in the reddening of the Balmer lines. Both reddening and extinction decreases with increasing galactic radius, at least for M33 and M101

  12. Synthesis and structural characterization of nickel(II), cobalt(II), Zinc(II), manganese(II), cadmium(II) and uranium(VI) complexes of α-oximinoacetoacet-o/p-anisidide thiosemicarbazone

    International Nuclear Information System (INIS)

    Patel, P.S.; Patel, M.M.; Ray, R.M.

    1993-01-01

    A few metal complexes of α-oximinoacetoacet-o/p-anisidide thiosemicarbazones (OAOATS)/(OAPATS) with Ni(II), Co(II), Zn(II), Mn(II), Hg(II), Cd(II) and UO 2 (II) have been prepared and characterized by elemental analyses, conductivity, differential scanning calorimetry study, thermogravimetric analyses and infrared and electronic spectral measurements in conjunction with magnetic susceptibility measurements at room temperature. They have also been tested for their antimicrobial activities. (author). 24 refs., 2 tabs

  13. Irradiations at RTNS-II

    International Nuclear Information System (INIS)

    Heikkinen, D.W.; Logan, C.M.

    1982-01-01

    The RTNS-II 14-MeV neutron source facility at Lawrence Livermore National Laboratory is described. Average neutron source parameters are outlined. A brief general description of the irradiation program to the present time is given. A short discussion of guidelines for prospective users is also given

  14. DUMAND-II progress report

    International Nuclear Information System (INIS)

    Wilkes, R.J.; Alexander, C.M.; Aoki, T.; Berson, U.; Bosetti, P.; Bolesta, J.; Boynton, P.E.; Bradner, H.; Camerini, U.; Dye, S.T.; Gergin, E.; Gorham, P.W.; Grieder, P.K.F.; Grogan, W.; Hanada, H.; Harris, D.; Hayashino, T.; Hazen, E.; Ito, M.; Jaworski, M.; Jenko, M.; Kawamoto, H.; Kitamura, T.; Kobayakawa, K.; Kondo, S.; Koske, P.; Learned, J.G.; Ley, C.; Lord, J.J.; Lord, R.; Lozic, T.; March, R.; Matsumoto, T.; Matsuno, S.; Mavretic, A.; McCourry, L.; Mignard, M.; Miller, K.; Minkowski, P.; Mitiguy, R.; Mitsui, K.; Narita, S.; Nicklaus, D.

    1993-01-01

    The design, scientific goals, and capabilities of the DUMAND II detector system are described. Construction was authorized by DOE in 1990, and construction of various detector subsystems is under way. Current plans include deployment of the shore cable, junction box and three strings of optical detector modules in 1993, with expansion to the full 9-string configuration about one year later

  15. Tech Area II: A history

    Energy Technology Data Exchange (ETDEWEB)

    Ullrich, R. [Ktech Corp., Albuquerque, NM (United States)

    1998-07-01

    This report documents the history of the major buildings in Sandia National Laboratories` Technical Area II. It was prepared in support of the Department of Energy`s compliance with Section 106 of the National Historic Preservation Act. Technical Area II was designed and constructed in 1948 specifically for the final assembly of the non-nuclear components of nuclear weapons, and was the primary site conducting such assembly until 1952. Both the architecture and location of the oldest buildings in the area reflect their original purpose. Assembly activities continued in Area II from 1952 to 1957, but the major responsibility for this work shifted to other sites in the Atomic Energy Commission`s integrated contractor complex. Gradually, additional buildings were constructed and the original buildings were modified. After 1960, the Area`s primary purpose was the research and testing of high-explosive components for nuclear weapons. In 1994, Sandia constructed new facilities for work on high-explosive components outside of the original Area II diamond-shaped parcel. Most of the buildings in the area are vacant and Sandia has no plans to use them. They are proposed for decontamination and demolition as funding becomes available.

  16. Light harvesting in photosystem II

    NARCIS (Netherlands)

    van Amerongen, H.; Croce, R.

    2013-01-01

    Water oxidation in photosynthesis takes place in photosystem II (PSII). This photosystem is built around a reaction center (RC) where sunlight-induced charge separation occurs. This RC consists of various polypeptides that bind only a few chromophores or pigments, next to several other cofactors. It

  17. TJ-II Library Manual

    International Nuclear Information System (INIS)

    Tribaldos, V.; Milligen, B.Ph., van; Lopez-Fraguas, A.

    1996-01-01

    This report contains a detailed description of the TJ-II library and its routines. The library is written in FORTRAN 77 language and is available in the CRAY J916 and DEC Alpha 8400 computers at CIEMAT. This document also contains some examples of its use. (Author)

  18. Case 22:Type II diabetes

    Science.gov (United States)

    Diabetes mellitus is characterized by elevated blood glucose levels. It is composed of two types depending on the pathogenesis. Type I diabetes is characterized by insulin deficiency and usually has its onset during childhood or teenage years. This is also called ketosis-prone diabetes. Type II diab...

  19. Rahvusvaheline "Scripta manent II" Tallinnas

    Index Scriptorium Estoniae

    2000-01-01

    Eduard Taska 110. sünniaastapäevale pühendatud rahvusvaheline köitekunsti- ja kalligraafianäitus "Scripta manent II" Tallinna Kunstihoones. Köitekunsti osas pälvis "kuldraamatu" Marielle Liivat, ergutusauhinnad: Marje Kask, Kadi Kiipus, Urve Kolde

  20. Recent results from DORIS II

    International Nuclear Information System (INIS)

    Bloom, E.D.

    1985-01-01

    This report contains a brief review of recent results from the ARGUS and Crystal Ball experiments at DORIS II, concentrating on UPSILON(1S) and UPSILON(2S) spectroscopy with a short foray into γγ physics. 18 refs., 10 figs

  1. Paiton II financing locked up

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1996-04-01

    The 2 x 610 MW Paiton II coal-fired independent power project in Indonesia became a reality last week with the completion of a 1.36 billion dollars commercial financing for the 1.65 billion dollar undertaking. Details of the financing are given. A table lists Indonesia`s independent power projects and their current status.

  2. Elizabeth II / Fagira D. Morti

    Index Scriptorium Estoniae

    Fagira D. Morti, pseud., 1974-

    2006-01-01

    Järjejutt Elizabeth II elust. Järgneb nr. 80, lk. 30-33, nr. 81, lk. 30-32, nr. 82, lk. 34-36, nr. 83, lk. 34-37, nr. 84, lk. 42-45, nr. 85, lk. 36-38, 86, lk. 44-47, nr. 87, lk. 32-35. Nr. 86 ja 87 autor: Helene Wait

  3. Application Programming in AWIPS II

    Science.gov (United States)

    Smit, Matt; McGrath, Kevin; Burks, Jason; Carcione, Brian

    2012-01-01

    Since its inception almost 8 years ago, NASA's Short-term Prediction Research and Transition (SPoRT) Center has integrated NASA data into the National Weather Service's decision support system (DSS) the Advanced Weather Interactive Processing System (AWIPS). SPoRT has, in some instances, had to shape and transform data sets into various formats and manipulate configurations to visualize them in AWIPS. With the advent of the next generation of DSS, AWIPS II, developers will be able to develop their own plugins to handle any type of data. Raytheon is developing AWIPS II to be a more extensible package written mainly in Java, and built around a Service Oriented Architecture. A plugin architecture will allow users to install their own code modules, and (if all the rules have been properly followed) they will work hand-in-hand with AWIPS II as if it were originally built in. Users can bring in new datasets with existing plugins, tweak plugins to handle a nuance or desired new functionality, or create an entirely new visualization layout for a new dataset. SPoRT is developing plugins to ensure its existing NASA data will be ready for AWIPS II when it is delivered, and to prepare for the future of new instruments on upcoming satellites.

  4. Type-II Weyl semimetals.

    Science.gov (United States)

    Soluyanov, Alexey A; Gresch, Dominik; Wang, Zhijun; Wu, QuanSheng; Troyer, Matthias; Dai, Xi; Bernevig, B Andrei

    2015-11-26

    Fermions--elementary particles such as electrons--are classified as Dirac, Majorana or Weyl. Majorana and Weyl fermions had not been observed experimentally until the recent discovery of condensed matter systems such as topological superconductors and semimetals, in which they arise as low-energy excitations. Here we propose the existence of a previously overlooked type of Weyl fermion that emerges at the boundary between electron and hole pockets in a new phase of matter. This particle was missed by Weyl because it breaks the stringent Lorentz symmetry in high-energy physics. Lorentz invariance, however, is not present in condensed matter physics, and by generalizing the Dirac equation, we find the new type of Weyl fermion. In particular, whereas Weyl semimetals--materials hosting Weyl fermions--were previously thought to have standard Weyl points with a point-like Fermi surface (which we refer to as type-I), we discover a type-II Weyl point, which is still a protected crossing, but appears at the contact of electron and hole pockets in type-II Weyl semimetals. We predict that WTe2 is an example of a topological semimetal hosting the new particle as a low-energy excitation around such a type-II Weyl point. The existence of type-II Weyl points in WTe2 means that many of its physical properties are very different to those of standard Weyl semimetals with point-like Fermi surfaces.

  5. Sequestration of Cu(II), Ni(II), and Co(II) by ethyleneimine immobilized on silica

    International Nuclear Information System (INIS)

    Arakaki, Luiza N.H.; Alves, Ana Paula M.; Silva Filho, Edson C. da; Fonseca, Maria G.; Oliveira, Severino F.; Espinola, Jose Geraldo P.; Airoldi, Claudio

    2007-01-01

    Thermodynamic data on interaction of Cu(II), Ni(II), and Co(II) with silica modified with ethyleneimine are obtained by calorimetric titration. The amount of ethyleneimine anchored on silica surface was estimated to be 0.70 mmol g -1 . The enthalpies of binding Ni(II), Cu(II) and Co(II), are -3.59 ± 0.001, -4.88 ± 0.001, and -7.75 ± 0.003 kJ mol -1 , respectively

  6. Solar photocatalytic removal of Cu(II), Ni(II), Zn(II) and Pb(II): Speciation modeling of metal-citric acid complexes

    International Nuclear Information System (INIS)

    Kabra, Kavita; Chaudhary, Rubina; Sawhney, R.L.

    2008-01-01

    The present study is targeted on solar photocatalytic removal of metal ions from wastewater. Photoreductive deposition and dark adsorption of metal ions Cu(II), Ni(II), Pb(II) and Zn(II), using solar energy irradiated TiO 2 , has been investigated. Citric acid has been used as a hole scavenger. Modeling of metal species has been performed and speciation is used as a tool for discussing the photodeposition trends. Ninety-seven percent reductive deposition was obtained for copper. The deposition values of other metals were significantly low [nickel (36.4%), zinc (22.2%) and lead (41.4%)], indicating that the photocatalytic treatment process, using solar energy, was more suitable for wastewater containing Cu(II) ions. In absence of citric acid, the decreasing order deposition was Cu(II) > Ni(II) > Pb(II) > Zn(II), which proves the theoretical thermodynamic predictions about the metals

  7. Radioimmunologic determination of plasmapepsinogen II

    International Nuclear Information System (INIS)

    Patzschke, C.; Berg, U.

    1979-01-01

    Within the frame of this study the pepsinogen II concentration could be determined for the first time with a radioimmunoassay in the plasma. In our normal study group the mean value was 13.91 ng/ml with a variation between 4.08 and 36.19 ng/ml. With increasing patient age a continuous increase of this concentration could be observed. The mean value of 14.99 ng/ml for male patients was by 4.75 ng/ml higher than the mean value of 10.24 ng/ml for female patients. The 24 hour profiles represented for the pepsinogen plasma concentration daily physiologic fluctuations and a stabilisation at night. The effects of meals could not be defined unambiguously. In stimulation tests Pentagastrin provoked in 4 of 9 test persons an increase of the concentration of up to 70% of the basic value. In short-term stress-tests the Pg II concentrations found in the test subjects presented an increase or a decrease. In investigations before or after the same patient underwent an operative procedure, an expressive Pg II decrease (up to 33.74 ng/ml) could be detected. Patients with a total resection of the stomach had only a very low Pg II concentration (less than 3.1 ng/ml). In patients with gastric pathologies a significant difference of the confidence limits was found for the Pg II concentration between superficial gastritis (m = 16.04 ng/ml) and atrophic gastritis (m = 27.38 ng/ml). Compared with various gastric diseases the normal patient group presents a significant difference with reference to the atrophic gastritis or the cancerous stomach. The mean values found in atrophic gastritis or the cancerous stomach. The mean values found in atrophic gastritis and in gastric carcinoma are close to each other and are increased, compared to those measured in the normal patient group. (orig./MG) [de

  8. Synthesis, Characterization, and Biological Activity of Mn(II, Fe(II, Co(II, Ni(II, Cu(II, Zn(II, and Cd(II Complexes of N-Thiophenoyl-N′-Phenylthiocarbohydrazide

    Directory of Open Access Journals (Sweden)

    M. Yadav

    2013-01-01

    Full Text Available Mn(II, Fe(II, Co(II, Ni(II, Cu(II, Zn(II, and Cd(II complex of N-thiophenoyl -N′-phenylthiocarbohydrazide (H2 TPTH have been synthesized and characterized by elemental analysis, magnetic susceptibility measurements, infrared, NMR, electronic, and ESR spectral studies. The complexes were found to have compositions [Mn(H TPTH2], [Co(TPTH (H2O2], [Ni(TPTH (H2O2], [Cu(TPTH], [Zn(H TPTH], [Cd(H TPTH2], and [Fe(H TPTH2(EtOH]. The magnetic and electronic spectral studies suggest square planar geometry for [Cu(TPTH], tetrahedral geometry for [Zn(TPTH] and [Cd(H TPTH2], and octahedral geometry for rest of the complexes. The infrared spectral studies of the 1 : 1 deprotonated complexes suggest bonding through enolic oxygen, thiolato sulfur, and both the hydrazinic nitrogens. Thus, H2TPTH acts as a binegative tetradentate ligand. H2 TPTH and its metal complexes have been screened against several bacteria and fungi.

  9. Digital logic circuit design with ALTERA Quartus II

    International Nuclear Information System (INIS)

    Lee, Seung Ho

    2009-09-01

    This book consists 31 chapters about digital logic circuit with ALTERA Quartus II. It includes the introduction of ALTERA Quartus II, ALTERA Quartus II schematic editor, ALTERA Quartus II compiler, ALTERA Quartus II simulator, ALTERA Quartus II timing analyzer, how to use HBE-COMBO II training and HBE-COMBO II training kit with schematic editor, VHDL grammar and practice of ALTERA Quartus II and HBE-COMBO II training kit with VHDL.

  10. Adsorption of Pb(II), Cu(II), Cd(II), Zn(II), Ni(II), Fe(II), and As(V) on bacterially produced metal sulfides.

    Science.gov (United States)

    Jong, Tony; Parry, David L

    2004-07-01

    The adsorption of Pb(II), Cu(II), Cd(II), Zn(II), Ni(II), Fe(II) and As(V) onto bacterially produced metal sulfide (BPMS) material was investigated using a batch equilibrium method. It was found that the sulfide material had adsorptive properties comparable with those of other adsorbents with respect to the specific uptake of a range of metals and, the levels to which dissolved metal concentrations in solution can be reduced. The percentage of adsorption increased with increasing pH and adsorbent dose, but decreased with increasing initial dissolved metal concentration. The pH of the solution was the most important parameter controlling adsorption of Cd(II), Cu(II), Fe(II), Ni(II), Pb(II), Zn(II), and As(V) by BPMS. The adsorption data were successfully modeled using the Langmuir adsorption isotherm. Desorption experiments showed that the reversibility of adsorption was low, suggesting high-affinity adsorption governed by chemisorption. The mechanism of adsorption for the divalent metals was thought to be the formation of strong, inner-sphere complexes involving surface hydroxyl groups. However, the mechanism for the adsorption of As(V) by BPMS appears to be distinct from that of surface hydroxyl exchange. These results have important implications to the management of metal sulfide sludge produced by bacterial sulfate reduction.

  11. Information on Asse II; Informationen ueber die Schachtanlage Asse II

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2014-07-15

    The information on Asse II include the following topics: The image and what is behind - the barrier building Dammjoch built 1914; Fact finding - underground explorations; concept for a site comparison; Learning from experiences - the final repository projects Asse, Gorleben and Morsleben show what should not be done; At first drilling - thereafter building - progress of the recovery duct; The retrieval can only go on in dialogue with the public.

  12. Type II Supernova Spectral Diversity. II. Spectroscopic and Photometric Correlations

    Science.gov (United States)

    Gutiérrez, Claudia P.; Anderson, Joseph P.; Hamuy, Mario; González-Gaitan, Santiago; Galbany, Lluis; Dessart, Luc; Stritzinger, Maximilian D.; Phillips, Mark M.; Morrell, Nidia; Folatelli, Gastón

    2017-11-01

    We present an analysis of observed trends and correlations between a large range of spectral and photometric parameters of more than 100 type II supernovae (SNe II), during the photospheric phase. We define a common epoch for all SNe of 50 days post-explosion, where the majority of the sample is likely to be under similar physical conditions. Several correlation matrices are produced to search for interesting trends between more than 30 distinct light-curve and spectral properties that characterize the diversity of SNe II. Overall, SNe with higher expansion velocities are brighter, have more rapidly declining light curves, shorter plateau durations, and higher 56Ni masses. Using a larger sample than previous studies, we argue that “Pd”—the plateau duration from the transition of the initial to “plateau” decline rates to the end of the “plateau”—is a better indicator of the hydrogen envelope mass than the traditionally used optically thick phase duration (OPTd: explosion epoch to end of plateau). This argument is supported by the fact that Pd also correlates with s 3, the light-curve decline rate at late times: lower Pd values correlate with larger s 3 decline rates. Large s 3 decline rates are likely related to lower envelope masses, which enables gamma-ray escape. We also find a significant anticorrelation between Pd and s 2 (the plateau decline rate), confirming the long standing hypothesis that faster declining SNe II (SNe IIL) are the result of explosions with lower hydrogen envelope masses and therefore have shorter Pd values. This paper includes data gathered with the 6.5 m Magellan Telescopes located at Las Campanas Observatory, Chile; and the Gemini Observatory, Cerro Pachon, Chile (Gemini Program GS- 2008B-Q-56). Based on observations collected at the European Organisation for Astronomical Research in the Southern Hemisphere, Chile (ESO Programs 076.A-0156, 078.D-0048, 080.A-0516, and 082.A-0526).

  13. Information on Asse II; Informationen ueber die Schachtanlage Asse II

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2015-02-15

    The information brochure on Asse II describes the situation in the repository for radioactive wastes that was closed by law due to the violations of safety standards. The discussed topics include the necessity of waste retrieval, the problems with public anxiety and public information, the hazard of an uncontrolled water ingress (worst case scenario), the work sites in the cavern, man-machine interactions and the cost of the project.

  14. Removal of lead(II) by adsorption using treated granular activated carbon: batch and column studies.

    Science.gov (United States)

    Goel, Jyotsna; Kadirvelu, Krishna; Rajagopal, Chitra; Kumar Garg, Vinod

    2005-10-17

    In the present study, a deeper understanding of adsorption behavior of Pb(II) from aqueous systems onto activated carbon and treated activated carbon has been attempted via static and column mode studies under various conditions. It probes mainly two adsorbents that is, activated carbon (AC) and modified activated carbon (AC-S). Characterization of both the adsorbents was one of the key focal areas of the present study. This has shown a clear change or demarcation in the various physical and chemical properties of the modified adsorbent from its precursor activated carbon. Both the adsorbents are subjected to static mode adsorption studies and then after a comparison based on isotherm analysis; more efficient adsorbent is screened for column mode adsorption studies. The lead removal increased for sample of treated carbon. The extent of Pb(II) removal was found to be higher in the treated activated carbon. The aim of carrying out the continuous-flow studies was to assess the effect of various process variables, viz., of bed height, hydraulic loading rate and initial feed concentration on breakthrough time and adsorption capacity. This has helped in ascertaining the practical applicability of the adsorbent. Breakthrough curves were plotted for the adsorption of lead on the adsorbent using continuous-flow column operation by varying different operating parameters like hydraulic loading rate (3.0-10.5 m3/(hm2)), bed height (0.3-0.5 m) and feed concentrations (2.0-6.0 mg/l). At the end, an attempt has also been made to model the data generated from column studies using the empirical relationship based on Bohart-Adams model. This model has provided an objective framework to the subjective interpretation of the adsorption system and the model constant obtained here can be used to achieve the ultimate objective of our study that is, up scaling and designing of adsorption process at the pilot plant scale level. AC-S column regeneration using 0.5 and 1.0M concentration of

  15. Physicochemical properties of 3,4,5-trimethoxybenzoates of Mn(II, Co(II, Ni(II and Zn(II

    Directory of Open Access Journals (Sweden)

    W. FERENC

    2005-09-01

    Full Text Available The complexes of Mn(II, Co(II, Ni(II, Cu(II and Zn(II with 3,4,5-trimethoxybenzoic acid anion of the formula: M(C10H11O52·nH2O, where n = 6 for Ni(II, n = 1 for Mn(II, Co(II, Cu(II, and n = 0 for Zn, have been synthesized and characterized by elemental analysis, IR spectroscopy, X–ray diffraction measurements, thermogravimetry and magnetic studies. They are crystalline compounds characterized by various symmetry. They decompose in various ways when heated in air to 1273 K. At first, they dehydrate in one step and form anhydrous salts. The final products of decomposition are oxides of the respective metals (Mn2O3, Co3O4, NiO, CuO, ZnO. The solubilities of the analysed complexes in water at 293 K are in the orders of 10-2 – 10-4 mol dm-3. The magnetic susceptibilities of the Mn(II, Co(II, Ni(II and Cu(II complexes were measured over the range of 76–303 K and the magnetic moments were calculated. The results show that the 3,4,5-trimethoxybenzoates of Mn(II, Co(II and Ni(II are high-spin complexes but that of Cu(II forms a dimer [Cu2(C10H11O54(H2O2]. The carboxylate groups bind as monodentate or bidentate chelating or bridging ligands.

  16. TAF(II)250: a transcription toolbox.

    Science.gov (United States)

    Wassarman, D A; Sauer, F

    2001-08-01

    Activation of RNA-polymerase-II-dependent transcription involves conversion of signals provided by gene-specific activator proteins into the synthesis of messenger RNA. This conversion requires dynamic structural changes in chromatin and assembly of general transcription factors (GTFs) and RNA polymerase II at core promoter sequence elements surrounding the transcription start site of genes. One hallmark of transcriptional activation is the interaction of DNA-bound activators with coactivators such as the TATA-box binding protein (TBP)-associated factors (TAF(II)s) within the GTF TFIID. TAF(II)250 possesses a variety of activities that are likely to contribute to the initial steps of RNA polymerase II transcription. TAF(II)250 is a scaffold for assembly of other TAF(II)s and TBP into TFIID, TAF(II)250 binds activators to recruit TFIID to particular promoters, TAF(II)250 regulates binding of TBP to DNA, TAF(II)250 binds core promoter initiator elements, TAF(II)250 binds acetylated lysine residues in core histones, and TAF(II)250 possesses protein kinase, ubiquitin-activating/conjugating and acetylase activities that modify histones and GTFs. We speculate that these activities achieve two goals--(1) they aid in positioning and stabilizing TFIID at particular promoters, and (2) they alter chromatin structure at the promoter to allow assembly of GTFs--and we propose a model for how TAF(II)250 converts activation signals into active transcription.

  17. Roget's II the new thesaurus

    CERN Document Server

    2003-01-01

    Roget’s II: The New Thesaurus, Third Edition, allows the user to find the right synonym with a minimum of effort. Unlike many thesauruses, this easy-to-use reference lists main entry words alphabetically, as in a dictionary, for quick lookup. Each entry is divided into senses, with brief definitions and a full list of synonyms for each sense, to ensure that the selected usage is the most appropriate one. All special usages, such as slang terms, are labeled and grouped together at the end of each synonym list. Following each list is a cross-reference to a related entry in the thesaurus’s unique Category Index. This index leads the reader from the starting word to dozens of others that have related or opposite meanings. All these features make Roget’s II the best resource for finding the right word every time.

  18. Belle II silicon vertex detector

    Energy Technology Data Exchange (ETDEWEB)

    Adamczyk, K. [H. Niewodniczanski Institute of Nuclear Physics, Krakow 31-342 (Poland); Aihara, H. [Department of Physics, University of Tokyo, Tokyo 113-0033 (Japan); Angelini, C. [Dipartimento di Fisica, Università di Pisa, I-56127 Pisa (Italy); INFN Sezione di Pisa, I-56127 Pisa (Italy); Aziz, T.; Babu, V. [Tata Institute of Fundamental Research, Mumbai 400005 (India); Bacher, S. [H. Niewodniczanski Institute of Nuclear Physics, Krakow 31-342 (Poland); Bahinipati, S. [Indian Institute of Technology Bhubaneswar, Satya Nagar (India); Barberio, E.; Baroncelli, Ti.; Baroncelli, To. [School of Physics, University of Melbourne, Melbourne, Victoria 3010 (Australia); Basith, A.K. [Indian Institute of Technology Madras, Chennai 600036 (India); Batignani, G. [Dipartimento di Fisica, Università di Pisa, I-56127 Pisa (Italy); INFN Sezione di Pisa, I-56127 Pisa (Italy); Bauer, A. [Institute of High Energy Physics, Austrian Academy of Sciences, 1050 Vienna (Austria); Behera, P.K. [Indian Institute of Technology Madras, Chennai 600036 (India); Bergauer, T. [Institute of High Energy Physics, Austrian Academy of Sciences, 1050 Vienna (Austria); Bettarini, S. [Dipartimento di Fisica, Università di Pisa, I-56127 Pisa (Italy); INFN Sezione di Pisa, I-56127 Pisa (Italy); Bhuyan, B. [Indian Institute of Technology Guwahati, Assam 781039 (India); Bilka, T. [Faculty of Mathematics and Physics, Charles University, 121 16 Prague (Czech Republic); Bosi, F. [INFN Sezione di Pisa, I-56127 Pisa (Italy); Bosisio, L. [Dipartimento di Fisica, Università di Trieste, I-34127 Trieste (Italy); INFN Sezione di Trieste, I-34127 Trieste (Italy); and others

    2016-09-21

    The Belle II experiment at the SuperKEKB collider in Japan is designed to indirectly probe new physics using approximately 50 times the data recorded by its predecessor. An accurate determination of the decay-point position of subatomic particles such as beauty and charm hadrons as well as a precise measurement of low-momentum charged particles will play a key role in this pursuit. These will be accomplished by an inner tracking device comprising two layers of pixelated silicon detector and four layers of silicon vertex detector based on double-sided microstrip sensors. We describe herein the design, prototyping and construction efforts of the Belle-II silicon vertex detector.

  19. MPS II drift chamber system

    International Nuclear Information System (INIS)

    Platner, E.D.

    1982-01-01

    The MPS II detectors are narrow drift space chambers designed for high position resolution in a magnetic field and in a very high particle flux environment. Central to this implementation was the development of 3 multi-channel custom IC's and one multi-channel hybrid. The system is deadtimeless and requires no corrections on an anode-to-anode basis. Operational experience and relevance to ISABELLE detectors is discussed

  20. FRM-II conversion revisited

    International Nuclear Information System (INIS)

    Glaser, A.; Pistner, C.; Liebert, W.

    2000-01-01

    The possibilities for a conversion of the currently constructed research reactor FRM-II has been extensively discussed at various RERTR meetings over the past years. In order to support the ongoing decision-making process in Germany, we prepared computer simulations providing extra information on the scientific usability of the converted reactor based on designs proposed by ANL and TUM. The most important results of these calculations are presented and discussed. Special attention is thereby given to the specific German context. (author)

  1. TRANSWRAP II: problem definition manual

    International Nuclear Information System (INIS)

    Knittle, D.E.

    1981-02-01

    The TRANSWRAP II computer code, written in Fortran IV and described in this Problem Definition Manual, was developed to analytically predict the magnitude of pressure pulses of large scale sodium-wate reactions in LMFBR secondary systems. It is currently being used for the Clinch River Breeder Reactor Program. The code provides the options, flexibility and features necessary to consider any system configuration. The code methodology has been validated with the aid of extensive sodium-water reaction test programs

  2. Spectroscopic and thermal degradation behavior of Mg(II, Ca(II, Ba(II and Sr(II complexes with paracetamol drug

    Directory of Open Access Journals (Sweden)

    Moamen S. Refat

    2017-05-01

    Full Text Available Complexes of Mg(II, Ca(II, Ba(II and Sr(II with paracetamol drug were synthesized and characterized by elemental analysis, conductivity, UV–Vis, IR, and 1H NMR spectroscopy and thermal analysis, as well as screened for antimicrobial activity. The IR spectral data suggested that the ligand behaves as paracetamol behaves as a neutral bidentate ligand coordinated to the metal ions via the lone pair of electrons of nitrogen and carbonyl-O atoms of the amide group. From the microanalytical data, the stoichiometry of the complexes reacts with Mg(II, Ca(II, Ba(II and Sr(II by molar ratios (2:1 (paracetamol:metal ion. The thermal behavior (TG/DTG of the complexes was studied. The ligand and their metal complexes were screened against both of antibacterial and fungicidal activities.

  3. World War II Weather Record Transmittances

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — World War II Weather Record Transmittances are a record of the weather and meteorological data observed during World War II and transferred to the archive. It...

  4. Synthesis and characterization of heterobimetallic complexes of the type [Cu(pn2][MCl4] where M = Co(II, Ni(II, Cu(II, Zn(II, Cd(II, and Hg(II

    Directory of Open Access Journals (Sweden)

    Seema Yadav

    2016-11-01

    Full Text Available A series of new bimetallic transition metal complexes of the type [Cu(pn2] [MCl4] have been synthesized (where M = Co(II, Ni(II, Cu(II, Zn(II, Cd(II and Hg(II, pn = 1,3-diaminopropane and characterized by elemental analysis, molar conductance, TGA, IR and electronic spectra. All the compounds are 1:1 electrolyte in DMF. The Cu(II ion is square-planar while metal ions in the anionic moiety acquire their usual tetrahedral arrangement. On the basis of these studies it is concluded that anionic moiety is electrically stabilized by its cationic counterpart.

  5. Preparation of Schiff s base complexes of Mn(II), Co(II), Ni(II), Cu(II), Zn(II), and Cd(II) and their spectroscopic, magnetic, thermal, and antifungal studies

    International Nuclear Information System (INIS)

    Parekh, H.M.; Patel, M.N.

    2006-01-01

    The potassium salt of salicylidene-DL-alanine (KHL), bis(benzylidene)ethylenediamine (A 1 ), thiophene-o-carboxaldene-p-toluidine (A 2 ), and its metal complexes of the formula [(M II (L)(A)(H 2 O)] (M=Mn(II), Co(II), Ni(II), Cu(II), Zn(II), and Cd(II); A = A 1 or A 2 ) are prepared. They are characterized by elemental analysis, magnetic susceptibility measurements, thermogravimetric analysis, and infrared and electronic spectral studies. The electronic spectral and magnetic moment data suggest an octahedral geometry for the complexes. All of these complexes, metal nitrates, fungicides (bavistin and emcarb), and ligands are screened for their antifungal activity against Aspergillus niger, Fusarium oxysporum, and Aspergillus flavus using a plate poison technique. The complexes show higher activity than those of the free ligands, metal nitrate, and the control (DMSO) and moderate activity against bavistin and emcarb [ru

  6. Status of Gerda Phase II

    Energy Technology Data Exchange (ETDEWEB)

    Wagner, Victoria [Max-Planck-Institut fuer Kernphysik, Heidelberg (Germany); Collaboration: GERDA-Collaboration

    2016-07-01

    The GERDA experiment is designed to search for neutrinoless double beta (0νββ) decay of {sup 76}Ge. In Phase I of the experiment a background index (BI) of 10{sup -2} cts/(keV.kg.yr) was reached. No signal has been found and a lower limit on the half-life of 2.1.10{sup 25} yr (at 90% C.L.) is extracted. The aim of Phase II is to double the Ge mass and further reduce the BI by an order of magnitude to explore half-lives of about 10{sup 26} yr. Thirty new Broad Energy Germanium (BEGe) detectors have been produced. These detectors are distinct for their improved energy resolution and enhanced pulse shape discrimination of signal from background events. Further background reduction will be reached by an active veto to read out argon scintillation light. The Phase II commissioning showed that two of the major background components, external γ-rays from {sup 214}Bi and {sup 208}Tl decays, can be suppressed up to two orders of magnitude. This talk presents the current status of the GERDA Phase II upgrade.

  7. Testing the Gossamer Albatross II

    Science.gov (United States)

    1980-01-01

    The Gossamer Albatross II is seen here during a test flight at NASA's Dryden Flight Research Center, Edwards, California. The original Gossamer Albatross is best known for completing the first completely human powered flight across the English Channel on June 12, 1979. The Albatross II was the backup craft for the Channel flight. It was fitted with a small battery-powered electric motor and flight instruments for the NASA research program in low-speed flight. NASA completed its flight testing of the Gossamer Albatross II and began analysis of the results in April, 1980. During the six week program, 17 actual data gathering flights and 10 other flights were flown here as part of the joint NASA Langley/Dryden flight research program. The lightweight craft, carrying a miniaturized instrumentation system, was flown in three configurations; using human power, with a small electric motor, and towed with the propeller removed. Results from the program contributed to data on the unusual aerodynamic, performance, stability, and control characteristics of large, lightweight aircraft that fly at slow speeds for application to future high altitude aircraft. The Albatross' design and research data contributed to numerous later high altitude projects, including the Pathfinder.

  8. Light echoes - Type II supernovae

    International Nuclear Information System (INIS)

    Schaefer, B.E.

    1987-01-01

    Type II supernovae (SNs) light curves show a remarkable range of shapes. Data have been collected for the 12 Type II SNs that have light curve information for more than four months past maximum. Contrary to previous reports, it is found that (1) the decay rate after 100 days past maximum varies by almost an order of magnitude and (2) the light curve shapes are not bimodally distributed, but actually form a continuum. In addition, it is found that the extinctions to the SNs are related to the light curve shapes. This implies that the absorbing dust is local to the SNs. The dust is likely to be part of a circumstellar shell emitted by the SN progenitor that Dwek (1983) has used to explain infrared echoes. The optical depth of the shell can get quite large. In such cases, it is found that the photons scattered and delayed by reflection off dust grains will dominate the light curve several months after peak brightness. This light echo offers a straightforward explanation of the diversity of Type II SN light curves. 22 references

  9. Synthesis, spectral characterization thermal stability, antimicrobial studies and biodegradation of starch–thiourea based biodegradable polymeric ligand and its coordination complexes with [Mn(II), Co(II), Ni(II), Cu(II), and Zn(II)] metals

    OpenAIRE

    Nahid Nishat; Ashraf Malik

    2016-01-01

    A biodegradable polymer was synthesized by the modification reaction of polymeric starch with thiourea which is further modified by transition metals, Mn(II), Co(II), Ni(II), Cu(II) and Zn(II). All the polymeric compounds were characterized by (FT-IR) spectroscopy, 1H NMR spectroscopy, 13C NMR spectroscopy, UV–visible spectra, magnetic moment measurements, thermogravimetric analysis (TGA) and antibacterial activities. Polymer complexes of Mn(II), Co(II) and Ni(II) show octahedral geometry, wh...

  10. Levels of Cd (II, Mn (II, Pb (II, Cu (II, and Zn (II in Common Buzzard (Buteo buteo from Sicily (Italy by Derivative Stripping Potentiometry

    Directory of Open Access Journals (Sweden)

    P. Licata

    2010-01-01

    Full Text Available The purpose of this study was to determine the concentrations of heavy metals (Cd, Pb, Cu, Mn, and Zn in different organs (liver, kidney, muscle, lung, skin, and feathers of buzzards (Buteo buteo, utilized as a “biological indicator” for environmental contamination, from different areas of Sicily and to investigate the relationships between birds sex, age, and weight and metal levels in these samples. All samples of common buzzards were collected at the “Recovery Center of Wild Fauna” of Palermo, through the Zooprophilactic Institute. Potentiometric stripping analysis (PSA was used to determine the content of Cd(II, Cu(II, Mn(II, Pb(II, and Zn(II in bird tissues. For toxic metals, the highest levels of Pb were in liver and those of Cd in lung; Zn levels were higher than Cu and Mn in all tissues analyzed. The concentrations in liver, lung, kidney, and muscle could be considered as an indicative of chronic exposure to metals while the presence of metals in skin could be consequential to storing and elimination processes. The found concentrations of metals in the studied matrices required a highly sensitive method for their determination and a simple sample preparation procedure, and the proposed method was well suited for this purpose.

  11. Synthesis, spectral, thermal and antimicrobial studies on cobalt(II), nickel(II), copper(II), zinc(II) and palladium(II) complexes containing thiosemicarbazone ligand

    Science.gov (United States)

    El-Sawaf, Ayman K.; El-Essawy, Farag; Nassar, Amal A.; El-Samanody, El-Sayed A.

    2018-04-01

    The coordination characteristic of new N4-morpholinyl isatin-3-thiosemicarbazone (HL) towards Co(II), Ni(II), Cu(II), Zn(II) and Pd(II) has been studies. The structures of the complexes were described by elemental analyses, molar conductivity, magnetic, thermal and spectral (IR, UV-Vis, 1H and 13C NMR and ESR) studies. On the basis of analytical and spectral studies the ligand behaves as monobasic tridentate ONS donor forming two five membered rings towards cobalt, copper and palladium and afforded complexes of the kind [M(L)X], (Mdbnd Co, Cu or Pd; Xdbnd Cl, Br or OAc). Whereas the ligand bound to NiCl2 as neutral tridentate ONS donor and with ZnCl2 as neutral bidentate NS donor. The newly synthesized thiosemicarbazone ligand and some of its complexes were examined for antimicrobial activity against 2 gram negative bacterial strains (Escherichia coli Pseudomonas and aeruginosa), 2 gram positive bacterial strains (Streptococcus pneumoniae and Staphylococcus aureus)} and two Pathogenic fungi (Aspergillus fumigatus and Candida albicans). All metal complexes possess higher antimicrobial activity comparing with the free thiosemicarbazone ligand. The high potent activities of the complexes may arise from the coordination and chelation, which tends to make metal complexes act as more controlling and potent antimicrobial agents, thus hindering the growing of the microorganisms. The antimicrobial results also show that copper bromide complex is better antimicrobial agent as compared to the Schiff base and its metal complexes.

  12. Efficiency of Chitosan for the Removal of Pb (II, Fe (II and Cu (II Ions from Aqueous Solutions

    Directory of Open Access Journals (Sweden)

    Soheil Sobhanardakani

    2014-09-01

    Full Text Available Background: Heavy metals have been recognized as harmful environmental pollutant known to produce highly toxic effects on different organs and systems of both humans and animals. The aim of this paper is to evaluate the adsorption potential of chitosan for the removal of Pb(II, Fe(II and Cu(II ions from aqueous solutions. Methods: This study was conducted in laboratory scale. In this paper chitosan has been used as an adsorbent for the removal of Pb(II, Fe(II and Cu(II from aqueous solution. In batch tests, the effects of parameters like pH solution (1.0-8.0, initial metal concentrations (100-1000 mgL-1, contact time (5.0-150 min and adsorbent dose (1.0-7.0 g on the adsorption process were studied. Results: The results showed that the adsorption of Pb(II, Fe(II and Cu(II ions on chitosan strongly depends on pH. The experimental isothermal data were analyzed using the Langmuir and Freundlich equations and it was found that the removal process followed the Langmuir isotherm and maximum adsorption capacity for the adsorption of Pb(II, Fe(II and Cu(II ions by the chitosan were 55.5mg g−1, 71.4 mg g−1 and 59 mg g−1, respectively, under equilibrium conditions at 25±1 ºC. The adsorption process was found to be well described by the pseudo-second-order rate model. Conclusion: The obtained results showed that chitosan is a readily, available, economic adsorbent and was found suitable for removing Pb(II, Fe(II and Cu(II ions from aqueous solution.

  13. Non-Invasive Mapping of Intraventricular Flow Patterns in Patients Treated with Left Ventricular Assist Devices

    Science.gov (United States)

    Miramontes, Marissa; Rossini, Lorenzo; Braun, Oscar; Brambatti, Michela; Almeida, Shone; Mizeracki, Adam; Martinez-Legazpi, Pablo; Benito, Yolanda; Bermejo, Javier; Kahn, Andrew; Adler, Eric; Del Álamo, Juan C.

    2017-11-01

    In heart failure patients, left ventricular (LV) assist devices (LVADs) decrease mortality and improve quality of life. We hypothesize echo color Doppler velocimetry (echo-CDV), an echocardiographic flow mapping modality, can non-invasively characterize the effect of LVAD support, optimize the device, thereby decreasing the stoke rate present in these patients. We used echo-CDV to image LV flow at baseline LVAD speed and during a ramp test in LVAD patients (Heartmate II, N =10). We tracked diastolic vortices and mapped blood stasis and cumulative shear. Compared to dilated cardiomyopathy (DCM) patients without LVADs, the flow had a less prominent diastolic vortex ring, and transited directly from mitral valve to cannula. Residence time and shear were significantly lower compared to healthy controls and DCMs. Aortic regurgitation and a large LV vortex presence or a direct mitral jet towards the cannula affected blood stasis region location and size. Flow patterns, residence time and shear depended on LV geometry, valve function and LVAD speed in a patient specific manner. This new methodology could be used with standard echo, hemodynamics and clinical information to find the flow optimizing LAVD setting minimizing stasis for each patient.

  14. General and acute care surgical procedures in patients with left ventricular assist devices.

    Science.gov (United States)

    Arnaoutakis, George J; Bittle, Gregory J; Allen, Jeremiah G; Weiss, Eric S; Alejo, Jennifer; Baumgartner, William A; Shah, Ashish S; Wolfgang, Christopher L; Efron, David T; Conte, John V

    2014-04-01

    Left ventricular assist devices (LVADs) have become common as a bridge to heart transplant as well as destination therapy. Acute care surgical (ACS) problems in this population are prevalent but remain ill-defined. Therefore, we reviewed our experience with ACS interventions in LVAD patients. A total of 173 patients who received HeartMate(®) XVE or HeartMate(®) II (HMII) LVADs between December 2001 and March 2010 were studied. Patient demographics, presentation of ACS problem, operative intervention, co-morbidities, transplantation, complications, and survival were analyzed. A total of 47 (27 %) patients underwent 67 ACS procedures at a median of 38 days after device implant (interquartile range 15-110), with a peri-operative mortality rate of 5 % (N = 3). Demographics, device type, and acuity were comparable between the ACS and non-ACS groups. A total of 21 ACS procedures were performed emergently, eight were urgent, and 38 were elective. Of 29 urgent and emergent procedures, 28 were for abdominal pathology. In eight patients, the cause of the ACS problem was related to LVADs or anticoagulation. Cumulative survival estimates revealed no survival differences if patients underwent ACS procedures (p = 0.17). Among HMII patients, transplantation rates were unaffected by an ACS intervention (p = 0.2). ACS problems occur frequently in LVAD patients and are not associated with adverse outcomes in HMII patients. The acute care surgeon is an integral member of a comprehensive approach to effective LVAD management.

  15. Sample Exchange Evaluation (SEE) Report - Phase II

    International Nuclear Information System (INIS)

    Winters, W.I.

    1994-01-01

    This report describes the results from Phase II of the Sample Exchange Evaluation (SEE) Program, a joint effort to compare analytical laboratory performance on samples from the Hanford Site's high-level waste tanks. In Phase II, the program has been expanded to include inorganic constituents in addition to radionuclides. Results from Phase II that exceeded 20% relative percent difference criteria are identified

  16. Competition from Cu(II), Zn(II) and Cd(II) in Pb(II) binding to Suwannee River Fulvic Acid

    NARCIS (Netherlands)

    Chakraborty, P.; Chakrabarti, C.L.

    2008-01-01

    This is a study of trace metal competition in the complexation of Pb(II) by well-characterized humic substances, namely Suwannee River Fulvic Acid (SRFA) in model solutions. It was found that Cu(II) seems to compete with Pb(II) for strong binding sites of SRFA when present at the same concentration

  17. A modified Glenn shunt reduces right ventricular stroke work during left ventricular assist device therapy.

    Science.gov (United States)

    Schiller, Petter; Vikholm, Per; Hellgren, Laila

    2016-03-01

    Right ventricular (RV) failure is a major cause of morbidity and mortality after left ventricular assist device (LVAD) placement and remains hard to predict. We hypothesized that partial surgical exclusion of the RV with a modified Glenn shunt during LVAD treatment would reduce RV stroke work. An LVAD was implanted in eight pigs and a modified Glenn shunt was constructed. A conductance pressure-volume catheter was placed in the right ventricle through the apex. Haemodynamic data and pressure-volume loops were obtained at the following time periods: (i) baseline, (ii) open shunt, (iii) LVAD with closed shunt and (iii) LVAD and open shunt. During LVAD therapy, the right atrial (RA) pressure increased from 9 mmHg (9-9) to 15 mmHg (12-15), P = 0.01. RV stroke volume increased from 30 ml (29-40) to 51 ml (42-53), P work increased to 708 mmHg ml (654-1193) from 535 mmHg ml (424-717), P = 0.04, compared with baseline. During LVAD therapy in combination with a Glenn shunt, the RA pressure decreased from 15 mmHg (12-15) to 10 mmHg (7-11) when compared with LVAD therapy only, P = 0.01. A decrease in RV stroke work from 708 mmHg ml (654-1193) to 465 mmHg ml (366-711), P = 0.04, was seen when the LVAD was combined with a shunt, not significantly different from the baseline value (535 mmHg ml). The developed pressure in the right ventricle decreased from 29 mmHg (26-32) to 21 mmHg (20-24), P work during the use of the shunt with LVAD treatment. A modified Glenn shunt reduced RV volumes, RV stroke work and RA pressure during LVAD therapy in an experimental model of heart failure in pigs. © The Author 2015. Published by Oxford University Press on behalf of the European Association for Cardio-Thoracic Surgery. All rights reserved.

  18. Macrocyclic receptor showing extremely high Sr(II)/Ca(II) and Pb(II)/Ca(II) selectivities with potential application in chelation treatment of metal intoxication.

    Science.gov (United States)

    Ferreirós-Martínez, Raquel; Esteban-Gómez, David; Tóth, Éva; de Blas, Andrés; Platas-Iglesias, Carlos; Rodríguez-Blas, Teresa

    2011-04-18

    Herein we report a detailed investigation of the complexation properties of the macrocyclic decadentate receptor N,N'-Bis[(6-carboxy-2-pyridil)methyl]-4,13-diaza-18-crown-6 (H(2)bp18c6) toward different divalent metal ions [Zn(II), Cd(II), Pb(II), Sr(II), and Ca(II)] in aqueous solution. We have found that this ligand is especially suited for the complexation of large metal ions such as Sr(II) and Pb(II), which results in very high Pb(II)/Ca(II) and Pb(II)/Zn(II) selectivities (in fact, higher than those found for ligands widely used for the treatment of lead poisoning such as ethylenediaminetetraacetic acid (edta)), as well as in the highest Sr(II)/Ca(II) selectivity reported so far. These results have been rationalized on the basis of the structure of the complexes. X-ray crystal diffraction, (1)H and (13)C NMR spectroscopy, as well as theoretical calculations at the density functional theory (B3LYP) level have been performed. Our results indicate that for large metal ions such as Pb(II) and Sr(II) the most stable conformation is Δ(δλδ)(δλδ), while for Ca(II) our calculations predict the Δ(λδλ)(λδλ) form being the most stable one. The selectivity that bp18c6(2-) shows for Sr(II) over Ca(II) can be attributed to a better fit between the large Sr(II) ions and the relatively large crown fragment of the ligand. The X-ray crystal structure of the Pb(II) complex shows that the Δ(δλδ)(δλδ) conformation observed in solution is also maintained in the solid state. The Pb(II) ion is endocyclically coordinated, being directly bound to the 10 donor atoms of the ligand. The bond distances to the donor atoms of the pendant arms (2.55-2.60 Å) are substantially shorter than those between the metal ion and the donor atoms of the crown moiety (2.92-3.04 Å). This is a typical situation observed for the so-called hemidirected compounds, in which the Pb(II) lone pair is stereochemically active. The X-ray structures of the Zn(II) and Cd(II) complexes show that

  19. Eight joint BER II and BESSY II users meeting. Abstracts

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2016-07-01

    The following topics were dealt with: Accelerator operation and projecs, photon science and instrumentation at BESSY II, status of energy materials in-situ Lab at BESSY II, high resolution spectrometer PEAXIS at BESSY II, sample environment at BESSY II, molecular control mechanisms in the Brr2 RNA helicase for efficient and regulated splicing, the Li conversion reaction of 4CoFe{sub 2}O{sub 4} nanoparticles, buried interfaces in lithium ion batteries probed with HAXPES, ARPES studies of the STO(001) 2DEG, all-in/all-out magnetic order in rare earth iridates, oxygen reduction reaction on graphene in Li-air batteries, electronic order in high-T{sub c} superconductors, in-siu observation of novel switching phenomena in highly porous metal-organic frameworks, photoinduced demagnetization and insulator-to-metal transition in ferromagnetic insulating BaFeO{sub 3} thin films, ARPES measurement of the ferroelectric bulk Rashba system GeTe, bisphenol A on Cu(111) and Ag(111), reverse water-gas shift or Sabathier methanation on N(110), structural studies of molecular machines, multi-MHz time-of-flight electronic band-structure imaging of graphene on Ir(111), diffusion pathways in ion conductors, ground-state potential energy surfaces around selected atoms from resonant inelastic X-ray scattering, solar energy in an emerging country, in-situ neutron analysis of electrode materials for electrochemical energy storage, structure and transport properties in thermoelectric skutterudites, investigation of the interphase formation on solid lithium-ion conductors by neutron reflectometry, load partitin and damage characterization of cast AlSi{sub 12}CuMgNi alloy with ceramic reinforcement, methane adsorption in highly porous metal-organics, structure and magnetic interactions in dimer system Ba{sub (3-x)}Sr{sub x}Cr{sub 2}O{sub 8}, distribution of S in C-S nanocomposites, current status of HFM-EXED FACITIY; SPIN NEAMTICITY IN s=1/2 frustrated zigzag chaIN β-TeVO{sub 4}, electronic

  20. Eight joint BER II and BESSY II users meeting. Abstracts

    International Nuclear Information System (INIS)

    2016-01-01

    The following topics were dealt with: Accelerator operation and projecs, photon science and instrumentation at BESSY II, status of energy materials in-situ Lab at BESSY II, high resolution spectrometer PEAXIS at BESSY II, sample environment at BESSY II, molecular control mechanisms in the Brr2 RNA helicase for efficient and regulated splicing, the Li conversion reaction of 4CoFe_2O_4 nanoparticles, buried interfaces in lithium ion batteries probed with HAXPES, ARPES studies of the STO(001) 2DEG, all-in/all-out magnetic order in rare earth iridates, oxygen reduction reaction on graphene in Li-air batteries, electronic order in high-T_c superconductors, in-siu observation of novel switching phenomena in highly porous metal-organic frameworks, photoinduced demagnetization and insulator-to-metal transition in ferromagnetic insulating BaFeO_3 thin films, ARPES measurement of the ferroelectric bulk Rashba system GeTe, bisphenol A on Cu(111) and Ag(111), reverse water-gas shift or Sabathier methanation on N(110), structural studies of molecular machines, multi-MHz time-of-flight electronic band-structure imaging of graphene on Ir(111), diffusion pathways in ion conductors, ground-state potential energy surfaces around selected atoms from resonant inelastic X-ray scattering, solar energy in an emerging country, in-situ neutron analysis of electrode materials for electrochemical energy storage, structure and transport properties in thermoelectric skutterudites, investigation of the interphase formation on solid lithium-ion conductors by neutron reflectometry, load partitin and damage characterization of cast AlSi_1_2CuMgNi alloy with ceramic reinforcement, methane adsorption in highly porous metal-organics, structure and magnetic interactions in dimer system Ba_(_3_-_x_)Sr_xCr_2O_8, distribution of S in C-S nanocomposites, current status of HFM-EXED FACITIY; SPIN NEAMTICITY IN s=1/2 frustrated zigzag chaIN β-TeVO_4, electronic properties of U(Ru_0_._9_2Rh_0_._0_8)_2Si_2 in

  1. The KNK II/1 fuel assembly NY-205: Compilation of the irradiation history and the fuel and fuel pin fabrication data of the INTERATOM data bank system BESEX

    International Nuclear Information System (INIS)

    Patzer, G.; Geier, F.

    1988-01-01

    The fuel assembly NY-205 has been irradiated during the first and the second core of KNK II with a total residence time of 832 equivalent full-power days. A maximum burnup of 175.000 MWd/tHM or 18.6 % was reached with a maximum steel damage of 66 dpa-NRT. For the cladding the materials 1.4970 and 1.4981 have been used in different metallurgical conditions, and for the Uranium/Plutonium mixed- oxide fuel the most important variants of the major fabrication parameters had been realized. The assembly will be brought to the Hot Cells of the KfK Karlsruhe for post-irradiation examination in February 1988, so that the knowledge of the fabrication data is of interest for the selection of fuel pins and for the evaluation of the examination results. Therefore this report compiles the fuel and fuel pin fabrication data from the INTERATOM data bank system BESEX and additionally, an overview of the irradiation history of the assembly is given [de

  2. Iodine capture by Hofmann-type clathrate Ni(II)(pz)[Ni(II)(CN)_4

    International Nuclear Information System (INIS)

    Massasso, Giovanni; Long, Jerome; Haines, Julien; Devautour-Vinot, Sabine; Maurin, Guillaume; Larionova, Joulia; Guerin, Christian; Guari, Yannick; Grandjean, Agnes; Onida, Barbara; Donnadieu, Bruno

    2014-01-01

    The thermally stable Hofmann-type clathrate framework Ni(II)(pz)[Ni(II)(CN)_4] (pz = pyrazine) was investigated for the efficient and reversible sorption of iodine (I_2) in the gaseous phase and in solution with a maximum adsorption capacity of 1 mol of I_2 per 1 mol of Ni(II)pz)[Ni(II)(CN)_4] in solution. (authors)

  3. Synthesis and Characterization of Multimetallic Fe(II) and Mn(II ...

    African Journals Online (AJOL)

    Iron(II) and Manganese(II) complexes of the resulting ligand were obtained from its reactions with Fe(II) and Mn(II) salts in absolute methanol for the metal to ligand ratio 2:3. These complexes were characterized by Solubility, Conductivity, IR and UV-VIS spectrometry, elemental analysis and mass spectrometry. Keywords: ...

  4. DNA damage by the cobalt (II) and zinc (II) complexes of ...

    African Journals Online (AJOL)

    STORAGESEVER

    2008-09-03

    Sep 3, 2008 ... distributed in grade 3. The results indicated that Co(II)-L induced a relatively high level of DNA damage in comparison with the level of damage induced by Zn(II)-L. Key words: Tetraazamacrocycle Zn(II) complex, tetraazamacrocycle Co(II) complex, Tetrahymena thermophila, DNA damage, the comet assay.

  5. Syntheses and spectroscopic properties of mercury(II) and nickel(II ...

    African Journals Online (AJOL)

    Mercury(II) complex, [Hg2(BPTU-2H)Cl2] and nickel(II) complex, [Ni(BPTU-H)2] were prepared by reacting Bis(N-phenylthiourea), BPTU, with mercury(II) chloride and nickel(II) acetate respectively. The complexes were characterized by IR, diffuse reflectance, 1H NMR spectra and elemental analysis. BPTU acts as ...

  6. Compensating for Language Deficits in Amnesia II: H.M.’s Spared versus Impaired Encoding Categories

    Directory of Open Access Journals (Sweden)

    Chris Hadley

    2013-03-01

    Full Text Available Although amnesic H.M. typically could not recall where or when he met someone, he could recall their topics of conversation after long interference-filled delays, suggesting impaired encoding for some categories of novel events but not others. Similarly, H.M. successfully encoded into internal representations (sentence plans some novel linguistic structures but not others in the present language production studies. For example, on the Test of Language Competence (TLC, H.M. produced uncorrected errors when encoding a wide range of novel linguistic structures, e.g., violating reliably more gender constraints than memory-normal controls when encoding referent-noun, pronoun-antecedent, and referent-pronoun anaphora, as when he erroneously and without correction used the gender-inappropriate pronoun “her” to refer to a man. In contrast, H.M. never violated corresponding referent-gender constraints for proper names, suggesting that his mechanisms for encoding proper name gender-agreement were intact. However, H.M. produced no more dysfluencies, off-topic comments, false starts, neologisms, or word and phonological sequencing errors than controls on the TLC. Present results suggest that: (a frontal mechanisms for retrieving and sequencing word, phrase, and phonological categories are intact in H.M., unlike in category-specific aphasia; (b encoding mechanisms in the hippocampal region are category-specific rather than item-specific, applying to, e.g., proper names rather than words; (c H.M.’s category-specific mechanisms for encoding referents into words, phrases, and propositions are impaired, with the exception of referent gender, person, and number for encoding proper names; and (d H.M. overuses his intact proper name encoding mechanisms to compensate for his impaired mechanisms for encoding other functionally equivalent linguistic information.

  7. BES-II fast data reconstruction

    International Nuclear Information System (INIS)

    Rong Gang; Zhang Jiawen; Guo Yiqing; Zhang Shaoqiang; Zhao Dixin

    2002-01-01

    The BES-II fast data reconstruction is reported. Based on PC FARM and/or a 'Distributed Clustered Linux PC System', BES-II fast data reconstruction system is set up. With this system the BES-II data can be fully reconstructed in about 20 minutes after data collection. It takes only 12 minutes to fully reconstruct 30000 events, collected with BES-II detector at BEPC Collider, with a P III-800 PC. The detector performance can be examined based on fully reconstructed data in about 20 minutes after data taking in the BES-II experiment

  8. Simultaneous Determination of Cobalt (II and Nickel (II By First Order Derivative Spectrophotometry in Micellar Media

    Directory of Open Access Journals (Sweden)

    Rajni Rohilla

    2012-01-01

    Full Text Available A first-derivative spectrophotometry method for the simultaneous determination of Co (II and Ni (II with Alizarin Red S in presence of Triton X-100 is described. Measurements were made at the zero-crossing wavelengths at 549.0 nm for Co (II and 546.0 nm for Ni (II. The linearity is obtained in the range of 0.291- 4.676 μg/ml of Ni (II and 0.293- 4.124 μg/ml of Co (II in the presence of each other by using first derivative spectrophotometric method. The possible interfering effects of various ions were studied. The validity of the method was examined by using synthetic mixtures of Co (II and Ni (II. The developed derivative procedure, using the zero crossing technique, has been successfully applied for the simultaneous analysis of Co (II and Ni (II in spiked water samples.

  9. DNA damage by the cobalt (II) and zinc (II) complexes of ...

    African Journals Online (AJOL)

    Using the single cell gel electrophoresis method, the tetraazamacrocycle Zn(II) complex (Zn(II)-L) and the tetraazamacrocycle Co(II) complex (Co(II)-L) were investigated focusing on their DNA damage to Tetrahymena thermophila. When the cells were treated with the 0.05, 0.25 and 0.50 mg/ml Zn(II)-L, the tail length ...

  10. (Diethylenetriaminebis(theophyllinatozinc(II dihydrate

    Directory of Open Access Journals (Sweden)

    Attila-Zsolt Kun

    2009-05-01

    Full Text Available In the title compound, [Zn(C7H7N4O22(C4H13N3]·2H2O, the ZnII ion is pentacoordinated by three N atoms of the diethylenetriamine ligand and one N atom of each of the two theophyllinate anions in a distorted trigonal-bipyramidal geometry. The Zn—N distances range from 2.076 (3 to 2.221 (3 Å. The crystal packing is stabilized by O—H...O, O—H...N and N—H...O hydrogen bonds involving the theophylline and diethylenetriamine ligands and uncoordinated water molecules.

  11. Actions against Asse II dismissed

    International Nuclear Information System (INIS)

    Anon.

    1980-01-01

    In the legal dispute over the storage of radioactive waste in the former Asse II salt mine near Wolfenbuettel, the Higher Administrative Court for Lower Saxony and Schleswig-Holstein in a decision dated January 17, 1980, dismissed as inadmissible the appeals brought by plaintiffs from the Federal Republic of Germany, Denmark and Austria against the decision by the Braunschweig Administrative Court, in which that action had been dismissed. Also more recent applications were declared to be inadmissible on the grounds that the Lower Saxony State Ministry of Social Affairs was not the proper defendant. No appeal was permitted. The written decision by the Court has not yet been published. (HSCH) [de

  12. Commissioning of NSLS-II

    Energy Technology Data Exchange (ETDEWEB)

    Willeke, F.

    2015-05-03

    NSLS-II, the new 3rd generation light source at BNL was designed for a brightness of 1022 photons s-1mm-2mrad-2 (0.1%BW)-1. It was constructed between 2009 and 2014. The storage ring was commissioned in April 2014 which was followed by insertion device and beamline commissioning in the fall of 2014. All ambitious design parameters of the facility have already been achieved except for commissioning the full beam intensity of 500mA which requires more RF installation. This paper reports on the results of commissioning.

  13. Reference design for LAMPF II

    International Nuclear Information System (INIS)

    Thiessen, H.A.

    1983-01-01

    A reference design for the 32-GeV LAMPF II proton accelerator is proposed. This design consists of a 30-Hz rapid-cycling synchrotron with a dc stretcher. A superiodicity 5 design with dispersion-free straight sections is suggested for both machines. Beam-dynamics calculations are partially complete and rf requirements are given. Apertures are calculated for 2 x 10 13 protons per pulse (100 μA average current). No significant problems are observed at any time in the cycle in a longitudinal beam-dynamics simulation including space charge

  14. Pep for PEP-II

    International Nuclear Information System (INIS)

    Anon.

    1995-01-01

    The major B-factory project at the Stanford Linear Accelerator Center have(SLAC) is well underway and moving along smartly, en route to commencement of operations in September 1998. Called PEP-II, the new facility is a joint venture of three California laboratories: Lawrence Berkeley Laboratory (LBL), Lawrence Livermore Laboratory (LLNL) and SLAC. Housed at SLAC in the tunnels and buildings built for the original PEP electron-positron collider in the late 1970s, it involves no conventional civil engineering. In fact, PEP-II is a recycling project in more ways than one: for example, most of the original PEP magnets have been renovated for reuse in the PEP-II high-energy ring. While some of them require substantial rework (to change their length, for instance), many of them merely require repainting and remeasuring. The work of building the hardware is divided up among the three laboratories. LBL is primarily responsible for the low-energy ring; LLNL is building most of the interaction region, the complicated part where the high and low energy rings come together; and SLAC is responsible for the rest. Proposed by President Clinton as a ''presidential initiative'' (December 1993, page 2), the project was given a four-year funding profile. The total cost of $177 million, excluding the BaBar detector (September, page 16), was planned by the US government to be entirely provided during the present administration, the last increment coming in the final quarter of 1997. Happily, the first two increments have been forthcoming as planned and the third is faring well in US Congress. The PEP-II design is based on two intersecting storage rings, one carrying 9 GeV electrons and the other 3.1 GeV positrons, operating with high beam currents (a few amperes) to produce a luminosity of 3 x 10 33 per sq cm per s. The asymmetry in the energies of the colliding particles means that the centre-ofmass of the electron-positron annihilation system moves rapidly in the

  15. PEP-II status report

    International Nuclear Information System (INIS)

    Dorfan, J.M.

    1998-06-01

    The main design features of the PEP-II asymmetric two-ring electron-positron B Factory collider, built at the Stanford Linear Accelerator Center, are described. This facility will complete construction in June 1998. The high energy ring, completed in May 1997, has had 3 months of commissioning and successfully stored 0.75 A of electrons. The success of the high energy ring testing validates not only its ring components, but also the injection system, the RF system and the control system all of which are common to the two rings

  16. Belle II Technical Design Report

    CERN Document Server

    Abe, T; Adamczyk, K; Ahn, S; Aihara, H; Akai, K; Aloi, M; Andricek, L; Aoki, K; Arai, Y; Arefiev, A; Arinstein, K; Arita, Y; Asner, D M; Aulchenko, V; Aushev, T; Aziz, T; Bakich, A M; Balagura, V; Ban, Y; Barberio, E; Barvich, T; Belous, K; Bergauer, T; Bhardwaj, V; Bhuyan, B; Blyth, S; Bondar, A; Bonvicini, G; Bozek, A; Bracko, M; Brodzicka, J; Brovchenko, O; Browder, T E; Cao, G; Chang, M -C; Chang, P; Chao, Y; Chekelian, V; Chen, A; Chen, K -F; Chen, P; Cheon, B G; Chiang, C -C; Chistov, R; Cho, K; Choi, S -K; Chung, K; Comerma, A; Cooney, M; Cowley, D E; Critchlow, T; Dalseno, J; Danilov, M; Dieguez, A; Dierlamm, A; Dillon, M; Dingfelder, J; Dolenec, R; Dolezal, Z; Drasal, Z; Drutskoy, A; Dungel, W; Dutta, D; Eidelman, S; Enomoto, A; Epifanov, D; Esen, S; Fast, J E; Feindt, M; Garcia, M Fernandez; Fifield, T; Fischer, P; Flanagan, J; Fourletov, S; Fourletova, J; Freixas, L; Frey, A; Friedl, M; Fruehwirth, R; Fujii, H; Fujikawa, M; Fukuma, Y; Funakoshi, Y; Furukawa, K; Fuster, J; Gabyshev, N; Cueto, A Gaspar de Valenzuela; Garmash, A; Garrido, L; Geisler, Ch; Gfall, I; Goh, Y M; Golob, B; Gorton, I; Grzymkowski, R; Guo, H; Ha, H; Haba, J; Hara, K; Hara, T; Haruyama, T; Hayasaka, K; Hayashi, K; Hayashii, H; Heck, M; Heindl, S; Heller, C; Hemperek, T; Higuchi, T; Horii, Y; Hou, W -S; Hsiung, Y B; Huang, C -H; Hwang, S; Hyun, H J; Igarashi, Y; Iglesias, C; Iida, Y; Iijima, T; Imamura, M; Inami, K; Irmler, C; Ishizuka, M; Itagaki, K; Itoh, R; Iwabuchi, M; Iwai, G; Iwai, M; Iwasaki, M; Iwasaki, M; Iwasaki, Y; Iwashita, T; Iwata, S; Jang, H; Ji, X; Jinno, T; Jones, M; Julius, T; Kageyama, T; Kah, D H; Kakuno, H; Kamitani, T; Kanazawa, K; Kapusta, P; Kataoka, S U; Katayama, N; Kawai, M; Kawai, Y; Kawasaki, T; Kennedy, J; Kichimi, H; Kikuchi, M; Kiesling, C; Kim, B K; Kim, G N; Kim, H J; Kim, H O; Kim, J -B; Kim, J H; Kim, M J; Kim, S K; Kim, K T; Kim, T Y; Kinoshita, K; Kishi, K; Kisielewski, B; van Dam, K Kleese; Knopf, J; Ko, B R; Koch, M; Kodys, P; Koffmane, C; Koga, Y; Kohriki, T; Koike, S; Koiso, H; Kondo, Y; Korpar, S; Kouzes, R T; Kreidl, Ch; Kreps, M; Krizan, P; Krokovny, P; Krueger, H; Kruth, A; Kuhn, W; Kuhr, T; Kumar, R; Kumita, T; Kupper, S; Kuzmin, A; Kvasnicka, P; Kwon, Y -J; Lacasta, C; Lange, J S; Lee, I -S; Lee, M J; Lee, M W; Lee, S -H; Lemarenko, M; Li, J; Li, W D; Li, Y; Libby, J; Limosani, A; Liu, C; Liu, H; Liu, Y; Liu, Z; Liventsev, D; Virto, A Lopez; Makida, Y; Mao, Z P; Marinas, C; Masuzawa, M; Matvienko, D; Mitaroff, W; Miyabayashi, K; Miyata, H; Miyazaki, Y; Miyoshi, T; Mizuk, R; Mohanty, G B; Mohapatra, D; Moll, A; Mori, T; Morita, A; Morita, Y; Moser, H -G; Martin, D Moya; Mueller, T; Muenchow, D; Murakami, J; Myung, S S; Nagamine, T; Nakamura, I; Nakamura, T T; Nakano, E; Nakano, H; Nakao, M; Nakazawa, H; Nam, S -H; Natkaniec, Z; Nedelkovska, E; Negishi, K; Neubauer, S; Ng, C; Ninkovic, J; Nishida, S; Nishimura, K; Novikov, E; Nozaki, T; Ogawa, S; Ohmi, K; Ohnishi, Y; Ohshima, T; Ohuchi, N; Oide, K; Olsen, S L; Ono, M; Ono, Y; Onuki, Y; Ostrowicz, W; Ozaki, H; Pakhlov, P; Pakhlova, G; Palka, H; Park, H; Park, H K; Peak, L S; Peng, T; Peric, I; Pernicka, M; Pestotnik, R; Petric, M; Piilonen, L E; Poluektov, A; Prim, M; Prothmann, K; Regimbal, K; Reisert, B; Richter, R H; Riera-Babures, J; Ritter, A; Ritter, A; Ritter, M; Roehrken, M; Rorie, J; Rosen, M; Rozanska, M; Ruckman, L; Rummel, S; Rusinov, V; Russell, R M; Ryu, S; Sahoo, H; Sakai, K; Sakai, Y; Santelj, L; Sasaki, T; Sato, N; Sato, Y; Scheirich, J; Schieck, J; Schwanda, C; Schwartz, A J; Schwenker, B; Seljak, A; Senyo, K; Seon, O -S; Sevior, M E; Shapkin, M; Shebalin, V; Shen, C P; Shibuya, H; Shiizuka, S; Shiu, J -G; Shwartz, B; Simon, F; Simonis, H J; Singh, J B; Sinha, R; Sitarz, M; Smerkol, P; Sokolov, A; Solovieva, E; Stanic, S; Staric, M; Stypula, J; Suetsugu, Y; Sugihara, S; Sugimura, T; Sumisawa, K; Sumiyoshi, T; Suzuki, K; Suzuki, S Y; Takagaki, H; Takasaki, F; Takeichi, H; Takubo, Y; Tanaka, M; Tanaka, S; Taniguchi, N; Tarkovsky, E; Tatishvili, G; Tawada, M; Taylor, G N; Teramoto, Y; Tikhomirov, I; Trabelsi, K; Tsuboyama, T; Tsunada, K; Tu, Y -C; Uchida, T; Uehara, S; Ueno, K; Uglov, T; Unno, Y; Uno, S; Urquijo, P; Ushiroda, Y; Usov, Y; Vahsen, S; Valentan, M; Vanhoefer, P; Varner, G; Varvell, K E; Vazquez, P; Vila, I; Vilella, E; Vinokurova, A; Visniakov, J; Vos, M; Wang, C H; Wang, J; Wang, M -Z; Wang, P; Wassatch, A; Watanabe, M; Watase, Y; Weiler, T; Wermes, N; Wescott, R E; White, E; Wicht, J; Widhalm, L; Williams, K M; Won, E; Xu, H; Yabsley, B D; Yamamoto, H; Yamaoka, H; Yamaoka, Y; Yamauchi, M; Yin, Y; Yoon, H; Yu, J; Yuan, C Z; Yusa, Y; Zander, D; Zdybal, M; Zhang, Z P; Zhao, J; Zhao, L; Zhao, Z; Zhilich, V; Zhou, P; Zhulanov, V; Zivko, T; Zupanc, A; Zyukova, O

    2010-01-01

    The Belle detector at the KEKB electron-positron collider has collected almost 1 billion Y(4S) events in its decade of operation. Super-KEKB, an upgrade of KEKB is under construction, to increase the luminosity by two orders of magnitude during a three-year shutdown, with an ultimate goal of 8E35 /cm^2 /s luminosity. To exploit the increased luminosity, an upgrade of the Belle detector has been proposed. A new international collaboration Belle-II, is being formed. The Technical Design Report presents physics motivation, basic methods of the accelerator upgrade, as well as key improvements of the detector.

  17. Solid Phase Extraction of Trace Al(III), Fe(II), Co(II), Cu(II), Cd(II) and Pb(II) Ions in Beverages on Functionalized Polymer Microspheres Prior to Flame Atomic Absorption Spectrometric Determinations.

    Science.gov (United States)

    Berber, Hale; Alpdogan, Güzin

    2017-01-01

    In this study, poly(glycidyl methacrylate-methyl methacrylate-divinylbenzene) was synthesized in the form of microspheres, and then functionalized by 2-aminobenzothiazole ligand. The sorption properties of these functionalized microspheres were investigated for separation, preconcentration and determination of Al(III), Fe(II), Co(II), Cu(II), Cd(II) and Pb(II) ions using flame atomic absorption spectrometry. The optimum pH values for quantitative sorption were 2 - 4, 5 - 8, 6 - 8, 4 - 6, 2 - 6 and 2 - 3 for Al(III), Fe(II), Co(II), Cu(II), Cd(II) and Pb(II), respectively, and also the highest sorption capacity of the functionalized microspheres was found to be for Cu(II) with the value of 1.87 mmol g -1 . The detection limits (3σ; N = 6) obtained for the studied metals in the optimal conditions were observed in the range of 0.26 - 2.20 μg L -1 . The proposed method was successfully applied to different beverage samples for the determination of Al(III), Fe(II), Co(II), Cu(II), Cd(II) and Pb(II) ions, with the relative standard deviation of <3.7%.

  18. Diet History Questionnaire II FAQs | EGRP/DCCPS/NCI/NIH

    Science.gov (United States)

    Answers to general questions about the Diet History Questionnaire II (DHQ II), as well as those related to DHQ II administration, validation, scanning, nutrient estimates, calculations, DHQ II modification, data quality, and more.

  19. potentiometric studies of the complexes formed by copper (ii)

    African Journals Online (AJOL)

    MBI

    The overall stability constants of copper (II) and zinc (II) ions with some polar ... The average number of coordinated amino acids to the copper (II) and zinc (II) ions .... of chelated rings (Yamuchi and Odani, 1996). ... Synthesis and techniques in.

  20. ERB-II operating experience

    International Nuclear Information System (INIS)

    Smith, R.N.; Cissel, D.W.; Smith, R.R.

    1977-01-01

    As originally designed and operated, EBR-II successfully demonstrated the concept of a sodium-cooled fast breeder power plant with a closed fuel reprocessing cycle (mini-nuclear park). Subsequent operation has been as an irradiation facility, a role which will continue into the foreseeable future. Since the beginning of operation in 1961, operating experience of EBR-II has been very satisfactory. Most of the components and systems have performed well. In particular, the mechanical performance of heat-removal systems has been excellent. A review of the operating experience reveals that all the original design objectives have been successfully demonstrated. To date, no failures or incidents resulting in serious in-core or out-of-core consequences have occurred. No water-to-sodium leaks have been detected over the life of the plant. At the present time, the facility is operating very well and continuously except for short shutdowns required by maintenance, refueling, modification, and minor repair. A plant factor of 76.9% was achieved for the calendar year 1976

  1. THE SPECTRUM OF Fe II

    Energy Technology Data Exchange (ETDEWEB)

    Nave, Gillian [National Institute of Standards and Technology, Gaithersburg, MD 20899-8422 (United States); Johansson, Sveneric, E-mail: gillian.nave@nist.gov [Lund Observatory, University of Lund, Box 43, SE-22100 Lund (Sweden)

    2013-01-15

    The spectrum of singly ionized iron (Fe II) has been recorded using high-resolution Fourier transform (FT) and grating spectroscopy over the wavelength range 900 A to 5.5 {mu}m. The spectra were observed in high-current continuous and pulsed hollow cathode discharges using FT spectrometers at the Kitt Peak National Observatory, Tucson, AZ and Imperial College, London and with the 10.7 m Normal Incidence Spectrograph at the National Institute of Standards and Technology. Roughly 12,900 lines were classified using 1027 energy levels of Fe II that were optimized to measured wavenumbers. The wavenumber uncertainties of lines in the FT spectra range from 10{sup -4} cm{sup -1} for strong lines around 4 {mu}m to 0.05 cm{sup -1} for weaker lines around 1500 A. The wavelength uncertainty of lines in the grating spectra is 0.005 A. The ionization energy of (130,655.4 {+-} 0.4) cm{sup -1} was estimated from the 3d{sup 6}({sup 5}D)5g and 3d{sup 6}({sup 5}D)6h levels.

  2. BNL ATF II beamlines design

    Energy Technology Data Exchange (ETDEWEB)

    Fedurin, M. [Brookhaven National Lab. (BNL), Upton, NY (United States); Jing, Y. [Brookhaven National Lab. (BNL), Upton, NY (United States); Stratakis, D. [Brookhaven National Lab. (BNL), Upton, NY (United States); Swinson, C. [Brookhaven National Lab. (BNL), Upton, NY (United States)

    2015-05-03

    The Brookhaven National Laboratory. Accelerator Test Facility (BNL ATF) is currently undergoing a major upgrade (ATF-II). Together with a new location and much improved facilities, the ATF will see an upgrade in its major capabilities: electron beam energy and quality and CO2 laser power. The electron beam energy will be increased in stages, first to 100-150 MeV followed by a further increase to 500 MeV. Combined with the planned increase in CO2 laser power (from 1-100 TW), the ATF-II will be a powerful tool for Advanced Accelerator research. A high-brightness electron beam, produced by a photocathode gun, will be accelerated and optionally delivered to multiple beamlines. Besides the energy range (up to a possible 500 MeV in the final stage) the electron beam can be tailored to each experiment with options such as: small transverse beam size (<10 um), short bunch length (<100 fsec) and, combined short and small bunch options. This report gives a detailed overview of the ATFII capabilities and beamlines configuration.

  3. District heating concept Hirtenwiesen II; Nahwaermekonzept Hirtenwiesen II

    Energy Technology Data Exchange (ETDEWEB)

    Wagner, Josef [Stadtwerke Crailsheim GmbH, Crailsheim (Germany)

    2009-07-01

    Hirtenwiesen II is a new urban development project on an abandoned industrial site west of Crailsheim, Germany. It will house a population of about 2,000 and provide a comprehensive infrastructure including kindergarten, schools, sports centers and shopping centers. Modern amenities will be combined with environment-friendly energy concepts based on solar energy. A school building - Lise-Meitner-Gymnasium - and a sports hall - Hirtenwiesenhalle - will be supplied with solar power as well. Solar energy will provide more than 50 % of the energy required, which is more than average. Also, the solar power plant will have a collector surface of 10,000 m{sup 3} and a capacity of 7 MW{sub th}, which will make it Germany's biggest individual thermal solar power plant. (orig./AKB)

  4. Quiet High Speed Fan II (QHSF II): Final Report

    Science.gov (United States)

    Kontos, Karen; Weir, Don; Ross, Dave

    2012-01-01

    This report details the aerodynamic, mechanical, structural design and fabrication of a Honey Engines Quiet High Speed Fan II (lower hub/tip ratio and higher specific flow than the Baseline I fan). This fan/nacelle system incorporates features such as advanced forward sweep and an advanced integrated fan/fan exit guide vane design that provides for the following characteristics: (1) Reduced noise at supersonic tip speeds, in comparison to current state-of-the-art fan technology; (2) Improved aeroelastic stability within the anticipated operating envelope; and (3) Aerodynamic performance consistent with current state-of-the-art fan technology. This fan was fabricated by Honeywell and tested in the NASA Glenn 9- by 15-Ft Low Speed Wind Tunnel for aerodynamic, aeromechanical, and acoustic performance.

  5. Synthesis, characterization and polymerization of methacrylates of copper (II), cobalt (II) and molybdenum (II). Generation of new materials

    International Nuclear Information System (INIS)

    Rojas Bolanos, Omar

    2006-01-01

    Coordination compounds of the species copper (II), cobalt (II) and molybdenum (II) with methacrylic acid were synthesized and characterized. Besides, it realized reactions of bromine addition to the doubles links of the species obtained previously, also too like reactions with dry HCl. Finally, it got hybrids materials by polymerization of the first compounds in an acrylic matrix. Research concluded with the characterization of all the products. (author) [es

  6. Shark class II invariant chain reveals ancient conserved relationships with cathepsins and MHC class II.

    Science.gov (United States)

    Criscitiello, Michael F; Ohta, Yuko; Graham, Matthew D; Eubanks, Jeannine O; Chen, Patricia L; Flajnik, Martin F

    2012-03-01

    The invariant chain (Ii) is the critical third chain required for the MHC class II heterodimer to be properly guided through the cell, loaded with peptide, and expressed on the surface of antigen presenting cells. Here, we report the isolation of the nurse shark Ii gene, and the comparative analysis of Ii splice variants, expression, genomic organization, predicted structure, and function throughout vertebrate evolution. Alternative splicing to yield Ii with and without the putative protease-protective, thyroglobulin-like domain is as ancient as the MHC-based adaptive immune system, as our analyses in shark and lizard further show conservation of this mechanism in all vertebrate classes except bony fish. Remarkable coordinate expression of Ii and class II was found in shark tissues. Conserved Ii residues and cathepsin L orthologs suggest their long co-evolution in the antigen presentation pathway, and genomic analyses suggest 450 million years of conserved Ii exon/intron structure. Other than an extended linker preceding the thyroglobulin-like domain in cartilaginous fish, the Ii gene and protein are predicted to have largely similar physiology from shark to man. Duplicated Ii genes found only in teleosts appear to have become sub-functionalized, as one form is predicted to play the same role as that mediated by Ii mRNA alternative splicing in all other vertebrate classes. No Ii homologs or potential ancestors of any of the functional Ii domains were found in the jawless fish or lower chordates. Copyright © 2011 Elsevier Ltd. All rights reserved.

  7. Reduced Anxiety and Depression in Patients With Advanced Heart Failure After Left Ventricular Assist Device Implantation.

    Science.gov (United States)

    Yost, Gardner; Bhat, Geetha; Mahoney, Edward; Tatooles, Antone

    Despite the high prevalence of depression and anxiety in patients with advanced heart failure, the effects of left ventricular assist device (LVAD) implantation on these critically important aspects of mental health are not well understood. We sought to assess changes in depression and anxiety following LVAD implantation. The Beck Depression Inventory-II (BDI-II) and Beck Anxiety Inventory (BAI) were administered to 54 patients by a clinical psychologist at a mean of 12 days before LVAD implantation and 251 days after implantation. Patient demographics and clinical data were collected concurrently to psychologic testing. Changes in BDI-II, BAI, and clinical markers of heart failure were assessed using paired t-tests. A p Psychosomatic Medicine. Published by Elsevier Inc. All rights reserved.

  8. Chelation of Cu(II, Zn(II, and Fe(II by Tannin Constituents of Selected Edible Nuts

    Directory of Open Access Journals (Sweden)

    Magdalena Karamać

    2009-12-01

    Full Text Available The tannin fractions isolated from hazelnuts, walnuts and almonds were characterised by colorimetric assays and by an SE-HPLC technique. The complexation of Cu(II and Zn(II was determined by the reaction with tetramethylmurexide, whereas for Fe(II, ferrozine was employed. The walnut tannins exhibited a significantly weaker reaction with the vanillin/HCl reagent than hazelnut and almond tannins, but the protein precipitation capacity of the walnut fraction was high. The SE-HPLC chromatogram of the tannin fraction from hazelnuts revealed the presence of oligomers with higher molecular weights compared to that of almonds. Copper ions were most effectively chelated by the constituents of the tannin fractions of hazelnuts, walnuts and almonds. At a 0.2 mg/assay addition level, the walnut tannins complexed almost 100% Cu(II. The Fe(II complexation capacities of the tannin fractions of walnuts and hazelnuts were weaker in comparison to that of the almond tannin fraction, which at a 2.5 mg/assay addition level, bound Fe(II by ~90%. The capacity to chelate Zn(II was quite varied for the different nut tannin fractions: almond tannins bound as much as 84% Zn(II, whereas the value for walnut tannins was only 8.7%; and for hazelnut tannins, no Zn(II chelation took place at the levels tested.

  9. Electrochemical, spectroscopic, and photophysical properties of structurally diverse polyazine-bridged Ru(II),Pt(II) and Os(II),Ru(II),Pt(II) supramolecular motifs.

    Science.gov (United States)

    Knoll, Jessica D; Arachchige, Shamindri M; Wang, Guangbin; Rangan, Krishnan; Miao, Ran; Higgins, Samantha L H; Okyere, Benjamin; Zhao, Meihua; Croasdale, Paul; Magruder, Katherine; Sinclair, Brian; Wall, Candace; Brewer, Karen J

    2011-09-19

    Five new tetrametallic supramolecules of the motif [{(TL)(2)M(dpp)}(2)Ru(BL)PtCl(2)](6+) and three new trimetallic light absorbers [{(TL)(2)M(dpp)}(2)Ru(BL)](6+) (TL = bpy = 2,2'-bipyridine or phen = 1,10-phenanthroline; M = Ru(II) or Os(II); BL = dpp = 2,3-bis(2-pyridyl)pyrazine, dpq = 2,3-bis(2-pyridyl)quinoxaline, or bpm = 2,2'-bipyrimidine) were synthesized and their redox, spectroscopic, and photophysical properties investigated. The tetrametallic complexes couple a Pt(II)-based reactive metal center to Ru and/or Os light absorbers through two different polyazine BL to provide structural diversity and interesting resultant properties. The redox potential of the M(II/III) couple is modulated by M variation, with the terminal Ru(II/III) occurring at 1.58-1.61 V and terminal Os(II/III) couples at 1.07-1.18 V versus Ag/AgCl. [{(TL)(2)M(dpp)}(2)Ru(BL)](PF(6))(6) display terminal M(dπ)-based highest occupied molecular orbitals (HOMOs) with the dpp(π*)-based lowest unoccupied molecular orbital (LUMO) energy relatively unaffected by the nature of BL. The coupling of Pt to the BL results in orbital inversion with localization of the LUMO on the remote BL in the tetrametallic complexes, providing a lowest energy charge separated (CS) state with an oxidized terminal Ru or Os and spatially separated reduced BL. The complexes [{(TL)(2)M(dpp)}(2)Ru(BL)](6+) and [{(TL)(2)M(dpp)}(2)Ru(BL)PtCl(2)](6+) efficiently absorb light throughout the UV and visible regions with intense metal-to-ligand charge transfer (MLCT) transitions in the visible at about 540 nm (M = Ru) and 560 nm (M = Os) (ε ≈ 33,000-42,000 M(-1) cm(-1)) and direct excitation to the spin-forbidden (3)MLCT excited state in the Os complexes about 720 nm. All the trimetallic and tetrametallic Ru-based supramolecular systems emit from the terminal Ru(dπ)→dpp(π*) (3)MLCT state, λ(max)(em) ≈ 750 nm. The tetrametallic systems display complex excited state dynamics with quenching of the (3)MLCT emission at

  10. Elaboration of a Highly Porous RuII,II Analogue of HKUST-1.

    Science.gov (United States)

    Zhang, Wenhua; Freitag, Kerstin; Wannapaiboon, Suttipong; Schneider, Christian; Epp, Konstantin; Kieslich, Gregor; Fischer, Roland A

    2016-12-19

    When the dinuclear Ru II,II precursor [Ru 2 (OOCCH 3 ) 4 ] is employed under redox-inert conditions, a Ru II,II analogue of HKUST-1 was successfully prepared and characterized as a phase-pure microcrystalline powder. X-ray absorption near-edge spectroscopy confirms the oxidation state of the Ru centers of the paddle-wheel nodes in the framework. The porosity of 1371 m 2 /mmol of Ru II,II -HKUST-1 exceeds that of the parent compound HKUST1 (1049 m 2 / mmol).

  11. Quantum mechanics II advanced topics

    CERN Document Server

    Rajasekar, S

    2015-01-01

    Quantum Mechanics II: Advanced Topics uses more than a decade of research and the authors’ own teaching experience to expound on some of the more advanced topics and current research in quantum mechanics. A follow-up to the authors introductory book Quantum Mechanics I: The Fundamentals, this book begins with a chapter on quantum field theory, and goes on to present basic principles, key features, and applications. It outlines recent quantum technologies and phenomena, and introduces growing topics of interest in quantum mechanics. The authors describe promising applications that include ghost imaging, detection of weak amplitude objects, entangled two-photon microscopy, detection of small displacements, lithography, metrology, and teleportation of optical images. They also present worked-out examples and provide numerous problems at the end of each chapter.

  12. Transdermic absorption of Melagenina II

    International Nuclear Information System (INIS)

    Hernandez Gonzalez, I.; Martinez Lopez, B.; Ruiz Pena, M.; Caso Pena, R.

    1997-01-01

    The transdermic absorption of Melagenina II (MII) was evaluated. MII was a labelled with 125I by the yodogen method and purified by column chromatography with Sephadex LH-20 in ethanol: water (7:3). In vitro absorption of ( 125I ) - MII thought human skin was carried out in Keshary-Chien modified diffusion cells. Tape stripping method was applied after 24 hours to evaluate the accumulated activity in dermis and epidermis. In vivo assays were performed in Sprague Dawley rats to analyze absorption of MII until 24 hours after a single application and for five days a low penetrability of the drug while in vivo there were not found blood levels significantly greater than zero , nevertheless and important amount of radioactivity was found in feces and urine. The activity was concentrated mainly in the application site in both models

  13. HERMES II experimenters' manual (revised)

    International Nuclear Information System (INIS)

    Schuch, R.L.

    1977-04-01

    The HERMES II is a high-intensity laboratory photon source for gamma-ray radiation effects experiments as well as a high-energy pulsed electron beam generator for a variety of potential applications. The purpose of this manual is to serve as a basic source of information for prospective users of HERMES. Included is a brief discussion of the design and operation of the accelerator system as well as a summary of environmental data for x-ray operation and output characteristics for electron beam modes. The manual also contains a description of the HERMES experimental facilities, including geometry of the test cell, instrumentation and data collection capabilities, and services and support available to experimenters

  14. RTNS-II utilization plan

    Energy Technology Data Exchange (ETDEWEB)

    Zwilsky, Klaus M.

    1978-09-01

    This plan describes a general program for the effective utilization of this resource by the fusion materials community. Because its flux is low relative to levels expected in commercial fusion reactors, the RINS-II is not expected to produce data of direct engineering significance (with some exceptions). Rather, it will be used chiefly to aid in the development of models of high energy neutron effects. Such models are needed in projecting engineering data obtained in high flux fission reactors to the fusion environment. Fission reactors, because of their relatively soft neutron spectra, cannot produce the high ratio of transmutations to displacements (except in an important special case) or the high energy recoil atoms appropriate to fusion reactors utilizing the D-T reaction.

  15. PEP-II prototype klystron

    International Nuclear Information System (INIS)

    Fowkes, W.R.; Caryotakis, G.; Lee, T.G.; Pearson, C.; Wright, E.L.

    1993-04-01

    A 540-kW continuous-wave (cw) klystron operating at 476 MHz was developed for use as a power source for testing PEP-II rf accelerating cavities and rf windows. It also serves as a prototype for a 1.2 MW cw klystron presently being developed as a potential rf source for asymmetric colliding ring use. The design incorporates the concepts and many of the parts used in the original 353 MHz PEP klystron developed sixteen years ago. The superior computer simulation codes available today result in improved performance with the cavity frequencies, drift lengths, and output circuit optimized for the higher frequency.The design and operating results of this tube are described with particular emphasis on the factors which affect efficiency and stability

  16. Sample Exchange Evaluation (SEE) Report - Phase II

    Energy Technology Data Exchange (ETDEWEB)

    Winters, W.I.

    1994-09-28

    This report describes the results from Phase II of the Sample Exchange Evaluation (SEE) Program, a joint effort to compare analytical laboratory performance on samples from the Hanford Site`s high-level waste tanks. In Phase II, the program has been expanded to include inorganic constituents in addition to radionuclides. Results from Phase II that exceeded 20% relative percent difference criteria are identified.

  17. Start II, red ink, and Boris Yeltsin

    International Nuclear Information System (INIS)

    Arbatov, A.

    1993-01-01

    Apart from the vulnerability implied by the START II treaty, it will bear the burden of the general political opposition to the Yeltsin administration. START II will be seen as part of an overall Yeltsin-Andrei Kozyrev foreign policy that is under fire for selling out Russian national interests in Yugoslavia, the Persian Gulf, and elsewhere. This article discusses public opinion concerning START II, the cost of its implementation, and the general purpose of the treaty

  18. SWAMI II technology transfer plan

    International Nuclear Information System (INIS)

    Ward, C.R.; Peterson, K.D.; Harpring, L.J.; Immel, D.M.; Jones, J.D.; Mallet, W.R.

    1995-01-01

    Thousands of drums of radioactive/hazardous/mixed waste are currently stored at DOE sites throughout US; they are stored in warehouse facilities on an interim basis, pending final disposition. Recent emphasis on anticipated decommissioning of facilities indicates that many more drums of waste will be generated, requiring additional storage. Federal and state regulations dictate that hazardous waste covered by RCRA be inspected periodically for container degradation and to verify inventories. All known DOE waste storage facilities are currently inspected manually. A system to perform robotic inspection of waste drums is under development by the SRTC Robotics Group of WSRC; it is called the Stored Waste Autonomous Mobile Inspector (SWAMI). The first version, SWAMI I, was developed by the Savannah River Technology Center (SRTC) as a proof of principle system for autonomous inspection of drums in a warehouse. SWAMI I was based on the Transitions Research Corporation (TRC) HelpMate mobile robot. TRC modified the Helpmate to navigate in aisles of drums. SRTC added subsystems to SWAMI I to determine its position in open areas, read bar code labels on the drums up to three levels high, capture images of the drums and perform a radiation survey of the floor in the aisles. The radiation survey was based on SRTC patented technology first implemented on the Semi-Intelligent Mobile Observing Navigator (SIMON). The radiation survey is not essential for the inspection of drums, but is an option that can increase the utility and effectiveness of SWAMI in warehouses with radioactive and/or mixed waste. All the sensors on SWAMI I were fixed on the vehicle. From the success of SWAMI I, a second version, SWAMI II, was developed; it will be evaluated at Fernald and tested with two other mobile robots. Intent is to transfer the technology developed for SWAMI I and II to industry so that it can supply additional units for purchase for drum inspection

  19. MHC Class II epitope predictive algorithms

    DEFF Research Database (Denmark)

    Nielsen, Morten; Lund, Ole; Buus, S

    2010-01-01

    Major histocompatibility complex class II (MHC-II) molecules sample peptides from the extracellular space, allowing the immune system to detect the presence of foreign microbes from this compartment. To be able to predict the immune response to given pathogens, a number of methods have been...... developed to predict peptide-MHC binding. However, few methods other than the pioneering TEPITOPE/ProPred method have been developed for MHC-II. Despite recent progress in method development, the predictive performance for MHC-II remains significantly lower than what can be obtained for MHC-I. One reason...

  20. Spectroscopic and thermal degradation behavior of Mg(II), Ca(II), Ba(II) and Sr(II) complexes with paracetamol drug

    OpenAIRE

    Moamen S. Refat; Gehad G. Mohamed; Mohamed Y. El-Sayed; Hamada M.A. Killa; Hammad Fetooh

    2017-01-01

    Complexes of Mg(II), Ca(II), Ba(II) and Sr(II) with paracetamol drug were synthesized and characterized by elemental analysis, conductivity, UV–Vis, IR, and 1H NMR spectroscopy and thermal analysis, as well as screened for antimicrobial activity. The IR spectral data suggested that the ligand behaves as paracetamol behaves as a neutral bidentate ligand coordinated to the metal ions via the lone pair of electrons of nitrogen and carbonyl-O atoms of the amide group. From the microanalytical dat...

  1. TRUPACT-II Container Maintenance Program Plan

    International Nuclear Information System (INIS)

    1991-05-01

    This document details the maintenance, repair, and replacement of components, as well as the documentation required and the procedures to be followed to maintain the integrity of the TRUPACT-II container in accordance with OM-134, TRUPACT-II Container Operations and Maintenance Manual; and the TRUPACT-II Container Certificate of Compliance (Number 9218). The routine shipping and receiving inspections required by the Department of Transportation (DOT), Department of Energy (DOE), Nuclear Regulatory Commission (NRC) and other regulations are not addressed in this document. This document applies to all DOE shipping and receiving sites that use the TRUPACT-II containers

  2. Optimization of simultaneous electrochemical determination of Cd(II), Pb(II), Cu(II) and Hg(II) at carbon nanotube-modified graphite electrodes.

    Science.gov (United States)

    Pikna, L'ubomír; Heželová, Mária; Kováčová, Zuzana

    2015-01-01

    The health of the environment is worsening every day. Monitoring of potentially toxic elements and remediation of environmental pollution are necessary. Therefore, the research and development of simple, inexpensive, portable and effective sensors is important. Electrochemistry is a useful component of the field of environment monitoring. The present study focuses on evaluating and comparing three types of electrodes (PIGE, PIGE/MWCNT/HNO3 and PIGE/MWCNT/EDTA/HNO3) employed for the simultaneous electrochemical determination of four potentially toxic elements: Cd(II), Pb(II), Cu(II) and Hg(II). Cyclic voltammograms were measured in an acetate buffer. The LOD, LOQ, the standard and relative precisions of the method and a prediction intervals were calculated (according to the technical procedure DIN 32 645) for the three electrodes and for each measured element. The LOD for PIGE/CNT/HNO3 (the electrode with narrowest calculated prediction intervals) was 2.98 × 10(-7) mol L(-1) for Cd(II), 4.83 × 10(-7) mol L(-1) for Pb(II), 3.81 × 10(-7) mol L(-1) for Cu(II), 6.79 × 10(-7) mol L(-1) for Hg(II). One of the benefits of this study was the determination of the amount of Hg(II) in the mixture of other elements.

  3. Biosorption of Fe (II) and Cd (II) ions from aqueous solution using a ...

    African Journals Online (AJOL)

    ADOWIE PERE

    Biosorption of Fe (II) and Cd (II) ions from aqueous solution using a low cost ... human activities in the environment poses a lot of risk ... ion exchange or reverse osmosis, electrochemical treatment ..... is the adsorption coefficient, n indicates the.

  4. Serum insulin-like growth factor II (IGF-II) in chronic heart failure

    International Nuclear Information System (INIS)

    Tong Lijun; Chen Donghai; Ji Naijun; Fan Bifu; Wang Chengyao; Mei Yibin; Li Fuyuan; Kao Yan

    2004-01-01

    Objective: To investigate the clinical significance of changes of serum insulin-like growth factor II (IGF-II) levels in patients with chronic heart failure. Methods: Serum IGF-II levels were measured with RIA in 132 cases of chronic heart failure and 45 controls. Results: Serum IGF-II levels were significantly higher in patients with chronic heart failure than those in the controls (t=0.033, P<0.001). IGF-II levels were highest in grade IV CHF patients (vs grade II t=3.963, P<0.01; vs grade III, t=3.578, P<0.01). In the twelve patients died in hospital, the serum IGF-II levels were significantly higher than those patients recovered (t=7.141, P<0.01). Conclusion: Serum IGF-II levels were increased in CHF patients and were highest in the most severe cases. (authors)

  5. Syntheses and spectroscopic properties of mercury(II) and nickel(II ...

    African Journals Online (AJOL)

    Syntheses and spectroscopic properties of mercury(II) and nickel(II) ... The complexes were characterized by IR, diffuse reflectance, 1H NMR spectra and elemental ... coordinating through thiolato sulphur and hydrazinic nitrogen atoms.

  6. MHC class II expression in lung cancer.

    Science.gov (United States)

    He, Yayi; Rozeboom, Leslie; Rivard, Christopher J; Ellison, Kim; Dziadziuszko, Rafal; Yu, Hui; Zhou, Caicun; Hirsch, Fred R

    2017-10-01

    Immunotherapy is an exciting development in lung cancer research. In this study we described major histocompatibility complex (MHC) Class II protein expression in lung cancer cell lines and patient tissues. We studied MHC Class II (DP, DQ, DR) (CR3/43, Abcam) protein expression in 55 non-small cell lung cancer (NSCLC) cell lines, 42 small cell lung cancer (SCLC) cell lines and 278 lung cancer patient tissues by immunohistochemistry (IHC). Seven (12.7%) NSCLC cell lines were positive for MHC Class II. No SCLC cell lines were found to be MHC Class II positive. We assessed 139 lung cancer samples available in the Hirsch Lab for MHC Class II. There was no positive MHC Class II staining on SCLC tumor cells. MHC Class II expression on TILs in SCLC was significantly lower than that on TILs in NSCLC (P<0.001). MHC Class II was also assessed in an additional 139 NSCLC tumor tissues from Medical University of Gdansk, Poland. Patients with positive staining of MHC Class II on TILs had longer regression-free survival (RFS) and overall survival (OS) than those whose TILs were MHC Class II negative (2.980 years, 95% CI 1.628-4.332 vs. 1.050 years, 95% CI 0.556-1.554, P=0.028) (3.230 years, 95% CI 2.617-3.843 vs. 1.390 years, 95% CI 0.629-2.151, P=0.014). MHC Class II was expressed both in NSCLC cell lines and tissues. However, MHC Class II was not detected in SCLC cell lines or tissue tumor cells. MHC Class II expression was lower on SCLC TILs than on NSCLC TILs. Loss of expression of MHC Class II on SCLC tumor cells and reduced expression on SCLC TILs may be a means of escaping anti-cancer immunity. Higher MHC Class II expression on TILs was correlated with better prognosis in patients with NSCLC. Copyright © 2017. Published by Elsevier B.V.

  7. Competitive adsorption of copper(II), cadmium(II), lead(II) and zinc(II) onto basic oxygen furnace slag

    International Nuclear Information System (INIS)

    Xue Yongjie; Hou Haobo; Zhu Shujing

    2009-01-01

    Polluted and contaminated water can often contain more than one heavy metal species. It is possible that the behavior of a particular metal species in a solution system will be affected by the presence of other metals. In this study, we have investigated the adsorption of Cd(II), Cu(II), Pb(II), and Zn(II) onto basic oxygen furnace slag (BOF slag) in single- and multi-element solution systems as a function of pH and concentration, in a background solution of 0.01 M NaNO 3 . In adsorption edge experiments, the pH was varied from 2.0 to 13.0 with total metal concentration 0.84 mM in the single element system and 0.21 mM each of Cd(II), Cu(II), Pb(II), and Zn(II) in the multi-element system. The value of pH 50 (the pH at which 50% adsorption occurs) was found to follow the sequence Zn > Cu > Pb > Cd in single-element systems, but Pb > Cu > Zn > Cd in the multi-element system. Adsorption isotherms at pH 6.0 in the multi-element systems showed that there is competition among various metals for adsorption sites on BOF slag. The adsorption and potentiometric titrations data for various slag-metal systems were modeled using an extended constant-capacitance surface complexation model that assumed an ion-exchange process below pH 6.5 and the formation of inner-sphere surface complexes at higher pH. Inner-sphere complexation was more dominant for the Cu(II), Pb(II) and Zn(II) systems

  8. Competitive adsorption of copper(II), cadmium(II), lead(II) and zinc(II) onto basic oxygen furnace slag

    Energy Technology Data Exchange (ETDEWEB)

    Xue Yongjie [School of Resource and Environment Science, Wuhan University, Hubei, Wuhan (China); Wuhan Kaidi Electric Power Environmental Protection Co. Ltd., Hubei, Wuhan (China)], E-mail: xueyj@mail.whut.edu.cn; Hou Haobo; Zhu Shujing [School of Resource and Environment Science, Wuhan University, Hubei, Wuhan (China)

    2009-02-15

    Polluted and contaminated water can often contain more than one heavy metal species. It is possible that the behavior of a particular metal species in a solution system will be affected by the presence of other metals. In this study, we have investigated the adsorption of Cd(II), Cu(II), Pb(II), and Zn(II) onto basic oxygen furnace slag (BOF slag) in single- and multi-element solution systems as a function of pH and concentration, in a background solution of 0.01 M NaNO{sub 3}. In adsorption edge experiments, the pH was varied from 2.0 to 13.0 with total metal concentration 0.84 mM in the single element system and 0.21 mM each of Cd(II), Cu(II), Pb(II), and Zn(II) in the multi-element system. The value of pH{sub 50} (the pH at which 50% adsorption occurs) was found to follow the sequence Zn > Cu > Pb > Cd in single-element systems, but Pb > Cu > Zn > Cd in the multi-element system. Adsorption isotherms at pH 6.0 in the multi-element systems showed that there is competition among various metals for adsorption sites on BOF slag. The adsorption and potentiometric titrations data for various slag-metal systems were modeled using an extended constant-capacitance surface complexation model that assumed an ion-exchange process below pH 6.5 and the formation of inner-sphere surface complexes at higher pH. Inner-sphere complexation was more dominant for the Cu(II), Pb(II) and Zn(II) systems.

  9. Competitive adsorption of copper(II), cadmium(II), lead(II) and zinc(II) onto basic oxygen furnace slag.

    Science.gov (United States)

    Xue, Yongjie; Hou, Haobo; Zhu, Shujing

    2009-02-15

    Polluted and contaminated water can often contain more than one heavy metal species. It is possible that the behavior of a particular metal species in a solution system will be affected by the presence of other metals. In this study, we have investigated the adsorption of Cd(II), Cu(II), Pb(II), and Zn(II) onto basic oxygen furnace slag (BOF slag) in single- and multi-element solution systems as a function of pH and concentration, in a background solution of 0.01M NaNO(3). In adsorption edge experiments, the pH was varied from 2.0 to 13.0 with total metal concentration 0.84mM in the single element system and 0.21mM each of Cd(II), Cu(II), Pb(II), and Zn(II) in the multi-element system. The value of pH(50) (the pH at which 50% adsorption occurs) was found to follow the sequence Zn>Cu>Pb>Cd in single-element systems, but Pb>Cu>Zn>Cd in the multi-element system. Adsorption isotherms at pH 6.0 in the multi-element systems showed that there is competition among various metals for adsorption sites on BOF slag. The adsorption and potentiometric titrations data for various slag-metal systems were modeled using an extended constant-capacitance surface complexation model that assumed an ion-exchange process below pH 6.5 and the formation of inner-sphere surface complexes at higher pH. Inner-sphere complexation was more dominant for the Cu(II), Pb(II) and Zn(II) systems.

  10. Derivation of electron density and temperature from (S II) and (O II) line intensity ratios

    Energy Technology Data Exchange (ETDEWEB)

    Canto, J; Meaburn, J; Theokas, A C [Manchester Univ. (UK). Dept of Astronomy; Elliott, K H [Anglo-Australian Observatory, Epping (Australia)

    1980-12-01

    Line intensity ratios for (S II) and (O II) due to collisional de-excitation are briefly discussed. Comparison is made between various reaction rate parameters presented by separate investigators. Included are observations of ratios obtained from the Orion nebula which experimentally confirm the reaction rates of Pradhan as best representing the observed distribution of these ratios. (O II) and (S II) contour plots are also presented, which allow effective electron temperatures and densities to be estimated from pairs of line ratios.

  11. Thermodynamic study of (alkyl esters+α,ω-alkyl dihalides) II: HmE and VmE for 25 binary mixtures {xCu-1H2u-1CO2C2H5+(1-x)α,ω-BrCH2(CH2)v-2CH2Br}, where u=1 to 5, α=1 and v=ω=2 to 6

    International Nuclear Information System (INIS)

    Ortega, J.; Navas, A.; Placido, J.; Toledo, F.J.

    2006-01-01

    Excess molar enthalpies H m E , and excess molar volumes V m E , have been determined experimentally at constant conditions of atmospheric pressure and a temperature of T=298.15K, for a set of 25 binary mixtures, composed of ethyl alkanoate (methanoate to pentanoate) with each of the α,ω-dibromoalkanes (1,2-dibromoethane to 1,6-dibromohexane), presenting the values of excess quantities Y m E as a function of the ester composition x. Most of the mixtures presented V m E >0, except those formed by 1,5-dibromopentane and 1,6-dibromohexane with propanoate, butanoate and ethyl pentanoate, for which V m E m E are made using two versions of the UNIFAC group contribution model. The version proposed by Dang and Tassios produces unacceptable estimations, while the version of Gmehling et al. produces results closer to experimentals.

  12. Low-temperature Synthesis of Tin(II) Oxide From Tin(II) ketoacidoximate Precursor

    KAUST Repository

    Alshankiti, Buthainah

    2015-01-01

    Sn (II) oxide finds numerous applications in different fields such as thin film transistors1, solar cells2 and sensors.3 In this study we present the fabrication of tin monoxide SnO by using Sn (II) ketoacid oximate complexes as precursors. Tin (II

  13. Mutation and biochemical analysis in carnitine palmitoyltransferase type II (CPT II) deficiency

    DEFF Research Database (Denmark)

    Olpin, S E; Afifi, A; Clark, S

    2003-01-01

    Carnitine palmitoyltransferase type II (CPT II) deficiency has three basic phenotypes, late-onset muscular (mild), infantile/juvenile hepatic (intermediate) and severe neonatal. We have measured fatty acid oxidation and CPT II activity and performed mutation studies in 24 symptomatic patients...

  14. Biosorption of Cd(II) and Zn(II) by nostoc commune: isotherm and kinetics studies

    Energy Technology Data Exchange (ETDEWEB)

    Morsy, Fatthy M. [Faculty of Science, Botany Department, Assiut University, Assiut (Egypt); Hassan, Sedky H.A. [Department of Biological Environment, Kangwon National University, Kangwon-do (Korea, Republic of); Koutb, Mostafa [Faculty of Science, Botany Department, Assiut University, Assiut (Egypt); Umm Al-Qura University, Faculty of Applied Science, Biology Department, Mecca (Saudi Arabia)

    2011-07-15

    In this study, Nostoc commune (cyanobacterium) was used as an inexpensive and efficient biosorbent for Cd(II) and Zn(II) removal from aqueous solutions. The effect of various physicochemical factors on Cd(II) and Zn(II) biosorption such as pH 2.0-7.0, initial metal concentration 0.0-300 mg/L and contact time 0-120 min were studied. Optimum pH for removal of Cd(II) and Zn(II) was 6.0, while the contact time was 30 min at room temperature. The nature of biosorbent and metal ion interaction was evaluated by infrared (IR) technique. IR analysis of bacterial biomass revealed the presence of amino, carboxyl, hydroxyl, and carbonyl groups, which are responsible for biosorption of Cd(II) and Zn (II). The maximum biosorption capacities for Cd(II) and Zn(II) biosorption by N. commune calculated from Langmuir biosorption isotherm were 126.32 and 115.41 mg/g, respectively. The biosorption isotherm for two biosorbents fitted well with Freundlich isotherm than Langmuir model with correlation coefficient (r{sup 2} < 0.99). The biosorption kinetic data were fitted well with the pseudo-second-order kinetic model. Thus, this study indicated that the N. commune is an efficient biosorbent for the removal of Cd(II) and Zn(II) from aqueous solutions. (Copyright copyright 2011 WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim)

  15. Synthesis, spectroscopic and antimicrobial properties of Co(II), Ni (II ...

    African Journals Online (AJOL)

    The objective of this study is to investigate the antimicrobial activity of novel Schiff base metal complexes. The resistance of micro-organisms to classical antimicrobial compounds poses a challenge to effective management and treatment of some diseases. In line with this, copper (II), nickel (II) and cobalt (II) complexes of ...

  16. The CDF SVX II detector upgrade

    International Nuclear Information System (INIS)

    Skarha, J.E.

    1993-10-01

    The proposed CDF SVX II detector upgrade for secondary vertex detection during the Fermilab Tevatron Run II collider run is described. The general design and important features of this silicon vertex detector are presented. The CDF physics goals which are addressed by this detector are also given

  17. Photocleavage of DNA by copper (II) complexes

    Indian Academy of Sciences (India)

    The chemistry of ternary and binary copper(II) complexes showing efficient visible lightinduced DNA cleavage activity is summarized in this article. The role of the metal in photo-induced DNA cleavage reactions is explored by designing complex molecules having a variety of ligands. Ternary copper(II) complexes with amino ...

  18. TRUPACT-II procedures and maintenance instructions

    International Nuclear Information System (INIS)

    1994-01-01

    The purpose of this document is to provide the technical requirements for operation, inspection and maintenance of a TRUPACT-II Shipping Package and directly related components. This document shall supply the minimum requirements as specified in the TRUPACT-II Safety Analysis Report for Packaging (SARP) and Certificate of Compliance (C of C) 9218. In the event there is a conflict between this document and the TRUPACT-II SARP (NRC Certificate of Compliance No. 9218), the TRUPACT-II SARP shall govern. This document details the operations, maintenance, repair, replacement of components, as well as the documentation required and the procedures to be followed to maintain the integrity of the TRUPACT-II container. These procedures may be modified for site use, but as a minimum all parameters and format listed herein must be included in any site modified version. For convenience and where applicable steps may be performed out of sequence. Packaging and payload handling equipment and transport trailers have been specifically designed for use with the TRUPACT-II Packaging. This document discusses the minimum required procedures for use of the adjustable center of gravity lift fixture and the TRUPACT-II transport trailer in conjunction with the TRUPACT-II Packaging

  19. World War II Homefront: A Historiography.

    Science.gov (United States)

    Winkler, Allan M.

    2002-01-01

    Highlights the scholarship that exists on the World War II homefront covering topics such as World War II as a good war, Franklin D. Roosevelt, economic policy, propaganda, status of women and women's employment, the role of African Americans, racial violence, and the Japanese American experience. (CMK)

  20. 24 CFR 202.12 - Title II.

    Science.gov (United States)

    2010-04-01

    ... INSTITUTIONS AND MORTGAGEES Title I and Title II Specific Requirements § 202.12 Title II. (a) Tiered pricing—(1... rate up to two percentage points under the mortgagee's customary lending practices must be based on... after accounting for the value of servicing rights generated by making the loan and other income to the...

  1. World War II Memorial Learning Activities.

    Science.gov (United States)

    Tennessee State Dept. of Education, Nashville.

    These learning activities can help students get the most out of a visit to the Tennessee World War II Memorial, a group of ten pylons located in Nashville (Tennessee). Each pylon contains informational text about the events of World War II. The ten pylons are listed as: (1) "Pylon E-1--Terror: America Enters the War against Fascism, June…

  2. Technical specifications: Tower Shielding Reactor II

    International Nuclear Information System (INIS)

    1979-02-01

    The technical specifications define the key limitations that must be observed for safe operation of the Tower Shielding Reactor II (TSR-II) and an envelope of operation within which there is reasonable assurance that these limits cannot be exceeded. The specifications were written to satisfy the requirements of the Department of Energy (DOE) Manual Chapter 0540, September 1, 1972

  3. DART II documentation. Volume III. Appendices

    Energy Technology Data Exchange (ETDEWEB)

    1979-10-01

    The DART II is a remote, interactive, microprocessor-based data acquistion system suitable for use with air monitors. This volume of DART II documentation contains the following appendixes: adjustment and calibration procedures; mother board signature list; schematic diagrams; device specification sheets; ROM program listing; 6800 microprocessor instruction list, octal listing; and cable lists. (RWR)

  4. Sex differences in angiotensin II- induced hypertension

    Directory of Open Access Journals (Sweden)

    B. Xue

    2007-05-01

    Full Text Available Sex differences in the development of hypertension and cardiovascular disease have been described in humans and in animal models. In this paper we will review some of our studies which have as their emphasis the examination of the role of sex differences and sex steroids in modulating the central actions of angiotensin II (ANG II via interactions with free radicals and nitric oxide, generating pathways within brain circumventricular organs and in central sympathomodulatory systems. Our studies indicate that low-dose infusions of ANG II result in hypertension in wild-type male mice but not in intact wild-type females. Furthermore, we have demonstrated that ANG II-induced hypertension in males is blocked by central infusions of the androgen receptor antagonist, flutamide, and by central infusions of the superoxide dismutase mimetic, tempol. We have also found that, in comparison to females, males show greater levels of intracellular reactive oxygen species in circumventricular organ neurons following long-term ANG II infusions. In female mice, ovariectomy, central blockade of estrogen receptors or total knockout of estrogen a receptors augments the pressor effects of ANG II. Finally, in females but not in males, central blockade of nitric oxide synthase increases the pressor effects of ANG II. Taken together, these results suggest that sex differences and estrogen and testosterone play important roles in the development of ANG II-induced hypertension.

  5. Oral Assessment Kit, Levels II & III. Draft.

    Science.gov (United States)

    Agrelo-Gonzalez, Maria; And Others

    The assessment packet includes a series of oral tests to help develop speaking as an integral part of second language instruction at levels II and III. It contains: 8 mini-tests for use at level II; 9 mini-tests for use at level III; a rating scale and score sheet masters for evaluating performance on these tests; and a collection of suggested…

  6. Metallothionein-I+II in neuroprotection

    DEFF Research Database (Denmark)

    Pedersen, Mie Ø; Jensen, Rikke; Pedersen, Dan S

    2009-01-01

    -I+II decrease inflammation and secondary tissue damage (oxidative stress, neurodegeneration, and apoptosis) and promote post-injury repair and regeneration (angiogenesis, neurogenesis, neuronal sprouting and tissue remodelling). Intracellularly the molecular MT-I+II actions involve metal ion control...... encephalomyelitis. (c) 2009 International Union of Biochemistry and Molecular Biology, Inc....

  7. TRUPACT-II container maintenance program plan

    International Nuclear Information System (INIS)

    1990-11-01

    This document details the maintenance/repair and replacement of components, as well as the documentation required and the procedures to be followed to maintain the integrity of the TRUPACT-II container, in accordance with requirements of the TRUPACT-II Container Operations and Maintenance Manual, OM-134, the TRUPACT-II Container Safety Analysis Report (SARP), and the TRUPACT-II Container Certificate of Compliance (Number 9218). The routine shipping and receiving inspections required by the Department of Transportation (DOT), Department of Energy (DOE), Nuclear Regulatory Commission (NRC) and other regulations are not addressed in this document. This document applies to all DOE shipping and receiving sites that use the TRUPACT-II containers

  8. ETA-II accelerator upgrades

    International Nuclear Information System (INIS)

    Nilson, D.G.; Deadrick, F.J.; Hibbs, S.M.; Sampayan, S.E.; Petersen, D.E.

    1991-09-01

    We discuss recent improvements to the ETA-II linear induction electron accelerator. The accelerator's cells have been carefully reconditioned to raise the maximum accelerating gap voltage from approximately 100 kV to 125 kV. Insulators of Rexolite plastic in a new ''zero-gap'' arrangement replaced the alumina originals after several alternative materials were investigated. A new multi-cable current feed system will be used to eliminate pulse reflection interactions encountered in earlier experiments. Improved alignment fixtures have been installed to help minimize beam perturbation due to poorly aligned intercell magnets between 10-cell groups. A stretched wire alignment technique (SWAT) has been utilized to enhance overall magnetic alignment, and to characterize irreducible alignment errors. These changes are in conjunction with an expansion of the accelerator from a 20-cell to a 60-cell configuration. When completed, the upgraded accelerator is expected to deliver 2.5 kA of electron beam current at 7.5 MeV in bursts of up to fifty 70-ns pulses at a 5-kHz repetition rate. A 5.5-meter-long wiggler will convert the energy into 3-GW microwave pulses at 140 GHz for plasma heating experiments in the Microwave Tokamak Experiment (MTX)

  9. The Steksovo II burial ground

    Directory of Open Access Journals (Sweden)

    Martianov Vladimir N.

    2014-12-01

    Full Text Available The article is dedicated to the results of many-years’ (1990-2010 excavations on the ancient Mordovian Steksovo II burial ground site. The burial ground had functioned in the 3rd to 13th centuries AD. The investigations revealed hundreds of burials, which enabled the researchers to judge upon the wealth of material items found and the variety of burial rites of the population that had formed the burial ground. The 1st millennium AD is characterized by bi-ritualism, while inhumation is characteristic of the 11-13th-century period; horses’ burials were also discovered. The data of the burial ground make it possible to modify the concept of the stages in ancient Mordovians ethnogenesis. It is generally attributed to the Erzya Mordvins, but in early burials the combination of the Erzya and Moksha ancientries is traced. Complexes of the items of crucial importance for the chronology of the burial are discussed in the article with a representation of statistical data characterizing funeral rites and traditions.

  10. Aspects of differential geometry II

    CERN Document Server

    Gilkey, Peter

    2015-01-01

    Differential Geometry is a wide field. We have chosen to concentrate upon certain aspects that are appropriate for an introduction to the subject; we have not attempted an encyclopedic treatment. Book II deals with more advanced material than Book I and is aimed at the graduate level. Chapter 4 deals with additional topics in Riemannian geometry. Properties of real analytic curves given by a single ODE and of surfaces given by a pair of ODEs are studied, and the volume of geodesic balls is treated. An introduction to both holomorphic and Kähler geometry is given. In Chapter 5, the basic properties of de Rham cohomology are discussed, the Hodge Decomposition Theorem, Poincaré duality, and the Künneth formula are proved, and a brief introduction to the theory of characteristic classes is given. In Chapter 6, Lie groups and Lie algebras are dealt with. The exponential map, the classical groups, and geodesics in the context of a bi-invariant metric are discussed. The de Rham cohomology of compact Lie groups an...

  11. TRUPACT-II, a regulatory perspective

    International Nuclear Information System (INIS)

    Gregory, P.C.; Spooner, O.R.

    1995-01-01

    The Transuranic Package Transporter II (TRUPACT-II) is a US Nuclear Regulatory Commission (NRC) certified Type B packaging for the shipment of contact-handled transuranic (CH-TRU) material by the US Department of Energy (DOE). The NRC approved the TRUPACT-II design as meeting the requirements of Title 10, Code of Federal Regulations, Part 71 (10 CFR 71) and issued Certificate of Compliance (CofC) Number 9218 to the DOE. There are currently 15 certified TRUPACT-IIs. Additional TRUPACT-IIs will be required to make more than 15,000 shipments of CH-TRU waste to the Waste Isolation Pilot Plant (WIPP) site near Carlsbad, New Mexico. The TRUPACT-II may also be used for the DOE inter-site and intra-site shipments of CH-TRU waste. The Land Withdrawal Act (Public Law 102-579), enacted by the US Congress, October 30, 1992, and an agreement between the DOE and the State of New Mexico, signed August 4, 1987, both stipulate that only NRC approved packaging may be used for shipments of TRU waste to the WIPP. Early in the TRUPACT-II development phase it was decided that the transportation system (tractor, trailer, and TRUPACT-II) should be highway legal on all routes without the need for oversize and/or overweight permits. In large measure, public acceptance of the DOE's efforts to safely transport CH-TRU waste depends on the public's perception that the TRUPACT-II is in compliance with all applicable regulations, standards, and quality assurance requirements. This paper addresses some of the numerous regulations applicable to Type B packaging, and it describes how the TRUPACT-II complies with these regulations

  12. Equilibrium and kinetic studies of Pb(II, Cd(II and Zn(II sorption by Lagenaria vulgaris shell

    Directory of Open Access Journals (Sweden)

    Mitić-Stojanović Dragana-Linda

    2012-01-01

    Full Text Available The sorption of lead, cadmium and zinc ions from aqueous solution by Lagenaria vulgaris shell biosorbent (LVB in batch system was investigated. The effect of relevant parameters such as contact time, biosorbent dosage and initial metal ions concentration was evaluated. The Pb(II, Cd(II and Zn(II sorption equilibrium (when 98% of initial metal ions were sorbed was attained within 15, 20 and 25 min, respectively. The pseudo first, pseudo-second order, Chrastil’s and intra-particle diffusion models were used to describe the kinetic data. The experimental data fitted the pseudo-second order kinetic model and intra-particle diffusion model. Removal efficiency of lead(II, cadmium(II and zinc(II ions rapidly increased with increasing biosorbent dose from 0.5 to 8.0 g dm-3. Optimal biosorbent dose was set to 4.0 g dm-3. An increase in the initial metal concentration increases the sorption capacity. The sorption data of investigated metal ions are fitted to Langmuir, Freundlich and Temkin isotherm models. Langmuir model best fitted the equilibrium data (r2 > 0.99. Maximal sorption capacities of LVB for Pb(II, Cd(II and Zn(II at 25.0±0.5°C were 0.130, 0.103 and 0.098 mM g-1, respectively. The desorption experiments showed that the LVB could be reused for six cycles with a minimum loss of the initial sorption capacity.

  13. Multi-metals column adsorption of lead(II), cadmium(II) and manganese(II) onto natural bentonite clay.

    Science.gov (United States)

    Alexander, Jock Asanja; Surajudeen, Abdulsalam; Aliyu, El-Nafaty Usman; Omeiza, Aroke Umar; Zaini, Muhammad Abbas Ahmad

    2017-10-01

    The present work was aimed at evaluating the multi-metals column adsorption of lead(II), cadmium(II) and manganese(II) ions onto natural bentonite. The bentonite clay adsorbent was characterized for physical and chemical properties using X-ray diffraction, X-ray fluorescence, Brunauer-Emmett-Teller surface area and cation exchange capacity. The column performance was evaluated using adsorbent bed height of 5.0 cm, with varying influent concentrations (10 mg/L and 50 mg/L) and flow rates (1.4 mL/min and 2.4 mL/min). The result shows that the breakthrough time for all metal ions ranged from 50 to 480 minutes. The maximum adsorption capacity was obtained at initial concentration of 10 mg/L and flow rate of 1.4 mL/min, with 2.22 mg/g of lead(II), 1.71 mg/g of cadmium(II) and 0.37 mg/g of manganese(II). The order of metal ions removal by natural bentonite is lead(II) > cadmium(II) > manganese(II). The sorption performance and the dynamic behaviour of the column were predicted using Adams-Bohart, Thomas, and Yoon-Nelson models. The linear regression analysis demonstrated that the Thomas and Yoon-Nelson models fitted well with the column adsorption data for all metal ions. The natural bentonite was effective for the treatment of wastewater laden with multi-metals, and the process parameters obtained from this work can be used at the industrial scale.

  14. Compensatory structural and functional adaptation after radical nephrectomy for renal cell carcinoma according to preoperative stage of chronic kidney disease. Choi DK, Jung SB, Park BH, Jeong BC, Seo SI, Jeon SS, Lee HM, Choi HY, Jeon HG.J Urol. 2015 Oct;194(4):910-5. [Epub 2015 Apr 28]. doi: 10.1016/j.juro.2015.04.093.

    Science.gov (United States)

    Jay, Raman; Jung, S B; Park, B H; Jeong, B C; Seo, S I; Jeon, S S; Lee, H M; Choi, H Y; Jeon, H G

    2017-03-01

    We investigated structural hypertrophy and functional hyperfiltration as compensatory adaptations after radical nephrectomy in patients with renal cell carcinoma according to the preoperative chronic kidney disease stage. We retrospectively identified 543 patients who underwent radical nephrectomy for renal cell carcinoma between 1997 and 2012. Patients were classified according to preoperative glomerular filtration rate as no chronic kidney disease-glomerular filtration rate 90ml/min/1.73m 2 or greater (230, 42.4%), chronic kidney disease stage II-glomerular filtration rate 60 to less than 90ml/min/1.73m 2 (227, 41.8%), and chronic kidney disease stage III-glomerular filtration rate 30 to less than 60ml/min/1.73m 2 (86, 15.8%). Computerized tomography performed within 2 months before surgery and 1 year after surgery was used to assess functional renal volume for measuring the degree of hypertrophy of the remnant kidney, and the preoperative and postoperative glomerular filtration rate per unit volume of functional renal volume was used to calculate the degree of hyperfiltration. Among all patients (mean age = 56.0y) mean preoperative glomerular filtration rate, functional renal volume, and glomerular filtration rate/functional renal volume were 83.2ml/min/1.73m 2 , 340.6cm 3 , and 0.25ml/min/1.73m 2 /cm 3 , respectively. The percent reduction in glomerular filtration rate was statistically significant according to chronic kidney disease stage (no chronic kidney disease 31.2% vs. stage II 26.5% vs. stage III 12.8%, P<0.001). However, the degree of hypertrophic functional renal volume in the remnant kidney was not statistically significant (no chronic kidney disease 18.5% vs. stage II 17.3% vs. stage III 16.5%, P = 0.250). The change in glomerular filtration rate/functional renal volume was statistically significant (no chronic kidney disease 18.5% vs. stage II 20.1% vs. stage III 45.9%, P<0.001). Factors that increased glomerular filtration rate/functional renal

  15. Unsaturated b-ketoesters and their Ni(II, Cu(II and Zn(II complexes

    Directory of Open Access Journals (Sweden)

    MUHAMMED BASHEER UMMATHUR

    2009-03-01

    Full Text Available A new series of b-ketoesters in which the keto group is attached to the olefinic linkage were synthesized by the reaction of methyl acetoacetate and aromatic aldehydes under specified conditions. The existence of these compounds predominantly in the intramolecularly hydrogen bonded enol form was well demonstrated from their IR, 1H-NMR and mass spectral data. Details on the formation of their [ML2] complexes with Ni(II, Cu(II and Zn(II and the nature of the bonding are discussed on the basis of analytical and spectral data.

  16. Adsorption of Cu(II), Hg(II), and Ni(II) ions by modified natural wool chelating fibers

    Energy Technology Data Exchange (ETDEWEB)

    Monier, M., E-mail: monierchem@yahoo.com [Chemistry Department, Drexel University, Philadelphia, PA (United States); Chemistry Department, Faculty of Science, Mansoura University, Mansoura (Egypt); Ayad, D.M.; Sarhan, A.A. [Chemistry Department, Faculty of Science, Mansoura University, Mansoura (Egypt)

    2010-04-15

    The graft copolymerization of ethyl acrylate (EA) onto natural wool fibers initiated by potassium persulphate and Mohr's salt redox initiator system in limited aqueous medium was carried out in heterogeneous media. Ester groups of the grafted copolymers were partially converted into hydrazide function groups followed by hydrazone formation through reaction with isatin. Also the application of the modified fibers for metal ion uptake was studied using Cu(II), Hg(II) and Ni(II). The modified chelating fibers were characterized using FTIR spectroscopy, SEM and X-ray diffraction.

  17. Adsorption of Cu(II), Hg(II), and Ni(II) ions by modified natural wool chelating fibers.

    Science.gov (United States)

    Monier, M; Ayad, D M; Sarhan, A A

    2010-04-15

    The graft copolymerization of ethyl acrylate (EA) onto natural wool fibers initiated by potassium persulphate and Mohr's salt redox initiator system in limited aqueous medium was carried out in heterogeneous media. Ester groups of the grafted copolymers were partially converted into hydrazide function groups followed by hydrazone formation through reaction with isatin. Also the application of the modified fibers for metal ion uptake was studied using Cu(II), Hg(II) and Ni(II). The modified chelating fibers were characterized using FTIR spectroscopy, SEM and X-ray diffraction. 2009 Elsevier B.V. All rights reserved.

  18. Adsorption of Cu(II), Hg(II), and Ni(II) ions by modified natural wool chelating fibers

    International Nuclear Information System (INIS)

    Monier, M.; Ayad, D.M.; Sarhan, A.A.

    2010-01-01

    The graft copolymerization of ethyl acrylate (EA) onto natural wool fibers initiated by potassium persulphate and Mohr's salt redox initiator system in limited aqueous medium was carried out in heterogeneous media. Ester groups of the grafted copolymers were partially converted into hydrazide function groups followed by hydrazone formation through reaction with isatin. Also the application of the modified fibers for metal ion uptake was studied using Cu(II), Hg(II) and Ni(II). The modified chelating fibers were characterized using FTIR spectroscopy, SEM and X-ray diffraction.

  19. Determination of activities of human carbonic anhydrase II inhibitors ...

    African Journals Online (AJOL)

    Purpose: To evaluate the activities of new curcumin analogs as carbonic anhydrase II (CA-II) inhibitor. Methods: Carbonic anhydrase II (CA-II) inhibition was determined by each ligand capability to inhibit the esterase activity of CA-II using 4-NPA as a substrate in 96-well plates. Dimethyl sulfoxide was used to dissolve each ...

  20. Solid-phase extraction of Mn(II), Co(II), Ni(II), Cu(II), Cd(II) and Pb(II) ions from environmental samples by flame atomic absorption spectrometry (FAAS)

    Energy Technology Data Exchange (ETDEWEB)

    Duran, Celal [Department of Chemistry, Faculty of Art and Science, Karadeniz Technical University, 61080 Trabzon (Turkey); Gundogdu, Ali [Department of Chemistry, Faculty of Art and Science, Karadeniz Technical University, 61080 Trabzon (Turkey); Bulut, Volkan Numan [Department of Chemistry, Giresun Faculty of Art and Science, Karadeniz Technical University, 28049 Giresun (Turkey); Soylak, Mustafa [Department of Chemistry, Faculty of Art and Science, Erciyes University, 38039 Kayseri (Turkey)]. E-mail: soylak@erciyes.edu.tr; Elci, Latif [Department of Chemistry, Faculty of Art and Science, Pamukkale University, 20020 Denizli (Turkey); Sentuerk, Hasan Basri [Department of Chemistry, Faculty of Art and Science, Karadeniz Technical University, 61080 Trabzon (Turkey); Tuefekci, Mehmet [Department of Chemistry, Faculty of Art and Science, Karadeniz Technical University, 61080 Trabzon (Turkey)

    2007-07-19

    A new method using a column packed with Amberlite XAD-2010 resin as a solid-phase extractant has been developed for the multi-element preconcentration of Mn(II), Co(II), Ni(II), Cu(II), Cd(II), and Pb(II) ions based on their complex formation with the sodium diethyldithiocarbamate (Na-DDTC) prior to flame atomic absorption spectrometric (FAAS) determinations. Metal complexes sorbed on the resin were eluted by 1 mol L{sup -1} HNO{sub 3} in acetone. Effects of the analytical conditions over the preconcentration yields of the metal ions, such as pH, quantity of Na-DDTC, eluent type, sample volume and flow rate, foreign ions etc. have been investigated. The limits of detection (LOD) of the analytes were found in the range 0.08-0.26 {mu}g L{sup -1}. The method was validated by analyzing three certified reference materials. The method has been applied for the determination of trace elements in some environmental samples.

  1. TFOS DEWS II pathophysiology report.

    Science.gov (United States)

    Bron, Anthony J; de Paiva, Cintia S; Chauhan, Sunil K; Bonini, Stefano; Gabison, Eric E; Jain, Sandeep; Knop, Erich; Markoulli, Maria; Ogawa, Yoko; Perez, Victor; Uchino, Yuichi; Yokoi, Norihiko; Zoukhri, Driss; Sullivan, David A

    2017-07-01

    The TFOS DEWS II Pathophysiology Subcommittee reviewed the mechanisms involved in the initiation and perpetuation of dry eye disease. Its central mechanism is evaporative water loss leading to hyperosmolar tissue damage. Research in human disease and in animal models has shown that this, either directly or by inducing inflammation, causes a loss of both epithelial and goblet cells. The consequent decrease in surface wettability leads to early tear film breakup and amplifies hyperosmolarity via a Vicious Circle. Pain in dry eye is caused by tear hyperosmolarity, loss of lubrication, inflammatory mediators and neurosensory factors, while visual symptoms arise from tear and ocular surface irregularity. Increased friction targets damage to the lids and ocular surface, resulting in characteristic punctate epithelial keratitis, superior limbic keratoconjunctivitis, filamentary keratitis, lid parallel conjunctival folds, and lid wiper epitheliopathy. Hybrid dry eye disease, with features of both aqueous deficiency and increased evaporation, is common and efforts should be made to determine the relative contribution of each form to the total picture. To this end, practical methods are needed to measure tear evaporation in the clinic, and similarly, methods are needed to measure osmolarity at the tissue level across the ocular surface, to better determine the severity of dry eye. Areas for future research include the role of genetic mechanisms in non-Sjögren syndrome dry eye, the targeting of the terminal duct in meibomian gland disease and the influence of gaze dynamics and the closed eye state on tear stability and ocular surface inflammation. Copyright © 2017 Elsevier Inc. All rights reserved.

  2. HERBICIDAS INIBIDORES DO FOTOSSISTEMA II – PARTE II / PHOTOSYSTEM II INHIBITOR HERBICIDES - PART

    Directory of Open Access Journals (Sweden)

    ILCA P. DE F. E SILVA

    2013-11-01

    Full Text Available Os herbicidas inibidores do fotossistema II (PSII ligam-se ao sítio da QB localizado na proteína D1 o qual se localiza na membrana dos tilacóides dos cloroplastos, causando, o bloqueia do transporte de elétrons da QA para QB, tendo como consequência, a peroxidação dos lipídios. Os principais fatores que afetam a evolução da resistência de plantas daninhas aos herbicidas têm sido agrupados em: genéticos, bioecológicos e agronômicos. A resistência de plantas daninhas a herbicidas é definida como a habilidade de uma planta sobreviver e reproduzir, após exposição a uma dose de herbicida normalmente letal para um biótipo normal da planta. A seletividade de um herbicida está relacionada à capacidade de eliminar plantas daninhas sem interferir na qualidade da planta de interesse econômico.

  3. IGF-II receptors and IGF-II-stimulated glucose transport in human fat cells

    International Nuclear Information System (INIS)

    Sinha, M.K.; Buchanan, C.; Raineri-Maldonado, C.; Khazanie, P.; Atkinson, S.; DiMarchi, R.; Caro, J.F.

    1990-01-01

    Insulin-like growth factor II (IGF-II) receptors have been described in rat but not in human adipocytes. In both species, IGF-II has been reported to stimulate glucose transport by interacting with the insulin receptor. In this study, we have unequivocally demonstrated the presence of IGF-II receptors in human adipocytes. 125I-labeled IGF-II specifically binds to intact adipocytes, membranes, and lectin-purified detergent solubilized extracts. Through the use of 0.5 mM disuccinimidyl suberate, 125I-IGF-II is cross-linked to a 260-kDa protein that is identified as the IGF-II receptor by displacement experiments with unlabeled IGF-II, IGF-I, and insulin and either by immunoprecipitation or by Western blot analysis with mannose 6-phosphate receptor antibodies. The concentrations of IGF-II required for half-maximal and maximal stimulation of glucose transport in human adipocytes are 35 and 100 times more than that of insulin. The possibility of IGF-II stimulating glucose transport by interacting predominantly with the insulin receptor is suggested by the following: (1) the concentration of IGF-II that inhibits half of insulin binding is only 20 times more than that of insulin; (2) the lack of an additive effect of IGF-II and insulin for maximal stimulation of glucose transport; (3) the ability of monoclonal insulin receptor antibodies to decrease glucose transport stimulated by submaximal concentrations of both IGF-II and insulin; and (4) the ability of IGF-II to stimulate insulin receptor autophosphorylation albeit at a reduced potency when compared with insulin

  4. Use of APACHE II and SAPS II to predict mortality for hemorrhagic and ischemic stroke patients.

    Science.gov (United States)

    Moon, Byeong Hoo; Park, Sang Kyu; Jang, Dong Kyu; Jang, Kyoung Sool; Kim, Jong Tae; Han, Yong Min

    2015-01-01

    We studied the applicability of the Acute Physiology and Chronic Health Evaluation II (APACHE II) and Simplified Acute Physiology Score II (SAPS II) in patients admitted to the intensive care unit (ICU) with acute stroke and compared the results with the Glasgow Coma Scale (GCS) and National Institutes of Health Stroke Scale (NIHSS). We also conducted a comparative study of accuracy for predicting hemorrhagic and ischemic stroke mortality. Between January 2011 and December 2012, ischemic or hemorrhagic stroke patients admitted to the ICU were included in the study. APACHE II and SAPS II-predicted mortalities were compared using a calibration curve, the Hosmer-Lemeshow goodness-of-fit test, and the receiver operating characteristic (ROC) curve, and the results were compared with the GCS and NIHSS. Overall 498 patients were included in this study. The observed mortality was 26.3%, whereas APACHE II and SAPS II-predicted mortalities were 35.12% and 35.34%, respectively. The mean GCS and NIHSS scores were 9.43 and 21.63, respectively. The calibration curve was close to the line of perfect prediction. The ROC curve showed a slightly better prediction of mortality for APACHE II in hemorrhagic stroke patients and SAPS II in ischemic stroke patients. The GCS and NIHSS were inferior in predicting mortality in both patient groups. Although both the APACHE II and SAPS II systems can be used to measure performance in the neurosurgical ICU setting, the accuracy of APACHE II in hemorrhagic stroke patients and SAPS II in ischemic stroke patients was superior. Copyright © 2014 Elsevier Ltd. All rights reserved.

  5. Forced convection heat transfer in He II

    International Nuclear Information System (INIS)

    Kashani, A.

    1986-01-01

    An investigation of forced convection heat transfer in He II is conducted. The study includes both experimental and theoretical treatments of the problem. The experiment consists of a hydraulic pump and a copper flow tube, 3 mm in ID and 2m long. The system allows measurements of one-dimensional heat and mass transfer in He II. The heat transfer experiments are performed by applying heat at the midpoint along the length of the flow tube. Two modes of heat input are employed, i.e., step function heat input and square pulse heat input. The heat transfer results are discussed in terms of temperature distribution in the tube. The experimental temperature profiles are compared with numerical solutions of an analytical model developed from the He II energy equation. The bath temperature is set at three different values of 1.65, 1.80, and 1.95 K. The He II flow velocity is varied up to 90 cm/s. Pressure is monitored at each end of the flow tube, and the He II pressure drop is obtained for different flow velocities. Results indicate that He II heat transfer by forced convention is considerably higher than that by internal convection. The theoretical model is in close agreement with the experiment. He II pressure drop and friction factor are very similar to those of an ordinary fluid

  6. Role of dust in H II regions

    International Nuclear Information System (INIS)

    Sarazin, C.L.

    1975-01-01

    The purpose of this dissertation is to determine quantitatively the effects of U.V. absorbing dust on H II regions, and compare these effects with observations. Many observations indicate that dust grains are present within H II regions. An analytic theory is presented which describes all three of the effects of dust in H II regions. Although this model is relatively crude, it is useful in determining the approximate size of the modifications due to dust. In order to explore this problem more carefully, detailed numerical models of H II regions with dust were constructed. The ionization and thermal structure of these model H II regions is discussed. The observational consequences of the presence of dust are explored; the optical line intensities, radio continuum and line fluxes, and infrared emission of model H II regions with dust are given. These numerical models are compared with observations of diffuse nebulae. The optical line ratios are compared to several nearby bright H II regions, and it is found that the dust models may explain several anomalies in their spectrum

  7. Oxidation of Fe(II) in rainwater.

    Science.gov (United States)

    Willey, J D; Whitehead, R F; Kieber, R J; Hardison, D R

    2005-04-15

    Photochemically produced Fe(II) is oxidized within hours under environmentally realistic conditions in rainwater. The diurnal variation between photochemical production and reoxidation of Fe(II) observed in our laboratory accurately mimics the behavior of ferrous iron observed in field studies where the highest concentrations of dissolved Fe(ll) occur in afternoon rain during the period of maximum sunlight intensity followed by gradually decreasing concentrations eventually returning to early morning pre-light values. The experimental work presented here, along with the results of kinetics studies done by others, suggests thatthe primary process responsible for the decline in photochemically produced Fe(II) concentrations is oxidation by hydrogen peroxide. This reaction is first order with respect to both the concentrations of Fe(II) and H2O2. The second-order rate constant determined for six different authentic rain samples varied over an order of magnitude and was always less than or equal to the rate constant determined for this reaction in simple acidic solutions. Oxidation of photochemically produced ferrous iron by other oxidants including molecular oxygen, ozone, hydroxyl radical, hydroperoxyl/superoxide radical, and hexavalent chromium were found to be insignificant under the conditions present in rainwater. This study shows that Fe(II) occurs as at least two different chemical species in rain; photochemically produced Fe(II) that is oxidized over time periods of hours, and a background Fe(II) that is protected against oxidation, perhaps by organic complexation, and is stable against oxidation for days. Because the rate of oxidation of photochemically produced Fe(II) does not increase with increasing rainwater pH, the speciation of this more labile form of Fe(II) is also not controlled by simple hydrolysis reactions.

  8. Status Report on PEP-II Performance

    International Nuclear Information System (INIS)

    Matter, Regina S.

    2002-01-01

    PEP-II [1-9] is an e+e- collider with asymmetric energies (3.1 and 9 GeV, respectively) in a 2200 m tunnel at the Stanford Linear Accelerator Center. The collider produces B mesons to study a particle physics effect called CP violation as well as other physics topics. PEP-II was completed in 1998 with the first luminosity generated in July of that year. The installation of the BaBar Detector was finished in May 1999. The overall layout of PEP-II is shown in Figure 1 and the interaction region of PEP-II in Figure 2. The accelerator parameters and achievements of the High Energy Ring (HER) are listed in Table 1 and those for the Low Energy Ring (LER) in Table 2. The two beams collide at a single point in the IR2 hall where the BaBar detector is located. Beam parameters at the best luminosity are shown in Table 3 and PEP-II milestones in Table 4. In August 1999 PEP-II passed the world's record for luminosity which was 8.1x10 32 /cm 2 /s. The present luminosity in PEP-II is 2.15x10 33 /cm 2 /s which is 72% of the design. In June 2000 PEP-II delivered an integrated luminosity of 150 pb -1 in one day, which is above the design integrated luminosity per day of 135 pb -1 . Over the past year PEP-II has delivered over 12 fb -1 to BaBar. BaBar has logged over 11 pb -1 . The present plan is collide until the end of October 2000 followed by a three month installation period

  9. Synthesis and characterization of polychelates of Cu(II), Ni(II), Co(II), Mn(II), Zn(II), oxovanadium(IV) and dioxouranium(VI) with 2,4-dihydroxybenzaldehyde-urea-formaldehyde polymer

    International Nuclear Information System (INIS)

    Patel, G.C.; Pancholi, H.B.; Patel, M.M.

    1991-01-01

    Polychelates of Cu(II), Ni(II), Co(II), Mn(II), Zn(II), oxovandium(IV) and dioxouranium(VI) with 2,4-dihydroxybenzaldehyde (2,4-DB)-urea(U)-formaldehyde(F) polymer (2,4-DBUF) have been prepared. Elemental analyses of the polychelates indicate a metal:ligand ratio of 1:2. The structures of the polychelates have been assigned on the basis of their elemental analyses, IR, reflectance spectra, magnetic moment, thermal data and their electrical conductivity behaviour. (author). 1 tab., 18 refs

  10. Level II Ergonomic Analyses, Dover AFB, DE

    Science.gov (United States)

    1999-02-01

    IERA-RS-BR-TR-1999-0002 UNITED STATES AIR FORCE IERA Level II Ergonomie Analyses, Dover AFB, DE Andrew Marcotte Marilyn Joyce The Joyce...Project (070401881, Washington, DC 20503. 1. AGENCY USE ONLY (Leave blank) 2. REPORT DATE 4. TITLE AND SUBTITLE Level II Ergonomie Analyses, Dover...1.0 INTRODUCTION 1-1 1.1 Purpose Of The Level II Ergonomie Analyses : 1-1 1.2 Approach 1-1 1.2.1 Initial Shop Selection and Administration of the

  11. Overview of the SECOM II communications system

    International Nuclear Information System (INIS)

    Olson, W.D.

    1977-04-01

    The conversion of the SECOM system to the SECOM II configuration has been completed and all communications between the central control station and vehicles carrying nuclear weapons and special nuclear materials are being handled by the SECOM II system. A summary of the system characteristics and the improvements achieved over the all-voice system is shown. Through the combined efforts of ALO and Sandia personnel, the transition from SECOM to SECOM II was achieved with a minimum disruption to the operation of the ERDA transportation system

  12. Angiotensin II and Renal Tubular Ion Transport

    Directory of Open Access Journals (Sweden)

    Patricia Valles

    2005-01-01

    Evidence for the regulation of H+-ATPase activity in vivo and in vitro by trafficking/exocytosis has been provided. An additional level of H+-ATPase regulation via protein synthesis may be important as well. Recently, we have shown that both aldosterone and angiotensin II provide such a mechanism of regulation in vivo at the level of the medullary collecting tubule. Interestingly, in this part of the nephron, the effects of aldosterone and angiotensin II are not sodium dependent, whereas in the cortical collecting duct, both aldosterone and angiotensin II, by contrast, affect H+ secretion by sodium-dependent mechanisms.

  13. International cooperation at RTNS-II

    International Nuclear Information System (INIS)

    Logan, C.M.

    1984-02-01

    The Rotating Target Neutron Source-II (RTNS-II) facility at LLNL is a unique materials-test facility. It provides the most intense source of 14-MeV neutrons in the world. Dedicated operation in support of the fusion-materials-research community began in early 1979. Three years later, the Japanese Ministry of Education, Science, and Culture (Monbusho) and the US Department of Energy agreed to jointly support the RTNS-II operation and to share in the use of the facility

  14. LHC II system sensitivity to magnetic fluids

    CERN Document Server

    Cotae, Vlad

    2005-01-01

    Experiments have been designed to reveal the influences of ferrofluid treatment and static magnetic field exposure on the photosynthetic system II, where the light harvesting complex (LHC II) controls the ratio chlorophyll a/ chlorophyll b (revealing, indirectly, the photosynthesis rate). Spectrophotometric measurement of chlorophyll content revealed different influences for relatively low ferrofluid concentrations (10-30 mul/l) in comparison to higher concentrations (70-100 mul/l). The overlapped effect of the static magnetic field shaped better the stimulatory ferrofluid action on LHC II system in young poppy plantlets.

  15. Phase II clinical development of new drugs

    CERN Document Server

    Ting, Naitee; Ho, Shuyen; Cappelleri, Joseph C

    2017-01-01

    This book focuses on how to appropriately plan and develop a Phase II program, and how to design Phase II clinical trials and analyze their data. It provides a comprehensive overview of the entire drug development process and highlights key questions that need to be addressed for the successful execution of Phase II, so as to increase its success in Phase III and for drug approval. Lastly it warns project team members of the common potential pitfalls and offers tips on how to avoid them.

  16. Comparative analysis of Carnaval II Library

    International Nuclear Information System (INIS)

    Santos Bastos, W. dos

    1981-01-01

    The Carnaval II cross sections library from the french fast reactor calculation system is evaluated in two ways: 1 0 ) a comparative analysis of the calculations system for fast reactors at IEN (Instituto de Engenharia Nuclear) using a 'benchmark' model is done; 2 0 ) a comparative analysis in relation to the french system itself is also done, using calculations realized with two versions of the french library: the SETR-II and the CARNAVAL IV, the first one being anterior and the second one posterior to the Carnaval II version, the one used by IEN. (Author) [pt

  17. Heat Generation in Axial and Centrifugal Flow Left Ventricular Assist Devices.

    Science.gov (United States)

    Yost, Gardner; Joseph, Christine Rachel; Royston, Thomas; Tatooles, Antone; Bhat, Geetha

    Despite increasing use of left ventricular assist devices (LVADs) as a surgical treatment for advanced heart failure in an era of improved outcomes with LVAD support, the mechanical interactions between these pumps and the cardiovascular system are not completely understood. We utilized an in vitro mock circulatory loop to analyze the heat production incurred by operation of an axial flow and centrifugal flow LVAD. A HeartMate II and a HeartWare HVAD were connected to an abbreviated flow loop and were implanted in a viscoelastic gel. Temperature was measured at the surface of each LVAD. Device speed and fluid viscosity were altered and, in the HeartMate II, as artificial thrombi were attached to the inflow stator, impeller, and outflow stator. The surface temperatures of both LVADs increased in all trials and reached a plateau within 80 minutes of flow initiation. Rate of heat generation and maximum system temperature were greater when speed was increased, when viscosity was increased, and when artificial thrombi were attached to the HeartMate II impeller. Normal operation of these two widely utilized LVADs results in appreciable heat generation in vitro. Increased pump loading resulted in more rapid heat generation, which was particularly severe when a large thrombus was attached to the impeller of the HeartMate II. While heat accumulation in vivo is likely minimized by greater dissipation in the blood and soft tissues, focal temperature gains with the pump housing of these two devices during long-term operation may have negative hematological consequences.

  18. Synthesis, spectral characterization thermal stability, antimicrobial studies and biodegradation of starch–thiourea based biodegradable polymeric ligand and its coordination complexes with [Mn(II, Co(II, Ni(II, Cu(II, and Zn(II] metals

    Directory of Open Access Journals (Sweden)

    Nahid Nishat

    2016-09-01

    Full Text Available A biodegradable polymer was synthesized by the modification reaction of polymeric starch with thiourea which is further modified by transition metals, Mn(II, Co(II, Ni(II, Cu(II and Zn(II. All the polymeric compounds were characterized by (FT-IR spectroscopy, 1H NMR spectroscopy, 13C NMR spectroscopy, UV–visible spectra, magnetic moment measurements, thermogravimetric analysis (TGA and antibacterial activities. Polymer complexes of Mn(II, Co(II and Ni(II show octahedral geometry, while polymer complexes of Cu(II and Zn(II show square planar and tetrahedral geometry, respectively. The TGA revealed that all the polymer metal complexes are more thermally stable than their parental ligand. In addition, biodegradable studies of all the polymeric compounds were also carried out through ASTM-D-5338-93 standards of biodegradable polymers by CO2 evolution method which says that coordination decreases biodegradability. The antibacterial activity was screened with the agar well diffusion method against some selected microorganisms. Among all the complexes, the antibacterial activity of the Cu(II polymer–metal complex showed the highest zone of inhibition because of its higher stability constant.

  19. Synthesis and studies on Cu(II), Co(II), Ni(II) complexes of Knoevenagel β-diketone ligands

    Science.gov (United States)

    Sumathi, S.; Tharmaraj, P.; Sheela, C. D.; Anitha, C.

    2012-11-01

    Transition metal complexes of various acetylacetone based ligands of the type ML [where M = Cu(II), Ni(II), Co(II); L = 3-(aryl)-pentane-2,4-dione] have been synthesized. The structural features have been derived from their elemental analysis, magnetic susceptibility, molar conductance, IR, UV-Vis, 1H NMR, Mass and ESR spectral studies. Conductivity measurements reveal that all the complexes are non-electrolytic in nature. Spectroscopic and other analytical data of the complexes suggest octahedral geometry for other metal(II) complexes. The redox behavior of the copper(II) complexes have been studied by cyclic voltammetry. The free ligands and their metal complexes have been screened for their in vitro biological activities against the bacteria Pseudomonas aeruginosa, Escherichia coli and Staphylococcus aureus as well as the fungus Candida albicans by well diffusion method. The zone of inhibition value indicates that the most of the metal(II) complexes are found to possess increased activities compared to those of the free ligands. All synthesized compounds may serve as potential photoactive materials as indicated from their characteristic fluorescence properties. The second harmonic generation (SHG) efficiency of the ligands (L1-L3) was found to be considerable effect than that of urea and KDP (potassium dihydrogen phosphate).

  20. Pecan nutshell as biosorbent to remove Cu(II), Mn(II) and Pb(II) from aqueous solutions.

    Science.gov (United States)

    Vaghetti, Julio C P; Lima, Eder C; Royer, Betina; da Cunha, Bruna M; Cardoso, Natali F; Brasil, Jorge L; Dias, Silvio L P

    2009-02-15

    In the present study we reported for the first time the feasibility of pecan nutshell (PNS, Carya illinoensis) as an alternative biosorbent to remove Cu(II), Mn(II) and Pb(II) metallic ions from aqueous solutions. The ability of PNS to remove the metallic ions was investigated by using batch biosorption procedure. The effects such as, pH, biosorbent dosage on the adsorption capacities of PNS were studied. Four kinetic models were tested, being the adsorption kinetics better fitted to fractionary-order kinetic model. Besides that, the kinetic data were also fitted to intra-particle diffusion model, presenting three linear regions, indicating that the kinetics of adsorption should follow multiple sorption rates. The equilibrium data were fitted to Langmuir, Freundlich, Sips and Redlich-Peterson isotherm models. Taking into account a statistical error function, the data were best fitted to Sips isotherm model. The maximum biosorption capacities of PNS were 1.35, 1.78 and 0.946mmolg(-1) for Cu(II), Mn(II) and Pb(II), respectively.