hidden collection sara: Topics by WorldWideScience.org

Sample records for hidden collection sara

2012 SARA Students Technical Report

International Nuclear Information System (INIS)

Briccetti, Angelo; Lorei, Nathan; Yonkings, David; Lorio, David; Goorley, John T.; Sood, Avneet

2012-01-01

The Service Academy Research Associates (SARA) program provides an opportunity for Midshipmen and Cadets from US Service Academies to participate in research at Los Alamos National Laboratory (LANL), Lawrence Livermore National Laboratory (LLNL), and Sandia National Laboratory for several weeks during the summer as part of their summer training assignments. During the summer of 2012, three Midshipmen were assigned to work with the XCP Division at LANL for approximately 5-6 weeks. As one of the nation's top national security science laboratories, LANL stretches across 36 square miles, has over 2,100 facilities, and employs over 9,000 individuals including a significant number of students and postdocs. LANL's mission is to 'apply science and technology to: ensure the safety, security, and reliability of the US nuclear deterrent, reduce global threats, and solve other emerging national security challenges.' While LANL officially operates under the US Department of Energy (DoE), fulfilling this mission requires mutual cooperation with the US Department of Defense (DoD) as well. LANL's high concentration of knowledge and experience provides interns a chance to perform research in many disciplines, and its connection with the DoD in both operation and personnel gives SARA students insight to career possibilities both during and after military service. SARA students have plenty of opportunity to enjoy hiking, camping, the Los Alamos YMCA, and many other outdoor activities in New Mexico while staying at the Buffalo Thunder Resort, located 20 miles east of the lab. XCP Division is the Computational Physics division of LANL's Weapons Department. Working with XCP Division requires individuals to be Q cleared by the DoE. This means it is significantly more convenient for SARA students to be assigned to XCP Division than their civilian counterparts as the DoD CNWDI clearance held by SARA students is easily transferred to the lab prior to the students arriving at the start of
2012 SARA Students Technical Report

Energy Technology Data Exchange (ETDEWEB)

Briccetti, Angelo [Los Alamos National Laboratory; Lorei, Nathan [Los Alamos National Laboratory; Yonkings, David [Los Alamos National Laboratory; Lorio, David [Los Alamos National Laboratory; Goorley, John T. [Los Alamos National Laboratory; Sood, Avneet [Los Alamos National Laboratory

2012-07-30

The Service Academy Research Associates (SARA) program provides an opportunity for Midshipmen and Cadets from US Service Academies to participate in research at Los Alamos National Laboratory (LANL), Lawrence Livermore National Laboratory (LLNL), and Sandia National Laboratory for several weeks during the summer as part of their summer training assignments. During the summer of 2012, three Midshipmen were assigned to work with the XCP Division at LANL for approximately 5-6 weeks. As one of the nation's top national security science laboratories, LANL stretches across 36 square miles, has over 2,100 facilities, and employs over 9,000 individuals including a significant number of students and postdocs. LANL's mission is to 'apply science and technology to: ensure the safety, security, and reliability of the US nuclear deterrent, reduce global threats, and solve other emerging national security challenges.' While LANL officially operates under the US Department of Energy (DoE), fulfilling this mission requires mutual cooperation with the US Department of Defense (DoD) as well. LANL's high concentration of knowledge and experience provides interns a chance to perform research in many disciplines, and its connection with the DoD in both operation and personnel gives SARA students insight to career possibilities both during and after military service. SARA students have plenty of opportunity to enjoy hiking, camping, the Los Alamos YMCA, and many other outdoor activities in New Mexico while staying at the Buffalo Thunder Resort, located 20 miles east of the lab. XCP Division is the Computational Physics division of LANL's Weapons Department. Working with XCP Division requires individuals to be Q cleared by the DoE. This means it is significantly more convenient for SARA students to be assigned to XCP Division than their civilian counterparts as the DoD CNWDI clearance held by SARA students is easily transferred to the lab prior to the
Identification of Differentially Expressed Proteins in Liver in Response to Subacute Ruminal Acidosis (SARA Induced by High-concentrate Diet

Directory of Open Access Journals (Sweden)

X. Y. Jiang

2014-08-01

Full Text Available The aim of this study was to evaluate protein expression patterns of liver in response to subacute ruminal acidosis (SARA induced by high-concentrate diet. Sixteen healthy mid-lactating goats were randomly divided into 2 groups and fed either a high-forage (HF diet or a high-concentrate (HC diet. The HC diet was expected to induce SARA. After ensuring the occurrence of SARA, liver samples were collected. Proteome analysis with differential in gel electrophoresis technology revealed that, 15 proteins were significantly modulated in liver in a comparison between HF and HC-fed goats. These proteins were found mainly associated with metabolism and energy transfer after identified by matrix-assisted laser desorption ionization/time of flight. The results indicated that glucose, lipid and protein catabolism could be enhanced when SARA occurred. It prompted that glucose, lipid and amine acid in the liver mainly participated in oxidation and energy supply when SARA occurred, which possibly consumed more precursors involved in milk protein and milk fat synthesis. These results suggest new candidate proteins that may contribute to a better understanding of the mechanisms that mediate liver adaptation to SARA.
Sara Wasson and Emily Alder, Gothic Science Fiction 1980-2010

OpenAIRE

Beaulé, Sophie

2014-01-01

With their collection of essays Gothic Science Fiction 1980-2010, Sara Wasson and Emily Alder illustrate the richness of gothic tropes in contemporary forms, from novels and movies to card games. More than cliché, melodrama, or gore, the “gothick” (to borrow Adam Roberts’s term, xi) allows for the hybridity in contemporary production, especially in science fiction, that the collected articles examine. The book is divided into three parts, “Redefining Genres”, “Biopower and Capital”, and “Gend...
News developments at Sara

International Nuclear Information System (INIS)

Belmont, J.L.; Fruneau, M.; Martin, P.

1989-05-01

SARA was one of the first cyclotrons to operate with an ECR ion source. Experience since 1983 showed it would be useful to have two sources situated outside the cyclotron vault to manage continuous operation of the accelerator and development of new ions. A 18 m long injection line for FERROMAFIOS and MINIMAFIOS has been constructed. One of its principal features is a 11 m long electrostatic guide with periodic focusing. Transmission ratios from the source to the internal beam are close to 30%. Experiences involving time of flight measurements require short beam bunches; in order to reduce their duration, a phase selecting system will be installed in the centre of the injector of SARA. A RF voltage at four times the frequency of the dees will vertically deflect early orbits while particles close to the central phase will cross the deflector at zero voltage and will undergo normal acceleration
Interpreting the SARA and RCRA training requirements

International Nuclear Information System (INIS)

Moreland, W.M.; Wells, S.M.

1987-01-01

The Resource Conservation and Recovery Act (RCRA) and the Superfund Amendments and Reauthorization Act (SARA) promulgated by the EPA (RCRA) and the OSHA (SARA) require hazardous materials training for all individuals working with hazardous materials. Facilities that are involved in the generation, storage, treatment, transportation, or disposal/removal of hazardous materials/waste must comply with all relevant training regulations. Using the guidelines contained in the RCRA and SARA regulations, decisions must be made to determine: the type of regulatory requirement based on facility function (i.e., whether the facility is a RCRA or CERCLA facility). The type of training required for specific categories of workers (e.g. managers, supervisors, or general site workers). The level of training needed for each category of worker. This presentation outlines how the Environmental Compliance and Health Protection Technical Resources and Training Group, working with waste operations personnel, establishes specific training requirements
SARAS 2 Constraints on Global 21 cm Signals from the Epoch of Reionization

Science.gov (United States)

Singh, Saurabh; Subrahmanyan, Ravi; Udaya Shankar, N.; Sathyanarayana Rao, Mayuri; Fialkov, Anastasia; Cohen, Aviad; Barkana, Rennan; Girish, B. S.; Raghunathan, A.; Somashekar, R.; Srivani, K. S.

2018-05-01

Spectral distortions in the cosmic microwave background over the 40–200 MHz band are imprinted by neutral hydrogen in the intergalactic medium prior to the end of reionization. This signal, produced in the redshift range z = 6–34 at the rest-frame wavelength of 21 cm, has not been detected yet; and a poor understanding of high-redshift astrophysics results in a large uncertainty in the expected spectrum. The SARAS 2 radiometer was purposely designed to detect the sky-averaged 21 cm signal. The instrument, deployed at the Timbaktu Collective (Southern India) in 2017 April–June, collected 63 hr of science data, which were examined for the presence of the cosmological 21 cm signal. In our previous work, the first-light data from the SARAS 2 radiometer were analyzed with Bayesian likelihood-ratio tests using 264 plausible astrophysical scenarios. In this paper we reexamine the data using an improved analysis based on the frequentist approach and forward-modeling. We show that SARAS 2 data reject 20 models, out of which 15 are rejected at a significance >5σ. All the rejected models share the scenario of inefficient heating of the primordial gas by the first population of X-ray sources, along with rapid reionization. Joint Astronomy Program, Indian Institute of Science, Bangalore 560012, India.
Changes in Microbiota in Rumen Digesta and Feces Due to a Grain-Based Subacute Ruminal Acidosis (SARA) Challenge

DEFF Research Database (Denmark)

Plaizier, Jan C.; Li, Shucong; Danscher, Anne Mette

2017-01-01

The effects of a grain-based subacute ruminal acidosis (SARA) challenge on bacteria in the rumen and feces of lactating dairy cows were determined. Six lactating, rumen-cannulated Danish Holstein cows were used in a cross-over study with two periods. Periods included two cows on a control diet...... and two cows on a SARA challenge. The control diet was a total mixed ration containing 45.5% dry matter (DM), 43.8% DM neutral detergent fiber, and 19.6% DM starch. The SARA challenge was conducted by gradually substituting the control diet with pellets containing 50% wheat and 50% barley over 3 days...... to reach a diet containing 55.6% DM, 31.3% DM neutral detergent fiber, and 31.8% DM starch, which was fed for four more days. Rumen fluid samples were collected at day 7 and 10 of experimental periods. Feces samples were collected on days 8 and 10 of these periods. Extracted DNA from the rumen and feces...
Subacute ruminal acidosis (SARA) in grazing Irish dairy cows.

Science.gov (United States)

O'Grady, Luke; Doherty, Michael L; Mulligan, Finbar J

2008-04-01

Subacute ruminal acidosis (SARA) is a significant production disease of dairy cattle. Previous concerns have been raised over the occurrence of SARA in pasture-fed dairy cattle and the potential consequences of laminitis and lameness. Highly digestible perennial rye grass contains high concentrations of rapidly fermentable carbohydrate and low concentrations of physical effective fibre that may result in SARA. This study conducted a point prevalence survey of rumen health status in grazing Irish dairy cattle fed predominantly perennial rye grass-based pasture. The survey assessed rumen fluid, animal health status, milk production data and pasture composition. A total of 144 cows between 80 and 150 days in milk were sampled on 12 farms. Eleven percent of cows were classified as affected with SARA (pH 5.8). The study showed that low rumen pH is prevalent in grazing Irish dairy cattle consuming perennial rye grass-based pasture and raises concerns regarding effective pasture utilisation and possible consequences for animal health.
System Analysis and Risk Assessment system (SARA) Version 4.0

International Nuclear Information System (INIS)

Sattison, M.B.; Russell, K.D.; Skinner, N.L.

1992-01-01

This NUREG is the tutorial for the System Analysis and Risk Assessment System (SARA) Version 4.0, a microcomputer-based system used to analyze the safety issues of a family [i.e., a power plant, a manufacturing facility, any facility on which a probabilistic risk assessment (PRA) might be performed]. A series of lessons are provided that walk the user through some basic steps common to most analyses performed with SARA. The example problems presented in the lessons build on one another, and in combination, lead the user through all aspects of SARA sensitivity analysis
The relationship between SARA fractions and crude oil stability

Directory of Open Access Journals (Sweden)

Siavash Ashoori

2017-03-01

Full Text Available Asphaltene precipitation and deposition are drastic issues in the petroleum industry. Monitoring the asphaltene stability in crude oil is still a serious problem and has been subject of many studies. To investigate crude oil stability by saturate, aromatic, resin and asphaltene (SARA analysis seven types of crudes with different components were used. The applied methods for SARA quantification are IP-143 and ASTM D893-69 and the colloidal instability index (CII is computed from the SARA values as well. In comparison between CII results, the values of oil compositions demonstrated that the stability of asphaltenes in crude oils is a phenomenon that is related to all these components and it cannot be associated only with one of them, individually.
Layering of life (Sara novel of Peter Sarić

Directory of Open Access Journals (Sweden)

Kostić Dragomir J.

2015-01-01

Full Text Available Novel Sara of Petar Sarić consists of two parts; in it are processed or present two wars, two major wars in the region of Montenegro and Herzegovina, the First and Second World War. However, it is more novel about divisions within the family and the man himself, (and infamous assault of godfather Luka on Sarah also and his murder are in that function, in the first part; and on the divisions among the people, in general, in the second part of the novel. The second part is, in fact, the image layering of life, not a symbolic one, full of hope, faith, reliance, rather than a concrete, real life, that life which is transformed into a fear of life. Separate, poetical, part of the novel, is his main character, Sara. It is no coincidence that her name novel entitled. Because she is one of most beautiful characters in the newer Serbian prose. Speech about the Sara precedes speech about her book. The book is Sara, Sara's book! Possession of book is her main feature of the exterior. Sara comes out from the Book and disappears in the book. Self contained and independent, therefore doomed to conflict with the environment. Loyal to husband and family, loyal to the truth and for justice, she ,,not hurt anything and anyone, no one is standing in the way, to anyone not wroth, nor has anyone looked wrong.' At the same time, the strange beauty, beauty that could not fit into some sort of scheme, one particular image or idea of beauty that again and again renewed, changed, remaining distant, and unmet. Strange goodness, marvelous beauty, she suffered unusual way; her life was transformed into continuous abstinence, repression, in anxiety and fear. In a word: in martirizam! Finally, in order to safeguard children, sacrificed herself. Novel is a strong critique of society which is not able to recognize the beauty / goodness!.
The SARA REU Site Program

Science.gov (United States)

Wood, M. A.; Oswalt, T. D.; SARA Collaboration

2000-12-01

We present an overview of the Research Experiences for Undergraduates (REU) Site Program hosted by the Southeastern Association for Research in Astronomy (SARA) for the past 6 years. SARA is a consortium of the six universities: Florida Institute of Technology, East Tennessee State University, Florida International University, The University of Georgia, Valdosta State University, and Clemson University. We host 10-11 student interns per year out of an application pool of ~150-200. Recruiting flyers are sent to the ~3400 undergraduate institutions in the United States, and we use a web-based application form and review process. We are a distributed REU Site, but come together for group meetings at the beginning and end of the summer program and stay in contact in between using email list manager software. Interns complete a research project working one-on-one with a faculty mentor, and each intern travels to observe at the SARA Observatory at Kitt Peak National Observatory. Interns give both oral and display presentations of their results at the final group meeting. In addition, all interns write a paper for publication in the IAPPP Communications, an international amateur-professional journal, and several present at professional meetings and in refereed publications. We include in the group meetings a ``how-to'' session on giving talks and posters, an Ethics Session, and a session on Women in Astronomy. This work was supported by the NSF Research Experiences for Undergraduates (REU) Site Program through grant AST 96169939 to The Florida Institute of Technology.
Gene : CBRC-SARA-01-1996 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-SARA-01-1996 Novel UN D UNKNOWN NU2C_ANTFO 0.004 26% gb|AAQ05281.1| NADH dehydrogenase subunit B [Metas...equoia glyptostroboides] 0.044 26% MILMLFLLGSSPRSLIHPRAILKTFPIVCCCLYAFCSLTSLILSLAVL
Staphylococcus aureus sarA regulates inflammation and colonization during central nervous system biofilm formation.

Directory of Open Access Journals (Sweden)

Jessica N Snowden

Full Text Available Infection is a frequent and serious complication following the treatment of hydrocephalus with CSF shunts, with limited therapeutic options because of biofilm formation along the catheter surface. Here we evaluated the possibility that the sarA regulatory locus engenders S. aureus more resistant to immune recognition in the central nervous system (CNS based on its reported ability to regulate biofilm formation. We utilized our established model of CNS catheter-associated infection, similar to CSF shunt infections seen in humans, to compare the kinetics of bacterial titers, cytokine production and inflammatory cell influx elicited by wild type S. aureus versus an isogenic sarA mutant. The sarA mutant was more rapidly cleared from infected catheters compared to its isogenic wild type strain. Consistent with this finding, several pro-inflammatory cytokines and chemokines, including IL-17, CXCL1, and IL-1β were significantly increased in the brain following infection with the sarA mutant versus wild type S. aureus, in agreement with the fact that the sarA mutant displayed impaired biofilm growth and favored a planktonic state. Neutrophil influx into the infected hemisphere was also increased in the animals infected with the sarA mutant compared to wild type bacteria. These changes were not attributable to extracellular protease activity, which is increased in the context of SarA mutation, since similar responses were observed between sarA and a sarA/protease mutant. Overall, these results demonstrate that sarA plays an important role in attenuating the inflammatory response during staphylococcal biofilm infection in the CNS via a mechanism that remains to be determined.
Teologi Politik Berbalu SARA Antara Ambisi dan Konspirasi

Directory of Open Access Journals (Sweden)

M. Sidi Ritau'din

2017-06-01

Full Text Available In a multi-cultural democracy based on Pancasila philosophy of independence, ethnic, religious, racial and intergroup issues it call (SARA are political indicators that can trigger conflict and division. If the player is ambitious and power-hungry, then he will not hesitate to do everything he can to gain power, even build a big conspiracy using SARA as a tool to divide the ummah, then he emerges as a unifier and presents programs prestigious sympathetic, there Imaging actions and slogans of the pro poor people, but essentially no more as political deceit, a false gift of hope, it familiar said (PHP that never realized, only reap the political advantage in the game of SARA, even not hesitate to shout thief when he Itself is a thieving thief based on greed and greed where the horizontal relations of fellow human beings deny the bond of faith as the foundation. Political conspiracy based on political interests and abuse of power, an action of political pathology that is not civilized that has become a trend of contemporary politics and globalization.
Rumen Microbiome Composition in Cattle during Grain-Induced Subacute Ruminal Acidosis (SARA)

DEFF Research Database (Denmark)

Danscher, Anne Mette; Derakshani, Hooman; Li, Shucong

2014-01-01

at the genus level. The rumen bacterial communities were altered in response to SARA (P=0.01). The proportion of several taxa was significantly higher in SARA samples, including S24-7, Erysipelotrichales. Lactobacillus, C lostridia, Moryella, Butyrivibrio, Olsenella, and C oprococcus. Microbiome profiling...
ESTETIKA TARIAN SARA DOUDA DALAM MASYARAKAT ADAT LOLI (SEBUAH PENDEKATAN LINGUISTIK KEBUDAYAAN

Directory of Open Access Journals (Sweden)

Sulistyastuti Sutomo

2015-01-01

Full Text Available Not only does art have self-fullfillment, but it also has axiological benefits both socially, culturally, religiously, and economiclally. So does Sara Douda dance. Sara Douda aesthetics is first contained in its whole dance movements. In addition, it can also be found in the whole dance equipments. Moreover, this dance aesthetics may also be contained in the verbal symbols in the speech forms prior to the dance performance. However, both verbal and non-verbal aesthetical forms are incorporated by the pieces of socio-cultural and religious values in the Loli community about their honoring their ancestors, having social harmony, and highly respecting each other among the community members. This study uses a cultural linguistic approach to find out and to review the aesthetics of Sara Douda dance. Seni memang memiliki kepenuhan dalam dirinya sendiri. Tetapi ia juga sekaligus punya faedah aksiologis, baik secara sosial, kultural, religius maupun secara ekonomis. Tarian Sara Douda pun demikian. Estetika Sara Douda pertama-tama ada dalam semua gerak tariannya. Juga dalam seluruh perlengkapan tarian tersebut. Bukan itu saja, estetika tarian ini juga ada dalam simbol-simbol verbal berupa tuturan menjelang tarian. Tetapi baik bentuk-bentuk estetisasi nonverbal maupun verbal, sama-sama disatukan oleh kepingan-kepingan nilai-nilai sosio-kultural dan religius masyarakat Loli tentang penghormatan kepada leluhur, tentang harmoni sosial, dan tentang penghargaan yang tinggi terhadap satu sama lain. Penelitian ini menggunakan pendekatan linguistik kebudayaan demi menemukan dan menelaah estetika dalam tarian Sara Douda
Sara John: Ethnisierte Arbeit. Eine feministische Perspektive. Marburg: Tectum Wissenschaftsverlag 2009.

Directory of Open Access Journals (Sweden)

Grit Grigoleit

2011-03-01

Full Text Available Auch bei steigender Erwerbsbeteiligung von Frauen ist der deutsche Arbeitsmarkt von einer weitverbreitenden Chancenungleichheit gekennzeichnet. Die Lebenswirklichkeiten von Migrant/-innen und ihre Einbindung in die vergeschlechtlichten Prozesse am Arbeitsmarkt wurden bislang nicht systematisch erfasst. An diesem Punkt setzt Sara John an, indem sie theoretische Konzeptionen zur Vergeschlechtlichung und zur Ethnisierung auf dem Arbeitsmarkt zusammenführt. In einem multidisziplinären Ansatz werden die zahlreichen Verschränkungen um das Phänomen ‚ethnisierte Arbeit‘ aufgegriffen, die vor dem Hintergrund der Debatte um Deutschland als Einwanderungsland zunehmend an Bedeutung und Brisanz gewinnen.Although women’s labor force participation is rising, the German job market is characterized by a widespread lack of equal opportunities. Thus far, the everyday realities of migrants and their integration into the gendered processes on the job market have not been collected systematically. This is where Sara John begins her study by combining theoretical conceptions about gendering and ethnicizing on the job market. In a multidisciplinary approach, several entanglements surrounding the phenomenon ‘ethnicized labor’ are taken into account. These entanglements keep gaining importance and topicality against the backdrop of Germany as a country of immigration.
System Analysis and Risk Assessment System (SARA), Version 4.0

International Nuclear Information System (INIS)

Russell, K.D.; Sattison, M.B.; Skinner, N.L.; Stewart, H.D.; Wood, S.T.

1992-02-01

This NUREG is the reference manual for the System Analysis and Risk Assessment (SARA) System Version 4.0, a microcomputer-based system used to analyze the safety issues of a family [i.e., a power plant, a manufacturing facility, any facility on which a probabilistic risk assessment (PRA) might be performed]. The SARA data base contains PRA data for the dominant accident sequences of a family and descriptive information about the family including event trees, fault trees, and system model diagrams. The number of facility data bases that can be accessed is limited only by the amount of disk storage available. To simulate changes to family systems, SARA users change the failure rates of initiating and basic events and/or modify the structure of the cut sets that make up the event trees, fault trees, and systems. The user then evaluates the effects of these changes through the recalculation of the resultant accident sequence probabilities and importance measures. The results are displayed in tables and graphs

Konflik SARA pada Pilkada DKI Jakarta di Grup WhatsApp dengan Anggota Multikultural

Directory of Open Access Journals (Sweden)

Tiara Kharisma

2017-12-01

Full Text Available Keanekaragaman SARA di Indonesia melahirkan masyarakat multikultural. Dalam kehidupannya, komunikasi antarbudaya tidak dapat dihindarkan. Salah satu medium dalam melakukan komunikasi antarbudaya adalah media sosial. Pada masyarakat multikultural isu SARA menjadi faktor utama penyebab terjadinya konflik. Di Pilkada DKI Jakarta 2017, isu SARA di grup WhatsApp marak menyebar termasuk anggota grup yang heterogen. Penelitian ini bertujuan untuk mengetahui pengelolaan konflik isu SARA pada Pilkada DKI Jakarta 2017 di grup WhatsApp dengan anggota multikultural. Penelitian ini menggunakan pendekatan kualitatif dengan teknik pengumpulan data melalui wawancara dan studi literatur. Dalam membahas penelitian ini, peneliti menggunakan kerangka teori manajemen konflik dari Martin, J. N. dan Nakayama. Hasil penelitian menunjukkan bahwa konflik terjadi karena ada anggota grup menyampaikan pesan bukan berangkat dari kesamaan anggota grup, yakni kepentingan dan tujuan awal dibentuknya grup. Pesan disebarkan dengan menganggap wujud pembelaan terhadap suatu agama. Ketika konflik terjadi, strategi pengelolaan konflik yang diterapkan adalah strategi mengompromikan (compromising dan menghindar (avoiding. Dalam grup terdapat anggota yang berperan sebagai cultural brokers.
System Analysis and Risk Assessment (SARA) system

International Nuclear Information System (INIS)

Krantz, E.A.; Russell, K.D.; Stewart, H.D.; Van Siclen, V.S.

1986-01-01

Utilization of Probabilistic Risk Assessment (PRA) related information in the day-to-day operation of plant systems has, in the past, been impracticable due to the size of the computers needed to run PRA codes. This paper discusses a microcomputer-based database system which can greatly enhance the capability of operators or regulators to incorporate PRA methodologies into their routine decision making. This system is called the System Analysis and Risk Assessment (SARA) system. SARA was developed by EG and G Idaho, Inc. at the Idaho National Engineering Laboratory to facilitate the study of frequency and consequence analyses of accident sequences from a large number of light water reactors (LWRs) in this country. This information is being amassed by several studies sponsored by the United States Nuclear Regulatory Commission (USNRC). To meet the need of portability and accessibility, and to perform the variety of calculations necessary, it was felt that a microcomputer-based system would be most suitable
2015 Cataloging Hidden Special Collections and Archives Unconference and Symposium: Innovation, Collaboration, and Models. Proceedings of the CLIR Cataloging Hidden Special Collections and Archives Symposium (Philadelphia, Pennsylvania, March 12-13, 2015)

Science.gov (United States)

Oestreicher, Cheryl, Ed.

2015-01-01

The 2015 CLIR Unconference & Symposium was the capstone event to seven years of grant funding through CLIR's Cataloging Hidden Special Collections and Archives program. These proceedings group presentations by theme. Collaborations provides examples of multi-institutional projects, including one international collaboration; Student and Faculty…
Concurrent software system design supported by SARA at the age of one

Energy Technology Data Exchange (ETDEWEB)

Campos, I.M.; Estrin, G.

A multilevel modeling method suitable for the design of concurrent hardware or software systems is presented. The methodology is requirement driven and uses tools incorporated in a programming system called SARA (Systems ARchitect's Apprentice). Both top-down refinement and bottom-up abstraction are supported. The design of an asynchronous sender-receiver illustrates the key steps in going smoothly from programing in the large to programing in the small or actual code. The same methodology can be used to design hardware systems by applying different pragmatics from those proposed for software systems. SARA consists of a set of interactive tools implemented both at UCLA and also on the MIT-Multics system. Although SARA continues in long-term development, completed design tools are accessible for experimentation by authorized users at either location via the ARPANET. 9 figures, 2 tables.
Innovative Stormwater Quality Tools by SARA for Holistic Watershed Master Planning

Science.gov (United States)

Thomas, S. M.; Su, Y. C.; Hummel, P. R.

2016-12-01

Stormwater management strategies such as Best Management Practices (BMP) and Low-Impact Development (LID) have increasingly gained attention in urban runoff control, becoming vital to holistic watershed master plans. These strategies can help address existing water quality impairments and support regulatory compliance, as well as guide planning and management of future development when substantial population growth and urbanization is projected to occur. However, past efforts have been limited to qualitative planning due to the lack of suitable tools to conduct quantitative assessment. The San Antonio River Authority (SARA), with the assistance of Lockwood, Andrews & Newnam, Inc. (LAN) and AQUA TERRA Consultants (a division of RESPEC), developed comprehensive hydrodynamic and water quality models using the Hydrological Simulation Program-FORTRAN (HSPF) for several urban watersheds in the San Antonio River Basin. These models enabled watershed management to look at water quality issues on a more refined temporal and spatial scale than the limited monitoring data. They also provided a means to locate and quantify potential water quality impairments and evaluate the effects of mitigation measures. To support the models, a suite of software tools were developed. including: 1) SARA Timeseries Utility Tool for managing and processing of large model timeseries files, 2) SARA Load Reduction Tool to determine load reductions needed to achieve screening levels for each modeled constituent on a sub-basin basis, and 3) SARA Enhanced BMP Tool to determine the optimal combination of BMP types and units needed to achieve the required load reductions. Using these SARA models and tools, water quality agencies and stormwater professionals can determine the optimal combinations of BMP/LID to accomplish their goals and save substantial stormwater infrastructure and management costs. The tools can also help regulators and permittees evaluate the feasibility of achieving compliance
SARAS MEASUREMENT OF THE RADIO BACKGROUND AT LONG WAVELENGTHS

International Nuclear Information System (INIS)

Patra, Nipanjana; Subrahmanyan, Ravi; Sethi, Shiv; Shankar, N. Udaya; Raghunathan, A.

2015-01-01

SARAS is a correlation spectrometer connected to a frequency independent antenna that is purpose-designed for precision measurements of the radio background at long wavelengths. The design, calibration, and observing strategies admit solutions for the internal additive contributions to the radiometer response, and hence a separation of these contaminants from the antenna temperature. We present here a wideband measurement of the radio sky spectrum by SARAS that provides an accurate measurement of the absolute brightness and spectral index between 110 and 175 MHz. Accuracy in the measurement of absolute sky brightness is limited by systematic errors of magnitude 1.2%; errors in calibration and in the joint estimation of sky and system model parameters are relatively smaller. We use this wide-angle measurement of the sky brightness using the precision wide-band dipole antenna to provide an improved absolute calibration for the 150 MHz all-sky map of Landecker and Wielebinski: subtracting an offset of 21.4 K and scaling by a factor of 1.05 will reduce the overall offset error to 8 K (from 50 K) and scale error to 0.8% (from 5%). The SARAS measurement of the temperature spectral index is in the range −2.3 to −2.45 in the 110–175 MHz band and indicates that the region toward the Galactic bulge has a relatively flatter index
Mengukur Politisasi Agama dalam Ruang Publik: Komunikasi SARA dalam Perdebatan Rational Choice Theory

Directory of Open Access Journals (Sweden)

Mohammad Supriyadi

2015-12-01

Full Text Available Tulisan ini memberikan gambaran runtuhnya pengaruh isu primordialisme di ruang publik dan digantikan dengan kearifan konvensional. Penelitian ini mengambil aspek pengaruh isu SARA pada aspek rasionalitas pemilih. Penulis menemukan beberapa aspek yang mendukung kesimpulan penelitian, antara lain; bahwa isu SARA tidak terlalu direspek pemilih rasional. Pemilih rasional lebih melihat masalah yang ada dan mengevaluasi kinerja pemerintahan sebelumnya. Di lain pihak, emosi antusias terhadap isu etnisitas akan memantabkan pilihan politik terhadap pemilih etnis minoritas, sebagai bentuk penguatan komunitas. Dengan menggunakan pendekatan teori pilihan rasional (rational choice theory, penulis melihat bahwa komunikasi politik yang dibangun melalui isu SARA di ruang publik dalam kehidupan masyarakat modern, tidak lagi mampu memengaruhi pemilih rasional. Pemilih rasional (rational choice, menentukan pilihan berdasarkan pada keuntungan yang diperolehnya (maximizing benefit. Dalam faktor ini sikap pemilih lebih dipengaruhi karakteristik dan track record kandidat.
NCBI nr-aa BLAST: CBRC-SARA-01-1488 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-SARA-01-1488 ref|ZP_01187451.1| conserved hypothetical protein [Bacillus weihenstep...hanensis KBAB4] gb|EAR73176.1| conserved hypothetical protein [Bacillus weihenstephanensis KBAB4] ZP_01187451.1 0.78 25% ...
NCBI nr-aa BLAST: CBRC-SARA-01-1089 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-SARA-01-1089 ref|ZP_00518636.1| Major facilitator superfamily [Crocosphaera watson...ii WH 8501] gb|EAM48279.1| Major facilitator superfamily [Crocosphaera watsonii WH 8501] ZP_00518636.1 1.3 32% ...
NCBI nr-aa BLAST: CBRC-SARA-01-0489 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-SARA-01-0489 ref|ZP_01035526.1| exopolysaccharide biosynthesis domain protein [Rose...ovarius sp. 217] gb|EAQ25691.1| exopolysaccharide biosynthesis domain protein [Roseovarius sp. 217] ZP_01035526.1 1.0 26% ...
NCBI nr-aa BLAST: CBRC-SARA-01-1419 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-SARA-01-1419 ref|YP_101126.1| hypothetical protein BF3850 [Bacteroides fragili...s YCH46] dbj|BAD50592.1| hypothetical protein [Bacteroides fragilis YCH46] YP_101126.1 5e-09 92% ...
NCBI nr-aa BLAST: CBRC-SARA-01-0522 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-SARA-01-0522 ref|YP_001499570.1| Peptidyl-tRNA hydrolase [Rickettsia massiliae... MTU5] gb|ABV85023.1| Peptidyl-tRNA hydrolase [Rickettsia massiliae MTU5] YP_001499570.1 4.7 36% ...
NCBI nr-aa BLAST: CBRC-SARA-01-0900 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-SARA-01-0900 ref|YP_898010.1| phosphatidylserine synthase [Francisella tularen...sis subsp. novicida U112] gb|ABK89256.1| phosphatidylserine synthase [Francisella tularensis subsp. novicida U112] YP_898010.1 3.0 27% ...
NCBI nr-aa BLAST: CBRC-SARA-01-0144 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-SARA-01-0144 ref|YP_438659.1| alcohol dehydrogenase, zinc-containing [Burkholderia thailand...ensis E264] gb|ABC35120.1| alcohol dehydrogenase, zinc-containing [Burkholderia thailandensis E264] YP_438659.1 0.69 35% ...
NCBI nr-aa BLAST: CBRC-SARA-01-1967 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-SARA-01-1967 ref|ZP_00370594.1| Predicted DNA repair exonuclease [Campylobacter upsaliens...is RM3195] gb|EAL53370.1| Predicted DNA repair exonuclease [Campylobacter upsaliensis RM3195] ZP_00370594.1 0.047 31% ...
NCBI nr-aa BLAST: CBRC-SARA-01-1753 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-SARA-01-1753 ref|YP_001476411.1| amino acid permease-associated region [Serratia proteam...aculans 568] gb|ABV39283.1| amino acid permease-associated region [Serratia proteamaculans 568] YP_001476411.1 0.83 35% ...
NCBI nr-aa BLAST: CBRC-SARA-01-1309 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-SARA-01-1309 ref|YP_001125845.1| hypothetical protein GTNG_1736 [Geobacillus thermoden...itrificans NG80-2] gb|ABO67100.1| Conserved hypothetical protein [Geobacillus thermodenitrificans NG80-2] YP_001125845.1 0.47 23% ...
NCBI nr-aa BLAST: CBRC-SARA-01-0488 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-SARA-01-0488 ref|YP_064024.1| sulfate permease (SulP) [Desulfotalea psychrophi...la LSv54] emb|CAG35017.1| probable sulfate permease (SulP) [Desulfotalea psychrophila LSv54] YP_064024.1 6.1 37% ...
NCBI nr-aa BLAST: CBRC-SARA-01-0771 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-SARA-01-0771 ref|NP_001029253.1| progestin and adipoQ receptor family member V...II [Rattus norvegicus] gb|AAY67652.1| progestin membrane receptor alpha [Rattus norvegicus] NP_001029253.1 1e-167 82% ...
NCBI nr-aa BLAST: CBRC-SARA-01-1323 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-SARA-01-1323 ref|NP_001008277.1| rhodopsin [Canis lupus familiaris] ref|XP_855...608.1| PREDICTED: rhodopsin [Canis familiaris] emb|CAA70209.1| unnamed protein product [Canis familiaris] NP_001008277.1 2e-62 94% ...

NCBI nr-aa BLAST: CBRC-SARA-01-0322 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-SARA-01-0322 ref|ZP_01459778.1| conserved hypothetical protein [Stigmatella au...rantiaca DW4/3-1] gb|EAU69359.1| conserved hypothetical protein [Stigmatella aurantiaca DW4/3-1] ZP_01459778.1 5.2 34% ...
NCBI nr-aa BLAST: CBRC-SARA-01-1608 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-SARA-01-1608 ref|XP_513201.1| PREDICTED: cannabinoid receptor 2 (macrophage) i...soform 2 [Pan troglodytes] ref|XP_001166334.1| PREDICTED: cannabinoid receptor 2 (macrophage) isoform 1 [Pan troglodytes] XP_513201.1 1e-155 77% ...
NCBI nr-aa BLAST: CBRC-SARA-01-0256 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-SARA-01-0256 ref|ZP_00739965.1| Integral membrane protein [Bacillus thuringiensis serovar israel...ensis ATCC 35646] gb|EAO55770.1| Integral membrane protein [Bacillus thuringiensis serovar israelensis ATCC 35646] ZP_00739965.1 1.3 24% ...
NCBI nr-aa BLAST: CBRC-SARA-01-1099 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-SARA-01-1099 ref|YP_001337495.1| hypothetical protein KPN_03841 [Klebsiella pneumoniae subsp. pneumonia...e MGH 78578] gb|ABR79228.1| hypothetical protein KPN_03841 [Klebsiella pneumoniae subsp. pneumoniae MGH 78578] YP_001337495.1 0.93 29% ...
NCBI nr-aa BLAST: CBRC-SARA-01-0771 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-SARA-01-0771 ref|NP_001033642.1| progestin and adipoQ receptor family member V...II [Bos taurus] gb|AAI11285.1| Progestin and adipoQ receptor family member VII [Bos taurus] NP_001033642.1 1e-180 87% ...
Sociology of Hidden Curriculum

Directory of Open Access Journals (Sweden)

Alireza Moradi

2017-06-01

Full Text Available This paper reviews the concept of hidden curriculum in the sociological theories and wants to explain sociological aspects of formation of hidden curriculum. The main question concentrates on the theoretical approaches in which hidden curriculum is explained sociologically.For this purpose it was applied qualitative research methodology. The relevant data include various sociological concepts and theories of hidden curriculum collected by the documentary method. The study showed a set of rules, procedures, relationships and social structure of education have decisive role in the formation of hidden curriculum. A hidden curriculum reinforces by existed inequalities among learners (based on their social classes or statues. There is, in fact, a balance between the learner's "knowledge receptions" with their "inequality proportion".The hidden curriculum studies from different major sociological theories such as Functionalism, Marxism and critical theory, Symbolic internationalism and Feminism. According to the functionalist perspective a hidden curriculum has a social function because it transmits social values. Marxists and critical thinkers correlate between hidden curriculum and the totality of social structure. They depicts that curriculum prepares learners for the exploitation in the work markets. Symbolic internationalism rejects absolute hegemony of hidden curriculum on education and looks to the socialization as a result of interaction between learner and instructor. Feminism theory also considers hidden curriculum as a vehicle which legitimates gender stereotypes.
NCBI nr-aa BLAST: CBRC-SARA-01-1273 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-SARA-01-1273 ref|ZP_00367235.1| competence locus E (comE3), putative [Campylob...acter coli RM2228] gb|EAL57139.1| competence locus E (comE3), putative [Campylobacter coli RM2228] ZP_00367235.1 0.001 28% ...
NCBI nr-aa BLAST: CBRC-SARA-01-1804 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-SARA-01-1804 ref|ZP_00743402.1| Sensory box/GGDEF family protein [Bacillus thuringiensis serovar israel...ensis ATCC 35646] gb|EAO52327.1| Sensory box/GGDEF family protein [Bacillus thuringiensis serovar israelensis ATCC 35646] ZP_00743402.1 0.20 36% ...
NCBI nr-aa BLAST: CBRC-SARA-01-1746 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-SARA-01-1746 ref|NP_001100989.1| non imprinted in Prader-Willi/Angelman syndro...me 1 homolog [Rattus norvegicus] gb|EDL86455.1| non imprinted in Prader-Willi/Angelman syndrome 1 homolog (human) (predicted) [Rattus norvegicus] NP_001100989.1 1e-113 80% ...
NCBI nr-aa BLAST: CBRC-SARA-01-1578 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-SARA-01-1578 ref|NP_001077100.1| cOR52N9 olfactory receptor family 52 subfamily N-like [Canis lupus... familiaris] gb|ABO36681.1| 52N9 olfactory receptor protein [Canis lupus familiaris] NP_001077100.1 1e-146 78% ...
Reactivity of Athabasca residue and of its SARA fractions during residue hydroconversion

Energy Technology Data Exchange (ETDEWEB)

Verstraete, J.; Danial-Fortain, P.; Gauthier, T.; Merdrignac, I. [IFP-Lyon, Vermaison (France); Budzinski, H. [Bordeaux Univ. (France). ISM-LPTC, UMR CNRS

2009-07-01

Residue conversion processes are becoming increasingly important because of the declining market for residual fuel oil and a greater demand for middle distillates. Ebullated-bed hydroconversion is a commercially proven technology for converting heavy feedstocks with high amounts of impurities. The process enables the conversion of atmospheric or vacuum residues at temperatures up to 440 degrees C, and at liquid hourly space velocity (LHSV) conditions in the range of 0.15 to 0.5 per hour. A 540 degrees C conversion of up to 80 weight per cent can be achieved under these conditions. This paper reported on a research study conducted at IFP Lyon in which the residue hydroconversion in a large-scale ebullated bed bench unit was investigated to determine the impact of operating conditions and feed properties on yield and product qualities. Hydrogen was added to the feed in the bench units to keep a high hydrogen partial pressure and favour the catalytic hydroconversion reactions. In a typical test, the reactor was fed with 50 g of feedstock and 0.45 g of crushed equilibrium industrial NiMo catalyst, pressurized hydrogen and quickly heated at the reaction temperature. This paper also discussed the conversion of Athabasca bitumen residue in the large-scale pilot plant and also in the small scale batch reactor. The effect of operating temperature and space velocity was examined. The reactivity of the saturates, aromatics, resins and asphaltenes (SARA) fractions of the bitumen was studied separately in order to better understand the conversion mechanisms and reactivities. The Athabasca bitumen feed and SARA fractions were also analyzed in terms of standard petroleum analysis, SARA fractionation, elemental analysis, size exclusion chromatography (SEC) and 13C NMR. Hydroconversion experiments were conducted in the batch unit at different reaction temperatures and reaction times. A comparison of small-scale batch results with those obtained with the continuous large-scale bench
Calculations for the design and modification of the 2 cyclotrons of S.A.R.A

International Nuclear Information System (INIS)

Albrand, P.S.; Belmont, J.L.; Ripouteau, F.

1983-09-01

S.A.R.A. is a heavy ion accelerator constituted by 2 cyclotrons. The second cyclotron (post-accelerator) was entirely calculated at the I.S.N. The pole tips of the first cyclotron which is much older, have recently been modified. An almost identical procedure was used for the calculation of each element of the post-accelerator of S.A.R.A. and also for the modifications to the first cyclotron
Inhibition of transforming growth factor-beta1-induced signaling and epithelial-to-mesenchymal transition by the Smad-binding peptide aptamer Trx-SARA.

Science.gov (United States)

Zhao, Bryan M; Hoffmann, F Michael

2006-09-01

Overexpression of the inhibitory Smad, Smad7, is used frequently to implicate the Smad pathway in cellular responses to transforming growth factor beta (TGF-beta) signaling; however, Smad7 regulates several other proteins, including Cdc42, p38MAPK, and beta-catenin. We report an alternative approach for more specifically disrupting Smad-dependent signaling using a peptide aptamer, Trx-SARA, which comprises a rigid scaffold, the Escherichia coli thioredoxin A protein (Trx), displaying a constrained 56-amino acid Smad-binding motif from the Smad anchor for receptor activation (SARA) protein. Trx-SARA bound specifically to Smad2 and Smad3 and inhibited both TGF-beta-induced reporter gene expression and epithelial-to-mesenchymal transition in NMuMG murine mammary epithelial cells. In contrast to Smad7, Trx-SARA had no effect on the Smad2 or 3 phosphorylation levels induced by TGF-beta1. Trx-SARA was primarily localized to the nucleus and perturbed the normal cytoplasmic localization of Smad2 and 3 to a nuclear localization in the absence of TGF-beta1, consistent with reduced Smad nuclear export. The key mode of action of Trx-SARA was to reduce the level of Smad2 and Smad3 in complex with Smad4 after TGF-beta1 stimulation, a mechanism of action consistent with the preferential binding of SARA to monomeric Smad protein and Trx-SARA-mediated disruption of active Smad complexes.
NCBI nr-aa BLAST: CBRC-SARA-01-1488 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-SARA-01-1488 ref|YP_001474562.1| DNA internalization-related competence protei...n ComEC/Rec2 [Shewanella sediminis HAW-EB3] gb|ABV37434.1| DNA internalization-related competence protein ComEC/Rec2 [Shewanella sediminis HAW-EB3] YP_001474562.1 1.7 33% ...
The SARA Consortium: Providing Undergraduate Access to a 0.9-m Telescope at Kitt Peak National Observatory

Science.gov (United States)

Wood, M. A.

2003-12-01

The Southeastern Research for Astronomy (SARA) operates a 0.9-m telescope at Kitt Peak National Observatory (KPNO). The member institutions are Florida Institute of Technology, East Tennessee State University, Florida International University, The University of Georgia at Athens, Valdosta State University, and Clemson University. The NSF awarded the KPNO #1 0.9-m telescope to the SARA Consortium in 1990. We built a new facility and began routine on-site observations in 1995. We began routine remote observations in 1999 using VNC to export the telescope and CCD control screens, and a web-cam in the dome to provide critical visual feedback on the status of the telescope and dome. The mission of the SARA Consortium is to foster astronomical research and education in the Southeastern United States. Although only two of the member institutions have no graduate programs, all six have a strong emphasis on undergraduate research and education. By pooling our resources, we are able to operate a research-grade facility that none of the individual schools could manage by itself, and in the process we can offer our undergraduate students the opportunity to assist in our research projects as well as to complete their own independent research projects using a facility at a premier site. The SARA Consortium also hosts a NSF REU Summer Intern Program in Astronomy, in which we support 11-12 students that work one-on-one with a SARA faculty mentor. Most of these interns are selected from primarily undergraduate institutions, and have not had significant previous research experience. As part of the program, interns and mentors travel to KPNO for a 4-5 night observing run at the telescope. The SARA NSF REU Program is funded through NSF grant AST-0097616.
SarA is a negative regulator of Staphylococcus epidermidis biofilm formation

DEFF Research Database (Denmark)

Martin, Christer; Heinze, C.; Busch, M.

2012-01-01

Biofilm formation is essential for Staphylococcus epidermidis pathogenicity in implant-associated infections. Nonetheless, large proportions of invasive S. epidermidis isolates fail to show accumulative biofilm growth in vitro. We here tested the hypothesis that this apparent paradox is related...... virulence. Genetic analysis revealed that inactivation of sarA induced biofilm formation via over-expression of the giant 1 MDa extracellular matrix binding protein (Embp), serving as an intercellular adhesin. In addition to Embp, increased extracellular DNA (eDNA) release significantly contributed...... to biofilm formation in mutant 1585ΔsarA. Increased eDNA amounts indirectly resulted from up-regulation of metalloprotease SepA, leading to boosted processing of major autolysin AtlE, in turn inducing augmented autolysis and release of chromosomal DNA. Hence, this study identifies sarA as a negative...
NCBI nr-aa BLAST: CBRC-SARA-01-0756 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-SARA-01-0756 gb|AAW70053.1| MRGX2 [Homo sapiens] gb|AAW70054.1| MRGX2 [Homo sapiens...] gb|AAW70055.1| MRGX2 [Homo sapiens] gb|AAW70070.1| MRGX2 [Homo sapiens] gb|AAW70083.1| MRGX2 [Homo sapiens] AAW70053.1 1e-66 52% ...
NCBI nr-aa BLAST: CBRC-SARA-01-1400 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-SARA-01-1400 gb|AAW70053.1| MRGX2 [Homo sapiens] gb|AAW70054.1| MRGX2 [Homo sapiens...] gb|AAW70055.1| MRGX2 [Homo sapiens] gb|AAW70070.1| MRGX2 [Homo sapiens] gb|AAW70083.1| MRGX2 [Homo sapiens] AAW70053.1 4e-34 52% ...
NCBI nr-aa BLAST: CBRC-SARA-01-0472 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-SARA-01-0472 sp|Q8NH41|OR4KF_HUMAN Olfactory receptor 4K15 dbj|BAC05798.1| sev...en transmembrane helix receptor [Homo sapiens] gb|EAW66492.1| olfactory receptor, family 4, subfamily K, member 15 [Homo sapiens] Q8NH41 1e-164 89% ...
NCBI nr-aa BLAST: CBRC-SARA-01-1206 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-SARA-01-1206 sp|Q8NH41|OR4KF_HUMAN Olfactory receptor 4K15 dbj|BAC05798.1| sev...en transmembrane helix receptor [Homo sapiens] gb|EAW66492.1| olfactory receptor, family 4, subfamily K, member 15 [Homo sapiens] Q8NH41 1e-40 85% ...

PLS models for determination of SARA analysis of Colombian vacuum residues and molecular distillation fractions using MIR-ATR

Directory of Open Access Journals (Sweden)

Jorge A. Orrego-Ruiz

2014-06-01

Full Text Available In this work, prediction models of Saturates, Aromatics, Resins and Asphaltenes fractions (SARA from thirty-seven vacuum residues of representative Colombian crudes and eighteen fractions of molecular distillation process were obtained. Mid-Infrared (MIR Attenuated Total Reflection (ATR spectroscopy in combination with partial least squares (PLS regression analysis was used to estimate accurately SARA analysis in these kind of samples. Calibration coefficients of prediction models were for saturates, aromatics, resins and asphaltenes fractions, 0.99, 0.96, 0.97 and 0.99, respectively. This methodology permits to control the molecular distillation process since small differences in chemical composition can be detected. Total time elapsed to give the SARA analysis per sample is 10 minutes.
NCBI nr-aa BLAST: CBRC-SARA-01-1746 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-SARA-01-1746 ref|NP_653200.2| non-imprinted in Prader-Willi/Angelman syndrome ...1 [Homo sapiens] sp|Q7RTP0|NIPA1_HUMAN Non-imprinted in Prader-Willi/Angelman syndrome region protein 1 tpg|...DAA01477.1| TPA_exp: non-imprinted in Prader-Willi/Angelman syndrome 1 [Homo sapiens] NP_653200.2 1e-113 81% ...
The Remote Observatories of the Southeastern Association for Research in Astronomy (SARA)

Science.gov (United States)

Keel, William C.; Oswalt, Terry; Mack, Peter; Henson, Gary; Hillwig, Todd; Batcheldor, Daniel; Berrington, Robert; De Pree, Chris; Hartmann, Dieter; Leake, Martha; Licandro, Javier; Murphy, Brian; Webb, James; Wood, Matt A.

2017-01-01

We describe the remote facilities operated by the Southeastern Association for Research in Astronomy (SARA) , a consortium of colleges and universities in the US partnered with Lowell Observatory, the Chilean National Telescope Allocation Committee, and the Instituto de Astrofísica de Canarias. SARA observatories comprise a 0.96 m telescope at Kitt Peak, Arizona; one of 0.6 m aperture on Cerro Tololo, Chile; and the 1 m Jacobus Kapteyn Telescope at the Roque de los Muchachos, La Palma, Spain. All are operated using standard VNC or Radmin protocols communicating with on-site PCs. Remote operation offers considerable flexibility in scheduling, allowing long-term observational cadences difficult to achieve with classical observing at remote facilities, as well as obvious travel savings. Multiple observers at different locations can share a telescope for training, educational use, or collaborative research programs. Each telescope has a CCD system for optical imaging, using thermoelectric cooling to avoid the need for frequent local service, and a second CCD for offset guiding. The Arizona and Chile telescopes also have fiber-fed echelle spectrographs. Switching between imaging and spectroscopy is very rapid, so a night can easily accommodate mixed observing modes. We present some sample observational programs. For the benefit of other groups organizing similar consortia, we describe the operating structure and principles of SARA, as well as some lessons learned from almost 20 years of remote operations.
DETERMINACIÓN DE LAS FRACCIONES SARA DE ASFALTOS COLOMBIANOS ENVEJECIDOS AL MEDIO AMBIENTE EMPLEANDO CROMATOGRAFÍA LÍQUIDA EN COLUMNA DETERMINAÇÃO DAS FRAÇÕES SARA DE ASFALTOS COLOMBIANOS ENVELHECIDOS AO MÉDIO AMBIENTE EMPREGANDO CROMATOGRAFIA LÍQUIDA EM COLUNA DETERMINATION OF SARA FRACTIONS OF ENVIRONMENTALLY AGED COLOMBIAN ASPHALTS USING LIQUID CHROMATOGRAPHY COLUMN

Directory of Open Access Journals (Sweden)

Fredy Alberto Reyes

2012-06-01

Full Text Available En este artículo presentamos un método basado en cromatografía líquida en columna para cuantificar la composición química de los cementos asfálticos fabricados en Colombia, sometidos al medio ambiente, mediante la determinación de las fracciones SARA. El método fue aplicado sobre películas de asfalto 60/70 y 80/100 para determinar los cambios en la composición química del material luego de ser expuesto durante 12 meses a las condiciones de intemperie de la ciudad de Bogotá; los ensayos de SARA fueron efectuados para el asfalto original a 1, 3, 6, 9 y 12 meses respectivamente. Los fraccionamientos SARA evidenciaron que el envejecimiento produjo una disminución de la fracción de aromáticos y un incremento en la de asfaltenos respecto al asfalto no envejecido. La disminución de los compuestos aromáticos y de resinas pudo ser responsable del endurecimiento observado en los asfaltos, que presentaron una consistencia dura y quebradiza, lo que está de acuerdo con la obtención de índices coloidales elevados. El método empleado permitió establecer correlaciones entre la composición química del asfalto y sus propiedades mecánicas.Neste artigo apresentamos um método baseado em cromatografia líquida em coluna para quantificar a composição química dos cimentos asfálticos fabricados em Colômbia, submetidos ao médio ambiente, mediante a determinação das frações SARA. O método foi aplicado sobre películas de asfalto 60/70 e 80/100 para determinar as mudanças na composição química do material depois de ser exposto durante 12 meses às condições de intempérie da cidade de Bogotá; os ensaios de SARA foram efetuados para o asfalto original a 1, 3, 6, 9 e 12 meses respectivamente. Os fraccionamentos SARA evidenciaram que o envelhecimento produziu uma diminuição da fração de aromáticos e um incremento na de asfaltenos com respeito ao asfalto não envelhecido. A diminuição dos compostos aromáticos e de resinas p
Hemolytic disease of the fetus and newborn caused by an antibody to a low-prevalence antigen, anti-SARA.

Science.gov (United States)

Towns, Dale; Hannon, Judith; Hendry, Julia; Barnes, Janet; Goldman, Mindy

2011-09-01

The first case describing the SARAH (SARA) antigen occurred in 1990, in an Australian blood donor. Hemolytic disease of the fetus and newborn (HDFN) due to anti-SARA has not been previously described. We report a case of HDFN in a multiparous female. The pregnancy was unremarkable except that she was involved in a seemingly minor motor vehicle accident at 25 weeks' gestation. Routine prenatal antibody screening was negative throughout the pregnancy. She presented at 37 weeks' gestation because of decreased fetal movements. Labor was induced and a 2702-g infant male was delivered. The infant's hemoglobin was 49 g/L and the bilirubin was 153 µmol/L. Blood samples from the parents and infant were referred to Canadian Blood Services National Immunohematology Reference Laboratory and subsequently to the Australian Red Cross Red Cell Reference Service. The father's and infant's red blood cells were confirmed to be SARA positive, and the mother's plasma contained anti-SARA. The infant was successfully treated with a double-volume exchange transfusion. This is the first example of HDFN associated with this antibody. © 2011 American Association of Blood Banks.
Staphylococcus aureus Quorum Regulator SarA Targeted Compound, 2-[(Methylaminomethyl]phenol Inhibits Biofilm and Down-Regulates Virulence Genes

Directory of Open Access Journals (Sweden)

P. Balamurugan

2017-07-01

Full Text Available Staphylococcus aureus is a widely acknowledged Gram-positive pathogen for forming biofilm and virulence gene expressions by quorum sensing (QS, a cell to cell communication process. The quorum regulator SarA of S. aureus up-regulates the expression of many virulence factors including biofilm formation to mediate pathogenesis and evasion of the host immune system in the late phases of growth. Thus, inhibiting the production or blocking SarA protein might influence the down-regulation of biofilm and virulence factors. In this context, here we have synthesized 2-[(Methylaminomethyl]phenol, which was specifically targeted toward the quorum regulator SarA through in silico approach in our previous study. The molecule has been evaluated in vitro to validate its antibiofilm activity against clinical S. aureus strains. In addition, antivirulence properties of the inhibitor were confirmed with the observation of a significant reduction in the expression of representative virulence genes like fnbA, hla and hld that are governed under S. aureus QS. Interestingly, the SarA targeted inhibitor showed negligible antimicrobial activity and markedly reduced the minimum inhibitory concentration of conventional antibiotics when used in combination making it a more attractive lead for further clinical tests.
Indicators of induced subacute ruminal acidosis (SARA) in Danish Holstein cows

DEFF Research Database (Denmark)

Danscher, Anne Mette; Li, Shucong; Andersen, Pia H.

2015-01-01

BACKGROUND: The prevalence of subacute ruminal acidosis (SARA) in dairy cows is high with large impact on economy and welfare. Its current field diagnosis is based on point ruminal pH measurements by oral probe or rumenocentesis. These techniques are invasive and inaccurate, and better markers fo...
Transferring generic SARA/OSHA training to US Department of Energy facilities

International Nuclear Information System (INIS)

White, A.; McKinley, T.

1989-01-01

The Technical Resources and Training Section staff at Oak Ridge National Laboratory have developed three extensive training programs for hazardous waste treatment, storage, and disposal facility workers a required by SARA/OSHA, 29 CFR 1910.120. The ORNL program is widely recognized as one of the best in the DOE system. ORNL and ORAU, who manages the Training Resources and Data Exchange (TRADE) network for DOE, entered into as cooperative relationship to respond to the many requests from DOE contractors for copies of the ORNL training materials. This discussion will describe the ORNL program and the process of turning it into a series of generic tools which can be used by additional DOE facilities to meet the training requirements established by SARA/OSHA, 20 CFR 1910.120. The speakers will describe how the materials are being used by DOE facilities as well as plans for additional resources to be developed through TRADE. 5 refs
NCBI nr-aa BLAST: CBRC-SARA-01-1597 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-SARA-01-1597 sp|Q9XT58|ADRB3_SHEEP Beta-3 adrenergic receptor (Beta-3 adrenoce...ptor) (Beta-3 adrenoreceptor) gb|AAG31165.1|AF314202_1 beta 3 adrenergic receptor [Ovis aries] gb|AAG31167.1|AF314204_1 beta 3 adrene...rgic receptor [Ovis aries] gb|ABB71185.1| beta 3 adrenergic reecptor [Ovis aries] Q9XT58 1e-140 75% ...
A hidden history

OpenAIRE

Peppers, Emily

2008-01-01

The Cultural Collections Audit project began at the University of Edinburgh in 2004, searching for hidden treasures in its 'distributed heritage collections' across the university. The objects and collections recorded in the Audit ranged widely from fine art and furniture to historical scientific and teaching equipment and personalia relating to key figures in the university's long tradition of academic excellence. This information was gathered in order to create a central database of informa...
NCBI nr-aa BLAST: CBRC-SARA-01-0195 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-SARA-01-0195 ref|NP_036916.1| cannabinoid receptor 1 (brain) [Rattus norvegicu...s] sp|P20272|CNR1_RAT Cannabinoid receptor 1 (CB1) (CB-R) (Brain-type cannabinoid receptor) emb|CAA39332.1| CB1 cann...abinoid receptor [Rattus norvegicus] gb|AAA99067.1| neuronal cannabinoid receptor gb|EDL98589.1| cann...abinoid receptor 1 (brain) [Rattus norvegicus] prf||1613453A cannabinoid receptor NP_036916.1 0.0 97% ...
NCBI nr-aa BLAST: CBRC-SARA-01-1750 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-SARA-01-1750 gb|ABR53744.1| opsin 1 short-wavelength senstive protein [Daubentonia madagascar...iensis] gb|ABR53745.1| opsin 1 short-wavelength senstive protein [Daubentonia madagascariensi...s] gb|ABR53746.1| opsin 1 short-wavelength senstive protein [Daubentonia madagascariensis] gb|ABR53747.1| op...sin 1 short-wavelength senstive protein [Daubentonia madagascariensis] gb|ABR5374...8.1| opsin 1 short-wavelength senstive protein [Daubentonia madagascariensis] gb|ABR53749.1| opsin 1 short-w
Impact of the Regulators SigB, Rot, SarA and sarS on the Toxic Shock Tst Promoter and TSST-1 Expression in Staphylococcus aureus.

Directory of Open Access Journals (Sweden)

Diego O Andrey

Full Text Available Staphylococcus aureus is an important pathogen manifesting virulence through diverse disease forms, ranging from acute skin infections to life-threatening bacteremia or systemic toxic shock syndromes. In the latter case, the prototypical superantigen is TSST-1 (Toxic Shock Syndrome Toxin 1, encoded by tst(H, and carried on a mobile genetic element that is not present in all S. aureus strains. Transcriptional regulation of tst is only partially understood. In this study, we dissected the role of sarA, sarS (sarH1, RNAIII, rot, and the alternative stress sigma factor sigB (σB. By examining tst promoter regulation predominantly in the context of its native sequence within the SaPI1 pathogenicity island of strain RN4282, we discovered that σB emerged as a particularly important tst regulator. We did not detect a consensus σB site within the tst promoter, and thus the effect of σB is likely indirect. We found that σB strongly repressed the expression of the toxin via at least two distinct regulatory pathways dependent upon sarA and agr. Furthermore rot, a member of SarA family, was shown to repress tst expression when overexpressed, although its deletion had no consistent measurable effect. We could not find any detectable effect of sarS, either by deletion or overexpression, suggesting that this regulator plays a minimal role in TSST-1 expression except when combined with disruption of sarA. Collectively, our results extend our understanding of complex multifactorial regulation of tst, revealing several layers of negative regulation. In addition to environmental stimuli thought to impact TSST-1 production, these findings support a model whereby sporadic mutation in a few key negative regulators can profoundly affect and enhance TSST-1 expression.
Layering of life (Sara novel of Peter Sarić)

OpenAIRE

Kostić, Dragomir J.

2015-01-01

Novel Sara of Petar Sarić consists of two parts; in it are processed or present two wars, two major wars in the region of Montenegro and Herzegovina, the First and Second World War. However, it is more novel about divisions within the family and the man himself, (and infamous assault of godfather Luka on Sarah also and his murder are in that function), in the first part; and on the divisions among the people, in general, in the second part of the novel. The second part is, in fact, the image ...
NCBI nr-aa BLAST: CBRC-SARA-01-1608 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-SARA-01-1608 ref|NP_001832.1| cannabinoid receptor 2 (macrophage) [Homo sapien...s] sp|P34972|CNR2_HUMAN Cannabinoid receptor 2 (CB2) (CB-2) (CX5) emb|CAA52376.1| CB2 (peripheral) cannabino...id receptor [Homo sapiens] emb|CAD22548.1| peripheral cannabinoid receptor CB2 [Homo sapiens] emb|CAD22549.1| peripheral cann...abinoid receptor CB2 [Homo sapiens] gb|AAO92299.1| cannabinoid r...eceptor 2 [Homo sapiens] emb|CAI14799.1| cannabinoid receptor 2 (macrophage) [Homo sapiens] emb|CAJ42137.1| cann
Saras Cranes in Palwal District in Southern Haryana are Asking for Immediate Attention for Their Last Rescue Effort

Directory of Open Access Journals (Sweden)

Tirshem Kumar Kaushik

2015-05-01

Full Text Available Saras Cranes Grus antigone are endangered birds of open wetlands with highly worrying depletion trends being witnessed related with disappearance of marshy and shallow perennial, expansive wetlands throughout northern India. Alongside, massive hunting in 18th, 19th and 20th centuries and even today is another serious cause for their worrisome deterioration. Also, destruction of nests, eggs, fledglings and adults by aboriginals indeliberately or deliberately is causing these cranes to perish sooner than latter, completely. Now, Saras Cranes are found in limited number and domain as four populations in the entire world including India, China, Burma, South East Asia and northern Australia. The population of Indian Saras Crane is pitiably restricted to Etawa and Mainpuri districts of Uttar Pradesh. Stray birds of this species are restricted to Kanha National Park in Madhya Pradesh and in some parts of Gujarat and Assam. It is interesting to note that few pairs have been seen in Faridabad and Palwal districts in southern Haryana, India. These need to be protected and conserved.
Religious Tolerance in the Hidden Curriculum

Directory of Open Access Journals (Sweden)

Kevin Nobel Kurniawan

2018-03-01

Full Text Available Religious intolerance is spreading within the Indonesian institution of education. Previous studies have shown that the growth of intolerance is due to the state’s regulation and pedagogical apparatus. In contrast to the previous studies, I argue that the intolerance is related to hidden curriculum applied by the institution of education. Normatively, the hidden curriculum contains the value of religious tolerance. However, factually, the author found that there are practices of intolerance, through the formal and informal spheres in the school’s structure, within the hidden curriculum. This article applies a qualitative approach with a mixed method research strategy to analyze data collected from students, teachers, and alumnis through field observation, in-depth interview, and survey.
Women Empowerment in the Realms of Institutionalized Religion and Patriarchy: El Saadawi’s Firdaus and Yezierska’s Sara as Examples

Directory of Open Access Journals (Sweden)

Abdullah K. Shehabat

2016-09-01

Full Text Available This paper explains how the two protagonists, Firdaus and Sara, successfully paved their own ways in search of self-liberation despite the authoritarian patriarchy and institutionalized religions that plagued them. El Saadawi's Woman at Point Zero and Yezierska’s Bread Givers represent the fruitful struggle these protagonists experienced as they come to forge an identity and be themselves. The paper argues that the protagonists manage to free themselves, establish their own spiritual homes at their own homes and assert the potentials of their femininity despite their endings. Empowered by the powers of reading, strong will and meticulous work, the protagonists were able to realize their own material independence and achieve their lifelong ambitions. However, through Firdaus' and Sara's journeys of breaking their silence, they were subject to different patterns of self-annihilation. While Firdaus was sentenced to death for killing a pimp, Sara embraced living under the hegemony of an authoritarian husband.
The new species of Mysidacea (Crustacea), Anchialina labatus and Gastrosaccus sarae, from south west Australia

Digital Repository Service at National Institute of Oceanography (India)

Panampunnayil, S.U.

on the third segment of the mandibular palp and by the modification of the exopod of the third pleopod of the male. G. sarae is distinguished from the other species by the shape and armature of the telson...
Global Update and Trends of Hidden Hunger, 1995-2011: The Hidden Hunger Index.

Directory of Open Access Journals (Sweden)

Julie C Ruel-Bergeron

Full Text Available Deficiencies in essential vitamins and minerals-also termed hidden hunger-are pervasive and hold negative consequences for the cognitive and physical development of children.This analysis evaluates the change in hidden hunger over time in the form of one composite indicator-the Hidden Hunger Index (HHI-using an unweighted average of prevalence estimates from the Nutrition Impact Model Study for anemia due to iron deficiency, vitamin A deficiency, and stunting (used as a proxy indicator for zinc deficiency. Net changes from 1995-2011 and population weighted regional means for various time periods are measured.Globally, hidden hunger improved (-6.7 net change in HHI from 1995-2011. Africa was the only region to see a deterioration in hidden hunger (+1.9 over the studied time period; East Asia and the Pacific performed exceptionally well (-13.0, while other regions improved only slightly. Improvements in HHI were mostly due to reductions in zinc and vitamin A deficiencies, while anemia due to iron deficiency persisted and even increased.This analysis is critical for informing and tracking the impact of policy and programmatic efforts to reduce micronutrient deficiencies, to advance the global nutrition agenda, and to achieve the Millennium Development Goals (MDGs. However, there remains an unmet need to invest in gathering frequent, nationally representative, high-quality micronutrient data as we renew our efforts to scale up nutrition, and as we enter the post-2015 development agenda.Preparation of this manuscript was funded by Sight and Life. There was no funding involved in the study design, data collection, analysis, or decision to publish.

A simple blowdown code for SUPER-SARA loop conditions

International Nuclear Information System (INIS)

Fritz, G.

1981-01-01

The Super Sara test programme (SSTP) is aimed to study in pile the fuel and cluster behaviour under two types of accident conditions: - the ''Large break loss of coolant'' condition (LB-Loca), - the ''Severe fuel damage'' (SFD) in a boildown caused by a small break. BIVOL was developed for the LB-Loca situation. This code is made for a loop where essentially two volumes define the thermohydraulics during the blowdown. In the SUPERSARA loop these two volumes are represented by the hot leg and cold leg pipings together with the respective upper and lower plenum of the test section
NCBI nr-aa BLAST: CBRC-SARA-01-1691 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-SARA-01-1691 ref|NP_000854.1| 5-hydroxytryptamine (serotonin) receptor 1B [Hom...o sapiens] ref|NP_001009102.1| 5-hydroxytryptamine (serotonin) receptor 1B [Pan troglodytes] sp|P28222|5HT1B...HT-1B) (Serotonin receptor 1B) (5-HT1B) gb|AAA58675.1| serotonin 1Db receptor gb|AAA36029.1| serotonin recep...tor gb|AAA36030.1| 5-hyroxytryptamine 1D receptor dbj|BAA01763.1| serotonin 1B receptor [Homo sapiens] gb|AAA60316.1| serotonin... 1D receptor emb|CAB51537.1| 5-hydroxytryptamine (serotonin) r
NCBI nr-aa BLAST: CBRC-SARA-01-1942 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-SARA-01-1942 ref|NP_000669.1| alpha-1D-adrenergic receptor [Homo sapiens] sp|P...25100|ADA1D_HUMAN Alpha-1D adrenergic receptor (Alpha 1D-adrenoceptor) (Alpha 1D-adrenoreceptor) (Alpha-1A adrenergic... receptor) (Alpha adrenergic receptor 1a) gb|AAB60351.1| adrenergic alpha-1a receptor protein gb|AAB59487.1| alpha 1a/d adre...nergic receptor dbj|BAA06222.1| alpha1A/D adrenergic rec...eptor [Homo sapiens] emb|CAH70478.1| adrenergic, alpha-1D-, receptor [Homo sapiens] emb|CAC00601.2| adrenergic
Nuclear spectroscopy of exotic nuclei with the SARA/IGISOL facility

International Nuclear Information System (INIS)

Beraud, R.; Emsallem, A.; Astier, A.; Duffait, R.; Aerje, J.; Aeystoe, J.; Jauho, P.; Barneoud, D.; Genevey, J.; Gizon, A.

1995-01-01

Some recent decay studies of neutron-rich and proton-rich nuclei are presented for nuclear structure investigations far off the valley of stability. The experiments, carried out at SARA, are based either on charged particle-induced fission of 238 U or on HI-induced fusion-evaporation reactions in combination with the IGISOL technique. The basic principle of this latter is recalled together with its advantages and limitations. The spectroscopic results obtained in three different regions of the chart of nuclei are sketched. (authors). 30 refs., 7 figs
Microwave background constraints on mixing of photons with hidden photons

International Nuclear Information System (INIS)

Mirizzi, Alessandro; Redondo, Javier; Sigl, Guenter

2008-12-01

Various extensions of the Standard Model predict the existence of hidden photons kinetically mixing with the ordinary photon. This mixing leads to oscillations between photons and hidden photons, analogous to the observed oscillations between different neutrino flavors. In this context, we derive new bounds on the photon-hidden photon mixing parameters using the high precision cosmic microwave background spectral data collected by the Far Infrared Absolute Spectrophotometer instrument on board of the Cosmic Background Explorer. Requiring the distortions of the CMB induced by the photon-hidden photon mixing to be smaller than experimental upper limits, this leads to a bound on the mixing angle χ 0 -7 - 10 -5 for hidden photon masses between 10 -14 eV and 10 -7 eV. This low-mass and low-mixing region of the hidden photon parameter space was previously unconstrained. (orig.)
Systems Analysis Programs for Hands-on Integrated Reliability Evaluations (SAPHIRE), Version 5.0. Volume 5, Systems Analysis and Risk Assessment (SARA) tutorial manual

International Nuclear Information System (INIS)

Sattison, M.B.; Russell, K.D.; Skinner, N.L.

1994-07-01

The Systems Analysis Programs for Hands-on Integrated Reliability Evaluations (SAPHIRE) refers to a set of several microcomputer programs that were developed to create and analyze probabilistic risk assessments (PRAs) primarily for nuclear power plants. This volume is the tutorial manual for the Systems Analysis and Risk Assessment (SARA) System Version 5.0, a microcomputer-based system used to analyze the safety issues of a open-quotes familyclose quotes [i.e., a power plant, a manufacturing facility, any facility on which a probabilistic risk assessment (PRA) might be performed]. A series of lessons is provided that guides the user through some basic steps common to most analyses performed with SARA. The example problems presented in the lessons build on one another, and in combination, lead the user through all aspects of SARA sensitivity analysis capabilities
Hidden Liquidity

OpenAIRE

Cebiroglu, Gökhan; Horst, Ulrich

2012-01-01

We cross-sectionally analyze the presence of aggregated hidden depth and trade volume in the S&P 500 and identify its key determinants. We find that the spread is the main predictor for a stock’s hidden dimension, both in terms of traded and posted liquidity. Our findings moreover suggest that large hidden orders are associated with larger transaction costs, higher price impact and increased volatility. In particular, as large hidden orders fail to attract (latent) liquidity to the market, hi...
Global Update and Trends of Hidden Hunger, 1995-2011: The Hidden Hunger Index

Science.gov (United States)

Stevens, Gretchen A.; Ezzati, Majid; Black, Robert E.; Kraemer, Klaus

2015-01-01

Background Deficiencies in essential vitamins and minerals–also termed hidden hunger–are pervasive and hold negative consequences for the cognitive and physical development of children. Methods This analysis evaluates the change in hidden hunger over time in the form of one composite indicator–the Hidden Hunger Index (HHI)–using an unweighted average of prevalence estimates from the Nutrition Impact Model Study for anemia due to iron deficiency, vitamin A deficiency, and stunting (used as a proxy indicator for zinc deficiency). Net changes from 1995–2011 and population weighted regional means for various time periods are measured. Findings Globally, hidden hunger improved (-6.7 net change in HHI) from 1995–2011. Africa was the only region to see a deterioration in hidden hunger (+1.9) over the studied time period; East Asia and the Pacific performed exceptionally well (-13.0), while other regions improved only slightly. Improvements in HHI were mostly due to reductions in zinc and vitamin A deficiencies, while anemia due to iron deficiency persisted and even increased. Interpretation This analysis is critical for informing and tracking the impact of policy and programmatic efforts to reduce micronutrient deficiencies, to advance the global nutrition agenda, and to achieve the Millennium Development Goals (MDGs). However, there remains an unmet need to invest in gathering frequent, nationally representative, high-quality micronutrient data as we renew our efforts to scale up nutrition, and as we enter the post-2015 development agenda. Funding Preparation of this manuscript was funded by Sight and Life. There was no funding involved in the study design, data collection, analysis, or decision to publish. PMID:26673631
Microwave background constraints on mixing of photons with hidden photons

Energy Technology Data Exchange (ETDEWEB)

Mirizzi, Alessandro [Max-Planck-Institut fuer Physik, Muenchen (Germany); Redondo, Javier [Deutsches Elektronen-Synchrotron (DESY), Hamburg (Germany); Sigl, Guenter [Hamburg Univ. (Germany). 2. Inst. fuer Theoretische Physik

2008-12-15

Various extensions of the Standard Model predict the existence of hidden photons kinetically mixing with the ordinary photon. This mixing leads to oscillations between photons and hidden photons, analogous to the observed oscillations between different neutrino flavors. In this context, we derive new bounds on the photon-hidden photon mixing parameters using the high precision cosmic microwave background spectral data collected by the Far Infrared Absolute Spectrophotometer instrument on board of the Cosmic Background Explorer. Requiring the distortions of the CMB induced by the photon-hidden photon mixing to be smaller than experimental upper limits, this leads to a bound on the mixing angle {chi}{sub 0} hidden photon masses between 10{sup -14} eV and 10{sup -7} eV. This low-mass and low-mixing region of the hidden photon parameter space was previously unconstrained. (orig.)
NCBI nr-aa BLAST: CBRC-SARA-01-0948 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-SARA-01-0948 ref|NP_473371.1| MAS-related GPR, member X2 [Homo sapiens] sp|Q96...LB1|MRGX2_HUMAN Mas-related G-protein coupled receptor member X2 gb|AAK91805.1| G protein-coupled receptor [Homo sapiens...] dbj|BAB89339.1| putative G-protein coupled receptor [Homo sapiens] dbj|BAC06030.1| seven trans...membrane helix receptor [Homo sapiens] gb|AAH63450.1| MAS-related GPR, member X2 [Homo sapiens...] gb|AAW70056.1| MRGX2 [Homo sapiens] gb|AAW70057.1| MRGX2 [Homo sapiens] gb|AAW70058.1| MRGX2 [Homo sapiens
NCBI nr-aa BLAST: CBRC-SARA-01-1066 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-SARA-01-1066 ref|NP_473371.1| MAS-related GPR, member X2 [Homo sapiens] sp|Q96...LB1|MRGX2_HUMAN Mas-related G-protein coupled receptor member X2 gb|AAK91805.1| G protein-coupled receptor [Homo sapiens...] dbj|BAB89339.1| putative G-protein coupled receptor [Homo sapiens] dbj|BAC06030.1| seven trans...membrane helix receptor [Homo sapiens] gb|AAH63450.1| MAS-related GPR, member X2 [Homo sapiens...] gb|AAW70056.1| MRGX2 [Homo sapiens] gb|AAW70057.1| MRGX2 [Homo sapiens] gb|AAW70058.1| MRGX2 [Homo sapiens
NCBI nr-aa BLAST: CBRC-SARA-01-1746 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-SARA-01-1746 ref|NP_705806.1| non-imprinted in Prader-Willi/Angelman syndrome ...1 [Mus musculus] sp|Q8BHK1|NIPA1_MOUSE Non-imprinted in Prader-Willi/Angelman syndrome region protein 1 homo...protein product [Mus musculus] gb|AAH55828.1| Non imprinted in Prader-Willi/Angel...man syndrome 1 homolog (human) [Mus musculus] gb|EDL21870.1| non imprinted in Prader-Willi/Angelman syndrome 1 homolog (human) [Mus musculus] NP_705806.1 1e-113 81% ... ...log gb|AAM34534.1| non-imprinted in Prader-Willi/Angelman syndrome 1 [Mus musculus] dbj|BAC32809.1| unnamed
Reading, Laterality, and the Brain: Early Contributions on Reading Disabilities by Sara S. Sparrow

Science.gov (United States)

Fletcher, Jack M.; Morris, Robin D.

2014-01-01

Although best known for work with children and adults with intellectual disabilities and autism spectrum disorders, training in speech pathology and a doctorate in clinical psychology and neuropsychology was the foundation for Sara Sparrow's long-term interest in reading disabilities. Her first papers were on dyslexia and laterality, and the…
Lepidoptera, Nymphalidae, Heliconiinae, Heliconius sara apseudes (Hübner, 1813: Distribution extension

Directory of Open Access Journals (Sweden)

Iserhard, C. A.

2010-01-01

Full Text Available This work presents new records and extends the geographic distribution of Heliconius sara apseudes in theAtlantic Forest of the state of Rio Grande do Sul. Five new records were taken along butterfly inventories carried outbetween 2005 and 2010 in distinct phytophysiognomies at Rio Grande do Sul northeast region: Swamp Forest, AtlanticForest stricto sensu and Araucaria Moist Forest. The fact that all registers occurred in well preserved habitats of the AtlanticForest emphasizes the need of conservation of this biome in Rio Grande do Sul.
Multivariate longitudinal data analysis with mixed effects hidden Markov models.

Science.gov (United States)

Raffa, Jesse D; Dubin, Joel A

2015-09-01

Multiple longitudinal responses are often collected as a means to capture relevant features of the true outcome of interest, which is often hidden and not directly measurable. We outline an approach which models these multivariate longitudinal responses as generated from a hidden disease process. We propose a class of models which uses a hidden Markov model with separate but correlated random effects between multiple longitudinal responses. This approach was motivated by a smoking cessation clinical trial, where a bivariate longitudinal response involving both a continuous and a binomial response was collected for each participant to monitor smoking behavior. A Bayesian method using Markov chain Monte Carlo is used. Comparison of separate univariate response models to the bivariate response models was undertaken. Our methods are demonstrated on the smoking cessation clinical trial dataset, and properties of our approach are examined through extensive simulation studies. © 2015, The International Biometric Society.
Hidden measurements, hidden variables and the volume representation of transition probabilities

OpenAIRE

Oliynyk, Todd A.

2005-01-01

We construct, for any finite dimension $n$, a new hidden measurement model for quantum mechanics based on representing quantum transition probabilities by the volume of regions in projective Hilbert space. For $n=2$ our model is equivalent to the Aerts sphere model and serves as a generalization of it for dimensions $n \\geq 3$. We also show how to construct a hidden variables scheme based on hidden measurements and we discuss how joint distributions arise in our hidden variables scheme and th...
The staphylococcal accessory regulator, SarA, is an RNA-binding protein that modulates the mRNA turnover properties of late-exponential and stationary phase Staphylococcus aureus cells

Directory of Open Access Journals (Sweden)

John M Morrison

2012-03-01

Full Text Available The modulation of mRNA turnover is gaining recognition as a mechanism by which Staphylococcus aureus regulates gene expression, but the factors that orchestrate alterations in transcript degradation are poorly understood. In that regard, we previously found that 138 mRNA species, including the virulence factors protein A (spa and collagen binding protein (cna, are stabilized in a sarA-dependent manner during exponential phase growth, suggesting that SarA protein may directly or indirectly effect the RNA turnover properties of these transcripts. Herein, we expanded our characterization of the effects of sarA on mRNA turnover during late exponential and stationary phases of growth. Results revealed that the locus affects the RNA degradation properties of cells during both growth phases. Further, using gel mobility shift assays and RIP-ChIP, it was found that SarA protein is capable of binding mRNA species that it stabilizes both in vitro and within bacterial cells. Taken together, these results suggest that SarA post-transcriptionally regulates S. aureus gene expression in a manner that involves binding to and consequently altering the mRNA turnover properties of target transcripts.
Intravenous immunoglobulin in the management of a rare cause of hemolytic disease of the newborn: Anti-SARA antibodies.

Science.gov (United States)

Venkataraman, Rohini; Yusuf, Kamran

2017-01-01

Hemolytic disease of newborn (HDN) is a condition that develops in a fetus, when the IgG molecules produced by the mother pass through the placenta and attack the fetal red blood cells. HDN can occur due to Rh and ABO incompatibilities between the mother and the fetus as well as due to other allo-immune antibodies belonging to Kell (K and k), Duffy (Fya), Kidd (Jka and Jkb), and MNS (M, N, S, and s) systems. Role of intravenous immunoglobulin in management of HDN is not clear.SARA red blood cell antigen, first discovered in 1990 is a low frequency antigen. We report, a multiparous female whose pregnancy was complicated by HDN due to anti-SARA antibodies requiring both exchange transfusion and intravenous immunoglobulin. The response was sustained after intravenous immunoglobulin (IVIG) rather than after exchange transfusion.
Search for hidden Higgs decay in ATLAS detector

International Nuclear Information System (INIS)

Gabrielli, A.

2013-01-01

In this paper, a brief overview of the search for the Higgs boson in Hidden Valley models is given. Hidden Valley models predict Higgs decays to neutral particles, which can be also long lived with decay paths comparable to the LHC detectors dimensions. Decay final states consist of collimated leptons (Lepton Jets). Results are presented of a search for Higgs decays to long lived particles in the ATLAS detector at the LHC, based on 1.92 fb −1 data collected during 2011 at a 7TeV center-of-mass energy.
Severe accident recriticality analyses (SARA)

Energy Technology Data Exchange (ETDEWEB)

Frid, W. E-mail: wiktor.frid@ski.se; Hoejerup, F.; Lindholm, I.; Miettinen, J.; Nilsson, L.; Puska, E.K.; Sjoevall, H

2001-11-01

Recriticality in a BWR during reflooding of an overheated partly degraded core, i.e. with relocated control rods, has been studied for a total loss of electric power accident scenario. In order to assess the impact of recriticality on reactor safety, including accident management strategies, the following issues have been investigated in the SARA project: (1) the energy deposition in the fuel during super-prompt power burst; (2) the quasi steady-state reactor power following the initial power burst; and (3) containment response to elevated quasi steady-state reactor power. The approach was to use three computer codes and to further develop and adapt them for the task. The codes were SIMULATE-3K, APROS and RECRIT. Recriticality analyses were carried out for a number of selected reflooding transients for the Oskarshamn 3 plant in Sweden with SIMULATE-3K and for the Olkiluoto 1 plant in Finland with all three codes. The core initial and boundary conditions prior to recriticality have been studied with the severe accident codes SCDAP/RELAP5, MELCOR and MAAP4. The results of the analyses show that all three codes predict recriticality--both super-prompt power bursts and quasi steady-state power generation--for the range of parameters studied, i.e. with core uncovering and heat-up to maximum core temperatures of approximately 1800 K, and water flow rates of 45-2000 kg s{sup -1} injected into the downcomer. Since recriticality takes place in a small fraction of the core, the power densities are high, which results in large energy deposition in the fuel during power burst in some accident scenarios. The highest value, 418 cal g{sup -1}, was obtained with SIMULATE-3K for an Oskarshamn 3 case with reflooding rate of 2000 kg s{sup -1}. In most cases, however, the predicted energy deposition was smaller, below the regulatory limits for fuel failure, but close to or above recently observed thresholds for fragmentation and dispersion of high burn-up fuel. The highest calculated

Severe accident recriticality analyses (SARA)

International Nuclear Information System (INIS)

Frid, W.; Hoejerup, F.; Lindholm, I.; Miettinen, J.; Nilsson, L.; Puska, E.K.; Sjoevall, H.

2001-01-01

Recriticality in a BWR during reflooding of an overheated partly degraded core, i.e. with relocated control rods, has been studied for a total loss of electric power accident scenario. In order to assess the impact of recriticality on reactor safety, including accident management strategies, the following issues have been investigated in the SARA project: (1) the energy deposition in the fuel during super-prompt power burst; (2) the quasi steady-state reactor power following the initial power burst; and (3) containment response to elevated quasi steady-state reactor power. The approach was to use three computer codes and to further develop and adapt them for the task. The codes were SIMULATE-3K, APROS and RECRIT. Recriticality analyses were carried out for a number of selected reflooding transients for the Oskarshamn 3 plant in Sweden with SIMULATE-3K and for the Olkiluoto 1 plant in Finland with all three codes. The core initial and boundary conditions prior to recriticality have been studied with the severe accident codes SCDAP/RELAP5, MELCOR and MAAP4. The results of the analyses show that all three codes predict recriticality--both super-prompt power bursts and quasi steady-state power generation--for the range of parameters studied, i.e. with core uncovering and heat-up to maximum core temperatures of approximately 1800 K, and water flow rates of 45-2000 kg s -1 injected into the downcomer. Since recriticality takes place in a small fraction of the core, the power densities are high, which results in large energy deposition in the fuel during power burst in some accident scenarios. The highest value, 418 cal g -1 , was obtained with SIMULATE-3K for an Oskarshamn 3 case with reflooding rate of 2000 kg s -1 . In most cases, however, the predicted energy deposition was smaller, below the regulatory limits for fuel failure, but close to or above recently observed thresholds for fragmentation and dispersion of high burn-up fuel. The highest calculated quasi steady
Reading, Laterality, and the Brain: Early Contributions on Reading Disabilities by Sara S. Sparrow

OpenAIRE

Fletcher, Jack M.; Morris, Robin D.

2014-01-01

Although best known for work with children and adults with intellectual disabilities and autism spectrum disorders, training in speech pathology and a doctorate in clinical psychology and neuropsychology was the foundation for Sara Sparrow’s long-term interest in reading disabilities. Her first papers were on dyslexia and laterality, and the maturational lag theory of developmental dyslexia proposed with Paul Satz, her mentor. The research program that emerged from this work had a wide impact...
EVALUASI HIDDEN CURRICULUM DI SMP NEGERI BOJA, KABUPATEN KENDAL

Directory of Open Access Journals (Sweden)

Neni Lestari

2015-12-01

Full Text Available This study aimed to evaluate the implementation and impact of Hidden Curriculum, as well as the determinant factors of success and sustainability in SMPN 2 Boja Kendal. This study was an evaluative research using qualitative approach. The data collected by using observation, interviews, and documentation. Data analyzed by collecting and selecting to be deduce. Validity used triangulation data that combined the result of observation, interviews, and documentation. The results of the study were: 1 The activities of hidden curriculum development at SMPN 2 Boja Kendal, namely: flag ceremony, school environmental management, establishing and enforcing discipline, special religious worship, smiles, greetings and courtesies, exemplary, relationship among students and principal, teachers, and staff, school canteen services. 2 The impact of the hidden curriculum development was the changing of school community’s behavior being better, created clean and beautiful school environment, the improvement of public trust to the school toward their kids’ education. Development of the hidden curriculum could establish students good character and an optimal achievement as well as a good school culture. 3 Internal supporting factors including: qualified human resources, the availability of school facilities, school environment was clean and beautiful. External supporting factors occur in the form of endorsement of the parents, school committees and communities in establishing good and virtuous character for the students.
Feminism and Faith: Exploring Christian Spaces in the Writing of Sara Maitland and Michèle Roberts

Directory of Open Access Journals (Sweden)

Arina LUNGU-CIRSTEA

2011-03-01

Full Text Available En 1983, les féministes britanniques Sara Maitland et Jo Garcia ont publié Walking on the Water (London : Virago, une collection d’essais, de récits, de poèmes et de photos produits par des femmes sur le thème de la spiritualité. Les contributrices ont été en particulier invitées à explorer la relation entre leur identité féministe et leurs croyances religieuses. Le ton de ces contributions varie fortement, allant de l’envie passionnée de concilier les objectifs du féminisme avec le christianisme à un rejet total de l’Eglise comme institution patriarcale suprême. Cet article met en dialogue des récits diamétralement opposés du rapport entre christianisme et féminisme en s’intéressante plus particulièrement à deux des contributrices, Sara Maitland (1950 - et Michèle Roberts (1949 - . Ces deux écrivaines, qui se sont activement impliquées dans les mouvements féministes des années 1970, ont toutes deux lutté pour se réconcilier avec leur héritage chrétien. Néanmoins, alors que Maitland tente essentiellement de revisiter le christianisme en y incorporant les points essentiels d’une idéologie féministe, Roberts sent le besoin impérieux de se défaire de son identité religieuse afin de devenir indépendante ; en effet, dans son autobiographie Paper Houses (2007 elle décrit son éducation catholique comme “autoritaire et misogyne” (16. Cet article explore les façons dont l’identité spirituelle se construit dans le jeu complexe des interactions entre féminisme et foi. Il se propose, dans une perspective comparatiste, d’analyser d’une part le recueil de nouvelles de Sara Maitland intitulé A Book of Spells, et d’autre part, le roman acclamé de Michèle Roberts, Daughters of the House. Dans ces écrits, Maitland et Roberts ont un objectif commun qui est de renégocier la place des femmes dans l’histoire chrétienne dont elles reconnaissent – il est vrai à partir de perspectives diff
Should Community College Be Free? Forum. "Education Next" Talks with Sara Goldrick-Rab and Andrew P. Kelly

Science.gov (United States)

Goldrick-Rab, Sara; Kelly, Andrew P.

2016-01-01

In this article, "Education Next" talks with Sara Goldrick-Rab and Andrew Kelly. President Obama's proposal for tuition-free community college, seems to have laid down a marker for the Democratic Party. Vermont senator Bernie Sanders is touting his plan for free four-year public college on the primary trail; Massachusetts senator…
Severe Accident Recriticality Analyses (SARA)

Energy Technology Data Exchange (ETDEWEB)

Frid, W. [Swedish Nuclear Power Inspectorate, Stockholm (Sweden); Hoejerup, F. [Risoe National Lab. (Denmark); Lindholm, I.; Miettinen, J.; Puska, E.K. [VTT Energy, Helsinki (Finland); Nilsson, Lars [Studsvik Eco and Safety AB, Nykoeping (Sweden); Sjoevall, H. [Teoliisuuden Voima Oy (Finland)

1999-11-01

Recriticality in a BWR has been studied for a total loss of electric power accident scenario. In a BWR, the B{sub 4}C control rods would melt and relocate from the core before the fuel during core uncovery and heat-up. If electric power returns during this time-window unborated water from ECCS systems will start to reflood the partly control rod free core. Recriticality might take place for which the only mitigating mechanisms are the Doppler effect and void formation. In order to assess the impact of recriticality on reactor safety, including accident management measures, the following issues have been investigated in the SARA project: 1. the energy deposition in the fuel during super-prompt power burst, 2. the quasi steady-state reactor power following the initial power burst and 3. containment response to elevated quasi steady-state reactor power. The approach was to use three computer codes and to further develop and adapt them for the task. The codes were SIMULATE-3K, APROS and RECRIT. Recriticality analyses were carried out for a number of selected reflooding transients for the Oskarshamn 3 plant in Sweden with SIMULATE-3K and for the Olkiluoto 1 plant in Finland with all three codes. The core state initial and boundary conditions prior to recriticality have been studied with the severe accident codes SCDAP/RELAP5, MELCOR and MAAP4. The results of the analyses show that all three codes predict recriticality - both superprompt power bursts and quasi steady-state power generation - for the studied range of parameters, i. e. with core uncovery and heat-up to maximum core temperatures around 1800 K and water flow rates of 45 kg/s to 2000 kg/s injected into the downcomer. Since the recriticality takes place in a small fraction of the core the power densities are high which results in large energy deposition in the fuel during power burst in some accident scenarios. The highest value, 418 cal/g, was obtained with SIMULATE-3K for an Oskarshamn 3 case with reflooding
Severe Accident Recriticality Analyses (SARA)

International Nuclear Information System (INIS)

Frid, W.; Hoejerup, F.; Lindholm, I.; Miettinen, J.; Puska, E.K.; Nilsson, Lars; Sjoevall, H.

1999-11-01

Recriticality in a BWR has been studied for a total loss of electric power accident scenario. In a BWR, the B 4 C control rods would melt and relocate from the core before the fuel during core uncovery and heat-up. If electric power returns during this time-window unborated water from ECCS systems will start to reflood the partly control rod free core. Recriticality might take place for which the only mitigating mechanisms are the Doppler effect and void formation. In order to assess the impact of recriticality on reactor safety, including accident management measures, the following issues have been investigated in the SARA project: 1. the energy deposition in the fuel during super-prompt power burst, 2. the quasi steady-state reactor power following the initial power burst and 3. containment response to elevated quasi steady-state reactor power. The approach was to use three computer codes and to further develop and adapt them for the task. The codes were SIMULATE-3K, APROS and RECRIT. Recriticality analyses were carried out for a number of selected reflooding transients for the Oskarshamn 3 plant in Sweden with SIMULATE-3K and for the Olkiluoto 1 plant in Finland with all three codes. The core state initial and boundary conditions prior to recriticality have been studied with the severe accident codes SCDAP/RELAP5, MELCOR and MAAP4. The results of the analyses show that all three codes predict recriticality - both superprompt power bursts and quasi steady-state power generation - for the studied range of parameters, i. e. with core uncovery and heat-up to maximum core temperatures around 1800 K and water flow rates of 45 kg/s to 2000 kg/s injected into the downcomer. Since the recriticality takes place in a small fraction of the core the power densities are high which results in large energy deposition in the fuel during power burst in some accident scenarios. The highest value, 418 cal/g, was obtained with SIMULATE-3K for an Oskarshamn 3 case with reflooding
Optimisation of Hidden Markov Model using Baum–Welch algorithm ...

Indian Academy of Sciences (India)

The present work is a part of development of Hidden Markov Model. (HMM) based ... the Himalaya. In this work, HMMs have been developed for forecasting of maximum and minimum ..... data collection teams of Snow and Avalanche Study.
Hidden gauge symmetry

International Nuclear Information System (INIS)

O'Raifeartaigh, L.

1979-01-01

This review describes the principles of hidden gauge symmetry and of its application to the fundamental interactions. The emphasis is on the structure of the theory rather than on the technical details and, in order to emphasise the structure, gauge symmetry and hidden symmetry are first treated as independent phenomena before being combined into a single (hidden gauge symmetric) theory. The main application of the theory is to the weak and electromagnetic interactions of the elementary particles, and although models are used for comparison with experiment and for illustration, emphasis is placed on those features of the application which are model-independent. (author)
Variational Infinite Hidden Conditional Random Fields

NARCIS (Netherlands)

Bousmalis, Konstantinos; Zafeiriou, Stefanos; Morency, Louis-Philippe; Pantic, Maja; Ghahramani, Zoubin

2015-01-01

Hidden conditional random fields (HCRFs) are discriminative latent variable models which have been shown to successfully learn the hidden structure of a given classification problem. An Infinite hidden conditional random field is a hidden conditional random field with a countably infinite number of
Hidden charged dark matter

International Nuclear Information System (INIS)

Feng, Jonathan L.; Kaplinghat, Manoj; Tu, Huitzu; Yu, Hai-Bo

2009-01-01

Can dark matter be stabilized by charge conservation, just as the electron is in the standard model? We examine the possibility that dark matter is hidden, that is, neutral under all standard model gauge interactions, but charged under an exact (\\rm U)(1) gauge symmetry of the hidden sector. Such candidates are predicted in WIMPless models, supersymmetric models in which hidden dark matter has the desired thermal relic density for a wide range of masses. Hidden charged dark matter has many novel properties not shared by neutral dark matter: (1) bound state formation and Sommerfeld-enhanced annihilation after chemical freeze out may reduce its relic density, (2) similar effects greatly enhance dark matter annihilation in protohalos at redshifts of z ∼ 30, (3) Compton scattering off hidden photons delays kinetic decoupling, suppressing small scale structure, and (4) Rutherford scattering makes such dark matter self-interacting and collisional, potentially impacting properties of the Bullet Cluster and the observed morphology of galactic halos. We analyze all of these effects in a WIMPless model in which the hidden sector is a simplified version of the minimal supersymmetric standard model and the dark matter is a hidden sector stau. We find that charged hidden dark matter is viable and consistent with the correct relic density for reasonable model parameters and dark matter masses in the range 1 GeV ∼ X ∼< 10 TeV. At the same time, in the preferred range of parameters, this model predicts cores in the dark matter halos of small galaxies and other halo properties that may be within the reach of future observations. These models therefore provide a viable and well-motivated framework for collisional dark matter with Sommerfeld enhancement, with novel implications for astrophysics and dark matter searches
Localization of hidden Chua's attractors

International Nuclear Information System (INIS)

Leonov, G.A.; Kuznetsov, N.V.; Vagaitsev, V.I.

2011-01-01

The classical attractors of Lorenz, Rossler, Chua, Chen, and other widely-known attractors are those excited from unstable equilibria. From computational point of view this allows one to use numerical method, in which after transient process a trajectory, started from a point of unstable manifold in the neighborhood of equilibrium, reaches an attractor and identifies it. However there are attractors of another type: hidden attractors, a basin of attraction of which does not contain neighborhoods of equilibria. In the present Letter for localization of hidden attractors of Chua's circuit it is suggested to use a special analytical-numerical algorithm. -- Highlights: → There are hidden attractors: basin doesn't contain neighborhoods of equilibria. → Hidden attractors cannot be reached by trajectory from neighborhoods of equilibria. → We suggested special procedure for localization of hidden attractors. → We discovered hidden attractor in Chua's system, L. Chua in his work didn't expect this.
Sara, a patient with borderline personality structure: A "crisis" management

Directory of Open Access Journals (Sweden)

Paola Marinelli

2015-05-01

Full Text Available In this article the author examines some significant passages of his treatment of a patient with borderline personality structure, with the intention of giving a formative contribution to the delicate issue of the search for congruence between theory and clinic operations. This reflection is therefore an opportunity to integrate these aspects. The individualization of the therapeutic relationship in the theoretical framework of group analysis allowed the emotional investment in the person of the therapist, which is useful in the construction of a meaningful relationship on the human, emotional and cognitive plane; a space within which it has become increasingly possible for Sara, share and process emotions, re-build, contact parts of the self frustrated and disappointed, perceive less and less the void and become less vulnerable, being able to pull over to the original trauma.
Hidden Liquidity: Determinants and Impact

OpenAIRE

Gökhan Cebiroglu; Ulrich Horst

2012-01-01

We cross-sectionally analyze the presence of aggregated hidden depth and trade volume in the S&P 500 and identify its key determinants. We find that the spread is the main predictor for a stockâ€™s hidden dimension, both in terms of traded and posted liquidity. Our findings moreover suggest that large hidden orders are associated with larger transaction costs, higher price impact and increased volatility. In particular, as large hidden orders fail to attract (latent) liquidity to the market, ...
A Different Curriculum of Preparation for Work: Commentary on Mike Rose, Sara Goldrick-Rab, Kris Gutierrez and Norton Grubb

Science.gov (United States)

Worthen, Helena Harlow

2012-01-01

The January 2012 issue of "Mind, Culture, and Activity" published the Invited Presidential Address "Rethinking Remedial Education and the Academic-Vocational Divide," given by Mike Rose at the 2011 meeting of the American Educational Research Association in New Orleans, along with responses and commentary by Sara Goldrick-Rab, Kris Gutierrez, and…
PERSONAL NETWORK SAMPLING, OUTDEGREE ANALYSIS AND MULTILEVEL ANALYSIS - INTRODUCING THE NETWORK CONCEPT IN STUDIES OF HIDDEN POPULATIONS

NARCIS (Netherlands)

SPREEN, M; ZWAAGSTRA, R

1994-01-01

Populations, such as heroin and cocaine users, the homeless and the like (hidden populations), are among the most difficult populations to which to apply classic random sampling procedures. A frequently used data collection method for these hidden populations is the snowball procedure. The
Construct Validity and Reliability of the SARA Gait and Posture Sub-scale in Early Onset Ataxia

Directory of Open Access Journals (Sweden)

Tjitske F. Lawerman

2017-12-01

Full Text Available Aim: In children, gait and posture assessment provides a crucial marker for the early characterization, surveillance and treatment evaluation of early onset ataxia (EOA. For reliable data entry of studies targeting at gait and posture improvement, uniform quantitative biomarkers are necessary. Until now, the pediatric test construct of gait and posture scores of the Scale for Assessment and Rating of Ataxia sub-scale (SARA is still unclear. In the present study, we aimed to validate the construct validity and reliability of the pediatric (SARAGAIT/POSTURE sub-scale.Methods: We included 28 EOA patients [15.5 (6–34 years; median (range]. For inter-observer reliability, we determined the ICC on EOA SARAGAIT/POSTURE sub-scores by three independent pediatric neurologists. For convergent validity, we associated SARAGAIT/POSTURE sub-scores with: (1 Ataxic gait Severity Measurement by Klockgether (ASMK; dynamic balance, (2 Pediatric Balance Scale (PBS; static balance, (3 Gross Motor Function Classification Scale -extended and revised version (GMFCS-E&R, (4 SARA-kinetic scores (SARAKINETIC; kinetic function of the upper and lower limbs, (5 Archimedes Spiral (AS; kinetic function of the upper limbs, and (6 total SARA scores (SARATOTAL; i.e., summed SARAGAIT/POSTURE, SARAKINETIC, and SARASPEECH sub-scores. For discriminant validity, we investigated whether EOA co-morbidity factors (myopathy and myoclonus could influence SARAGAIT/POSTURE sub-scores.Results: The inter-observer agreement (ICC on EOA SARAGAIT/POSTURE sub-scores was high (0.97. SARAGAIT/POSTURE was strongly correlated with the other ataxia and functional scales [ASMK (rs = -0.819; p < 0.001; PBS (rs = -0.943; p < 0.001; GMFCS-E&R (rs = -0.862; p < 0.001; SARAKINETIC (rs = 0.726; p < 0.001; AS (rs = 0.609; p = 0.002; and SARATOTAL (rs = 0.935; p < 0.001]. Comorbid myopathy influenced SARAGAIT/POSTURE scores by concurrent muscle weakness, whereas comorbid myoclonus predominantly influenced
Development of an ion guide coupled to an on-line isotope separation system on Sara. Identification and study of isospin exotic nuclei at Isolde and Sara

International Nuclear Information System (INIS)

Bouldjedri, A.

1992-06-01

This work is concerned with the study of exotic nuclei located on both sides of the stability-line and known as neutron rich and neutron deficient respectively. For the former, produced by alpha particle-induced fission, an on-line isotope separation with an ion guide (IGISOL) has been developed and submitted to several off-line and on-line optimization tests showing capacity to spectroscopic studies. In the case of neutron deficient nuclei near the magicity Z=82, 182 Tl(3s) has been identified and its decaying modes and those of 183 Tl ground state, studied, using the on-line separator ISOLDE. On the other hand, the β decay of 172,175 Ir produced in 32 S induced reaction is studied using a helium jet system on the SARA accelerator. Existence of isomers is derived from half-lives measurements
Hidden Curriculum: An Analytical Definition

Directory of Open Access Journals (Sweden)

Mohammad Reza Andarvazh

2018-03-01

Full Text Available Background: The concept of hidden curriculum was first used by Philip Jackson in 1968, and Hafferty brought this concept to the medical education. Many of the subjects that medical students learn are attributed to this curriculum. So far several definitions have been presented for the hidden curriculum, which on the one hand made this concept richer, and on the other hand, led to confusion and ambiguity.This paper tries to provide a clear and comprehensive definition of it.Methods: In this study, concept analysis of McKenna method was used. Using keywords and searching in the databases, 561 English and 26 Persian references related to the concept was found, then by limitingthe research scope, 125 abstracts and by finding more relevant references, 55 articles were fully studied.Results: After analyzing the definitions by McKenna method, the hidden curriculum is defined as follows: The hidden curriculum is a hidden, powerful, intrinsic in organizational structure and culture and sometimes contradictory message, conveyed implicitly and tacitly in the learning environment by structural and human factors and its contents includes cultural habits and customs, norms, values, belief systems, attitudes, skills, desires and behavioral and social expectations can have a positive or negative effect, unplanned, neither planners nor teachers, nor learners are aware of it. The ultimate consequence of the hidden curriculum includes reproducing the existing class structure, socialization, and familiarizing learners for transmission and joining the professional world.Conclusion: Based on the concept analysis, we arrived at an analytical definition of the hidden curriculum that could be useful for further studies in this area.Keywords: CONCEPT ANALYSIS, HIDDEN CURRICULUM, MCKENNA’S METHOD
Hidden particle production at the ILC

International Nuclear Information System (INIS)

Fujii, Keisuke; Itoh, Hideo; Okada, Nobuchika; Hano, Hitoshi; Yoshioka, Tamaki

2008-01-01

In a class of new physics models, the new physics sector is completely or partly hidden, namely, a singlet under the standard model (SM) gauge group. Hidden fields included in such new physics models communicate with the standard model sector through higher-dimensional operators. If a cutoff lies in the TeV range, such hidden fields can be produced at future colliders. We consider a scalar field as an example of the hidden fields. Collider phenomenology on this hidden scalar is similar to that of the SM Higgs boson, but there are several features quite different from those of the Higgs boson. We investigate productions of the hidden scalar at the International Linear Collider (ILC) and study the feasibility of its measurements, in particular, how well the ILC distinguishes the scalar from the Higgs boson, through realistic Monte Carlo simulations.

SAPHIRE technical reference manual: IRRAS/SARA Version 4.0

International Nuclear Information System (INIS)

Russell, K.D.; Atwood, C.L.; Sattison, M.B.; Rasmuson, D.M.

1993-01-01

This report provides information on the principles used in the construction and operation of Version 4.0 of the Integrated Reliability and Risk Analysis System (IRRAS) and the System Analysis and Risk Assessment (SARA) system. It summarizes the fundamental mathematical concepts of sets and logic, fault trees, and probability. The report then describes the algorithms that these programs use to construct a fault tree and to obtain the minimal cut sets. It gives the formulas used to obtain the probability of the top event from the minimal cut sets, and the formulas for probabilities that are appropriate under various assumptions concerning repairability and mission time. It defines the measures of basic event importance that these programs can calculate. The report gives an overview of uncertainty analysis using simple Monte Carlo sampling or Latin Hypercube sampling, and states the algorithms used by these programs to generate random basic event probabilities from various distributions. Further references are given, and a detailed example of the reduction and quantification of a simple fault tree is provided in an appendix
Probing hidden sector photons through the Higgs window

International Nuclear Information System (INIS)

Ahlers, M.

2008-07-01

We investigate the possibility that a (light) hidden sector extra photon receives its mass via spontaneous symmetry breaking of a hidden sector Higgs boson, the so-called hidden-Higgs. The hidden-photon can mix with the ordinary photon via a gauge kinetic mixing term. The hidden-Higgs can couple to the Standard Model Higgs via a renormalizable quartic term - sometimes called the Higgs Portal. We discuss the implications of this light hidden-Higgs in the context of laser polarization and light-shining-through-the-wall experiments as well as cosmological, astrophysical, and non-Newtonian force measurements. For hidden-photons receiving their mass from a hidden-Higgs we find in the small mass regime significantly stronger bounds than the bounds on massive hidden sector photons alone. (orig.)
Probing hidden sector photons through the Higgs window

International Nuclear Information System (INIS)

Ahlers, Markus; Jaeckel, Joerg; Redondo, Javier; Ringwald, Andreas

2008-01-01

We investigate the possibility that a (light) hidden sector extra photon receives its mass via spontaneous symmetry breaking of a hidden sector Higgs boson, the so-called hidden-Higgs. The hidden-photon can mix with the ordinary photon via a gauge kinetic mixing term. The hidden-Higgs can couple to the standard model Higgs via a renormalizable quartic term - sometimes called the Higgs portal. We discuss the implications of this light hidden-Higgs in the context of laser polarization and light-shining-through-the-wall experiments as well as cosmological, astrophysical, and non-Newtonian force measurements. For hidden-photons receiving their mass from a hidden-Higgs, we find in the small mass regime significantly stronger bounds than the bounds on massive hidden sector photons alone.
A market on both ‘sides’ of the law: the use of the hidden web for the sale of new psychoactive substances

OpenAIRE

Wadsworth, Elle; Drummond, Colin; Kimergård, Andreas; Deluca, Paolo

2017-01-01

ObjectiveThe hidden Web is used for the anonymous sale of drugs, and with the UK Psychoactive Substances Act, 2016, implemented on May 26th 2016; it could increase as a platform for obtaining new psychoactive substances (NPS).This study aims to describe the NPS market on the visible and hidden Web preban, and assess whether the hidden Web is a likely place for the sale of NPS postban.MethodsData collection of 113 online shops took place in October 2015. Data collection of 22 cryptomarkets too...
Insight: Exploring Hidden Roles in Collaborative Play

Directory of Open Access Journals (Sweden)

Tricia Shi

2015-06-01

Full Text Available This paper looks into interaction modes between players in co-located, collaborative games. In particular, hidden traitor games, in which one or more players is secretly working against the group mission, has the effect of increasing paranoia and distrust between players, so this paper looks into the opposite of a hidden traitor – a hidden benefactor. Rather than sabotaging the group mission, the hidden benefactor would help the group achieve the end goal while still having a reason to stay hidden. The paper explores what games with such a role can look like and how the role changes player interactions. Finally, the paper addresses the divide between video game and board game interaction modes; hidden roles are not common within video games, but they are of growing prevalence in board games. This fact, combined with the exploration of hidden benefactors, reveals that hidden roles is a mechanic that video games should develop into in order to match board games’ complexity of player interaction modes.
Hidden attractors in dynamical systems

Science.gov (United States)

Dudkowski, Dawid; Jafari, Sajad; Kapitaniak, Tomasz; Kuznetsov, Nikolay V.; Leonov, Gennady A.; Prasad, Awadhesh

2016-06-01

Complex dynamical systems, ranging from the climate, ecosystems to financial markets and engineering applications typically have many coexisting attractors. This property of the system is called multistability. The final state, i.e., the attractor on which the multistable system evolves strongly depends on the initial conditions. Additionally, such systems are very sensitive towards noise and system parameters so a sudden shift to a contrasting regime may occur. To understand the dynamics of these systems one has to identify all possible attractors and their basins of attraction. Recently, it has been shown that multistability is connected with the occurrence of unpredictable attractors which have been called hidden attractors. The basins of attraction of the hidden attractors do not touch unstable fixed points (if exists) and are located far away from such points. Numerical localization of the hidden attractors is not straightforward since there are no transient processes leading to them from the neighborhoods of unstable fixed points and one has to use the special analytical-numerical procedures. From the viewpoint of applications, the identification of hidden attractors is the major issue. The knowledge about the emergence and properties of hidden attractors can increase the likelihood that the system will remain on the most desirable attractor and reduce the risk of the sudden jump to undesired behavior. We review the most representative examples of hidden attractors, discuss their theoretical properties and experimental observations. We also describe numerical methods which allow identification of the hidden attractors.
Collection-Level Surveys for Special Collections: Coalescing Descriptors across Standards

Science.gov (United States)

Ascher, James P.; Ferris, Anna M.

2012-01-01

Developing collection-level surveys to expose hidden collections in special collections and archives departments within ARL libraries has received a great deal of scholarly attention in the recent years. Numerous standards have been explored, and each has its strengths and weaknesses. This paper summarizes some of the major initiatives in…
Partially Hidden Markov Models

DEFF Research Database (Denmark)

Forchhammer, Søren Otto; Rissanen, Jorma

1996-01-01

Partially Hidden Markov Models (PHMM) are introduced. They differ from the ordinary HMM's in that both the transition probabilities of the hidden states and the output probabilities are conditioned on past observations. As an illustration they are applied to black and white image compression where...
Hidden photons in connection to dark matter

Energy Technology Data Exchange (ETDEWEB)

Andreas, Sarah; Ringwald, Andreas [Deutsches Elektronen-Synchrotron (DESY), Hamburg (Germany); Goodsell, Mark D. [CPhT, Ecole Polytechnique, Palaiseau (France)

2013-06-15

Light extra U(1) gauge bosons, so called hidden photons, which reside in a hidden sector have attracted much attention since they are a well motivated feature of many scenarios beyond the Standard Model and furthermore could mediate the interaction with hidden sector dark matter.We review limits on hidden photons from past electron beam dump experiments including two new limits from such experiments at KEK and Orsay. In addition, we study the possibility of having dark matter in the hidden sector. A simple toy model and different supersymmetric realisations are shown to provide viable dark matter candidates in the hidden sector that are in agreement with recent direct detection limits.
Hidden photons in connection to dark matter

International Nuclear Information System (INIS)

Andreas, Sarah; Ringwald, Andreas; Goodsell, Mark D.

2013-06-01

Light extra U(1) gauge bosons, so called hidden photons, which reside in a hidden sector have attracted much attention since they are a well motivated feature of many scenarios beyond the Standard Model and furthermore could mediate the interaction with hidden sector dark matter.We review limits on hidden photons from past electron beam dump experiments including two new limits from such experiments at KEK and Orsay. In addition, we study the possibility of having dark matter in the hidden sector. A simple toy model and different supersymmetric realisations are shown to provide viable dark matter candidates in the hidden sector that are in agreement with recent direct detection limits.
SARAS 2: a spectral radiometer for probing cosmic dawn and the epoch of reionization through detection of the global 21-cm signal

Science.gov (United States)

Singh, Saurabh; Subrahmanyan, Ravi; Shankar, N. Udaya; Rao, Mayuri Sathyanarayana; Girish, B. S.; Raghunathan, A.; Somashekar, R.; Srivani, K. S.

2018-04-01

The global 21-cm signal from Cosmic Dawn (CD) and the Epoch of Reionization (EoR), at redshifts z ˜ 6-30, probes the nature of first sources of radiation as well as physics of the Inter-Galactic Medium (IGM). Given that the signal is predicted to be extremely weak, of wide fractional bandwidth, and lies in a frequency range that is dominated by Galactic and Extragalactic foregrounds as well as Radio Frequency Interference, detection of the signal is a daunting task. Critical to the experiment is the manner in which the sky signal is represented through the instrument. It is of utmost importance to design a system whose spectral bandpass and additive spurious signals can be well calibrated and any calibration residual does not mimic the signal. Shaped Antenna measurement of the background RAdio Spectrum (SARAS) is an ongoing experiment that aims to detect the global 21-cm signal. Here we present the design philosophy of the SARAS 2 system and discuss its performance and limitations based on laboratory and field measurements. Laboratory tests with the antenna replaced with a variety of terminations, including a network model for the antenna impedance, show that the gain calibration and modeling of internal additive signals leave no residuals with Fourier amplitudes exceeding 2 mK, or residual Gaussians of 25 MHz width with amplitudes exceeding 2 mK. Thus, even accounting for reflection and radiation efficiency losses in the antenna, the SARAS 2 system is capable of detection of complex 21-cm profiles at the level predicted by currently favoured models for thermal baryon evolution.
Escribiendo el silencio: la contemplación poética de Sara Pujol

Directory of Open Access Journals (Sweden)

Gala, Candelas

2005-06-01

Full Text Available Reading Sara Pujol Russell's El fuego tiende su aire (1999 and Intacto asombro de la luz del silencio (2001, is entering into a poetic world whose content and form are both innovative and complex. This poetry invites the reader into a state of meditative contemplation that seeks correspondences among different elements in reality as the key to access a superior type of knowledge. Pujol's writing moves in the fringes between voice and silence, art and nature, meaning and nothingness, identity and difference, it seeks to surpass its own verbal texture while only in that texture does it find articulation and only through it does transcendence becones accessible. The focus of the present reading centers on the point where Pujol's language seeks to transcend the disjunction between sign and surrounding, the point where synthesis is fusion about to dissolve.La lectura de El fuego tiende su aire (1999 e Intacto asombro en la luz del silencio (2001 de Sara Pujol Russell, supone la entrada en un discurso poético innovador y complejo tanto en contenido como en forma. Esta poesía invita a una contemplación meditativa que busca las correspondencias entre los diversos elementos de la realidad como clave para acceder a un conocimiento superior. Su escritura se mueve en los bordes entre la voz y el silencio, el arte y la naturaleza, el sentido y el vacío, la identidad y la diferencia, buscando trascender lo que está más allá de su misma urdimbre verbal pero que sólo en ella se configura, y sólo desde ella se puede acceder. En el movimiento de esta escritura por superar la disyunción entre signo y entorno, en esa síntesis a punto de disolverse, es donde se enfoca la lectura en este ensayo.
POVMs and hidden variables

International Nuclear Information System (INIS)

Stairs, Allen

2007-01-01

Recent results by Paul Busch and Adan Cabello claim to show that by appealing to POVMs, non-contextual hidden variables can be ruled out in two dimensions. While the results of Busch and Cabello are mathematically correct, interpretive problems render them problematic as no hidden variable proofs
Os suínos da raça Bísara – oportunidades e desafios

OpenAIRE

Carvalho, Marieta

2015-01-01

A procura mundial de produtos de origem animal aumentará cerca de 70% em 2050. Estima-se que mil milhões de pobres dependam dos animais para a sua alimentação e criação de riqueza1. A carne de porco é um dos alimentos mais consumidos mundialmente, representando em 2012: 43,3% em todo o mundo2, 45,9% na União Europeia1 e 39,8 % em Portugal da carne total consumida3. Este trabalho tem como objetivo, fazer uma caracterização atual da suinicultura, com base nos suínos da raça Bísara, enumer...
Helioscope bounds on hidden sector photons

International Nuclear Information System (INIS)

Redondo, J.

2008-01-01

The flux of hypothetical ''hidden photons'' from the Sun is computed under the assumption that they interact with normal matter only through kinetic mixing with the ordinary standard model photon. Requiring that the exotic luminosity is smaller than the standard photon luminosity provides limits for the mixing parameter down to χ -14 , depending on the hidden photon mass. Furthermore, it is pointed point out that helioscopes looking for solar axions are also sensitive to hidden photons. The recent results of the CAST collaboration are used to further constrain the mixing parameter χ at low masses (m γ' <1 eV) where the luminosity bound is weaker. In this regime the solar hidden photon ux has a sizable contribution of longitudinally polarized hidden photons of low energy which are invisible for current helioscopes. (orig.)
Managing Hidden Costs of Offshoring

DEFF Research Database (Denmark)

Larsen, Marcus M.; Pedersen, Torben

2014-01-01

This chapter investigates the concept of the ‘hidden costs’ of offshoring, i.e. unexpected offshoring costs exceeding the initially expected costs. Due to the highly undefined nature of these costs, we position our analysis towards the strategic responses of firms’ realisation of hidden costs....... In this regard, we argue that a major response to the hidden costs of offshoring is the identification and utilisation of strategic mechanisms in the organisational design to eventually achieving system integration in a globally dispersed and disaggregated organisation. This is heavily moderated by a learning......-by-doing process, where hidden costs motivate firms and their employees to search for new and better knowledge on how to successfully manage the organisation. We illustrate this thesis based on the case of the LEGO Group....
The Hidden Costs of Offshoring

DEFF Research Database (Denmark)

Møller Larsen, Marcus; Manning, Stephan; Pedersen, Torben

2011-01-01

of offshoring. Specifically, we propose that hidden costs can be explained by the combination of increasing structural, operational and social complexity of offshoring activities. In addition, we suggest that firm orientation towards organizational design as part of an offshoring strategy and offshoring......This study seeks to explain hidden costs of offshoring, i.e. unexpected costs resulting from the relocation of business tasks and activities outside the home country. We develop a model that highlights the role of complexity, design orientation and experience in explaining hidden costs...... experience moderate the relationship between complexity and hidden costs negatively i.e. reduces the cost generating impact of complexity. We develop three hypotheses and test them on comprehensive data from the Offshoring Research Network (ORN). In general, we find support for our hypotheses. A key result...
A market on both "sides" of the law: The use of the hidden web for the sale of new psychoactive substances.

Science.gov (United States)

Wadsworth, Elle; Drummond, Colin; Kimergård, Andreas; Deluca, Paolo

2017-05-01

The hidden Web is used for the anonymous sale of drugs, and with the UK Psychoactive Substances Act, 2016, implemented on May 26th 2016; it could increase as a platform for obtaining new psychoactive substances (NPS). This study aims to describe the NPS market on the visible and hidden Web preban, and assess whether the hidden Web is a likely place for the sale of NPS postban. Data collection of 113 online shops took place in October 2015. Data collection of 22 cryptomarkets took place every 2 months from October 2015 to 2016 as part of the CASSANDRA project. All online shops with a UK domain location sold NPS that were uncontrolled by the UK Misuse of Drugs Act, 1971, and closed after the ban. Of the cryptomarkets analysed, the total number of vendors selling NPS, number of substances, and listings advertised, all increased over the year. The majority of the NPS advertised on the hidden Web were phenethylamines and cathinones, yet the majority of uncontrolled NPS were synthetic cannabinoids. Vendors selling and availability of NPS increased over the 12 months of data collection. Potential displacement from the visible Web to hidden Web should be taken into consideration. Copyright © 2017 John Wiley & Sons, Ltd.
Nuclear spectroscopy of exotic nuclei with the Sara/Igisol facility

International Nuclear Information System (INIS)

Beraud, R.; Emsallem, A.; Astier, A.; Duffait, R.; Le Coz, Y.; Redon, N.; Barneoud, D.; Genevey, J.; Gizon, A.

1994-11-01

The authors review their recent studies on alpha and beta decay of exotic nuclei performed with the on-line mass separator at the Igisol/Sara facility in Grenoble. The experiments using charged particle induced fission have given new information on production cross section and properties of n-rich nuclei with A=110-130 whereas by means of heavy ion induced fusion evaporation reactions the authors have investigated two regions close to the proton drip line around A=180 and A=130. This paper gives first a brief description of the Igisol technique and shows its application in case of two different production modes: charged particle-induced fission and heavy ion -induced fusion-evaporation reactions. The systematic study of the low-lying levels in n-rich Ru isotopes has allowed to show an axial symmetry breaking, whereas complementary investigations are necessary to clarify the case of 180 Tl decay. A number of new spectroscopic data such as new isotopes identification have been gained in the region of light rare earth nuclei. (N.T.)
Hidden Risk Factors for Women

Science.gov (United States)

... A.S.T. Quiz Hidden Stroke Risk Factors for Women Updated:Nov 22,2016 Excerpted from "What Women Need To Know About The Hidden Risk Factors ... 2012) This year, more than 100,000 U.S. women under 65 will have a stroke. Stroke is ...

Hidden-Sector Dynamics and the Supersymmetric Seesaw

CERN Document Server

Campbell, Bruce A; Maybury, David W

2008-01-01

In light of recent analyses that have shown that nontrivial hidden-sector dynamics in models of supersymmetry breaking can lead to a significant impact on the predicted low-energy supersymmetric spectrum, we extend these studies to consider hidden-sector effects in extensions of the MSSM to include a seesaw model for neutrino masses. A dynamical hidden sector in an interval of mass scales below the seesaw scale would yield renormalization-group running involving both the anomalous dimension from the hidden sector and the seesaw-extended MSSM renormalization group equations (RGEs). These effects interfere in general, altering the generational mixing of the sleptons, and allowing for a substantial change to the expected level of charged-lepton flavour violation in seesaw-extended MSSM models. These results provide further support for recent theoretical observations that knowledge of the hidden sector is required in order to make concrete low-energy predictions, if the hidden sector is strongly coupled. In parti...
Hidden variables and locality in quantum theory

International Nuclear Information System (INIS)

Shiva, Vandana.

1978-12-01

The status of hidden variables in quantum theory has been debated since the 1920s. The author examines the no-hidden-variable theories of von Neumann, Kochen, Specker and Bell, and finds that they all share one basic assumption: averaging over the hidden variables should reproduce the quantum mechanical probabilities. Von Neumann also makes a linearity assumption, Kochen and Specker require the preservation of certain functional relations between magnitudes, and Bell proposes a locality condition. It has been assumed that the extrastatistical requirements are needed to serve as criteria of success for the introduction of hidden variables because the statistical condition is trivially satisfied, and that Bell's result is based on a locality condition that is physically motivated. The author shows that the requirement of weak locality, which is not physically motivated, is enough to give Bell's result. The proof of Bell's inequality works equally well for any pair of commuting magnitudes satisfying a condition called the degeneracy principle. None of the no-hidden-variable proofs apply to a class of hidden variable theories that are not phase-space reconstructions of quantum mechanics. The author discusses one of these theories, the Bohm-Bub theory, and finds that hidden variable theories that re all the quantum statistics, for single and sequential measurements, must introduce a randomization process for the hidden variables after each measurement. The philosophical significance of this theory lies in the role it can play in solving the conceptual puzzles posed by quantum theory
Pushing and Pulling Sara: A Case Study of the Contrasting Influences of High School and University Experiences on Engineering Agency, Identity, and Participation

Science.gov (United States)

Godwin, Allison; Potvin, Geoff

2017-01-01

This manuscript reports a longitudinal case study of how one woman, Sara, who had previously considered dropping out of high school, authored strong mathematics and science identities and purposefully exhibited agency through her experiences in high school science. These experiences empowered her to choose an engineering major in college; however,…
… To be hidden does not mean to be merely revealed – Part 1 Artistic research on hidden curriculum

Directory of Open Access Journals (Sweden)

Annette Krause

2015-09-01

Full Text Available This text revisits the long-term project Hidden Curriculum, initiated by Annette Krauss. The project addresses unquestioned routines, hierarchies of knowledge (part 1, and the role of the body in learning processes (part 2 from the perspective of secondary/high school education (in the research on a hidden curriculum. A deeper analysis of educational studies on the phenomenon of ‘hidden curriculum’ in relation to the feminist and critical pedagogies of bell hooks, Paulo Freire, and Jacques Rancière brings forward important insights generated through the artistic research within hidden curriculum. The aim of this text is to address academic canons, corporeality, and investigate everyday norms through revisiting the framework, results, and processes of the collaborative research into hidden curriculum with secondary high school students.
Compressing the hidden variable space of a qubit

OpenAIRE

Montina, Alberto

2010-01-01

In previously exhibited hidden variable models of quantum state preparation and measurement, the number of continuous hidden variables describing the actual state of a single realization is never smaller than the quantum state manifold dimension. We introduce a simple model for a qubit whose hidden variable space is one-dimensional, i.e., smaller than the two-dimensional Bloch sphere. The hidden variable probability distributions associated with the quantum states satisfy reasonable criteria ...
Search for Hidden Particles

CERN Multimedia

Solovev, V

The SHiP Experiment is a new general-purpose fixed target facility at the SPS to search for hidden particles as predicted by a very large number of recently elaborated models of Hidden Sectors which are capable of accommodating dark matter, neutrino oscillations, and the origin of the full baryon asymmetry in the Universe. Specifically, the experiment is aimed at searching for very weakly interacting long lived particles including Heavy Neutral Leptons - right-handed partners of the active neutrinos; light supersymmetric particles - sgoldstinos, etc.; scalar, axion and vector portals to the hidden sector. The high intensity of the SPS and in particular the large production of charm mesons with the 400 GeV beam allow accessing a wide variety of light long-lived exotic particles of such models and of SUSY. Moreover, the facility is ideally suited to study the interactions of tau neutrinos.
Higgs Portal into Hidden Sectors

CERN Multimedia

CERN. Geneva

2007-01-01

Several attractive theoretical ideas suggest the existence of one or more 'hidden sectors' consisting of standard model singlet fields, some of which may not be too heavy. There is a profound reason to think that the Higgs sector might provide the first access to these hidden sectors. This scenario could affect Higgs phenomenology in drastic ways.
Hidden in plain sight: the formal, informal, and hidden curricula of a psychiatry clerkship.

Science.gov (United States)

Wear, Delese; Skillicorn, Jodie

2009-04-01

To examine perceptions of the formal, informal, and hidden curricula in psychiatry as they are observed and experienced by (1) attending physicians who have teaching responsibilities for residents and medical students, (2) residents who are taught by those same physicians and who have teaching responsibilities for medical students, and (3) medical students who are taught by attendings and residents during their psychiatry rotation. From June to November 2007, the authors conducted focus groups with attendings, residents, and students in one midwestern academic setting. The sessions were audiotaped, transcribed, and analyzed for themes surrounding the formal, informal, and hidden curricula. All three groups offered a similar belief that the knowledge, skills, and values of the formal curriculum focused on building relationships. Similarly, all three suggested that elements of the informal and hidden curricula were expressed primarily as the values arising from attendings' role modeling, as the nature and amount of time attendings spend with patients, and as attendings' advice arising from experience and intuition versus "textbook learning." Whereas students and residents offered negative values arising from the informal and hidden curricula, attendings did not, offering instead the more positive values they intended to encourage through the informal and hidden curricula. The process described here has great potential in local settings across all disciplines. Asking teachers and learners in any setting to think about how they experience the educational environment and what sense they make of all curricular efforts can provide a reality check for educators and a values check for learners as they critically reflect on the meanings of what they are learning.
A Novel Method for Decoding Any High-Order Hidden Markov Model

Directory of Open Access Journals (Sweden)

Fei Ye

2014-01-01

Full Text Available This paper proposes a novel method for decoding any high-order hidden Markov model. First, the high-order hidden Markov model is transformed into an equivalent first-order hidden Markov model by Hadar’s transformation. Next, the optimal state sequence of the equivalent first-order hidden Markov model is recognized by the existing Viterbi algorithm of the first-order hidden Markov model. Finally, the optimal state sequence of the high-order hidden Markov model is inferred from the optimal state sequence of the equivalent first-order hidden Markov model. This method provides a unified algorithm framework for decoding hidden Markov models including the first-order hidden Markov model and any high-order hidden Markov model.
Abelian hidden sectors at a GeV

International Nuclear Information System (INIS)

Morrissey, David E.; Poland, David; Zurek, Kathryn M.

2009-01-01

We discuss mechanisms for naturally generating GeV-scale hidden sectors in the context of weak-scale supersymmetry. Such low mass scales can arise when hidden sectors are more weakly coupled to supersymmetry breaking than the visible sector, as happens when supersymmetry breaking is communicated to the visible sector by gauge interactions under which the hidden sector is uncharged, or if the hidden sector is sequestered from gravity-mediated supersymmetry breaking. We study these mechanisms in detail in the context of gauge and gaugino mediation, and present specific models of Abelian GeV-scale hidden sectors. In particular, we discuss kinetic mixing of a U(1) x gauge force with hypercharge, singlets or bi-fundamentals which couple to both sectors, and additional loop effects. Finally, we investigate the possible relevance of such sectors for dark matter phenomenology, as well as for low- and high-energy collider searches.
Reading Sara Pujol Russell’s Poetry of Contemplation and Connection

Directory of Open Access Journals (Sweden)

Anita M. Hart

2012-06-01

Full Text Available Sara Pujol Russell’s poetry captures a process of expanding consciousness and personal renewal. Through contemplation and attention to nature, the poet-speaker in her works generates a sense of connection that moves her beyond daily concerns. Pujol’s poetry is both metaphysical and also different in that it resists easy classification and is not representative of mainstream trends. This essay approaches the distinctiveness of Pujol’s work by studying selected poems from her third book of poetry in Spanish, Para decir sí a la carencia, sí a la naranja, al azafrán en el pan (2004 ‘To Say Yes to Lack, Yes to the Orange, to the Saffron in the Bread.’ Incorporating philosopher María Zambrano’s thoughts on contemplation, it shows Pujol’s poet-speaker establishing a connection with nature and spirit, experiencing a heightened consciousness, and searching for expression. The poetic language is characterized by vision, intimacy, enigma, and contradiction. In its subjective, intuitive way, Pujol’s work reveals the poet-speaker’s winding path of discovery and challenges the reader to look closely inside and outside in engaging life’s mysteries.
Stargate of the Hidden Multiverse

Directory of Open Access Journals (Sweden)

Alexander Antonov

2016-02-01

Full Text Available Concept of Monoverse, which corresponds to the existing broad interpretation of the second postulate of the special theory of relativity, is not consistent with the modern astrophysical reality — existence of the dark matter and the dark energy, the total mass-energy of which is ten times greater than the mass-energy of the visible universe (which has been considered as the entire universe until very recent . This concept does not allow to explain their rather unusual properties — invisibility and lack of baryon content — which would seem to even destroy the very modern understanding of the term ‘matter’. However, all numerous alternative concepts of Multiverses, which have been proposed until today, are unable to explain these properties of the dark matter and dark energy. This article describes a new concept: the concept of the hidden Multiverse and hidden Supermultiverse, which mutual invisibility of parallel universes is explained by the physical reality of imaginary numbers. This concept completely explains the phenomenon of the dark matter and the dark energy. Moreover, it is shown that the dark matter and the dark energy are the experimental evidence for the existence of the hidden Multiverse. Described structure of the hidden Multiverse is fully consistent with the data obtained by the space stations WMAP and Planck. An extremely important property of the hidden Multiverse is an actual possibility of its permeation through stargate located on the Earth.
Optimized hardware framework of MLP with random hidden layers for classification applications

Science.gov (United States)

Zyarah, Abdullah M.; Ramesh, Abhishek; Merkel, Cory; Kudithipudi, Dhireesha

2016-05-01

Multilayer Perceptron Networks with random hidden layers are very efficient at automatic feature extraction and offer significant performance improvements in the training process. They essentially employ large collection of fixed, random features, and are expedient for form-factor constrained embedded platforms. In this work, a reconfigurable and scalable architecture is proposed for the MLPs with random hidden layers with a customized building block based on CORDIC algorithm. The proposed architecture also exploits fixed point operations for area efficiency. The design is validated for classification on two different datasets. An accuracy of ~ 90% for MNIST dataset and 75% for gender classification on LFW dataset was observed. The hardware has 299 speed-up over the corresponding software realization.
Women Empowerment in the Realms of Institutionalized Religion and Patriarchy: El Saadawi’s Firdaus and Yezierska’s Sara as Examples

OpenAIRE

Abdullah K. Shehabat

2016-01-01

This paper explains how the two protagonists, Firdaus and Sara, successfully paved their own ways in search of self-liberation despite the authoritarian patriarchy and institutionalized religions that plagued them. El Saadawi's Woman at Point Zero and Yezierska’s Bread Givers represent the fruitful struggle these protagonists experienced as they come to forge an identity and be themselves. The paper argues that the protagonists manage to free themselves, establish their own spiritual homes at...
Coding with partially hidden Markov models

DEFF Research Database (Denmark)

Forchhammer, Søren; Rissanen, J.

1995-01-01

Partially hidden Markov models (PHMM) are introduced. They are a variation of the hidden Markov models (HMM) combining the power of explicit conditioning on past observations and the power of using hidden states. (P)HMM may be combined with arithmetic coding for lossless data compression. A general...... 2-part coding scheme for given model order but unknown parameters based on PHMM is presented. A forward-backward reestimation of parameters with a redefined backward variable is given for these models and used for estimating the unknown parameters. Proof of convergence of this reestimation is given....... The PHMM structure and the conditions of the convergence proof allows for application of the PHMM to image coding. Relations between the PHMM and hidden Markov models (HMM) are treated. Results of coding bi-level images with the PHMM coding scheme is given. The results indicate that the PHMM can adapt...
Compressing the hidden variable space of a qubit

International Nuclear Information System (INIS)

Montina, Alberto

2011-01-01

In previously exhibited hidden variable models of quantum state preparation and measurement, the number of continuous hidden variables describing the actual state of single realizations is never smaller than the quantum state manifold dimension. We introduce a simple model for a qubit whose hidden variable space is one-dimensional, i.e., smaller than the two-dimensional Bloch sphere. The hidden variable probability distributions associated with quantum states satisfy reasonable criteria of regularity. Possible generalizations of this shrinking to an N-dimensional Hilbert space are discussed.
Hidden biodiversity in entomological collections: The overlooked co-occurrence of dipteran and hymenopteran ant parasitoids in stored biological material.

Science.gov (United States)

Pérez-Lachaud, Gabriela; Lachaud, Jean-Paul

2017-01-01

Biological collections around the world are the repository of biodiversity on Earth; they also hold a large quantity of unsorted, unidentified, or misidentified material and can house behavioral information on species that are difficult to access or no longer available to science. Among the unsorted, alcohol-preserved material stored in the Formicidae Collection of the 'El Colegio de la Frontera Sur' Research Center (Chetumal, Mexico), we found nine colonies of the ponerine ant Neoponera villosa, that had been collected in bromeliads at Calakmul (Campeche, Mexico) in 1999. Ants and their brood were revised for the presence of any sign of parasitism. Cocoons were dissected and their content examined under a stereomicroscope. Six N. villosa prepupae had been attacked by the ectoparasitoid syrphid fly Hypselosyrphus trigonus Hull (Syrphidae: Microdontinae), to date the only known dipteran species of the Microdontinae with a parasitoid lifestyle. In addition, six male pupae from three colonies contained gregarious endoparasitoid wasps. These were specialized in parasitizing this specific host caste as no gyne or worker pupae displayed signs of having been attacked. Only immature stages (larvae and pupae) of the wasp could be obtained. Due to the long storage period, DNA amplification failed; however, based on biological and morphological data, pupae were placed in the Encyrtidae family. This is the first record of an encyrtid wasp parasitizing N. villosa, and the second example of an encyrtid as a primary parasitoid of ants. Furthermore, it is also the first record of co-occurrence of a dipteran ectoparasitoid and a hymenopteran endoparasitoid living in sympatry within the same population of host ants. Our findings highlight the importance of biological collections as reservoirs of hidden biodiversity, not only at the taxonomic level, but also at the behavioral level, revealing complex living networks. They also highlight the need for funding in order to carry out
A survey of hidden-variables theories

CERN Document Server

Belinfante, F J

1973-01-01

A Survey of Hidden-Variables Theories is a three-part book on the hidden-variable theories, referred in this book as """"theories of the first kind"""". Part I reviews the motives in developing different types of hidden-variables theories. The quest for determinism led to theories of the first kind; the quest for theories that look like causal theories when applied to spatially separated systems that interacted in the past led to theories of the second kind. Parts II and III further describe the theories of the first kind and second kind, respectively. This book is written to make the literat
A classification of hidden-variable properties

International Nuclear Information System (INIS)

Brandenburger, Adam; Yanofsky, Noson

2008-01-01

Hidden variables are extra components added to try to banish counterintuitive features of quantum mechanics. We start with a quantum-mechanical model and describe various properties that can be asked of a hidden-variable model. We present six such properties and a Venn diagram of how they are related. With two existence theorems and three no-go theorems (EPR, Bell and Kochen-Specker), we show which properties of empirically equivalent hidden-variable models are possible and which are not. Formally, our treatment relies only on classical probability models, and physical phenomena are used only to motivate which models to choose
The comparison of naturally weathered oil and artificially photo-degraded oil at the molecular level by a combination of SARA fractionation and FT-ICR MS

International Nuclear Information System (INIS)

Islam, Ananna; Cho, Yunju; Yim, Un Hyuk; Shim, Won Joon; Kim, Young Hwan; Kim, Sunghwan

2013-01-01

Highlights: • Weathered oils from the Hebei Spirit oil spill and photo degraded oils are compared. • We investigate changes of polar species at the molecular level by 15T FT-ICR MS. • Significant reduction of sulfur class compounds in saturates fraction is observed. • The relative abundance of protonated compounds (presumably basic nitrogen compounds) increase after degradation. • Changes of polar compounds occurred by natural and photo degradation are similar. -- Abstract: Two sets of oil samples, one obtained from different weathering stages of the M/V Hebei Spirit oil spill site and the other prepared by an in vitro photo-degradation experiment, were analyzed and compared at the molecular level by atmospheric pressure photo-ionization coupled with Fourier transform ion cyclotron resonance mass spectrometry (FT-ICR MS). For a more detailed comparison at the molecular level, the oil samples were separated into saturate, aromatic, resin, and asphaltene (SARA) fractions before MS analysis. Gravimetric analysis of the SARA fractions revealed a decreased weight percentage of the aromatic fraction and an increased resin fraction in both sets of samples. Molecular-level investigations of the SARA fractions showed a significant reduction in the S 1 class in the saturate fraction and increase of S 1 O 1 class compounds with high DBE values in resin fraction. Levels of N 1 and N 1 O 1 class compounds resulting in protonated ions (presumably basic nitrogen compounds) increased after degradation compared to compounds generating molecular ions (presumably non-basic nitrogen compounds). This study revealed changes occurring in heteroatom polar species of crude oils such as sulfur and nitrogen containing compounds that have not been easily detected with conventional GC based techniques

Perspective: Disclosing hidden sources of funding.

Science.gov (United States)

Resnik, David B

2009-09-01

In this article, the author discusses ethical and policy issues related to the disclosure of hidden sources of funding in research. The author argues that authors have an ethical obligation to disclose hidden sources of funding and that journals should adopt policies to enforce this obligation. Journal policies should require disclosure of hidden sources of funding that authors know about and that have a direct relation to their research. To stimulate this discussion, the author describes a recent case: investigators who conducted a lung cancer screening study had received funding from a private foundation that was supported by a tobacco company, but they did not disclose this relationship to the journal. Investigators and journal editors must be prepared to deal with these issues in a manner that promotes honesty, transparency, fairness, and accountability in research. The development of well-defined, reasonable policies pertaining to hidden sources of funding can be a step in this direction.
Hidden Statistics of Schroedinger Equation

Science.gov (United States)

Zak, Michail

2011-01-01

Work was carried out in determination of the mathematical origin of randomness in quantum mechanics and creating a hidden statistics of Schr dinger equation; i.e., to expose the transitional stochastic process as a "bridge" to the quantum world. The governing equations of hidden statistics would preserve such properties of quantum physics as superposition, entanglement, and direct-product decomposability while allowing one to measure its state variables using classical methods.
Optimization of Artificial Neural Network using Evolutionary Programming for Prediction of Cascading Collapse Occurrence due to the Hidden Failure Effect

Science.gov (United States)

Idris, N. H.; Salim, N. A.; Othman, M. M.; Yasin, Z. M.

2018-03-01

This paper presents the Evolutionary Programming (EP) which proposed to optimize the training parameters for Artificial Neural Network (ANN) in predicting cascading collapse occurrence due to the effect of protection system hidden failure. The data has been collected from the probability of hidden failure model simulation from the historical data. The training parameters of multilayer-feedforward with backpropagation has been optimized with objective function to minimize the Mean Square Error (MSE). The optimal training parameters consists of the momentum rate, learning rate and number of neurons in first hidden layer and second hidden layer is selected in EP-ANN. The IEEE 14 bus system has been tested as a case study to validate the propose technique. The results show the reliable prediction of performance validated through MSE and Correlation Coefficient (R).
sarA negatively regulates Staphylococcus epidermidis biofilm formation by modulating expression of 1 MDa extracellular matrix binding protein and autolysis‐dependent release of eDNA

DEFF Research Database (Denmark)

Christner, Martin; Heinze, Constanze; Busch, Michael

2012-01-01

to biofilm formation in mutant 1585ΔsarA. Increased eDNA amounts indirectly resulted from upregulation of metalloprotease SepA, leading to boosted processing of autolysin AtlE, in turn inducing augmented autolysis and release of eDNA. Hence, this study identifies sarA as a negative regulator of Embp‐ and e...
Hidden supersymmetry and Fermion number fractionalization

International Nuclear Information System (INIS)

Akhoury, R.

1985-01-01

This paper discusses how a hidden supersymmetry of the underlying field theories can be used to interpret and to calculate fermion number fractionalization in different dimensions. This is made possible by relating it to a corresponding Witten index of the hidden supersymmetry. The closely related anomalies in odd dimensions are also discussed
Addressing the hidden curriculum in the clinical workplace: A practical tool for trainees and faculty.

Science.gov (United States)

Mulder, Hanneke; Ter Braak, Edith; Chen, H Carrie; Ten Cate, Olle

2018-02-28

The hidden curriculum, commonly described in negative terms, is considered highly influential in medical education, especially in the clinical workplace. Structured approaches to address it are limited in number and scope. This paper presents a practical, value-neutral method called REVIEW (Reflecting & Evaluating Values Implicit in Education in the Workplace), to facilitate reflection and discussion on the hidden curriculum by faculty members and trainees. REVIEW approaches the hidden curriculum as a reflection of the professional microculture of a clinical team. This microculture results from collective problem solving and mutual negotiation when facing different, often conflicting, demands and interests, and their underlying values in daily clinical practice. Using this nonjudgmental conceptual framework, REVIEW employs a series of 50 culture statements that must be prioritized using Q-sort methodology, reflecting how the culture in a particular clinical context (e.g. ward or department) is perceived by faculty members and trainees. This procedure can be done individually or in groups. Most important is the resulting team discussion after the exercise - a discussion about perceptions of actual team culture and the culture desired by the team. Our early experiences suggest that REVIEW can be a useful tool for addressing the hidden curriculum.
The Hidden Reason Behind Children's Misbehavior.

Science.gov (United States)

Nystul, Michael S.

1986-01-01

Discusses hidden reason theory based on the assumptions that: (1) the nature of people is positive; (2) a child's most basic psychological need is involvement; and (3) a child has four possible choices in life (good somebody, good nobody, bad somebody, or severely mentally ill.) A three step approach for implementing hidden reason theory is…
Hidden acoustic information revealed by intentional nonlinearity

Science.gov (United States)

Dowling, David R.

2017-11-01

Acoustic waves are omnipresent in modern life and are well described by the linearized equations of fluid dynamics. Once generated, acoustic waves carry and collect information about their source and the environment through which they propagate, respectively, and this information may be retrieved by analyzing recordings of these waves. Because of this, acoustics is the primary means for observation, surveillance, reconnaissance, and remote sensing in otherwise opaque environments, such as the Earth's oceans and crust, and the interior of the human body. For such information-retrieval tasks, acoustic fields are nearly always interrogated within their recorded frequency range or bandwidth. However, this frequency-range restriction is not general; acoustic fields may also carry (hidden) information at frequencies outside their bandwidth. Although such a claim may seem counter intuitive, hidden acoustic-field information can be revealed by re-introducing a marquee trait of fluid dynamics: nonlinearity. In particular, an intentional quadratic nonlinearity - a form of intra-signal heterodyning - can be used to obtain acoustic field information at frequencies outside a recorded acoustic field's bandwidth. This quadratic nonlinearity enables a variety of acoustic remote sensing applications that were long thought to be impossible. In particular, it allows the detrimental effects of sparse recordings and random scattering to be suppressed when the original acoustic field has sufficient bandwidth. In this presentation, the topic is developed heuristically, with a just brief exposition of the relevant mathematics. Hidden acoustic field information is then revealed from simulated and measured acoustic fields in simple and complicated acoustic environments involving frequencies from a few Hertz to more than 100 kHz, and propagation distances from tens of centimeters to hundreds of kilometers. Sponsored by ONR, NAVSEA, and NSF.
Hidden worlds in quantum physics

CERN Document Server

Gouesbet, Gérard

2014-01-01

The past decade has witnessed a resurgence in research and interest in the areas of quantum computation and entanglement. This new book addresses the hidden worlds or variables of quantum physics. Author Gérard Gouesbet studied and worked with a former student of Louis de Broglie, a pioneer of quantum physics. His presentation emphasizes the history and philosophical foundations of physics, areas that will interest lay readers as well as professionals and advanced undergraduate and graduate students of quantum physics. The introduction is succeeded by chapters offering background on relevant concepts in classical and quantum mechanics, a brief history of causal theories, and examinations of the double solution, pilot wave, and other hidden-variables theories. Additional topics include proofs of possibility and impossibility, contextuality, non-locality, classification of hidden-variables theories, and stochastic quantum mechanics. The final section discusses how to gain a genuine understanding of quantum mec...
TRADE instructional materials for SARA/OSHA training. Volume 2, Managers and supervisors training

Energy Technology Data Exchange (ETDEWEB)

1989-03-01

This document provides instructional materials for an eight-hour training course for managers and supervisors of hazardous waste sites. It is one of three volumes of course materials TRADE is preparing to help DOE contractor training staff comply with 29 CFR 1910.120, the Occupational Health and Safety Administration (OSHA) rule that implements Title I of the Superfund Amendments and Reauthorization Act (SARA) of 1986. OSHA`s final rule for hazardous waste operators was published in the Federal Register of March 6, 1989 (54 FR 9294). Combined with the materials in Volumes I and III and with appropriate site-specific information, these materials will help DOE contractors to meet the requirements of 1910.120 (e) that ``on-site management and supervisors directly responsible for, or who supervise employees engaged in, hazardous waste operations`` receive the same initial training as that of the employees they supervise and at least eight additional hours of specialized training in managing hazardous waste operations.
Hidden Valley Search at ATLAS

CERN Document Server

Verducci, M

2011-01-01

A number of extensions of the Standard Model result in neutral and weakly-coupled particles that decay to multi hadrons or multi leptons with macroscopic decay lengths. These particles with decay paths that can be comparable with ATLAS detector dimensions represent, from an experimental point of view, a challenge both for the trigger and for the reconstruction capabilities of the ATLAS detector. We will present a set of signature driven triggers for the ATLAS detector that target such displaced decays and evaluate their performances for some benchmark models and describe analysis strategies and limits on the production of such long-lived particles. A first estimation of the Hidden Valley trigger rates has been evaluated with 6 pb-1 of data collected at ATLAS during the data taking of 2010.
Hidden charged dark matter and chiral dark radiation

Science.gov (United States)

Ko, P.; Nagata, Natsumi; Tang, Yong

2017-10-01

In the light of recent possible tensions in the Hubble constant H0 and the structure growth rate σ8 between the Planck and other measurements, we investigate a hidden-charged dark matter (DM) model where DM interacts with hidden chiral fermions, which are charged under the hidden SU(N) and U(1) gauge interactions. The symmetries in this model assure these fermions to be massless. The DM in this model, which is a Dirac fermion and singlet under the hidden SU(N), is also assumed to be charged under the U(1) gauge symmetry, through which it can interact with the chiral fermions. Below the confinement scale of SU(N), the hidden quark condensate spontaneously breaks the U(1) gauge symmetry such that there remains a discrete symmetry, which accounts for the stability of DM. This condensate also breaks a flavor symmetry in this model and Nambu-Goldstone bosons associated with this flavor symmetry appear below the confinement scale. The hidden U(1) gauge boson and hidden quarks/Nambu-Goldstone bosons are components of dark radiation (DR) above/below the confinement scale. These light fields increase the effective number of neutrinos by δNeff ≃ 0.59 above the confinement scale for N = 2, resolving the tension in the measurements of the Hubble constant by Planck and Hubble Space Telescope if the confinement scale is ≲1 eV. DM and DR continuously scatter with each other via the hidden U(1) gauge interaction, which suppresses the matter power spectrum and results in a smaller structure growth rate. The DM sector couples to the Standard Model sector through the exchange of a real singlet scalar mixing with the Higgs boson, which makes it possible to probe our model in DM direct detection experiments. Variants of this model are also discussed, which may offer alternative ways to investigate this scenario.
Collateral benefits and hidden hazards of soil arsenic during abatement assessment of residential lead hazards

International Nuclear Information System (INIS)

Elless, M.P.; Ferguson, B.W.; Bray, C.A.; Patch, S.; Mielke, H.; Blaylock, M.J.

2008-01-01

Abatement of soil-lead hazards may also reduce human exposure to other soil toxins, thereby achieving significant collateral benefits that are not accounted for today. This proposition was tested with the specific case of soil-arsenic, where 1726 residential soil samples were collected and analyzed for lead and arsenic. The study found that these two toxins coexisted in most samples, but their concentrations were weakly correlated, reflecting the differing sources for each toxin. Collateral benefits of 9% would be achieved during abatement of the lead-contaminated soils having elevated arsenic concentrations. However, a hidden hazard of 16% was observed by overlooking elevated arsenic concentrations in soils having lead concentrations not requiring abatement. This study recommends that soil samples collected under HUD programs should be collected from areas of lead and arsenic deposition and tested for arsenic as well as lead, and that soil abatement decisions consider soil-arsenic as well as soil-lead guidelines. - Coexistence of arsenic at elevated concentrations with lead in residential soils undergoing lead hazard assessment is often overlooked, providing either collateral benefits or hidden hazards
Adaptive filtering for hidden node detection and tracking in networks.

Science.gov (United States)

Hamilton, Franz; Setzer, Beverly; Chavez, Sergio; Tran, Hien; Lloyd, Alun L

2017-07-01

The identification of network connectivity from noisy time series is of great interest in the study of network dynamics. This connectivity estimation problem becomes more complicated when we consider the possibility of hidden nodes within the network. These hidden nodes act as unknown drivers on our network and their presence can lead to the identification of false connections, resulting in incorrect network inference. Detecting the parts of the network they are acting on is thus critical. Here, we propose a novel method for hidden node detection based on an adaptive filtering framework with specific application to neuronal networks. We consider the hidden node as a problem of missing variables when model fitting and show that the estimated system noise covariance provided by the adaptive filter can be used to localize the influence of the hidden nodes and distinguish the effects of different hidden nodes. Additionally, we show that the sequential nature of our algorithm allows for tracking changes in the hidden node influence over time.
Social humanoid robot SARA: development of the wrist mechanism

Science.gov (United States)

Penčić, M.; Rackov, M.; Čavić, M.; Kiss, I.; Cioată, V. G.

2018-01-01

This paper presents the development of a wrist mechanism for humanoid robots. The research was conducted within the project which develops social humanoid robot Sara - a mobile anthropomorphic platform for researching the social behaviour of robots. There are two basic ways for the realization of humanoid wrist. The first one is based on biologically inspired structures that have variable stiffness, and the second one on low backlash mechanisms that have high stiffness. Our solution is low backlash differential mechanism that requires small actuators. Based on the kinematic-dynamic requirements, a dynamic model of the robot wrist is formed. A dynamic simulation for several hand positions was performed and the driving torques of the wrist mechanism were determined. The realized wrist has 2 DOFs and enables movements in the direction of flexion/extension 115°, ulnar/radial deviation ±45° and the combination of these two movements. It consists of a differential mechanism with three spur bevel gears, two of which are driving and identical, while the last one is the driven gear to which the robot hand is attached. Power transmission and motion from the actuator to the input links of the differential mechanism is realized with two parallel placed identical gear mechanisms. The wrist mechanism has high carrying capacity and reliability, high efficiency, a compact design and low backlash that provides high positioning accuracy and repeatability of movements, which is essential for motion control.
The hidden universe

International Nuclear Information System (INIS)

Disney, M.

1985-01-01

Astronomer Disney has followed a somewhat different tack than that of most popular books on cosmology by concentrating on the notion of hidden (as in not directly observable by its own radiation) matter in the universe
Incremental discovery of hidden structure: Applications in theory of elementary particles

International Nuclear Information System (INIS)

Zytkow, J.M.; Fischer, P.J.

1996-01-01

Discovering hidden structure is a challenging, universal research task in Physics, Chemistry, Biology, and other disciplines. Not only must the elements of hidden structure be postulated by the discoverer, but they can only be verified by indirect evidence, at the level of observable objects. In this paper we describe a framework for hidden structure discovery, built on a constructive definition of hidden structure. This definition leads to operators that build models of hidden structure step by step, postulating hidden objects, their combinations and properties, reactions described in terms of hidden objects, and mapping between the hidden and the observed structure. We introduce the operator dependency diagram, which shows the order of operator application and model evaluation. Different observational knowledge supports different evaluation criteria, which lead to different search systems with verifiable sequences of operator applications. Isomorph-free structure generation is another issue critical for efficiency of search. We apply our framework in the system GELL-MANN, that hypothesizes hidden structure for elementary particles and we present the results of a large scale search for quark models
Hidden gauge structure of supersymmetric free differential algebras

Energy Technology Data Exchange (ETDEWEB)

Andrianopoli, Laura [DISAT, Politecnico di Torino,Corso Duca degli Abruzzi 24, I-10129 Turin (Italy); INFN - Sezione di Torino,Torino (Italy); D’Auria, Riccardo [DISAT, Politecnico di Torino,Corso Duca degli Abruzzi 24, I-10129 Turin (Italy); Ravera, Lucrezia [DISAT, Politecnico di Torino,Corso Duca degli Abruzzi 24, I-10129 Turin (Italy); INFN - Sezione di Torino,Torino (Italy)

2016-08-16

The aim of this paper is to clarify the role of the nilpotent fermionic generator Q{sup ′} introduced in http://dx.doi.org/10.1016/0550-3213(82)90376-5 and appearing in the hidden supergroup underlying the free differential algebra (FDA) of D=11 supergravity. We give a physical explanation of its role by looking at the gauge properties of the theory. We find that its presence is necessary, in order that the extra 1-forms of the hidden supergroup give rise to the correct gauge transformations of the p-forms of the FDA. This interpretation is actually valid for any supergravity containing antisymmetric tensor fields, and any supersymmetric FDA can always be traded for a hidden Lie superalgebra containing extra fermionic nilpotent generators. As an interesting example we construct the hidden superalgebra associated with the FDA of N=2, D=7 supergravity. In this case we are able to parametrize the mutually non local 2- and 3-form B{sup (2)} and B{sup (3)} in terms of hidden 1-forms and find that supersymmetry and gauge invariance require in general the presence of two nilpotent fermionic generators in the hidden algebra. We propose that our approach, where all the invariances of the FDA are expressed as Lie derivatives of the p-forms in the hidden supergroup manifold, could be an appropriate framework to discuss theories defined in enlarged versions of superspace recently considered in the literature, such us double field theory and its generalizations.
Fitting Hidden Markov Models to Psychological Data

Directory of Open Access Journals (Sweden)

Ingmar Visser

2002-01-01

Full Text Available Markov models have been used extensively in psychology of learning. Applications of hidden Markov models are rare however. This is partially due to the fact that comprehensive statistics for model selection and model assessment are lacking in the psychological literature. We present model selection and model assessment statistics that are particularly useful in applying hidden Markov models in psychology. These statistics are presented and evaluated by simulation studies for a toy example. We compare AIC, BIC and related criteria and introduce a prediction error measure for assessing goodness-of-fit. In a simulation study, two methods of fitting equality constraints are compared. In two illustrative examples with experimental data we apply selection criteria, fit models with constraints and assess goodness-of-fit. First, data from a concept identification task is analyzed. Hidden Markov models provide a flexible approach to analyzing such data when compared to other modeling methods. Second, a novel application of hidden Markov models in implicit learning is presented. Hidden Markov models are used in this context to quantify knowledge that subjects express in an implicit learning task. This method of analyzing implicit learning data provides a comprehensive approach for addressing important theoretical issues in the field.
Geometric phases and hidden local gauge symmetry

International Nuclear Information System (INIS)

Fujikawa, Kazuo

2005-01-01

The analysis of geometric phases associated with level crossing is reduced to the familiar diagonalization of the Hamiltonian in the second quantized formulation. A hidden local gauge symmetry, which is associated with the arbitrariness of the phase choice of a complete orthonormal basis set, becomes explicit in this formulation (in particular, in the adiabatic approximation) and specifies physical observables. The choice of a basis set which specifies the coordinate in the functional space is arbitrary in the second quantization, and a subclass of coordinate transformations, which keeps the form of the action invariant, is recognized as the gauge symmetry. We discuss the implications of this hidden local gauge symmetry in detail by analyzing geometric phases for cyclic and noncyclic evolutions. It is shown that the hidden local symmetry provides a basic concept alternative to the notion of holonomy to analyze geometric phases and that the analysis based on the hidden local gauge symmetry leads to results consistent with the general prescription of Pancharatnam. We however note an important difference between the geometric phases for cyclic and noncyclic evolutions. We also explain a basic difference between our hidden local gauge symmetry and a gauge symmetry (or equivalence class) used by Aharonov and Anandan in their definition of generalized geometric phases

Locating Hidden Servers

National Research Council Canada - National Science Library

Oeverlier, Lasse; Syverson, Paul F

2006-01-01

.... Announced properties include server resistance to distributed DoS. Both the EFF and Reporters Without Borders have issued guides that describe using hidden services via Tor to protect the safety of dissidents as well as to resist censorship...
Hidden biodiversity in entomological collections: The overlooked co-occurrence of dipteran and hymenopteran ant parasitoids in stored biological material.

Directory of Open Access Journals (Sweden)

Gabriela Pérez-Lachaud

Full Text Available Biological collections around the world are the repository of biodiversity on Earth; they also hold a large quantity of unsorted, unidentified, or misidentified material and can house behavioral information on species that are difficult to access or no longer available to science. Among the unsorted, alcohol-preserved material stored in the Formicidae Collection of the 'El Colegio de la Frontera Sur' Research Center (Chetumal, Mexico, we found nine colonies of the ponerine ant Neoponera villosa, that had been collected in bromeliads at Calakmul (Campeche, Mexico in 1999. Ants and their brood were revised for the presence of any sign of parasitism. Cocoons were dissected and their content examined under a stereomicroscope. Six N. villosa prepupae had been attacked by the ectoparasitoid syrphid fly Hypselosyrphus trigonus Hull (Syrphidae: Microdontinae, to date the only known dipteran species of the Microdontinae with a parasitoid lifestyle. In addition, six male pupae from three colonies contained gregarious endoparasitoid wasps. These were specialized in parasitizing this specific host caste as no gyne or worker pupae displayed signs of having been attacked. Only immature stages (larvae and pupae of the wasp could be obtained. Due to the long storage period, DNA amplification failed; however, based on biological and morphological data, pupae were placed in the Encyrtidae family. This is the first record of an encyrtid wasp parasitizing N. villosa, and the second example of an encyrtid as a primary parasitoid of ants. Furthermore, it is also the first record of co-occurrence of a dipteran ectoparasitoid and a hymenopteran endoparasitoid living in sympatry within the same population of host ants. Our findings highlight the importance of biological collections as reservoirs of hidden biodiversity, not only at the taxonomic level, but also at the behavioral level, revealing complex living networks. They also highlight the need for funding in order
Hidden neural networks

DEFF Research Database (Denmark)

Krogh, Anders Stærmose; Riis, Søren Kamaric

1999-01-01

A general framework for hybrids of hidden Markov models (HMMs) and neural networks (NNs) called hidden neural networks (HNNs) is described. The article begins by reviewing standard HMMs and estimation by conditional maximum likelihood, which is used by the HNN. In the HNN, the usual HMM probability...... parameters are replaced by the outputs of state-specific neural networks. As opposed to many other hybrids, the HNN is normalized globally and therefore has a valid probabilistic interpretation. All parameters in the HNN are estimated simultaneously according to the discriminative conditional maximum...... likelihood criterion. The HNN can be viewed as an undirected probabilistic independence network (a graphical model), where the neural networks provide a compact representation of the clique functions. An evaluation of the HNN on the task of recognizing broad phoneme classes in the TIMIT database shows clear...
Hidden neural networks: application to speech recognition

DEFF Research Database (Denmark)

Riis, Søren Kamaric

1998-01-01

We evaluate the hidden neural network HMM/NN hybrid on two speech recognition benchmark tasks; (1) task independent isolated word recognition on the Phonebook database, and (2) recognition of broad phoneme classes in continuous speech from the TIMIT database. It is shown how hidden neural networks...
Adult-acquired hidden penis in obese patients: a critical survey of the literature.

Science.gov (United States)

Cavayero, Chase T; Cooper, Meghan A; Harlin, Stephen L

2015-03-01

Hidden penis is anatomically defined by a lack of firm attachments of the skin and dartos fascia to the underlying Buck fascia. To critically appraise the research evidence that could support the most effective surgical techniques for adult-acquired hidden penis in obese patients. Studies investigating patients with a diagnosis of hidden penis were identified. Of these studies, only those with adult patients classified as overweight or obese (body mass index >25) were included in the review. Three reviewers examined the abstracts of the studies identified in the initial Medline search, and abstracts considered potentially relevant underwent full-text review. Studies that included patients with congenital, iatrogenic (eg, circumcision issues or aesthetic genital surgery), or traumatic causes of hidden penis were excluded. Studies that did not define the diagnostic criteria for hidden penis were excluded to minimize the risk of definition bias. The quality of evidence for each study was determined after considering the following sources of bias: method of allocation to study groups, data analysis, presence of baseline differences between groups, objectivity of outcome, and completeness of follow-up. Using these criteria, studies were then graded as high, moderate, or low in quality. Seven studies with a total of 119 patients met the inclusion criteria. All but 1 of the studies were nonrandomized. One study provided a clear presentation of results and appropriate statistical analysis. Six studies accounted for individual-based differences, and 1 study failed to account for baseline differences altogether. Four studies addressed follow-up. One study was of high quality, 2 were of moderate quality, and 4 were of low quality. Building a clinical practice guideline for the surgical management of hidden penis has proven difficult because of a lack of high-quality, statistically significant data in the research synthesis. The authors elucidate the challenges and epitomize
Hidden Crises and Communication: An Interactional Analysis of Hidden Crises

NARCIS (Netherlands)

dr. Annette Klarenbeek

2011-01-01

In this paper I describe the ways in which the communication discipline can make a hidden crisis transparent. For this purpose I examine the concept of crisis entrepreneurship from a communication point of view. Using discourse analysis, I analyse the discursive practices of crisis entrepreneurs in
Hidden Crises and Communication : An Interactional Analysis of Hidden Crises

NARCIS (Netherlands)

dr. Annette Klarenbeek

2011-01-01

In this paper I describe the ways in which the communication discipline can make a hidden crisis transparent. For this purpose I examine the concept of crisis entrepreneurship from a communication point of view. Using discourse analysis, I analyse the discursive practices of crisis entrepreneurs in
Hidden treasures - 50 km points of interests

Science.gov (United States)

Lommi, Matias; Kortelainen, Jaana

2015-04-01

Tampere is third largest city in Finland and a regional centre. During 70's there occurred several communal mergers. Nowadays this local area has both strong and diversed identity - from wilderness and agricultural fields to high density city living. Outside the city center there are interesting geological points unknown for modern city settlers. There is even a local proverb, "Go abroad to Teisko!". That is the area the Hidden Treasures -student project is focused on. Our school Tammerkoski Upper Secondary School (or Gymnasium) has emphasis on visual arts. We are going to offer our art students scientific and artistic experiences and knowledge about the hidden treasures of Teisko area and involve the Teisko inhabitants into this project. Hidden treasures - Precambrian subduction zone and a volcanism belt with dense bed of gold (Au) and arsenic (As), operating goldmines and quarries of minerals and metamorphic slates. - North of subduction zone a homogenic precambrian magmastone area with quarries, products known as Kuru Grey. - Former ashores of post-glasial Lake Näsijärvi and it's sediments enabled the developing agriculture and sustained settlement. Nowadays these ashores have both scenery and biodiversity values. - Old cattle sheds and dairy buildings made of local granite stones related to cultural stonebuilding inheritance. - Local active community of Kapee, about 100 inhabitants. Students will discover information of these "hidden" phenomena, and rendering this information trough Enviromental Art Method. Final form of this project will be published in several artistic and informative geocaches. These caches are achieved by a GPS-based special Hidden Treasures Cycling Route and by a website guiding people to find these hidden points of interests.
Hidden Markov Model Application to Transfer The Trader Online Forex Brokers

Directory of Open Access Journals (Sweden)

Farida Suharleni

2012-05-01

Full Text Available Hidden Markov Model is elaboration of Markov chain, which is applicable to cases that can’t directly observe. In this research, Hidden Markov Model is used to know trader’s transition to broker forex online. In Hidden Markov Model, observed state is observable part and hidden state is hidden part. Hidden Markov Model allows modeling system that contains interrelated observed state and hidden state. As observed state in trader’s transition to broker forex online is category 1, category 2, category 3, category 4, category 5 by condition of every broker forex online, whereas as hidden state is broker forex online Marketiva, Masterforex, Instaforex, FBS and Others. First step on application of Hidden Markov Model in this research is making construction model by making a probability of transition matrix (A from every broker forex online. Next step is making a probability of observation matrix (B by making conditional probability of five categories, that is category 1, category 2, category 3, category 4, category 5 by condition of every broker forex online and also need to determine an initial state probability (π from every broker forex online. The last step is using Viterbi algorithm to find hidden state sequences that is broker forex online sequences which is the most possible based on model and observed state that is the five categories. Application of Hidden Markov Model is done by making program with Viterbi algorithm using Delphi 7.0 software with observed state based on simulation data. Example: By the number of observation T = 5 and observed state sequences O = (2,4,3,5,1 is found hidden state sequences which the most possible with observed state O as following : where X1 = FBS, X2 = Masterforex, X3 = Marketiva, X4 = Others, and X5 = Instaforex.
Hidden symmetries in minimal five-dimensional supergravity

International Nuclear Information System (INIS)

Poessel, Markus; Silva, Sebastian

2004-01-01

We study the hidden symmetries arising in the dimensional reduction of d=5, N=2 supergravity to three dimensions. Extending previous partial results for the bosonic part, we give a derivation that includes fermionic terms, shedding light on the appearance of the local hidden symmetry SO(4) in the reduction
Local models and hidden nonlocality in Quantum Theory

OpenAIRE

Guerini, Leonardo

2014-01-01

This Master's thesis has two central subjects: the simulation of correlations generated by local measurements on entangled quantum states by local hidden-variables models and the revelation of hidden nonlocality. We present and detail the Werner's local model and the hidden nonlocality of some Werner states of dimension $d\\geq5$, the Gisin-Degorre's local model for a Werner state of dimension $d=2$ and the local model of Hirsch et al. for mixtures of the singlet state and noise, all of them f...
Searching for hidden-charm baryonium signals in QCD sum rules

Energy Technology Data Exchange (ETDEWEB)

Chen, Hua-Xing; Zhou, Dan [Beihang University, School of Physics, Beijing Key Laboratory of Advanced Nuclear Materials and Physics, Beijing (China); Chen, Wei [University of Saskatchewan, Department of Physics and Engineering Physics, Saskatoon, SK (Canada); Liu, Xiang [Lanzhou University, School of Physical Science and Technology, Lanzhou (China); Lanzhou University, Research Center for Hadron and CSR Physics, Institute of Modern Physics of CAS, Lanzhou (China); Zhu, Shi-Lin [Peking University, School of Physics, State Key Laboratory of Nuclear Physics and Technology, Beijing (China); Collaborative Innovation Center of Quantum Matter, Beijing (China); Peking University, Center of High Energy Physics, Beijing (China)

2016-11-15

We give an explicit QCD sum rule investigation for hidden-charm baryonium states with the quark content u anti ud anti dc anti c, spin J = 0/1/2/3, and of both positive and negative parities. We systematically construct the relevant local hidden-charm baryonium interpolating currents, which can actually couple to various structures, including hidden-charm baryonium states, charmonium states plus two pions, and hidden-charm tetraquark states plus one pion, etc. We do not know which structure these currents couple to at the beginning, but after sum rule analyses we can obtain some information. We find some of them can couple to hidden-charm baryonium states, using which we evaluate the masses of the lowest-lying hidden-charm baryonium states with quantum numbers J{sup P} = 2{sup -}/3{sup -}/0{sup +}/1{sup +}/2{sup +} to be around 5.0 GeV. We suggest to search for hidden-charm baryonium states, especially the one of J = 3{sup -}, in the D-wave J/ψππ and P-wave J/ψρ and J/ψω channels in this energy region. (orig.)
Hidden symmetries in five-dimensional supergravity

International Nuclear Information System (INIS)

Poessel, M.

2003-05-01

This thesis is concerned with the study of hidden symmetries in supergravity, which play an important role in the present picture of supergravity and string theory. Concretely, the appearance of a hidden G 2(+2) /SO(4) symmetry is studied in the dimensional reduction of d=5, N=2 supergravity to three dimensions - a parallel model to the more famous E 8(+8) /SO(16) case in eleven-dimensional supergravity. Extending previous partial results for the bosonic part, I give a derivation that includes fermionic terms. This sheds new light on the appearance of the local hidden symmetry SO(4) in the reduction, and shows up an unusual feature which follows from an analysis of the R-symmetry associated with N=4 supergravity and of the supersymmetry variations, and which has no parallel in the eleven-dimensional case: The emergence of an additional SO(3) as part of the enhanced local symmetry, invisible in the dimensional reduction of the gravitino, and corresponding to the fact that, of the SO(4) used in the coset model, only the diagonal SO(3) is visible immediately upon dimensional reduction. The uncovering of the hidden symmetries proceeds via the construction of the proper coset gravity in three dimensions, and matching it with the Lagrangian obtained from the reduction. (orig.)
QCD sum rule study of hidden-charm pentaquarks

Energy Technology Data Exchange (ETDEWEB)

Chen, Hua-Xing; Cui, Er-Liang [Beihang University, School of Physics and Beijing Key Laboratory of Advanced Nuclear Materials and Physics, Beijing (China); Chen, Wei; Steele, T.G. [University of Saskatchewan, Department of Physics and Engineering Physics, Saskatoon, Saskatchewan (Canada); Liu, Xiang [Lanzhou University, School of Physical Science and Technology, Lanzhou (China); Lanzhou University and Institute of Modern Physics of CAS, Research Center for Hadron and CSR Physics, Lanzhou (China); Zhu, Shi-Lin [Peking University, School of Physics and State Key Laboratory of Nuclear Physics and Technology, Beijing (China); Collaborative Innovation Center of Quantum Matter, Beijing (China); Peking University, Center of High Energy Physics, Beijing (China)

2016-10-15

We study the mass spectra of hidden-charm pentaquarks having spin J = (1)/(2)/(3)/(2)/(5)/(2) and quark contents uudc anti c. We systematically construct all the relevant local hidden-charm pentaquark currents, and we select some of them to perform QCD sum rule analyses. We find that the P{sub c}(4380) and P{sub c}(4450) can be identified as hidden-charm pentaquark states composed of an anti-charmed meson and a charmed baryon. Besides them, we also find (a) the lowest-lying hidden-charm pentaquark state of J{sup P} = 1/2{sup -} has the mass 4.33{sup +0.17}{sub -0.13} GeV, while the one of J{sup P} = 1/2{sup +} is significantly higher, that is, around 4.7-4.9 GeV; (b) the lowest-lying hidden-charm pentaquark state of J{sup P} = 3/2{sup -} has the mass 4.37{sup +0.18}{sub -0.13} GeV, consistent with the P{sub c}(4380) of J{sup P} = 3/2{sup -}, while the one of J{sup P} = 3/2{sup +} is also significantly higher, that is, above 4.6 GeV; (c) the hidden-charm pentaquark state of J{sup P} = 5/2{sup -} has a mass around 4.5-4.6 GeV, slightly larger than the P{sub c}(4450) of J{sup P} = 5/2{sup +}. (orig.)
Sociocultural Dimension of Hidden Content in a Professional Language Curriculum

Directory of Open Access Journals (Sweden)

Ekaterina E. Shishlova

2017-12-01

Full Text Available Introduction: studying curriculum as a pedagogical problem has traditionally been reduced to the analysis of its explicit content, set in official educational documents. However, a much less studied hidden content plays a significant role in education. So, what is the role of the hidden curriculum during professional language training? The purpose of the article is to determine the potential impact of hidden curriculum on students’ conceptual worldview. Comparing the worldview presented in textbooks with students’ one has allowed us to estimate the rate of influence of hidden curr iculum. Materials and Methods: the methodological basis of the work is the cultural concept of personalityoriented education. The methodology for studying the role of hidden curriculum includes four stages: at the first stage, the authors set the criteria for selecting textbooks for analysis and do the selection; at the second stage, the authors select sociocultural concepts for analysis; at the third stage, the scheme of analysis is designed and the analysis of textbooks is done; at the fourth stage, the authors identify the potential influence of hidden curriculum on students’ conceptual worldview. Results: the structure of hidden curriculum has been determined and the scheme for analysing its subject component has been developed. The authors have identified a significant influence of hidden curriculum on students’ worldview, which represents the scientific novelty of the article. Discussion and Conclusions: the article gives the definition of a hidden curriculum which is new for Russian pedagogy and presents a methodology for its analysis in EFL textbooks. That analysis is recommended to be conducted when selecting teaching materials both i n languages and other humanities.
Infinite hidden conditional random fields for human behavior analysis.

Science.gov (United States)

Bousmalis, Konstantinos; Zafeiriou, Stefanos; Morency, Louis-Philippe; Pantic, Maja

2013-01-01

Hidden conditional random fields (HCRFs) are discriminative latent variable models that have been shown to successfully learn the hidden structure of a given classification problem (provided an appropriate validation of the number of hidden states). In this brief, we present the infinite HCRF (iHCRF), which is a nonparametric model based on hierarchical Dirichlet processes and is capable of automatically learning the optimal number of hidden states for a classification task. We show how we learn the model hyperparameters with an effective Markov-chain Monte Carlo sampling technique, and we explain the process that underlines our iHCRF model with the Restaurant Franchise Rating Agencies analogy. We show that the iHCRF is able to converge to a correct number of represented hidden states, and outperforms the best finite HCRFs--chosen via cross-validation--for the difficult tasks of recognizing instances of agreement, disagreement, and pain. Moreover, the iHCRF manages to achieve this performance in significantly less total training, validation, and testing time.
The acquisition and supervision system of S.A.R.A.'s (Accelerator system Rhone-Alpes) parameters

International Nuclear Information System (INIS)

Iazzourene, F.

1982-01-01

The acquisition and supervision system of SARA's (Systeme Accelerateur Rhone-Alpes) parameters is built up. The basic hardware consists of: - A PDP 11/10 computer with a 64 K bytes memory capacity. The system and load device is a floppy disk of 28 megabytes capacity. - A CAMAC crate including a data logger with 224 input channels, a terminal driver (JTY21) and three modules designed for reading out a few digital data, for instance polarities of power supplies. The software provides three distinct programs: AKITS, which uses 3 commands, detects and signals functioning defects in the CAMAC modules used. AKIDO which uses 11 commands, is the acquisition and organization program of the accelerator's functioning parameters. AKISUR is the supervision program of the functioning parameter's stability, within a fixed gap, during the accelerator running [fr
Instructional materials for SARA/OSHA training. Volume 1, General site working training

Energy Technology Data Exchange (ETDEWEB)

Copenhaver, E.D.; White, D.A.; Wells, S.M. [Oak Ridge National Lab., TN (United States)

1988-04-01

This proposed 24 hour ORNL SARA/OSHA training curriculum emphasizes health and safety concerns in hazardous waste operations as well as methods of worker protection. Consistent with guidelines for hazardous waste site activities developed jointly by National Institute for Occupational Safety and Health, Occupational Safety and Health Administration, US Coast Guard, and the Envirorunental Protection Agency, the program material will address Basic Training for General Site Workers to include: ORNL Site Safety Documentation, Safe Work Practices, Nature of Anticipated Hazards, Handling Emergencies and Self-Rescue, Employee Rights and Responsibilities, Demonstration of Use, Care, and Limitations of Personal Protective, Clothing and Equipment, and Demonstration of Monitoring Equipment and Sampling Techniques. The basic training courses includes major fundamentals of industrial hygiene presented to the workers in a format that encourages them to assume responsibility for their own safety and health protection. Basic course development has focused on the special needs of ORNL facilities. Because ORNL generates chemical wastes, radioactive wastes, and mixed wastes, we have added significant modules on radiation protection in general, as well as modules on radiation toxicology and on radiation protective clothing and equipment.
Detecting hidden particles with MATHUSLA

Science.gov (United States)

Evans, Jared A.

2018-03-01

A hidden sector containing light long-lived particles provides a well-motivated place to find new physics. The recently proposed MATHUSLA experiment has the potential to be extremely sensitive to light particles originating from rare meson decays in the very long lifetime region. In this work, we illustrate this strength with the specific example of a light scalar mixed with the standard model-like Higgs boson, a model where MATHUSLA can further probe unexplored parameter space from exotic Higgs decays. Design augmentations should be considered in order to maximize the ability of MATHUSLA to discover very light hidden sector particles.
Zipf exponent of trajectory distribution in the hidden Markov model

Science.gov (United States)

Bochkarev, V. V.; Lerner, E. Yu

2014-03-01

This paper is the first step of generalization of the previously obtained full classification of the asymptotic behavior of the probability for Markov chain trajectories for the case of hidden Markov models. The main goal is to study the power (Zipf) and nonpower asymptotics of the frequency list of trajectories of hidden Markov frequencys and to obtain explicit formulae for the exponent of the power asymptotics. We consider several simple classes of hidden Markov models. We prove that the asymptotics for a hidden Markov model and for the corresponding Markov chain can be essentially different.

Zipf exponent of trajectory distribution in the hidden Markov model

International Nuclear Information System (INIS)

Bochkarev, V V; Lerner, E Yu

2014-01-01

This paper is the first step of generalization of the previously obtained full classification of the asymptotic behavior of the probability for Markov chain trajectories for the case of hidden Markov models. The main goal is to study the power (Zipf) and nonpower asymptotics of the frequency list of trajectories of hidden Markov frequencys and to obtain explicit formulae for the exponent of the power asymptotics. We consider several simple classes of hidden Markov models. We prove that the asymptotics for a hidden Markov model and for the corresponding Markov chain can be essentially different
SHIFT: server for hidden stops analysis in frame-shifted translation.

Science.gov (United States)

Gupta, Arun; Singh, Tiratha Raj

2013-02-23

Frameshift is one of the three classes of recoding. Frame-shifts lead to waste of energy, resources and activity of the biosynthetic machinery. In addition, some peptides synthesized after frame-shifts are probably cytotoxic which serve as plausible cause for innumerable number of diseases and disorders such as muscular dystrophies, lysosomal storage disorders, and cancer. Hidden stop codons occur naturally in coding sequences among all organisms. These codons are associated with the early termination of translation for incorrect reading frame selection and help to reduce the metabolic cost related to the frameshift events. Researchers have identified several consequences of hidden stop codons and their association with myriad disorders. However the wealth of information available is speckled and not effortlessly acquiescent to data-mining. To reduce this gap, this work describes an algorithmic web based tool to study hidden stops in frameshifted translation for all the lineages through respective genetic code systems. This paper describes SHIFT, an algorithmic web application tool that provides a user-friendly interface for identifying and analyzing hidden stops in frameshifted translation of genomic sequences for all available genetic code systems. We have calculated the correlation between codon usage frequencies and the plausible contribution of codons towards hidden stops in an off-frame context. Markovian chains of various order have been used to model hidden stops in frameshifted peptides and their evolutionary association with naturally occurring hidden stops. In order to obtain reliable and persuasive estimates for the naturally occurring and predicted hidden stops statistical measures have been implemented. This paper presented SHIFT, an algorithmic tool that allows user-friendly exploration, analysis, and visualization of hidden stop codons in frameshifted translations. It is expected that this web based tool would serve as a useful complement for
Asymptotics for Estimating Equations in Hidden Markov Models

DEFF Research Database (Denmark)

Hansen, Jørgen Vinsløv; Jensen, Jens Ledet

Results on asymptotic normality for the maximum likelihood estimate in hidden Markov models are extended in two directions. The stationarity assumption is relaxed, which allows for a covariate process influencing the hidden Markov process. Furthermore a class of estimating equations is considered...
A hidden service model based on HS-HS anonymous network

Science.gov (United States)

Meng, Yitong; Zhao, Xing; Fei, Jinlong; Zhu, Yuefei

2017-10-01

The Hidden Service provided by Tor anonymous network can effectively protect the anonymity and security of the Hidden server, this article through the analysis of the data packet structure of Tor, three jump transmission mechanism and link establishment protocol and Hidden Service communication process, in view of the Hidden node number too much, link building Service for too long and too redundant link problem. An improved hidden service model HS-HS is proposed that incorporating multiple transmission link and reuse, and at the same time will be important transit point for reuse protection link anonymity, through the ExperimenTor simulation environment test, verify the improved model of HS-HS can be more effective in guarantee anonymity and security, improve the overall efficiency of data transmission, to meet the needs of today's anonymous service.
VISIBLE COSTS AND HIDDEN COSTS IN THE BAKING INDUSTRY

Directory of Open Access Journals (Sweden)

Criveanu Maria

2013-04-01

Full Text Available Hidden costs are present in the activity of any company, hardly identified in the traditional administrative accounting. The high levels of the hidden costs and their unknown presence have serious consequences on the decisions made by the managers. This paper aims at presenting some aspects related to the hidden costs that occur in the activity of the companies in the baking industry and the possibilities to reduce their level.
The hidden values

DEFF Research Database (Denmark)

Rasmussen, Birgitte; Jensen, Karsten Klint

“The Hidden Values - Transparency in Decision-Making Processes Dealing with Hazardous Activities”. The report seeks to shed light on what is needed to create a transparent framework for political and administrative decisions on the use of GMOs and chemical products. It is our hope that the report...
Suppressing the QCD axion abundance by hidden monopoles

International Nuclear Information System (INIS)

Kawasaki, Masahiro

2015-11-01

We study the Witten effect of hidden monopoles on the QCD axion dynamics, and show that its abundance as well as isocurvature perturbations can be significantly suppressed if there is a sufficient amount of hidden monopoles. When the hidden monopoles make up a significant fraction of dark matter, the Witten effect suppresses the abundance of axion with the decay constant smaller than 10 12 GeV. The cosmological domain wall problem of the QCD axion can also be avoided, relaxing the upper bound on the decay constant when the Peccei-Quinn symmetry is spontaneously broken after inflation.
PERBANDINGAN ALGORITMA HIDDEN SPACE REMOVAL: Z-UFFER DAN SCANLINE DILIHAT DARI PENGGUNAAN MEMORI DAN KECEPATAN

Directory of Open Access Journals (Sweden)

Djoni Haryadi Setiabudi

2001-01-01

Full Text Available Hidden surface removal is an algorithm used to hide part of the object which is blocked by the object in front of it. If there are two plane crossed each other displayed without Hidden surface removal algorithm, the crossing section is invisible, because one object will block another object without crossing. The crossing sections can be displayed using Hidden surface removal algorithm. Z buffer algorithm implements Hidden Surface Removal by entering color and depth of the visible plane into the buffer, then displays the result on the screen. Scan Line algorithm will scanning the screen row by row of each object surface in three dimension and then displays on the screen after each row scanning. Both of the algorithms will be compared based on the memory usage dan time needed to execute. The experiment shows that Scanline algorithm uses less memory compared with Z-Buffer algoritm. Furthermore, based on the speed, the Scanline is better than the Z-Buffer if the object is collected on the y row, but the Z-Buffer is better than the Scanline if the object scattered and used all rows on the drawing plane and has more surface do displayed. Abstract in Bahasa Indonesia : Hidden surface removal adalah suatu algoritma yang digunakan untuk menghilangkan penampilan bagian yang tertutup oleh objek yang didepannya. Apabila ada dua bidang yang berpotongan, apabila ditampilkan biasa tanpa menggunakan algoritma Hidden surface removal maka bagian yang berpotongan itu akan tidak kelihatan, oleh karena bidang yang satu ditutupi oleh bagian yang lain tanpa memotong. Oleh karena itu untuk menampilkan bidang perpotongan, diperlukan Algoritma Hidden surface removal. Algoritma Z buffer melaksanakan proses Hidden Surface Removal dengan memasukkan warna dan kedalaman bidang permukaan yang tampak ke dalam buffer, dan kemudian setelah selesai hasilnya ditampilkan ke layar. Algoritma Scan Line melakukan scanning untuk setiap baris dari layar bidang gambar untuk setiap
Context Tree Estimation in Variable Length Hidden Markov Models

OpenAIRE

Dumont, Thierry

2011-01-01

We address the issue of context tree estimation in variable length hidden Markov models. We propose an estimator of the context tree of the hidden Markov process which needs no prior upper bound on the depth of the context tree. We prove that the estimator is strongly consistent. This uses information-theoretic mixture inequalities in the spirit of Finesso and Lorenzo(Consistent estimation of the order for Markov and hidden Markov chains(1990)) and E.Gassiat and S.Boucheron (Optimal error exp...
Extracting hidden-photon dark matter from an LC-circuit

International Nuclear Information System (INIS)

Arias, Paola; Arza, Ariel; Gamboa, Jorge; Mendez, Fernando

2014-11-01

We point out that a cold dark matter condensate made of gauge bosons from an extra hidden U(1) sector - dubbed hidden-photons - can create a small, oscillating electric density current. Thus, they could also be searched for in the recently proposed LC-circuit setup conceived for axion cold dark matter search by Sikivie, Sullivan and Tanner. We estimate the sensitivity of this setup for hidden-photon cold dark matter and we find it could cover a sizable, so far unexplored parameter space.
Extracting Hidden-Photon Dark Matter From an LC-Circuit

CERN Document Server

Arias, Paola; Döbrich, Babette; Gamboa, Jorge; Méndez, Fernando

2015-01-01

We point out that a cold dark matter condensate made of gauge bosons from an extra hidden U(1) sector - dubbed hidden- photons - can create a small, oscillating electric density current. Thus, they could also be searched for in the recently proposed LC-circuit setup conceived for axion cold dark matter search by Sikivie, Sullivan and Tanner. We estimate the sensitivity of this setup for hidden-photon cold dark matter and we find it could cover a sizable, so far unexplored parameter space.
Hidden photons in beam dump experiments and in connection with dark matter

Energy Technology Data Exchange (ETDEWEB)

Andreas, Sarah

2012-12-15

Hidden sectors with light extra U(1) gauge bosons, so-called hidden photons, recently received much interest as natural feature of beyond standard model scenarios like string theory and SUSY and because of their possible connection to dark matter. This paper presents limits on hidden photons from past electron beam dump experiments including two new limits from experiments at KEK and Orsay. Additionally, various hidden sector models containing both a hidden photon and a dark matter candidate are discussed with respect to their viability and potential signatures in direct detection.
Hidden photons in beam dump experiments and in connection with dark matter

International Nuclear Information System (INIS)

Andreas, Sarah

2012-12-01

Hidden sectors with light extra U(1) gauge bosons, so-called hidden photons, recently received much interest as natural feature of beyond standard model scenarios like string theory and SUSY and because of their possible connection to dark matter. This paper presents limits on hidden photons from past electron beam dump experiments including two new limits from experiments at KEK and Orsay. Additionally, various hidden sector models containing both a hidden photon and a dark matter candidate are discussed with respect to their viability and potential signatures in direct detection.
Search for hidden particles with the SHiP experiment

Energy Technology Data Exchange (ETDEWEB)

Hagner, Caren; Bick, Daniel; Bieschke, Stefan; Ebert, Joachim; Schmidt-Parzefall, Walter [Universitaet Hamburg, Institut fuer Experimentalphysik, Luruper Chaussee 149, 22761 Hamburg (Germany)

2016-07-01

Many theories beyond the standard model predict long lived neutral (hidden) particles. There might be a whole Hidden Sector (HS) of weakly interacting particles, which cannot be detected in existing high energy experiments. The SHiP experiment (Search for Hidden Particles) requires a high intensity beam dump, which could be realized by a new facility at the CERN SPS accelerator. New superweakly interacting particles with masses below O(10) GeV could be produced in the beam dump and detected in a general purpose Hidden Sector (HS) detector. In addition there will be a dedicated tau neutrino subdetector. I present the major requirements and technical challenges for the HS detector and discuss how the HS can be accessed through several portals: neutrino portal, scalar portal, vector portal and many more.
Multilayer Neural Networks with Extensively Many Hidden Units

International Nuclear Information System (INIS)

Rosen-Zvi, Michal; Engel, Andreas; Kanter, Ido

2001-01-01

The information processing abilities of a multilayer neural network with a number of hidden units scaling as the input dimension are studied using statistical mechanics methods. The mapping from the input layer to the hidden units is performed by general symmetric Boolean functions, whereas the hidden layer is connected to the output by either discrete or continuous couplings. Introducing an overlap in the space of Boolean functions as order parameter, the storage capacity is found to scale with the logarithm of the number of implementable Boolean functions. The generalization behavior is smooth for continuous couplings and shows a discontinuous transition to perfect generalization for discrete ones
Hidden Area and Mechanical Nonlinearities in Freestanding Graphene

Science.gov (United States)

Nicholl, Ryan J. T.; Lavrik, Nickolay V.; Vlassiouk, Ivan; Srijanto, Bernadeta R.; Bolotin, Kirill I.

2017-06-01

We investigated the effect of out-of-plane crumpling on the mechanical response of graphene membranes. In our experiments, stress was applied to graphene membranes using pressurized gas while the strain state was monitored through two complementary techniques: interferometric profilometry and Raman spectroscopy. By comparing the data obtained through these two techniques, we determined the geometric hidden area which quantifies the crumpling strength. While the devices with hidden area ˜0 % obeyed linear mechanics with biaxial stiffness 428 ±10 N /m , specimens with hidden area in the range 0.5%-1.0% were found to obey an anomalous nonlinear Hooke's law with an exponent ˜0.1 .
Extracting hidden-photon dark matter from an LC-circuit

International Nuclear Information System (INIS)

Arias, Paola; Arza, Ariel; Gamboa, Jorge; Mendez, Fernando; Doebrich, Babette

2015-01-01

We point out that a cold dark matter condensate made of gauge bosons from an extra hidden U(1) sector - dubbed hidden photons - can create a small, oscillating electric density current. Thus, they could also be searched for in the recently proposed LC-circuit setup conceived for axion cold dark matter search by Sikivie, Sullivan and Tanner. We estimate the sensitivity of this setup for hidden-photon cold dark matter and we find it could cover a sizable, so far unexplored parameter space. (orig.)
Petro Rents, Political Institutions, and Hidden Wealth

DEFF Research Database (Denmark)

Andersen, Jørgen Juel; Johannesen, Niels; Lassen, David Dreyer

2017-01-01

Do political institutions limit rent seeking by politicians? We study the transformation of petroleum rents, almost universally under direct government control, into hidden wealth using unique data on bank deposits in offshore financial centers that specialize in secrecy and asset protection. Our...... rulers is diverted to secret accounts. We find very limited evidence that shocks to other types of income not directly controlled by governments affect hidden wealth....
Hidden charm molecules in a finite volume

International Nuclear Information System (INIS)

Albaladejo, M.; Hidalgo-Duque, C.; Nieves, J.; Oset, E.

2014-01-01

In the present paper we address the interaction of charmed mesons in hidden charm channels in a finite box. We use the interaction from a recent model based on heavy quark spin symmetry that predicts molecules of hidden charm in the infinite volume. The energy levels in the box are generated within this model, and several methods for the analysis of these levels ("inverse problem") are investigated. (author)
B-graph sampling to estimate the size of a hidden population

NARCIS (Netherlands)

Spreen, M.; Bogaerts, S.

2015-01-01

Link-tracing designs are often used to estimate the size of hidden populations by utilizing the relational links between their members. A major problem in studies of hidden populations is the lack of a convenient sampling frame. The most frequently applied design in studies of hidden populations is

Memoria de la guerra civil española. Entre el sol y la tormenta de Sara Berenguer

Directory of Open Access Journals (Sweden)

Helena López

2013-07-01

Full Text Available En este artículo pretendo analizar dos cuestiones en relación con las memorias de guerra de la militante anarquista Sara Berenguer. En primer lugar, quiero atender a las estrategias discursivas (clase, género, sexualidad de construcción de la subjetividad en este texto. Además, me interesa indagar cómo estos discursos se interseccionan con la posición espacio-temporal (tiempo de la memoria y tiempo-espacio del exilio del sujeto autobiográfico. Mi objetivo principal es proponer una problematización de los conceptos de “memoria colectiva” y de “experiencia femenina” y reivindicar, por lo tanto, la relevancia tanto teórica como política de análisis críticos basados en narrativas personales.
Hidden Agendas in Marriage: Affective and Longitudinal Dimensions.

Science.gov (United States)

Krokoff, Lowell J.

1990-01-01

Examines how couples' discussions of troublesome problems reveal hidden agendas (issues not directly discussed or explored). Finds disgust and contempt are at the core of both love and respect agendas for husbands and wives. Finds that wives' more than husbands' hidden agendas are directly predictive of how negatively they argue at home. (SR)
The perception of the hidden curriculum on medical education: an exploratory study

Directory of Open Access Journals (Sweden)

Murakami Manabu

2009-12-01

Full Text Available Abstract Background Major curriculum reform of undergraduate medical education occurred during the past decades in the United Kingdom (UK; however, the effects of the hidden curriculum, which influence the choice of primary care as a career, have not been sufficiently recognized. While Japan, where traditionally few institutions systematically foster primary care physicians and very few have truly embraced family medicine as their guiding discipline, has also experienced meaningful curriculum reform, the effect of the hidden curriculum is not well known. The aim of this study is to identify themes pertaining to the students' perceptions of the hidden curriculum affecting undergraduate medical education in bedside learning in Japan. Methods Semi-structured interviews with thematic content analysis were implemented. Undergraduate year-5 students from a Japanese medical school at a Japanese teaching hospital were recruited. Interview were planned to last between 30 to 60 minutes each, over an 8-month period in 2007. The interviewees' perceptions concerning the quality of teaching in their bedside learning and related experiences were collected and analysed thematically. Results Twenty five medical students (18 males and 7 females, mean age 25 years old consented to participate in the interviews, and seven main themes emerged: "the perception of education as having a low priority," "the prevalence of positive/negative role models," "the persistence of hierarchy and exclusivity," "the existence of gender issues," "an overburdened medical knowledge," "human relationships with colleagues and medical team members," and "first experience from the practical wards and their patients." Conclusions Both similarities and differences were found when comparing the results to those of previous studies in the UK. Some effects of the hidden curriculum in medical education likely exist in common between the UK and Japan, despite the differences in their demographic
On the LHC sensitivity for non-thermalised hidden sectors

Science.gov (United States)

Kahlhoefer, Felix

2018-04-01

We show under rather general assumptions that hidden sectors that never reach thermal equilibrium in the early Universe are also inaccessible for the LHC. In other words, any particle that can be produced at the LHC must either have been in thermal equilibrium with the Standard Model at some point or must be produced via the decays of another hidden sector particle that has been in thermal equilibrium. To reach this conclusion, we parametrise the cross section connecting the Standard Model to the hidden sector in a very general way and use methods from linear programming to calculate the largest possible number of LHC events compatible with the requirement of non-thermalisation. We find that even the HL-LHC cannot possibly produce more than a few events with energy above 10 GeV involving states from a non-thermalised hidden sector.
Massive hidden photons as lukewarm dark matter

International Nuclear Information System (INIS)

Redondo, Javier; Postma, Marieke

2008-11-01

We study the possibility that a keV-MeV mass hidden photon (HP), i.e. a hidden sector U(1) gauge boson, accounts for the observed amount of dark matter. We focus on the case where the HP interacts with the standard model sector only through kinetic mixing with the photon. The relic abundance is computed including all relevant plasma effects into the photon's self-energy, which leads to a resonant yield almost independent of the HP mass. The HP can decay into three photons. Moreover, if light enough it can be copiously produced in stars. Including bounds from cosmic photon backgrounds and stellar evolution, we find that the hidden photon can only give a subdominant contribution to the dark matter. This negative conclusion may be avoided if another production mechanism besides kinetic mixing is operative. (orig.)
Massive hidden photons as lukewarm dark matter

Energy Technology Data Exchange (ETDEWEB)

Redondo, Javier [Deutsches Elektronen-Synchrotron (DESY), Hamburg (Germany); Postma, Marieke [Nationaal Inst. voor Kernfysica en Hoge-Energiefysica (NIKHEF), Amsterdam (Netherlands)

2008-11-15

We study the possibility that a keV-MeV mass hidden photon (HP), i.e. a hidden sector U(1) gauge boson, accounts for the observed amount of dark matter. We focus on the case where the HP interacts with the standard model sector only through kinetic mixing with the photon. The relic abundance is computed including all relevant plasma effects into the photon's self-energy, which leads to a resonant yield almost independent of the HP mass. The HP can decay into three photons. Moreover, if light enough it can be copiously produced in stars. Including bounds from cosmic photon backgrounds and stellar evolution, we find that the hidden photon can only give a subdominant contribution to the dark matter. This negative conclusion may be avoided if another production mechanism besides kinetic mixing is operative. (orig.)
A dinâmica dos mercados associados ao suínos de raça Bísara na Terra Fria Transmonta

OpenAIRE

Carvalho, Marieta

2014-01-01

A procura mundial de produtos de origem animal aumentará cerca de 70% em 2050, com especial relevância para a de origem do porco (FAO, 2014). Este trabalho visa estudar: · A dinâmica dos mercados associados aos suínos da raça Bísara: animais, carne e fumeiro de Vinhais. · Os circuitos de comercialização, os preços ao criador de suínos de animais vivos, da carne e fumeiro de Vinhais. A metodologia utilizada baseou-se na análise descritiva, referente aos de 2013 e 2014, dos ...
New limits on hidden photons from past electron beam dumps

International Nuclear Information System (INIS)

Andreas, Sarah; Niebuhr, Carsten; Ringwald, Andreas

2012-09-01

Hidden sectors with light extra U(1) gauge bosons, so called hidden photons, have recently attracted some attention because they are a common feature of physics beyond the Standard Model like string theory and SUSY and additionally are phenomenologically of great interest regarding recent astrophysical observations. The hidden photon is already constrained by various laboratory experiments and presently searched for in running as well as upcoming experiments. We summarize the current status of limits on hidden photons from past electron beam dump experiments including two new limits from such experiments at KEK and Orsay that have so far not been considered. All our limits take into account the experimental acceptances obtained from Monte Carlo simulations.
New limits on hidden photons from past electron beam dumps

Energy Technology Data Exchange (ETDEWEB)

Andreas, Sarah; Niebuhr, Carsten; Ringwald, Andreas

2012-09-15

Hidden sectors with light extra U(1) gauge bosons, so called hidden photons, have recently attracted some attention because they are a common feature of physics beyond the Standard Model like string theory and SUSY and additionally are phenomenologically of great interest regarding recent astrophysical observations. The hidden photon is already constrained by various laboratory experiments and presently searched for in running as well as upcoming experiments. We summarize the current status of limits on hidden photons from past electron beam dump experiments including two new limits from such experiments at KEK and Orsay that have so far not been considered. All our limits take into account the experimental acceptances obtained from Monte Carlo simulations.
Análise SWOT global da exploração dos suínos da raça Bísara

OpenAIRE

Carvalho, Marieta

2015-01-01

A procura mundial de produtos de origem animal aumentará cerca de 70% em 2050. Estima-se que mil milhões de pobres dependam dos animais para a sua alimentação e criação de riqueza (FAO, 2014). A raça Bísara, são suínos autóctones portugueses do tronco Celta em risco de extinção. Apesar do seu reduzido efetivo representa para as populações locais um elevado peso económico e social. Este trabalho tem como objetivo, fazer uma caracterização atual da suinicultura, com base nos suínos da ra...
Invisible axion in the hidden sector of no-scale supergravity

International Nuclear Information System (INIS)

Sato, Hikaru

1987-01-01

We propose a new axion model which incorporates the U(1) PQ symmetry into a hidden sector, as well as an observable sector, of no-scale supergravity models. The axion is a spin-zero field in the hidden sector. The U(1) PQ symmetry is naturally embedded in the family symmetry of the no-scale models. Invisible axions live in the gravity hidden sector without conflict with the cosmological and astrophysical constraints. (orig.)
Increased taxon sampling reveals thousands of hidden orthologs in flatworms

Science.gov (United States)

2017-01-01

Gains and losses shape the gene complement of animal lineages and are a fundamental aspect of genomic evolution. Acquiring a comprehensive view of the evolution of gene repertoires is limited by the intrinsic limitations of common sequence similarity searches and available databases. Thus, a subset of the gene complement of an organism consists of hidden orthologs, i.e., those with no apparent homology to sequenced animal lineages—mistakenly considered new genes—but actually representing rapidly evolving orthologs or undetected paralogs. Here, we describe Leapfrog, a simple automated BLAST pipeline that leverages increased taxon sampling to overcome long evolutionary distances and identify putative hidden orthologs in large transcriptomic databases by transitive homology. As a case study, we used 35 transcriptomes of 29 flatworm lineages to recover 3427 putative hidden orthologs, some unidentified by OrthoFinder and HaMStR, two common orthogroup inference algorithms. Unexpectedly, we do not observe a correlation between the number of putative hidden orthologs in a lineage and its “average” evolutionary rate. Hidden orthologs do not show unusual sequence composition biases that might account for systematic errors in sequence similarity searches. Instead, gene duplication with divergence of one paralog and weak positive selection appear to underlie hidden orthology in Platyhelminthes. By using Leapfrog, we identify key centrosome-related genes and homeodomain classes previously reported as absent in free-living flatworms, e.g., planarians. Altogether, our findings demonstrate that hidden orthologs comprise a significant proportion of the gene repertoire in flatworms, qualifying the impact of gene losses and gains in gene complement evolution. PMID:28400424
Searching for hidden sector in multiparticle production at LHC

Directory of Open Access Journals (Sweden)

Miguel-Angel Sanchis-Lozano

2016-03-01

Full Text Available We study the impact of a hidden sector beyond the Standard Model, e.g. a Hidden Valley model, on factorial moments and cumulants of multiplicity distributions in multiparticle production with a special emphasis on the prospects for LHC results.
An introduction to hidden Markov models for biological sequences

DEFF Research Database (Denmark)

Krogh, Anders Stærmose

1998-01-01

A non-matematical tutorial on hidden Markov models (HMMs) plus a description of one of the applications of HMMs: gene finding.......A non-matematical tutorial on hidden Markov models (HMMs) plus a description of one of the applications of HMMs: gene finding....
The origin of the hidden supersymmetry

International Nuclear Information System (INIS)

Jakubsky, Vit; Nieto, Luis-Miguel; Plyushchay, Mikhail S.

2010-01-01

The hidden supersymmetry and related tri-supersymmetric structure of the free particle system, the Dirac delta potential problem and the Aharonov-Bohm effect (planar, bound state, and tubule models) are explained by a special nonlocal unitary transformation, which for the usual N=2 supercharges has a nature of Foldy-Wouthuysen transformation. We show that in general case, the bosonized supersymmetry of nonlocal, parity even systems emerges in the same construction, and explain the origin of the unusual N=2 supersymmetry of electron in three-dimensional parity even magnetic field. The observation extends to include the hidden superconformal symmetry.
Naturally light hidden photons in LARGE volume string compactifications

International Nuclear Information System (INIS)

Goodsell, M.; Jaeckel, J.; Redondo, J.; Ringwald, A.

2009-09-01

Extra ''hidden'' U(1) gauge factors are a generic feature of string theory that is of particular phenomenological interest. They can kinetically mix with the Standard Model photon and are thereby accessible to a wide variety of astrophysical and cosmological observations and laboratory experiments. In this paper we investigate the masses and the kinetic mixing of hidden U(1)s in LARGE volume compactifications of string theory. We find that in these scenarios the hidden photons can be naturally light and that their kinetic mixing with the ordinary electromagnetic photon can be of a size interesting for near future experiments and observations. (orig.)
Hidden photon dark matter search with large metallic mirror

International Nuclear Information System (INIS)

Doebrich, Babette; Lindner, Axel; Daumiller, Kai; Engel, Ralph; Roth, Markus; Kowalski, Marek

2014-10-01

If Dark Matter is composed of hidden-sector photons that kinetically mix with photons of the visible sector, then Dark Matter has a tiny oscillating electric field component. Its presence would lead to a small amount of visible radiation being emitted from a conducting surface, with the photon frequency given approximately by the mass of the hidden photon. Here, we report on experimental efforts that have started recently to search for such hidden photon Dark Matter in the (sub-)eV regime with a prototype mirror for the Auger fluorescence detector at the Karlsruhe Institute for Technology.
Supersymmetry, p-brane duality, and hidden spacetime dimensions

International Nuclear Information System (INIS)

Bars, I.

1996-01-01

A global superalgebra with 32 supercharges and all possible central extensions is studied in order to extract some general properties of duality and hidden dimensions in a theory that treats p-branes democratically. The maximal number of dimensions is 12, with signature (10,2), containing one space and one time dimension that are hidden from the point of view of perturbative ten-dimensional string theory or its compactifications. When the theory is compactified on R d-1,1 circle-times T c+1,1 with d+c+2=12, there are isometry groups that relate to the hidden dimensions as well as to duality. Their combined intersecting classification schemes provide some properties of nonperturbative states and their couplings. copyright 1996 The American Physical Society
A single hidden layer feedforward network with only one neuron in the hidden layer can approximate any univariate function

OpenAIRE

Guliyev , Namig; Ismailov , Vugar

2016-01-01

The possibility of approximating a continuous function on a compact subset of the real line by a feedforward single hidden layer neural network with a sigmoidal activation function has been studied in many papers. Such networks can approximate an arbitrary continuous function provided that an unlimited number of neurons in a hidden layer is permitted. In this paper, we consider constructive approximation on any finite interval of $\\mathbb{R}$ by neural networks with only one neuron in the hid...
Discovering hidden sectors with monophoton Z' searches

International Nuclear Information System (INIS)

Gershtein, Yuri; Petriello, Frank; Quackenbush, Seth; Zurek, Kathryn M.

2008-01-01

In many theories of physics beyond the standard model, from extra dimensions to Hidden Valleys and models of dark matter, Z ' bosons mediate between standard model particles and hidden sector states. We study the feasibility of observing such hidden states through an invisibly decaying Z ' at the LHC. We focus on the process pp→γZ ' →γXX † , where X is any neutral, (quasi-) stable particle, whether a standard model neutrino or a new state. This complements a previous study using pp→ZZ ' →l + l - XX † . Only the Z ' mass and two effective charges are needed to describe this process. If the Z ' decays invisibly only to standard model neutrinos, then these charges are predicted by observation of the Z ' through the Drell-Yan process, allowing discrimination between Z ' decays to standard model ν's and invisible decays to new states. We carefully discuss all backgrounds and systematic errors that affect this search. We find that hidden sector decays of a 1 TeV Z ' can be observed at 5σ significance with 50 fb -1 at the LHC. Observation of a 1.5 TeV state requires super-LHC statistics of 1 ab -1 . Control of the systematic errors, in particular, the parton distribution function uncertainty of the dominant Zγ background, is crucial to maximize the LHC search reach.

The Art of the Hidden: Magical and Esoteric Practices in Rinconete y Cortadillo

Directory of Open Access Journals (Sweden)

Frederick A. de Armas

2013-12-01

Full Text Available One of the most frequently studied motifs in Rinconete y Cortadillo has been its relation to the picaresque as well as the new elements that it brings to this genre. It has also been asserted that, since chronologically it is one of the first novellas included in the collection of Novelas ejemplares, it eschews the structures of romance, which are prevalent in later novellas. This study foregrounds a series of elements of romance which can be found in Rinconete y Cortadillo and that reveal a series of hidden mysteries in the novella. The essay analyzes, among others, the motif of descent and the infernal geography of the novella; the presence of Mercury as a guide to the infernal regions; the final ascent promised by Rinconete and the onomastic secrets hidden in his name; the significance of perfect friendship; the desire for freedom and its implications; and the meaning of joy as found among the rogues and the followers of the barbarous Monipodio.
Child Abuse: The Hidden Bruises

Science.gov (United States)

... for Families - Vietnamese Spanish Facts for Families Guide Child Abuse - The Hidden Bruises No. 5; Updated November 2014 The statistics on physical child abuse are alarming. It is estimated hundreds of thousands ...
Modeling of IP scanning activities with Hidden Markov Models: Darknet case study

OpenAIRE

De Santis , Giulia; Lahmadi , Abdelkader; Francois , Jerome; Festor , Olivier

2016-01-01

International audience; We propose a methodology based on Hidden Markov Models (HMMs) to model scanning activities monitored by a darknet. The HMMs of scanning activities are built on the basis of the number of scanned IP addresses within a time window and fitted using mixtures of Poisson distributions. Our methodology is applied on real data traces collected from a darknet and generated by two large scale scanners, ZMap and Shodan. We demonstrated that the built models are able to characteri...
Learning and inference in a nonequilibrium Ising model with hidden nodes.

Science.gov (United States)

Dunn, Benjamin; Roudi, Yasser

2013-02-01

We study inference and reconstruction of couplings in a partially observed kinetic Ising model. With hidden spins, calculating the likelihood of a sequence of observed spin configurations requires performing a trace over the configurations of the hidden ones. This, as we show, can be represented as a path integral. Using this representation, we demonstrate that systematic approximate inference and learning rules can be derived using dynamical mean-field theory. Although naive mean-field theory leads to an unstable learning rule, taking into account Gaussian corrections allows learning the couplings involving hidden nodes. It also improves learning of the couplings between the observed nodes compared to when hidden nodes are ignored.
La difesa della donna ebrea: Sara Copio Sullam e Debora Ascarelli

Directory of Open Access Journals (Sweden)

Umberto Fortis

2014-04-01

Full Text Available Sara Copio Sullam and Debora Ascarelli, the best-known Jewish women poets of the age of the Italian ghetto, have often been studied with a focus on the distinctive features of their writing: the former as a translator of sacred texts, the latter as the author of original verses, sometimes written as a risposta per le rime (reply through rhymes or in defence of her orthodoxy. They share, however, a common theme, which has often been neglected: the defence of the Jewish woman, which is overt in some of Copio’s sonnets and prose, whereas it has not yet been properly pointed out in some of Ascarelli’s verses. This paper aims at bringing this theme to the fore not only in Copio, through a rereading of some passages of her Manifesto, but also in Debora Ascarelli, through an analysis of her few original verses. These hendecasyllables certainly reflect the Petrarchan and classicistic atmosphere of the late 16th century in Rome, but they are far from the mainstream modes of women’s poetry of the age. They allow us, therefore, to highlight, besides the differences, the similarities between the two poetesses; their commitment, in the late 16th and early 17th century, to the intellectual and moral defence of the Jewish woman, in a context of general depreciation of women, but also in the background of the claim to the “nobility and excellence of women”.
Analysing the hidden curriculum: use of a cultural web.

Science.gov (United States)

Mossop, Liz; Dennick, Reg; Hammond, Richard; Robbé, Iain

2013-02-01

Major influences on learning about medical professionalism come from the hidden curriculum. These influences can contribute positively or negatively towards the professional enculturation of clinical students. The fact that there is no validated method for identifying the components of the hidden curriculum poses problems for educators considering professionalism. The aim of this study was to analyse whether a cultural web, adapted from a business context, might assist in the identification of elements of the hidden curriculum at a UK veterinary school. A qualitative approach was used. Seven focus groups consisting of three staff groups and four student groups were organised. Questioning was framed using the cultural web, which is a model used by business owners to assess their environment and consider how it affects their employees and customers. The focus group discussions were recorded, transcribed and analysed thematically using a combination of a priori and emergent themes. The cultural web identified elements of the hidden curriculum for both students and staff. These included: core assumptions; routines; rituals; control systems; organisational factors; power structures, and symbols. Discussions occurred about how and where these issues may affect students' professional identity development. The cultural web framework functioned well to help participants identify elements of the hidden curriculum. These aspects aligned broadly with previously described factors such as role models and institutional slang. The influence of these issues on a student's development of a professional identity requires discussion amongst faculty staff, and could be used to develop learning opportunities for students. The framework is promising for the analysis of the hidden curriculum and could be developed as an instrument for implementation in other clinical teaching environments. © Blackwell Publishing Ltd 2013.
Anticipating hidden text salting in emails (extended abstract)

OpenAIRE

Lioma, Christina; Moens, Marie-Francine; Gomez, Juan Carlos; De Beer, Jan; Bergholz, Andre; Paass, Gerhard; Horkan, Patrick

2008-01-01

Salting is the intentional addition or distortion of content, aimed to evade automatic filtering. Salting is usually found in spam emails. Salting can also be hidden in phishing emails, which aim to steal personal information from users. We present a novel method that detects hidden salting tricks as visual anomalies in text. We solely use these salting tricks to successfully classify emails as phishing (F-measure >90%).
Complicated basins and the phenomenon of amplitude death in coupled hidden attractors

Energy Technology Data Exchange (ETDEWEB)

Chaudhuri, Ushnish [Department of Physics, Sri Venkateswara College, University of Delhi, New Delhi 110021 (India); Department of Physics, National University of Singapore, Singapore 117551 (Singapore); Prasad, Awadhesh, E-mail: awadhesh@physics.du.ac.in [Department of Physics and Astrophysics, University of Delhi, Delhi 110007 (India)

2014-02-07

Understanding hidden attractors, whose basins of attraction do not contain the neighborhood of equilibrium of the system, are important in many physical applications. We observe riddled-like complicated basins of coexisting hidden attractors both in coupled and uncoupled systems. Amplitude death is observed in coupled hidden attractors with no fixed point using nonlinear interaction. A new route to amplitude death is observed in time-delay coupled hidden attractors. Numerical results are presented for systems with no or one stable fixed point. The applications are highlighted.
Gauge mediation scenario with hidden sector renormalization in MSSM

International Nuclear Information System (INIS)

Arai, Masato; Kawai, Shinsuke; Okada, Nobuchika

2010-01-01

We study the hidden sector effects on the mass renormalization of a simplest gauge-mediated supersymmetry breaking scenario. We point out that possible hidden sector contributions render the soft scalar masses smaller, resulting in drastically different sparticle mass spectrum at low energy. In particular, in the 5+5 minimal gauge-mediated supersymmetry breaking with high messenger scale (that is favored by the gravitino cold dark matter scenario), we show that a stau can be the next lightest superparticle for moderate values of hidden sector self-coupling. This provides a very simple theoretical model of long-lived charged next lightest superparticles, which imply distinctive signals in ongoing and upcoming collider experiments.
Gauge mediation scenario with hidden sector renormalization in MSSM

Science.gov (United States)

Arai, Masato; Kawai, Shinsuke; Okada, Nobuchika

2010-02-01

We study the hidden sector effects on the mass renormalization of a simplest gauge-mediated supersymmetry breaking scenario. We point out that possible hidden sector contributions render the soft scalar masses smaller, resulting in drastically different sparticle mass spectrum at low energy. In particular, in the 5+5¯ minimal gauge-mediated supersymmetry breaking with high messenger scale (that is favored by the gravitino cold dark matter scenario), we show that a stau can be the next lightest superparticle for moderate values of hidden sector self-coupling. This provides a very simple theoretical model of long-lived charged next lightest superparticles, which imply distinctive signals in ongoing and upcoming collider experiments.
Quantum mechanics and hidden superconformal symmetry

Science.gov (United States)

Bonezzi, R.; Corradini, O.; Latini, E.; Waldron, A.

2017-12-01

Solvability of the ubiquitous quantum harmonic oscillator relies on a spectrum generating osp (1 |2 ) superconformal symmetry. We study the problem of constructing all quantum mechanical models with a hidden osp (1 |2 ) symmetry on a given space of states. This problem stems from interacting higher spin models coupled to gravity. In one dimension, we show that the solution to this problem is the Vasiliev-Plyushchay family of quantum mechanical models with hidden superconformal symmetry obtained by viewing the harmonic oscillator as a one dimensional Dirac system, so that Grassmann parity equals wave function parity. These models—both oscillator and particlelike—realize all possible unitary irreducible representations of osp (1 |2 ).
Hidden simplicity of gauge theory amplitudes

Energy Technology Data Exchange (ETDEWEB)

Drummond, J M, E-mail: drummond@lapp.in2p3.f [LAPTH, Universite de Savoie, CNRS, B.P. 110, F-74941 Annecy-le-Vieux, Cedex (France)

2010-11-07

These notes were given as lectures at the CERN Winter School on Supergravity, Strings and Gauge Theory 2010. We describe the structure of scattering amplitudes in gauge theories, focussing on the maximally supersymmetric theory to highlight the hidden symmetries which appear. Using the Britto, Cachzo, Feng and Witten (BCFW) recursion relations we solve the tree-level S-matrix in N=4 super Yang-Mills theory and describe how it produces a sum of invariants of a large symmetry algebra. We review amplitudes in the planar theory beyond tree level, describing the connection between amplitudes and Wilson loops, and discuss the implications of the hidden symmetries.
Update on hidden sectors with dark forces and dark matter

Energy Technology Data Exchange (ETDEWEB)

Andreas, Sarah

2012-11-15

Recently there has been much interest in hidden sectors, especially in the context of dark matter and ''dark forces'', since they are a common feature of beyond standard model scenarios like string theory and SUSY and additionally exhibit interesting phenomenological aspects. Various laboratory experiments place limits on the so-called hidden photon and continuously further probe and constrain the parameter space; an updated overview is presented here. Furthermore, for several hidden sector models with light dark matter we study the viability with respect to the relic abundance and direct detection experiments.
Searching for hidden sectors in multiparticle production at the LHC

CERN Document Server

Sanchis-Lozano, Miguel-Angel; Moreno-Picot, Salvador

2016-01-01

We study the impact of a hidden sector beyond the Standard Model, e.g. a Hidden Valley model, on factorial moments and cumulants of multiplicity distributions in multiparticle production with a special emphasis on the prospects for LHC results.
Secret Codes: The Hidden Curriculum of Semantic Web Technologies

Science.gov (United States)

Edwards, Richard; Carmichael, Patrick

2012-01-01

There is a long tradition in education of examination of the hidden curriculum, those elements which are implicit or tacit to the formal goals of education. This article draws upon that tradition to open up for investigation the hidden curriculum and assumptions about students and knowledge that are embedded in the coding undertaken to facilitate…
State-space dimensionality in short-memory hidden-variable theories

International Nuclear Information System (INIS)

Montina, Alberto

2011-01-01

Recently we have presented a hidden-variable model of measurements for a qubit where the hidden-variable state-space dimension is one-half the quantum-state manifold dimension. The absence of a short memory (Markov) dynamics is the price paid for this dimensional reduction. The conflict between having the Markov property and achieving the dimensional reduction was proved by Montina [A. Montina, Phys. Rev. A 77, 022104 (2008)] using an additional hypothesis of trajectory relaxation. Here we analyze in more detail this hypothesis introducing the concept of invertible process and report a proof that makes clearer the role played by the topology of the hidden-variable space. This is accomplished by requiring suitable properties of regularity of the conditional probability governing the dynamics. In the case of minimal dimension the set of continuous hidden variables is identified with an object living an N-dimensional Hilbert space whose dynamics is described by the Schroedinger equation. A method for generating the economical non-Markovian model for the qubit is also presented.
Numerical studies of the heat-up-phase of Super-Sara 'severe fuel damage'. Boildown tests

International Nuclear Information System (INIS)

Eifler, W.; Shepherd, I.M.

1983-01-01

Calculations to investigate the heat-up phase of the Super-Sara 'severe fuel damage' test matrix have been performed using a simple computer code which models a typical pin. In particular the effect of the exothermic zirconium water reaction on the transient is considered. It is shown that it is possible to achieve the desired objectives of all the tests by a test procedure involving a constant power level a simple flow history. This flow history consists of an initial inlet flow, that has the water saturated at outlet. It is then linearly decreased in a time of the order of 200 seconds to a steady lower value. The clad temperature ramp rate is defined by the power and the peak clad temperature by the ratio of the power of the final steady inlet flow rate. If the final inlet flow rate for a particular power is below a certain critical value then the clad will reach melting temperature. The sensitivity of the results are discussed and a sample calculation is made for each test in the matrix
Dopamine reward prediction errors reflect hidden state inference across time

Science.gov (United States)

Starkweather, Clara Kwon; Babayan, Benedicte M.; Uchida, Naoshige; Gershman, Samuel J.

2017-01-01

Midbrain dopamine neurons signal reward prediction error (RPE), or actual minus expected reward. The temporal difference (TD) learning model has been a cornerstone in understanding how dopamine RPEs could drive associative learning. Classically, TD learning imparts value to features that serially track elapsed time relative to observable stimuli. In the real world, however, sensory stimuli provide ambiguous information about the hidden state of the environment, leading to the proposal that TD learning might instead compute a value signal based on an inferred distribution of hidden states (a ‘belief state’). In this work, we asked whether dopaminergic signaling supports a TD learning framework that operates over hidden states. We found that dopamine signaling exhibited a striking difference between two tasks that differed only with respect to whether reward was delivered deterministically. Our results favor an associative learning rule that combines cached values with hidden state inference. PMID:28263301
Higher-dimensional black holes: hidden symmetries and separation of variables

International Nuclear Information System (INIS)

Frolov, Valeri P; Kubiznak, David

2008-01-01

In this paper, we discuss hidden symmetries in rotating black hole spacetimes. We start with an extended introduction which mainly summarizes results on hidden symmetries in four dimensions and introduces Killing and Killing-Yano tensors, objects responsible for hidden symmetries. We also demonstrate how starting with a principal CKY tensor (that is a closed non-degenerate conformal Killing-Yano 2-form) in 4D flat spacetime one can 'generate' the 4D Kerr-NUT-(A)dS solution and its hidden symmetries. After this we consider higher-dimensional Kerr-NUT-(A)dS metrics and demonstrate that they possess a principal CKY tensor which allows one to generate the whole tower of Killing-Yano and Killing tensors. These symmetries imply complete integrability of geodesic equations and complete separation of variables for the Hamilton-Jacobi, Klein-Gordon and Dirac equations in the general Kerr-NUT-(A)dS metrics
Extended abstract of a hidden agenda

Energy Technology Data Exchange (ETDEWEB)

Goguen, J.; Malcolm, G. [Oxford Univ. (United Kingdom)

1996-12-31

The initial goal of our hidden research programme was both straightforward and ambitious: give a semantics for software engineering, and in particular for the object paradigm, supporting correctness proofs that are as simple and mechanical as possible. This emphasizes proofs rather than models, and thus suggests an equational approach, rather than one based on higher order logic, denotational semantics, or any kind of model, because equational proofs achieve maximal simplicity and mechanization, and yet are fully expressive. We introduce powerful coinduction techniques for proving behavioral properties of complex systems. We make the no doubt outrageous claim that our hidden approach gives simpler proofs than other formalisms; this is because we exploit algebraic structure that most other approaches discard.

Photoacoustic imaging of hidden dental caries by using a fiber-based probing system

Science.gov (United States)

Koyama, Takuya; Kakino, Satoko; Matsuura, Yuji

2017-04-01

Photoacoustic method to detect hidden dental caries is proposed. It was found that high frequency ultrasonic waves are generated from hidden carious part when radiating laser light to occlusal surface of model tooth. By making a map of intensity of these high frequency components, photoacoustic images of hidden caries were successfully obtained. A photoacoustic imaging system using a bundle of hollow optical fiber was fabricated for using clinical application, and clear photoacoustic image of hidden caries was also obtained by this system.
Testing Convergence of Different Free-Energy Methods in a Simple Analytical System with Hidden Barriers

Directory of Open Access Journals (Sweden)

S. Alexis Paz

2018-03-01

Full Text Available In this work, we study the influence of hidden barriers on the convergence behavior of three free-energy calculation methods: well-tempered metadynamics (WTMD, adaptive-biasing forces (ABF, and on-the-fly parameterization (OTFP. We construct a simple two-dimensional potential-energy surfaces (PES that allows for an exact analytical result for the free-energy in any one-dimensional order parameter. Then we chose different CV definitions and PES parameters to create three different systems with increasing sampling challenges. We find that all three methods are not greatly affected by the hidden-barriers in the simplest case considered. The adaptive sampling methods show faster sampling while the auxiliary high-friction requirement of OTFP makes it slower for this case. However, a slight change in the CV definition has a strong impact in the ABF and WTMD performance, illustrating the importance of choosing suitable collective variables.
Life imitating art: depictions of the hidden curriculum in medical television programs.

Science.gov (United States)

Stanek, Agatha; Clarkin, Chantalle; Bould, M Dylan; Writer, Hilary; Doja, Asif

2015-09-26

The hidden curriculum represents influences occurring within the culture of medicine that indirectly alter medical professionals' interactions, beliefs and clinical practices throughout their training. One approach to increase medical student awareness of the hidden curriculum is to provide them with readily available examples of how it is enacted in medicine; as such the purpose of this study was to examine depictions of the hidden curriculum in popular medical television programs. One full season of ER, Grey's Anatomy and Scrubs were selected for review. A summative content analysis was performed to ascertain the presence of depictions of the hidden curriculum, as well as to record the type, frequency and quality of examples. A second reviewer also viewed a random selection of episodes from each series to establish coding reliability. The most prevalent themes across all television programs were: the hierarchical nature of medicine; challenges during transitional stages in medicine; the importance of role modeling; patient dehumanization; faking or overstating one's capabilities; unprofessionalism; the loss of idealism; and difficulties with work-life balance. The hidden curriculum is frequently depicted in popular medical television shows. These examples of the hidden curriculum could serve as a valuable teaching resource in undergraduate medical programs.
Rare Z boson decays to a hidden sector

Science.gov (United States)

Blinov, Nikita; Izaguirre, Eder; Shuve, Brian

2018-01-01

We demonstrate that rare decays of the Standard Model Z boson can be used to discover and characterize the nature of new hidden-sector particles. We propose new searches for these particles in soft, high-multiplicity leptonic final states at the Large Hadron Collider. The proposed searches are sensitive to low-mass particles produced in Z decays, and we argue that these striking signatures can shed light on the hidden-sector couplings and mechanism for mass generation.
The Consensus String Problem and the Complexity of Comparing Hidden Markov Models

DEFF Research Database (Denmark)

Lyngsø, Rune Bang; Pedersen, Christian Nørgaard Storm

2002-01-01

The basic theory of hidden Markov models was developed and applied to problems in speech recognition in the late 1960s, and has since then been applied to numerous problems, e.g. biological sequence analysis. Most applications of hidden Markov models are based on efficient algorithms for computing...... the probability of generating a given string, or computing the most likely path generating a given string. In this paper we consider the problem of computing the most likely string, or consensus string, generated by a given model, and its implications on the complexity of comparing hidden Markov models. We show...... that computing the consensus string, and approximating its probability within any constant factor, is NP-hard, and that the same holds for the closely related labeling problem for class hidden Markov models. Furthermore, we establish the NP-hardness of comparing two hidden Markov models under the L∞- and L1...
Butanol/Gasoline Test Plan

Science.gov (United States)

2012-03-01

authorities. METHODS FOR CLEANING UP: Contain spillage and then collect with non-combustible absorbent material, (e.g. sand, soil , diatomaceous earth...SARA 311/312 Hazards: Fire Hazard, Acute Health Hazard, and Chronic Health Hazard CERCLA SECTION 103 and SARA SECTION 304 (RELEASE TO THE ENVIROMENT
Cosmological abundance of the QCD axion coupled to hidden photons

Science.gov (United States)

Kitajima, Naoya; Sekiguchi, Toyokazu; Takahashi, Fuminobu

2018-06-01

We study the cosmological evolution of the QCD axion coupled to hidden photons. For a moderately strong coupling, the motion of the axion field leads to an explosive production of hidden photons by tachyonic instability. We use lattice simulations to evaluate the cosmological abundance of the QCD axion. In doing so, we incorporate the backreaction of the produced hidden photons on the axion dynamics, which becomes significant in the non-linear regime. We find that the axion abundance is suppressed by at most O (102) for the decay constant fa =1016GeV, compared to the case without the coupling. For a sufficiently large coupling, the motion of the QCD axion becomes strongly damped, and as a result, the axion abundance is enhanced. Our results show that the cosmological upper bound on the axion decay constant can be relaxed by a few hundred for a certain range of the coupling to hidden photons.
Identification of new proton-rich rare earth nuclei by means of the coupled system helium jet-isotope separator of SARA

International Nuclear Information System (INIS)

Ollivier, T.

1986-01-01

In order to study new exotic nuclei far from stability we built a fast separation system by coupling a helium jet with the medium-current source of the mass separator. First the tests were made in Lyon and then the system used on line with the heavy ion accelerator SARA, in Grenoble. We obtained efficiency greater than 1% for each element and a better chemical independence. This allowed us to perform experiments on rare-earth region near N=82, with fusion-evaporation reactions after an investigation of various ranges of beam energies. The first results allow to identify two new isotopes, 143 Tb (12s) and 138 Eu (12s). The decay schemes obtained are analysed in the frame of existing models [fr
Low-scale gravity mediation in warped extra dimension and collider phenomenology on hidden sector

International Nuclear Information System (INIS)

Itoh, H.; Okada, N.; Yamashita, T.

2007-01-01

We propose a new scenario of gravity-mediated supersymmetry breaking (gravity mediation) in a supersymmetric Randall-Sundrum model, where the gravity mediation takes place at a low scale due to the warped metric. We investigate collider phenomenology involving the hidden sector field, and find a possibility that the hidden sector field can be produced at the LHC and the ILC. The hidden sector may no longer be hidden. (author)
An impossibility theorem for parameter independent hidden variable theories

Science.gov (United States)

Leegwater, Gijs

2016-05-01

Recently, Roger Colbeck and Renato Renner (C&R) have claimed that '[n]o extension of quantum theory can have improved predictive power' (Colbeck & Renner, 2011, 2012b). If correct, this is a spectacular impossibility theorem for hidden variable theories, which is more general than the theorems of Bell (1964) and Leggett (2003). Also, C&R have used their claim in attempt to prove that a system's quantum-mechanical wave function is in a one-to-one correspondence with its 'ontic' state (Colbeck & Renner, 2012a). C&R's claim essentially means that in any hidden variable theory that is compatible with quantum-mechanical predictions, probabilities of measurement outcomes are independent of these hidden variables. This makes such variables otiose. On closer inspection, however, the generality and validity of the claim can be contested. First, it is based on an assumption called 'Freedom of Choice'. As the name suggests, this assumption involves the independence of an experimenter's choice of measurement settings. But in the way C&R define this assumption, a no-signalling condition is surreptitiously presupposed, making the assumption less innocent than it sounds. When using this definition, any hidden variable theory violating parameter independence, such as Bohmian Mechanics, is immediately shown to be incompatible with quantum-mechanical predictions. Also, the argument of C&R is hard to follow and their mathematical derivation contains several gaps, some of which cannot be closed in the way they suggest. We shall show that these gaps can be filled. The issue with the 'Freedom of Choice' assumption can be circumvented by explicitly assuming parameter independence. This makes the result less general, but better founded. We then obtain an impossibility theorem for hidden variable theories satisfying parameter independence only. As stated above, such hidden variable theories are impossible in the sense that any supplemental variables have no bearing on outcome probabilities
Entry deterrence and hidden competition

NARCIS (Netherlands)

Lavrutich, Maria; Huisman, Kuno; Kort, Peter

This paper studies strategic investment behavior of firms facing an uncertain demand in a duopoly setting. Firms choose both investment timing and the capacity level while facing additional uncertainty about market participants, which is introduced via the concept of hidden competition. We focus on
Adaptive Partially Hidden Markov Models

DEFF Research Database (Denmark)

Forchhammer, Søren Otto; Rasmussen, Tage

1996-01-01

Partially Hidden Markov Models (PHMM) have recently been introduced. The transition and emission probabilities are conditioned on the past. In this report, the PHMM is extended with a multiple token version. The different versions of the PHMM are applied to bi-level image coding....
Applications of hidden symmetries to black hole physics

International Nuclear Information System (INIS)

Frolov, Valeri

2011-01-01

This work is a brief review of applications of hidden symmetries to black hole physics. Symmetry is one of the most important concepts of the science. In physics and mathematics the symmetry allows one to simplify a problem, and often to make it solvable. According to the Noether theorem symmetries are responsible for conservation laws. Besides evident (explicit) spacetime symmetries, responsible for conservation of energy, momentum, and angular momentum of a system, there also exist what is called hidden symmetries, which are connected with higher order in momentum integrals of motion. A remarkable fact is that black holes in four and higher dimensions always possess a set ('tower') of explicit and hidden symmetries which make the equations of motion of particles and light completely integrable. The paper gives a general review of the recently obtained results. The main focus is on understanding why at all black holes have something (symmetry) to hide.
Land-use evaluation for sustainable construction in a protected area: A case of Sara mountain national park.

Science.gov (United States)

Ristić, Vladica; Maksin, Marija; Nenković-Riznić, Marina; Basarić, Jelena

2018-01-15

The process of making decisions on sustainable development and construction begins in spatial and urban planning when defining the suitability of using land for sustainable construction in a protected area (PA) and its immediate and regional surroundings. The aim of this research is to propose and assess a model for evaluating land-use suitability for sustainable construction in a PA and its surroundings. The methodological approach of Multi-Criteria Decision Analysis was used in the formation of this model and adapted for the research; it was combined with the adapted Analytical hierarchy process and the Delphi process, and supported by a geographical information system (GIS) within the framework of ESRI ArcGIS software - Spatial analyst. The model is applied to the case study of Sara mountain National Park in Kosovo. The result of the model is a "map of integrated assessment of land-use suitability for sustainable construction in a PA for the natural factor". Copyright © 2017 Elsevier Ltd. All rights reserved.
Detecting Hidden Hierarchy of Non Hierarchical Terrorist Networks

DEFF Research Database (Denmark)

Memon, Nasrullah

measures (and combinations of them) to identify key players (important nodes) in terrorist networks. Our recently introduced techniques and algorithms (which are also implemented in the investigative data mining toolkit known as iMiner) will be particularly useful for law enforcement agencies that need...... to analyze terrorist networks and prioritize their targets. Applying recently introduced mathematical methods for constructing the hidden hierarchy of "nonhierarchical" terrorist networks; we present case studies of the terrorist attacks occurred / planned in the past, in order to identify hidden hierarchy...
Signatures of a hidden cosmic microwave background.

Science.gov (United States)

Jaeckel, Joerg; Redondo, Javier; Ringwald, Andreas

2008-09-26

If there is a light Abelian gauge boson gamma' in the hidden sector its kinetic mixing with the photon can produce a hidden cosmic microwave background (HCMB). For meV masses, resonant oscillations gammagamma' happen after big bang nucleosynthesis (BBN) but before CMB decoupling, increasing the effective number of neutrinos Nnu(eff) and the baryon to photon ratio, and distorting the CMB blackbody spectrum. The agreement between BBN and CMB data provides new constraints. However, including Lyman-alpha data, Nnu(eff) > 3 is preferred. It is tempting to attribute this effect to the HCMB. The interesting parameter range will be tested in upcoming laboratory experiments.
Hidden inventory and safety considerations

International Nuclear Information System (INIS)

Anderson, A.R.; James, R.H.; Morgan, F.

1976-01-01

Preliminary results are described of the evaluation of residual plutonium in a process line used for the production of experimental fast reactor fuel. Initial attention has been focussed on a selection of work boxes used for processing powders and solutions. Amounts of material measured as ''hidden inventory'' are generally less than 0.1 percent of throughput but in one box containing very complex equipment the amount was exceptionally about 0.5 percent. The total surface area of the box and the installed equipment appears to be the most significant factor in determining the amount of plutonium held-up as ''hidden inventory,'' representing an average of about 4 x 10 -4 g cm -2 . Present results are based on gamma spectrometer measurements but neutron techniques are being developed to overcome some of the inherent uncertainties in the gamma method. It is suggested that the routine use of sample plates of known surface area would be valuable in monitoring the deposition of plutonium in work boxes
Hidden School Dropout among Immigrant Students: A Cross-Sectional Study

Science.gov (United States)

Makarova, Elena; Herzog, Walter

2013-01-01

Actual school dropout among immigrant youth has been addressed in a number of studies, but research on hidden school dropout among immigrant students is rare. Thus, the objective of this paper is to analyze hidden school dropout among primary school students with an immigrant background. The analyses were performed using survey data of 1186…
WIMPless dark matter from non-Abelian hidden sectors with anomaly-mediated supersymmetry breaking

International Nuclear Information System (INIS)

Feng, Jonathan L.; Shadmi, Yael

2011-01-01

In anomaly-mediated supersymmetry breaking models, superpartner masses are proportional to couplings squared. Their hidden sectors therefore naturally contain WIMPless dark matter, particles whose thermal relic abundance is guaranteed to be of the correct size, even though they are not weakly interacting massive particles. We study viable dark matter candidates in WIMPless anomaly-mediated supersymmetry breaking models with non-Abelian hidden sectors and highlight unusual possibilities that emerge in even the simplest models. In one example with a pure SU(N) hidden sector, stable hidden gluinos freeze out with the correct relic density, but have an extremely low, but natural, confinement scale, providing a framework for self-interacting dark matter. In another simple scenario, hidden gluinos freeze out and decay to visible Winos with the correct relic density, and hidden glueballs may either be stable, providing a natural framework for mixed cold-hot dark matter, or may decay, yielding astrophysical signals. Last, we present a model with light hidden pions that may be tested with improved constraints on the number of nonrelativistic degrees of freedom. All of these scenarios are defined by a small number of parameters, are consistent with gauge coupling unification, preserve the beautiful connection between the weak scale and the observed dark matter relic density, and are natural, with relatively light visible superpartners. We conclude with comments on interesting future directions.
On the hidden maxwell superalgebra underlying D = 4 supergravity

Energy Technology Data Exchange (ETDEWEB)

Penafiel, D.M. [Departamento de Fisica, Universidad de Concepcion (Chile); DISAT, Politecnico di Torino (Italy); Istituto Nazionale di Fisica Nucleare (INFN), Sezione di Torino (Italy); Ravera, L. [DISAT, Politecnico di Torino (Italy); Istituto Nazionale di Fisica Nucleare (INFN), Sezione di Torino (Italy)

2017-09-15

In this work, we expand the hidden AdS-Lorentz superalgebra underlying D = 4 supergravity, reaching a (hidden) Maxwell superalgebra. The latter can be viewed as an extension involving cosmological constant of the superalgebra underlying D = 4 supergravity in flat spacetime. We write the Maurer-Cartan equations in this context and we find some interesting extensions of the antisymmetric 3-form A{sup (3)} appearing in the Free Differential Algebra in Minkowski space. The structure of Free Differential Algebras is obtained by considering the zero curvature equations. We write the parametrization of A{sup (3)} in terms of 1-forms and we rend the topological features of its extensions manifest. We interestingly find out that the structure of these extensions, and consequently the structure of the corresponding boundary contribution dA{sup (3)}, strongly depends on the form of the extra fermionic generator appearing in the hidden Maxwell superalgebra. The model we develop in this work is defined in an enlarged superspace with respect to the ordinary one, and the extra bosonic and fermionic 1-forms required for the closure of the hidden Maxwell superalgebra must be considered as physical fields in this enlarged superspace. (copyright 2017 WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim)

Explore the Buffering Effects of Perceived Hidden Inflation on Survival of Mobile Phone Service Providers in Taiwan

Directory of Open Access Journals (Sweden)

Sheng-Wen Liu

2017-04-01

Full Text Available The purpose of this study is to examine the moderating role of perceived hidden inflation on the relationships between service quality, brand trust and brand loyalty. All data collected from the target population are analyzed through two-step structural equation modeling (SEM and moderated multiple regression (MMR to examine the hypotheses. 1,050 questionnaires are randomly distributed at 21 telecommunication service stores in Taiwan. Findings indicated that service quality has no direct impact on behavioral loyalty but it has a significant indirect impact on behavioral loyalty through brand trust or attitudinal loyalty. Moreover, findings identify perceived hidden inflation as the moderating role in the service quality–brand trust–brand loyalty chain. Besides the need for empirical confirmation of the hypotheses given, finally, there are several practical implications for service marketers and future research directions for scholars.
The Hidden Dimensions of Databases.

Science.gov (United States)

Jacso, Peter

1994-01-01

Discusses methods of evaluating commercial online databases and provides examples that illustrate their hidden dimensions. Topics addressed include size, including the number of records or the number of titles; the number of years covered; and the frequency of updates. Comparisons of Readers' Guide Abstracts and Magazine Article Summaries are…
Low-intensity interference effects and hidden-variable theories

Energy Technology Data Exchange (ETDEWEB)

Buonomano, V [Universidade Estadual de Campinas (Brazil). Inst. de Matematica

1978-05-11

The double-slit interference experiment and other similar experiments in the low-intensity limit (that is, one photon in the apparatus at a time) are examined in the spirit of Bell's work from the point of view of hidden-variable theories. It is found that there exists a class of hidden-variable theories which disagrees with quantum mechanics for a certain type of interference experiment. A manufactured conceptualization of this class, which is a particle view of interference, is described. An experiment, which appears to be feasible, is proposed to examine this disagreement.
Application of Hidden Markov Models in Biomolecular Simulations.

Science.gov (United States)

Shukla, Saurabh; Shamsi, Zahra; Moffett, Alexander S; Selvam, Balaji; Shukla, Diwakar

2017-01-01

Hidden Markov models (HMMs) provide a framework to analyze large trajectories of biomolecular simulation datasets. HMMs decompose the conformational space of a biological molecule into finite number of states that interconvert among each other with certain rates. HMMs simplify long timescale trajectories for human comprehension, and allow comparison of simulations with experimental data. In this chapter, we provide an overview of building HMMs for analyzing bimolecular simulation datasets. We demonstrate the procedure for building a Hidden Markov model for Met-enkephalin peptide simulation dataset and compare the timescales of the process.
Detecting Faults By Use Of Hidden Markov Models

Science.gov (United States)

Smyth, Padhraic J.

1995-01-01

Frequency of false alarms reduced. Faults in complicated dynamic system (e.g., antenna-aiming system, telecommunication network, or human heart) detected automatically by method of automated, continuous monitoring. Obtains time-series data by sampling multiple sensor outputs at discrete intervals of t and processes data via algorithm determining whether system in normal or faulty state. Algorithm implements, among other things, hidden first-order temporal Markov model of states of system. Mathematical model of dynamics of system not needed. Present method is "prior" method mentioned in "Improved Hidden-Markov-Model Method of Detecting Faults" (NPO-18982).
From the solar system fo hidden cosmic structures

Energy Technology Data Exchange (ETDEWEB)

Benes, K

1987-01-01

The development of experimental astrophysics showed that in the evolution of planets, natural processes of a common nature take place. They include, e.g., radiogenic heat, the production of magmas, volcanic activity, degassing, etc. The solar system is a cosmic formation in an advanced stage of development and it is a realistic assumption that in the Galaxy other hidden planetary systems in various stages of development exist. The views on the possibility of the origination of life in other systems differ; life, however, is seen as a hidden property of cosmic matter. (M.D.).
Dissipative hidden sector dark matter

Science.gov (United States)

Foot, R.; Vagnozzi, S.

2015-01-01

A simple way of explaining dark matter without modifying known Standard Model physics is to require the existence of a hidden (dark) sector, which interacts with the visible one predominantly via gravity. We consider a hidden sector containing two stable particles charged under an unbroken U (1 )' gauge symmetry, hence featuring dissipative interactions. The massless gauge field associated with this symmetry, the dark photon, can interact via kinetic mixing with the ordinary photon. In fact, such an interaction of strength ε ˜10-9 appears to be necessary in order to explain galactic structure. We calculate the effect of this new physics on big bang nucleosynthesis and its contribution to the relativistic energy density at hydrogen recombination. We then examine the process of dark recombination, during which neutral dark states are formed, which is important for large-scale structure formation. Galactic structure is considered next, focusing on spiral and irregular galaxies. For these galaxies we modeled the dark matter halo (at the current epoch) as a dissipative plasma of dark matter particles, where the energy lost due to dissipation is compensated by the energy produced from ordinary supernovae (the core-collapse energy is transferred to the hidden sector via kinetic mixing induced processes in the supernova core). We find that such a dynamical halo model can reproduce several observed features of disk galaxies, including the cored density profile and the Tully-Fisher relation. We also discuss how elliptical and dwarf spheroidal galaxies could fit into this picture. Finally, these analyses are combined to set bounds on the parameter space of our model, which can serve as a guideline for future experimental searches.
Hidden twelve-dimensional super Poincare symmetry in eleven dimensions

International Nuclear Information System (INIS)

Bars, Itzhak; Deliduman, Cemsinan; Pasqua, Andrea; Zumino, Bruno

2004-01-01

First, we review a result in our previous paper, of how a ten-dimensional superparticle, taken off-shell, has a hidden eleven-dimensional super Poincare symmetry. Then, we show that the physical sector is defined by three first-class constraints which preserve the full eleven-dimensional symmetry. Applying the same concepts to the eleven-dimensional superparticle, taken off-shell, we discover a hidden twelve-dimensional super Poincare symmetry that governs the theory
Electroweak-charged bound states as LHC probes of hidden forces

Science.gov (United States)

Li, Lingfeng; Salvioni, Ennio; Tsai, Yuhsin; Zheng, Rui

2018-01-01

We explore the LHC reach on beyond-the-standard model (BSM) particles X associated with a new strong force in a hidden sector. We focus on the motivated scenario where the SM and hidden sectors are connected by fermionic mediators ψ+,0 that carry SM electroweak charges. The most promising signal is the Drell-Yan production of a ψ±ψ¯ 0 pair, which forms an electrically charged vector bound state ϒ± due to the hidden force and later undergoes resonant annihilation into W±X . We analyze this final state in detail in the cases where X is a real scalar ϕ that decays to b b ¯, or a dark photon γd that decays to dileptons. For prompt X decays, we show that the corresponding signatures can be efficiently probed by extending the existing ATLAS and CMS diboson searches to include heavy resonance decays into BSM particles. For long-lived X , we propose new searches where the requirement of a prompt hard lepton originating from the W boson ensures triggering and essentially removes any SM backgrounds. To illustrate the potential of our results, we interpret them within two explicit models that contain strong hidden forces and electroweak-charged mediators, namely λ -supersymmetry (SUSY) and non-SUSY ultraviolet extensions of the twin Higgs model. The resonant nature of the signals allows for the reconstruction of the mass of both ϒ± and X , thus providing a wealth of information about the hidden sector.
Application of ANNS in tube CHF prediction: effect on neuron number in hidden layer

International Nuclear Information System (INIS)

Han, L.; Shan, J.; Zhang, B.

2004-01-01

Prediction of the Critical Heat Flux (CHF) for upward flow of water in uniformly heated vertical round tube is studied with Artificial Neuron Networks (ANNs) method utilizing different neuron number in hidden layers. This study is based on thermal equilibrium conditions. The neuron number in hidden layers is chosen to vary from 5 to 30 with the step of 5. The effect due to the variety of the neuron number in hidden layers is analyzed. The analysis shows that the neuron number in hidden layers should be appropriate, too less will affect the prediction accuracy and too much may result in abnormal parametric trends. It is concluded that the appropriate neuron number in two hidden layers should be [15 15]. (authors)
UV Photography Shows Hidden Sun Damage

Science.gov (United States)

... mcat1=de12", ]; for (var c = 0; c UV photography shows hidden sun damage A UV photograph gives ... developing skin cancer and prematurely aged skin. Normal photography UV photography 18 months of age: This boy's ...
Anomalies of hidden local chiral symmetries in sigma-models and extended supergravities

International Nuclear Information System (INIS)

Vecchia, P. di; Ferrara, S.; Girardello, L.

1985-01-01

Non-linear sigma-models with hidden gauge symmetries are anomalous, at the quantum level, when coupled to chiral fermions in not anomaly free representations of the hidden chiral symmetry. These considerations generally apply to supersymmetric kaehlerian sigma-models on coset spaces with hidden chiral symmetries as well as to extended supergravities in four dimensions with local SU(N) symmetry. The presence of the anomaly implies that the scenario of dynamical generation of gauge vector bosons has to be reconsidered in these theories. (orig.)
Review of hidden carbon emissions, trade, and labor income share in China, 2001–2011

International Nuclear Information System (INIS)

Wang, Shu-Hong; Song, Ma-Lin

2014-01-01

Coordinated development between the economy and the environment is currently one of the most important issues in China. By establishing models concerning labor income share and hidden carbon emissions, and taking trade as the link in their relationship, this study puts forward the scale effects, technological effects, and structural effects that relate to labor income share under the function of trade. We then establish multi-index and multi-indicator constitutive (MIMIC) equation to measure the ratio of hidden carbon emissions to total emissions, which is further considered the basis of the measurement model. Results of regression analysis carried out on labor income share show that hidden carbon emissions do have a positive effect on labor income share. In the meantime, we also prove that under scale effects, technological effects, and the structural effects of trade, hidden carbon emissions affect labor income shares in different directions. Our conclusions and policy implications are obtained from the calculated results. - Highlights: • This study establishes models concerning labor income share and hidden carbon emissions. • MIMIC is established to measure the ratio of hidden carbon emissions to total discharge. • Hidden carbon emissions have a positive effect on labor income share. • Hidden carbon emissions have various effects on the labor income share
The selection and implementation of hidden line algorithms

International Nuclear Information System (INIS)

Schneider, A.

1983-06-01

One of the most challenging problems in the field of computer graphics is the elimination of hidden lines in images of nontransparent bodies. In the real world the nontransparent material hinders the light ray coming from hidden regions to the observer. In the computer based image formation process there is no automatic visibility regulation of this kind. So many lines are created which result in a poor quality of the spacial representation. Therefore a three-dimensional representation on the screen is only meaningfull if the hidden lines are eliminated. For this process many algorithms have been developed in the past. A common feature of these codes is the large amount of computer time needed. In the first generation of algorithms, which are commonly used today, the bodies are modeled by plane polygons. More recently, however, also algorithms are in use, which are able to treat curved surfaces without discretisation by plane surfaces. In this paper the first group of algorithms is reviewed, and the most important codes are described. The experience obtained during the implementation of two algorithms is presented. (orig.) [de
Hidden sector behind the CKM matrix

Science.gov (United States)

Okawa, Shohei; Omura, Yuji

2017-08-01

The small quark mixing, described by the Cabibbo-Kobayashi-Maskawa (CKM) matrix in the standard model, may be a clue to reveal new physics around the TeV scale. We consider a simple scenario that extra particles in a hidden sector radiatively mediate the flavor violation to the quark sector around the TeV scale and effectively realize the observed CKM matrix. The lightest particle in the hidden sector, whose contribution to the CKM matrix is expected to be dominant, is a good dark matter (DM) candidate. There are many possible setups to describe this scenario, so that we investigate some universal predictions of this kind of model, focusing on the contribution of DM to the quark mixing and flavor physics. In this scenario, there is an explicit relation between the CKM matrix and flavor violating couplings, such as four-quark couplings, because both are radiatively induced by the particles in the hidden sector. Then, we can explicitly find the DM mass region and the size of Yukawa couplings between the DM and quarks, based on the study of flavor physics and DM physics. In conclusion, we show that DM mass in our scenario is around the TeV scale, and the Yukawa couplings are between O (0.01 ) and O (1 ). The spin-independent DM scattering cross section is estimated as O (10-9) [pb]. An extra colored particle is also predicted at the O (10 ) TeV scale.
Laser experiments explore the hidden sector

International Nuclear Information System (INIS)

Ahlers, M.

2007-11-01

Recently, the laser experiments BMV and GammeV, searching for light shining through walls, have published data and calculated new limits on the allowed masses and couplings for axion-like particles. In this note we point out that these experiments can serve to constrain a much wider variety of hidden-sector particles such as, e.g., minicharged particles and hidden-sector photons. The new experiments improve the existing bounds from the older BFRT experiment by a factor of two. Moreover, we use the new PVLAS constraints on a possible rotation and ellipticity of light after it has passed through a strong magnetic field to constrain pure minicharged particle models. For masses -7 times the electron electric charge. This is the best laboratory bound and comparable to bounds inferred from the energy spectrum of the cosmic microwave background. (orig.)
438 Optimal Number of States in Hidden Markov Models and its ...

African Journals Online (AJOL)

In this paper, Hidden Markov Model is applied to model human movements as to .... emit either discrete information or a continuous data derived from a Probability .... For each hidden state in the test set, the probability = ... by applying the Kullback-Leibler distance (Juang & Rabiner, 1985) which ..... One Size Does Not Fit.
Simultaneous escaping of explicit and hidden free energy barriers: application of the orthogonal space random walk strategy in generalized ensemble based conformational sampling.

Science.gov (United States)

Zheng, Lianqing; Chen, Mengen; Yang, Wei

2009-06-21

To overcome the pseudoergodicity problem, conformational sampling can be accelerated via generalized ensemble methods, e.g., through the realization of random walks along prechosen collective variables, such as spatial order parameters, energy scaling parameters, or even system temperatures or pressures, etc. As usually observed, in generalized ensemble simulations, hidden barriers are likely to exist in the space perpendicular to the collective variable direction and these residual free energy barriers could greatly abolish the sampling efficiency. This sampling issue is particularly severe when the collective variable is defined in a low-dimension subset of the target system; then the "Hamiltonian lagging" problem, which reveals the fact that necessary structural relaxation falls behind the move of the collective variable, may be likely to occur. To overcome this problem in equilibrium conformational sampling, we adopted the orthogonal space random walk (OSRW) strategy, which was originally developed in the context of free energy simulation [L. Zheng, M. Chen, and W. Yang, Proc. Natl. Acad. Sci. U.S.A. 105, 20227 (2008)]. Thereby, generalized ensemble simulations can simultaneously escape both the explicit barriers along the collective variable direction and the hidden barriers that are strongly coupled with the collective variable move. As demonstrated in our model studies, the present OSRW based generalized ensemble treatments show improved sampling capability over the corresponding classical generalized ensemble treatments.
The hidden and informal curriculum across the continuum of training: A cross-sectional qualitative study.

Science.gov (United States)

Doja, Asif; Bould, M Dylan; Clarkin, Chantalle; Eady, Kaylee; Sutherland, Stephanie; Writer, Hilary

2016-04-01

The hidden and informal curricula refer to learning in response to unarticulated processes and constraints, falling outside the formal medical curriculum. The hidden curriculum has been identified as requiring attention across all levels of learning. We sought to assess the knowledge and perceptions of the hidden and informal curricula across the continuum of learning at a single institution. Focus groups were held with undergraduate and postgraduate learners and faculty to explore knowledge and perceptions relating to the hidden and informal curricula. Thematic analysis was conducted both inductively by research team members and deductively using questions structured by the existing literature. Participants highlighted several themes related to the presence of the hidden and informal curricula in medical training and practice, including: the privileging of some specialties over others; the reinforcement of hierarchies within medicine; and a culture of tolerance towards unprofessional behaviors. Participants acknowledged the importance of role modeling in the development of professional identities and discussed the deterioration in idealism that occurs. Common issues pertaining to the hidden curriculum exist across all levels of learners, including faculty. Increased awareness of these issues could allow for the further development of methods to address learning within the hidden curriculum.
Low scale gravity mediation with warped extra dimension and collider phenomenology on the hidden sector

International Nuclear Information System (INIS)

Itoh, Hideo; Okada, Nobuchika; Yamashita, Toshifumi

2006-01-01

We propose a scenario of gravity mediated supersymmetry breaking (gravity mediation) in a supersymmetric Randall-Sundrum model. In our setup, both the visible sector and the hidden sector coexist on the infrared (IR) brane. We introduce the Polonyi model as a simple hidden sector. Because of the warped metric, the effective cutoff scale on the IR brane is 'warped down', so that the gravity mediation occurs at a low scale. As a result, the gravitino is naturally the lightest superpartner (LSP) and contact interactions between the hidden and the visible sector fields become stronger. We address phenomenologies for various IR cutoff scales. In particular, we investigate collider phenomenology involving a scalar field (Polonyi field) in the hidden sector for the case with the IR cutoff around 10 TeV. We find a possibility that the hidden sector scalar can be produced at the LHC and the international linear collider (ILC). Interestingly, the scalar behaves like the Higgs boson of the standard model in the production process, while its decay process is quite different and, once produced, it will provide us with a very clean signature. The hidden sector may be no longer hidden

In Brief: Hidden environment and health costs of energy

Science.gov (United States)

Showstack, Randy

2009-10-01

The hidden costs of energy production and use in the United States amounted to an estimated $120 billion in 2005, according to a 19 October report by the U.S. National Research Council. The report, “Hidden Costs of Energy: Unpriced Consequences of Energy Production and Use,” examines hidden costs, including the cost of air pollution damage to human health, which are not reflected in market prices of energy sources, electricity, or gasoline. The report found that in 2005, the total annual external damages from sulfur dioxide, nitrogen oxides, and particulate matter created by coal-burning power plants that produced 95% of the nation's coal-generated electricity were about $62 billion, with nonclimate damages averaging about 3.2 cents for every kilowatt-hour of energy produced. It is estimated that by 2030, nonclimate damages will fall to 1.7 cents per kilowatt-hour. The 2030 figure assumes that new policies already slated for implementation are put in place.
LHCb - Search for hidden-sector bosons at LHCb

CERN Multimedia

Mauri, Andrea

2016-01-01

A search is presented for a hidden-sector boson, $\\chi$, produced in the decay $B^0 \\rightarrow K^* (892)^0 \\chi$, with $K^* (892)^0 \\rightarrow K^+ \\pi^-$ and $\\chi \\rightarrow \\mu^+ \\mu^-$ . The search is performed using a $pp$-collision data sample collected at $\\sqrt{s}=7$ and 8 TeV with the LHCb detector, corresponding to integrated luminosities of 1 and 2 fb$^{-1}$ respectively. No significant signal is observed in the mass range $214 \\le m_\\chi \\le 4350$ MeV, and upper limits are placed on the branching fraction product $\\mathcal{B}(B^0 \\rightarrow K^* (892)^0 \\chi) \\times \\mathcal{B}(\\chi \\rightarrow \\mu^+ \\mu^- )$ as a function of the mass and lifetime of the $\\chi$ boson. These limits place the most stringent constraints to date on many theories that predict the existence of additional low-mass dark bosons.
Distinguishing Hidden Markov Chains

OpenAIRE

Kiefer, Stefan; Sistla, A. Prasad

2015-01-01

Hidden Markov Chains (HMCs) are commonly used mathematical models of probabilistic systems. They are employed in various fields such as speech recognition, signal processing, and biological sequence analysis. We consider the problem of distinguishing two given HMCs based on an observation sequence that one of the HMCs generates. More precisely, given two HMCs and an observation sequence, a distinguishing algorithm is expected to identify the HMC that generates the observation sequence. Two HM...
Coupling of Hidden Sector

OpenAIRE

Królikowski, Wojciech

2016-01-01

A hypothetic Hidden Sector of the Universe, consisting of sterile fer\\-mions (``sterinos'') and sterile mediating bosons (``sterons'') of mass dimension 1 (not 2!) --- the last described by an antisymmetric tensor field --- requires to exist also a scalar isovector and scalar isoscalar in order to be able to construct electroweak invariant coupling (before spontaneously breaking its symmetry). The introduced scalar isoscalar might be a resonant source for the diphoton excess of 750 GeV, sugge...
Co-existing hidden attractors in a radio-physical oscillator system

DEFF Research Database (Denmark)

Kuznetsov, A. P.; Kuznetsov, S. P.; Mosekilde, Erik

2015-01-01

The term `hidden attractor' relates to a stable periodic, quasiperiodic or chaotic state whose basin of attraction does not overlap with the neighborhood of an unstable equilibrium point. Considering a three-dimensional oscillator system that does not allow for the existence of an equilibrium point...... frequency, describe the bifurcations through which hidden attractors of different type arise and disappear, and illustrate the form of the basins of attraction....
A two particle hidden sector and the oscillations with photons

Energy Technology Data Exchange (ETDEWEB)

Alvarez, Pedro D. [Universidad de Antofagasta, Departamento de Fisica, Antofagasta (Chile); Arias, Paola; Maldonado, Carlos [Universidad de Santiago de Chile, Departmento de Fisica, Santiago (Chile)

2018-01-15

We present a detailed study of the oscillations and optical properties for vacuum, in a model for the dark sector that contains axion-like particles and hidden photons. We provide bounds for the couplings versus the mass, using current results from ALPS-I and PVLAS. We also discuss the challenges for the detection of models with more than one hidden particle in light shining trough wall-like experiments. (orig.)
Optimal no-go theorem on hidden-variable predictions of effect expectations

Science.gov (United States)

Blass, Andreas; Gurevich, Yuri

2018-03-01

No-go theorems prove that, under reasonable assumptions, classical hidden-variable theories cannot reproduce the predictions of quantum mechanics. Traditional no-go theorems proved that hidden-variable theories cannot predict correctly the values of observables. Recent expectation no-go theorems prove that hidden-variable theories cannot predict the expectations of observables. We prove the strongest expectation-focused no-go theorem to date. It is optimal in the sense that the natural weakenings of the assumptions and the natural strengthenings of the conclusion make the theorem fail. The literature on expectation no-go theorems strongly suggests that the expectation-focused approach is more general than the value-focused one. We establish that the expectation approach is not more general.
Raising awareness of the hidden curriculum in veterinary medical education: a review and call for research.

Science.gov (United States)

Whitcomb, Tiffany L

2014-01-01

The hidden curriculum is characterized by information that is tacitly conveyed to and among students about the cultural and moral environment in which they find themselves. Although the hidden curriculum is often defined as a distinct entity, tacit information is conveyed to students throughout all aspects of formal and informal curricula. This unconsciously communicated knowledge has been identified across a wide spectrum of educational environments and is known to have lasting and powerful impacts, both positive and negative. Recently, medical education research on the hidden curriculum of becoming a doctor has come to the forefront as institutions struggle with inconsistencies between formal and hidden curricula that hinder the practice of patient-centered medicine. Similarly, the complex ethical questions that arise during the practice and teaching of veterinary medicine have the potential to cause disagreement between what the institution sets out to teach and what is actually learned. However, the hidden curriculum remains largely unexplored for this field. Because the hidden curriculum is retained effectively by students, elucidating its underlying messages can be a key component of program refinement. A review of recent literature about the hidden curriculum in a variety of fields, including medical education, will be used to explore potential hidden curricula in veterinary medicine and draw attention to the need for further investigation.
Nonparametric model validations for hidden Markov models with applications in financial econometrics.

Science.gov (United States)

Zhao, Zhibiao

2011-06-01

We address the nonparametric model validation problem for hidden Markov models with partially observable variables and hidden states. We achieve this goal by constructing a nonparametric simultaneous confidence envelope for transition density function of the observable variables and checking whether the parametric density estimate is contained within such an envelope. Our specification test procedure is motivated by a functional connection between the transition density of the observable variables and the Markov transition kernel of the hidden states. Our approach is applicable for continuous time diffusion models, stochastic volatility models, nonlinear time series models, and models with market microstructure noise.
The Consensus String Problem and the Complexity of Comparing Hidden Markov Models

DEFF Research Database (Denmark)

Lyngsø, Rune Bang; Pedersen, Christian Nørgaard Storm

2002-01-01

The basic theory of hidden Markov models was developed and applied to problems in speech recognition in the late 1960s, and has since then been applied to numerous problems, e.g. biological sequence analysis. Most applications of hidden Markov models are based on efficient algorithms for computing......-norms. We discuss the applicability of the technique used for proving the hardness of comparing two hidden Markov models under the L1-norm to other measures of distance between probability distributions. In particular, we show that it cannot be used for proving NP-hardness of determining the Kullback...
Inference with constrained hidden Markov models in PRISM

DEFF Research Database (Denmark)

Christiansen, Henning; Have, Christian Theil; Lassen, Ole Torp

2010-01-01

A Hidden Markov Model (HMM) is a common statistical model which is widely used for analysis of biological sequence data and other sequential phenomena. In the present paper we show how HMMs can be extended with side-constraints and present constraint solving techniques for efficient inference. De......_different are integrated. We experimentally validate our approach on the biologically motivated problem of global pairwise alignment.......A Hidden Markov Model (HMM) is a common statistical model which is widely used for analysis of biological sequence data and other sequential phenomena. In the present paper we show how HMMs can be extended with side-constraints and present constraint solving techniques for efficient inference...
Hidden and generalized conformal symmetry of Kerr–Sen spacetimes

International Nuclear Information System (INIS)

Ghezelbash, A M; Siahaan, H M

2013-01-01

It is recently conjectured that generic non-extremal Kerr black hole could be holographically dual to a hidden conformal field theory (CFT) in two dimensions. Moreover, it is known that there are two CFT duals (pictures) to describe the charged rotating black holes which correspond to angular momentum J and electric charge Q of the black hole. Furthermore these two pictures can be incorporated by the CFT duals (general picture) that are generated by SL(2,Z) modular group. The general conformal structure can be revealed by looking at charged scalar wave equation in some appropriate values of frequency and charge. In this regard, we consider the wave equation of a charged massless scalar field in the background of Kerr–Sen black hole and show that in the ‘near region’, the wave equation can be reproduced by the Casimir operator of a local SL(2,R) L ×SL(2,R) R hidden conformal symmetry. We find the exact agreement between macroscopic and microscopic physical quantities like entropy and absorption cross section of scalars for Kerr–Sen black hole. We then find an extension of vector fields that in turn yields an extended local family of SL(2,R) L ×SL(2,R) R hidden conformal symmetry, parameterized by one parameter. For some special values of the parameter, we find a copy of SL(2,R) hidden conformal algebra for the charged Gibbons–Maeda–Garfinkle–Horowitz–Strominger black hole in the strong deflection limit. (paper)
A Hidden Markov Model for Analysis of Frontline Veterinary Data for Emerging Zoonotic Disease Surveillance

Science.gov (United States)

Robertson, Colin; Sawford, Kate; Gunawardana, Walimunige S. N.; Nelson, Trisalyn A.; Nathoo, Farouk; Stephen, Craig

2011-01-01

Surveillance systems tracking health patterns in animals have potential for early warning of infectious disease in humans, yet there are many challenges that remain before this can be realized. Specifically, there remains the challenge of detecting early warning signals for diseases that are not known or are not part of routine surveillance for named diseases. This paper reports on the development of a hidden Markov model for analysis of frontline veterinary sentinel surveillance data from Sri Lanka. Field veterinarians collected data on syndromes and diagnoses using mobile phones. A model for submission patterns accounts for both sentinel-related and disease-related variability. Models for commonly reported cattle diagnoses were estimated separately. Region-specific weekly average prevalence was estimated for each diagnoses and partitioned into normal and abnormal periods. Visualization of state probabilities was used to indicate areas and times of unusual disease prevalence. The analysis suggests that hidden Markov modelling is a useful approach for surveillance datasets from novel populations and/or having little historical baselines. PMID:21949763
Hidden solution to the μ/Bμ problem in gauge mediation

International Nuclear Information System (INIS)

Roy, Tuhin S.; Schmaltz, Martin

2008-01-01

We propose a solution to the μ/B μ problem in gauge mediation. The novel feature of our solution is that it uses dynamics of the hidden sector, which is often present in models with dynamical supersymmetry breaking. We give an explicit example model of gauge mediation where a very simple messenger sector generates both μ and B μ at one loop. The usual problem, that B μ is then too large, is solved by strong renormalization effects from the hidden sector which suppress B μ relative to μ. Our mechanism relies on an assumption about the signs of certain incalculable anomalous dimensions in the hidden sector. Making these assumptions not only allows us to solve the μ/B μ problem but also leads to a characteristic superpartner spectrum which would be a smoking gun signal for our mechanism.
Multitask TSK fuzzy system modeling by mining intertask common hidden structure.

Science.gov (United States)

Jiang, Yizhang; Chung, Fu-Lai; Ishibuchi, Hisao; Deng, Zhaohong; Wang, Shitong

2015-03-01

The classical fuzzy system modeling methods implicitly assume data generated from a single task, which is essentially not in accordance with many practical scenarios where data can be acquired from the perspective of multiple tasks. Although one can build an individual fuzzy system model for each task, the result indeed tells us that the individual modeling approach will get poor generalization ability due to ignoring the intertask hidden correlation. In order to circumvent this shortcoming, we consider a general framework for preserving the independent information among different tasks and mining hidden correlation information among all tasks in multitask fuzzy modeling. In this framework, a low-dimensional subspace (structure) is assumed to be shared among all tasks and hence be the hidden correlation information among all tasks. Under this framework, a multitask Takagi-Sugeno-Kang (TSK) fuzzy system model called MTCS-TSK-FS (TSK-FS for multiple tasks with common hidden structure), based on the classical L2-norm TSK fuzzy system, is proposed in this paper. The proposed model can not only take advantage of independent sample information from the original space for each task, but also effectively use the intertask common hidden structure among multiple tasks to enhance the generalization performance of the built fuzzy systems. Experiments on synthetic and real-world datasets demonstrate the applicability and distinctive performance of the proposed multitask fuzzy system model in multitask regression learning scenarios.
Hidden Costs of Hospital Based Delivery from Two Tertiary Hospitals in Western Nepal.

Directory of Open Access Journals (Sweden)

Jeevan Acharya

Full Text Available Hospital based delivery has been an expensive experience for poor households because of hidden costs which are usually unaccounted in hospital costs. The main aim of this study was to estimate the hidden costs of hospital based delivery and determine the factors associated with the hidden costs.A hospital based cross-sectional study was conducted among 384 post-partum mothers with their husbands/house heads during the discharge time in Manipal Teaching Hospital and Western Regional Hospital, Pokhara, Nepal. A face to face interview with each respondent was conducted using a structured questionnaire. Hidden costs were calculated based on the price rate of the market during the time of the study.The total hidden costs for normal delivery and C-section delivery were 243.4 USD (US Dollar and 321.6 USD respectively. Of the total maternity care expenditures; higher mean expenditures were found for food & drinking (53.07%, clothes (9.8% and transport (7.3%. For postpartum women with their husband or house head, the total mean opportunity cost of "days of work loss" were 84.1 USD and 81.9 USD for normal delivery and C-section respectively. Factors such as literate mother (p = 0.007, employed house head (p = 0.011, monthly family income more than 25,000 NRs (Nepalese Rupees (p = 0.014, private hospital as a place of delivery (p = 0.0001, C-section as a mode of delivery (p = 0.0001, longer duration (>5days of stay in hospital (p = 0.0001, longer distance (>15km from house to hospital (p = 0.0001 and longer travel time (>240 minutes from house to hospital (p = 0.007 showed a significant association with the higher hidden costs (>25000 NRs.Experiences of hidden costs on hospital based delivery and opportunity costs of days of work loss were found high. Several socio-demographic factors, delivery related factors (place and mode of delivery, length of stay, distance from hospital and travel time were associated with hidden costs. Hidden costs can be a
Hidden Costs of Hospital Based Delivery from Two Tertiary Hospitals in Western Nepal.

Science.gov (United States)

Acharya, Jeevan; Kaehler, Nils; Marahatta, Sujan Babu; Mishra, Shiva Raj; Subedi, Sudarshan; Adhikari, Bipin

2016-01-01

Hospital based delivery has been an expensive experience for poor households because of hidden costs which are usually unaccounted in hospital costs. The main aim of this study was to estimate the hidden costs of hospital based delivery and determine the factors associated with the hidden costs. A hospital based cross-sectional study was conducted among 384 post-partum mothers with their husbands/house heads during the discharge time in Manipal Teaching Hospital and Western Regional Hospital, Pokhara, Nepal. A face to face interview with each respondent was conducted using a structured questionnaire. Hidden costs were calculated based on the price rate of the market during the time of the study. The total hidden costs for normal delivery and C-section delivery were 243.4 USD (US Dollar) and 321.6 USD respectively. Of the total maternity care expenditures; higher mean expenditures were found for food & drinking (53.07%), clothes (9.8%) and transport (7.3%). For postpartum women with their husband or house head, the total mean opportunity cost of "days of work loss" were 84.1 USD and 81.9 USD for normal delivery and C-section respectively. Factors such as literate mother (p = 0.007), employed house head (p = 0.011), monthly family income more than 25,000 NRs (Nepalese Rupees) (p = 0.014), private hospital as a place of delivery (p = 0.0001), C-section as a mode of delivery (p = 0.0001), longer duration (>5days) of stay in hospital (p = 0.0001), longer distance (>15km) from house to hospital (p = 0.0001) and longer travel time (>240 minutes) from house to hospital (p = 0.007) showed a significant association with the higher hidden costs (>25000 NRs). Experiences of hidden costs on hospital based delivery and opportunity costs of days of work loss were found high. Several socio-demographic factors, delivery related factors (place and mode of delivery, length of stay, distance from hospital and travel time) were associated with hidden costs. Hidden costs can be a
Hidden-sector Spectroscopy with Gravitational Waves from Binary Neutron Stars

Science.gov (United States)

Croon, Djuna; Nelson, Ann E.; Sun, Chen; Walker, Devin G. E.; Xianyu, Zhong-Zhi

2018-05-01

We show that neutron star (NS) binaries can be ideal laboratories to probe hidden sectors with a long-range force. In particular, it is possible for gravitational wave (GW) detectors such as LIGO and Virgo to resolve the correction of waveforms from ultralight dark gauge bosons coupled to NSs. We observe that the interaction of the hidden sector affects both the GW frequency and amplitude in a way that cannot be fitted by pure gravity.
A Hidden Twelve-Dimensional SuperPoincare Symmetry In Eleven Dimensions

Energy Technology Data Exchange (ETDEWEB)

Bars, Itzhak; Deliduman, Cemsinan; Pasqua, Andrea; Zumino, Bruno

2003-12-13

First, we review a result in our previous paper, of how a ten-dimensional superparticle, taken off-shell, has a hidden eleven-dimensional superPoincare symmetry. Then, we show that the physical sector is defined by three first-class constraints which preserve the full eleven-dimensional symmetry. Applying the same concepts to the eleven dimensional superparticle, taken off-shell, we discover a hidden twelve dimensional superPoincare symmetry that governs the theory.
Hidden Neural Networks: A Framework for HMM/NN Hybrids

DEFF Research Database (Denmark)

Riis, Søren Kamaric; Krogh, Anders Stærmose

1997-01-01

This paper presents a general framework for hybrids of hidden Markov models (HMM) and neural networks (NN). In the new framework called hidden neural networks (HNN) the usual HMM probability parameters are replaced by neural network outputs. To ensure a probabilistic interpretation the HNN is nor...... HMMs on TIMIT continuous speech recognition benchmarks. On the task of recognizing five broad phoneme classes an accuracy of 84% is obtained compared to 76% for a standard HMM. Additionally, we report a preliminary result of 69% accuracy on the TIMIT 39 phoneme task...

Hidden costs, value lost: uninsurance in America

National Research Council Canada - National Science Library

Committee on the Consequences of Uninsurance

2003-01-01

Hidden Cost, Value Lost , the fifth of a series of six books on the consequences of uninsurance in the United States, illustrates some of the economic and social losses to the country of maintaining...
Hidden Markov Models for Human Genes

DEFF Research Database (Denmark)

Baldi, Pierre; Brunak, Søren; Chauvin, Yves

1997-01-01

We analyse the sequential structure of human genomic DNA by hidden Markov models. We apply models of widely different design: conventional left-right constructs and models with a built-in periodic architecture. The models are trained on segments of DNA sequences extracted such that they cover com...
Analyzing Hidden Semantics in Social Bookmarking of Open Educational Resources

Science.gov (United States)

Minguillón, Julià

Web 2.0 services such as social bookmarking allow users to manage and share the links they find interesting, adding their own tags for describing them. This is especially interesting in the field of open educational resources, as delicious is a simple way to bridge the institutional point of view (i.e. learning object repositories) with the individual one (i.e. personal collections), thus promoting the discovering and sharing of such resources by other users. In this paper we propose a methodology for analyzing such tags in order to discover hidden semantics (i.e. taxonomies and vocabularies) that can be used to improve descriptions of learning objects and make learning object repositories more visible and discoverable. We propose the use of a simple statistical analysis tool such as principal component analysis to discover which tags create clusters that can be semantically interpreted. We will compare the obtained results with a collection of resources related to open educational resources, in order to better understand the real needs of people searching for open educational resources.
The hidden costs of self-management services in the accounting activity of a company

Directory of Open Access Journals (Sweden)

Dan Ioan TOPOR

2017-05-01

Full Text Available This article addresses relevant aspects regarding the hidden costs of self-management services in the accounting area, within the accounting department of a company. With this aim, the authors conducted a study using a questionnaire, whose results were analyzed and interpreted. The hidden costs of the self-management of business accounting services observed in the accounting department of the company have been assessed and the causes of their generating sources were identified and analyzed. The debate of these hidden costs involved the treating of notions that exist in the accounting language, but are still not sufficiently explored by the specialists in the area. We also presented and analyzed the causes of the hidden costs of self-management in the accounting activity, as well as a reporting document for failures, arising from the case study. The article ends with the authors' conclusions regarding the hidden costs of self-management services in the accounting area.
Hidden Costs and the Role of Modularity

DEFF Research Database (Denmark)

Larsen, Marcus M.

2013-01-01

that the inability to effectively estimate the costs of implementing an activity in a foreign location has a negative impact on the process performance of that activity. Performance is deterred as operations are likely to be disrupted by opportunity costs and managerial responses. However, this relationship......This paper addresses estimation errors in strategic decision-making processes due to hidden costs. While previous research has investigated the antecedents of hidden costs, this paper investigates performance consequences. Using unique data on 221 offshoring implementations, it is argued...... is mitigated by the degree of modularity in the activity as it reduces the need for costly coordination in offshoring. This paper contributes to research on offshoring and strategic decision-making by emphasizing the importance of organizational design and of estimating the costs of internal organizational...
Called to respond: The potential of unveiling hiddens

Directory of Open Access Journals (Sweden)

Alison L Black

2014-12-01

Full Text Available Interested in exploring how personal stories and aesthetic modes of representing experiences can nudge open academic and educational spaces, this article/collection of particles seeks to document our encounters of being affected and called to respond to things the other has written and represented. As a way of engaging with questions about what research and research data might be and become, our attention has been drawn to stories and images from our lives that we have not shaken off – and to how, as we have opened these to the other, making once private moments public, our hiddens have morphed tenderly into a shared knowing and being. As we have acted on the call we have felt to respond we have found ourselves entering spaces of collaboration, communion, contemplation, and conversation – spaces illuminated by what we have not been able to – and cannot – set aside. Using visual and poetic materials we explore heartfelt and heartbroken aspects of our educational worlds and lives, to be present with each other and our (reemerging personal and professional meanings. We see the shared body (of work, of writing, of image that develops from the taking of brave steps and the risky slipping off of academic masks and language, as a manifestation of the trusted and nurturing spaces that can be generated through collaborative opportunities to gather together. These steps towards unveiling hiddens are producing in us and of us a friendship, fluency, and fluidity as we write new ways of becoming. In turn, we hope the uncovering and revealing of our dialogue in the public gathering of this journal might supports readers’ telling of their own life stories through what calls them to respond.
Segmentation of laser range radar images using hidden Markov field models

International Nuclear Information System (INIS)

Pucar, P.

1993-01-01

Segmentation of images in the context of model based stochastic techniques is connected with high, very often unpracticle computational complexity. The objective with this thesis is to take the models used in model based image processing, simplify and use them in suboptimal, but not computationally demanding algorithms. Algorithms that are essentially one-dimensional, and their extensions to two dimensions are given. The model used in this thesis is the well known hidden Markov model. Estimation of the number of hidden states from observed data is a problem that is addressed. The state order estimation problem is of general interest and is not specifically connected to image processing. An investigation of three state order estimation techniques for hidden Markov models is given. 76 refs
Hidden Markov models for labeled sequences

DEFF Research Database (Denmark)

Krogh, Anders Stærmose

1994-01-01

A hidden Markov model for labeled observations, called a class HMM, is introduced and a maximum likelihood method is developed for estimating the parameters of the model. Instead of training it to model the statistics of the training sequences it is trained to optimize recognition. It resembles MMI...
Valorización del arte en los textos periodísticos de Clarice Lispector y Sara Gallardo (1967-1973

Directory of Open Access Journals (Sweden)

Guillermina Feudal

2017-12-01

Full Text Available En el contexto regional de democratización en el acceso a los bienes culturales, un aspecto nuclear de la producción periodística de Clarice Lispector y Sara Gallardo revela una sintonía común en el comentario y apropiación de recursos estéticos de las vanguardias “de los sesenta”. La apelación al arte como referencia para evaluar la vida cotidiana constituye una decisión comunicacional que funciona, desde el planteo formal y temático, como eje de las intervenciones críticas que ellas operan en el periodismo. El artículo analiza y compara la fundamentación de las elecciones artísticas de las autoras, así como los universos de discusión en los que desarrollan la contienda estética y debaten sobre los alcances de las nuevas modalidades de interacción cultural.
Hidden costs of nuclear power

International Nuclear Information System (INIS)

England, R.W.

1979-01-01

Mr. England contends that these hidden costs add up to a figure much higher than those that appear in the electric utilities' profit and loss account - costs that are borne by Federal taxpayers, by nuclear industry workers, and by all those people who must share their environment with nuclear facilities. Costs he details are additional deaths and illnesses resulting from exposure to radiation, and the use of tax dollars to clean up the lethal garbage produced by those activities. He asserts that careless handling of uranium ore and mill tailings in past years has apparently resulted in serious public health problems in those mining communities. In another example, Mr. England states that the failure to isolate uranium tailings physically from their environment has probably contributed to an acute leukemia rate in Mesa County, Colorado. He mentions much of the technology development for power reactors being done by the Federal government, not by private reactor manufacturers - thus, again, hidden costs that do not show up in electric bills of customers. The back end of the nuclear fuel cycle as a place for Federally subsidized research and development is discussed briefly. 1 figure, 2 tables
Limits of performance for the model reduction problem of hidden Markov models

KAUST Repository

Kotsalis, Georgios

2015-12-15

We introduce system theoretic notions of a Hankel operator, and Hankel norm for hidden Markov models. We show how the related Hankel singular values provide lower bounds on the norm of the difference between a hidden Markov model of order n and any lower order approximant of order n̂ < n.
Limits of performance for the model reduction problem of hidden Markov models

KAUST Repository

Kotsalis, Georgios; Shamma, Jeff S.

2015-01-01

We introduce system theoretic notions of a Hankel operator, and Hankel norm for hidden Markov models. We show how the related Hankel singular values provide lower bounds on the norm of the difference between a hidden Markov model of order n and any lower order approximant of order n̂ < n.
Hidden Valley Higgs Decays in the ATLAS detector

CERN Document Server

Ciapetti, G

2009-01-01

A number of extensions of the Standard Model result in particles that are neutral, weakly-coupled and have macroscopic decay lengths that can be comparable with LHC detector dimensions. These particles represent, from an experimental point of view, a challenge both for the trigger and for the reconstruction capabilities of the ATLAS apparatus. For the purpose of exploring the challenges to the trigger posed by long-lived particles, the Hidden Valley scenario serves as an excellent setting. In this note we present the results of a first study of ATLAS detector performance for some Hidden Valley processes with long-lived, neutral states that decay throughout the detector volume to multi heavy-flavor jets, mainly b-bbar.
The hidden epidemic: confronting sexually transmitted diseases

National Research Council Canada - National Science Library

Eng, Thomas R; Butler, William T

.... In addition, STDs increase the risk of HIV transmission. The Hidden Epidemic examines the scope of sexually transmitted infections in the United States and provides a critical assessment of the nation's response to this public health crisis...
Dimensional reduction in field theory and hidden symmetries in extended supergravity

International Nuclear Information System (INIS)

Kremmer, E.

1985-01-01

Dimensional reduction in field theories is discussed both in theories which do not include gravity and in gravity theories. In particular, 11-dimensional supergravity and its reduction to 4 dimensions is considered. Hidden symmetries of supergravity with N=8 in 4 dimensions, global E 7 and local SU(8)-invariances in particular are detected. The hidden symmmetries permit to interpret geometrically the scalar fields
A Hidden Markov Model for Urban-Scale Traffic Estimation Using Floating Car Data.

Science.gov (United States)

Wang, Xiaomeng; Peng, Ling; Chi, Tianhe; Li, Mengzhu; Yao, Xiaojing; Shao, Jing

2015-01-01

Urban-scale traffic monitoring plays a vital role in reducing traffic congestion. Owing to its low cost and wide coverage, floating car data (FCD) serves as a novel approach to collecting traffic data. However, sparse probe data represents the vast majority of the data available on arterial roads in most urban environments. In order to overcome the problem of data sparseness, this paper proposes a hidden Markov model (HMM)-based traffic estimation model, in which the traffic condition on a road segment is considered as a hidden state that can be estimated according to the conditions of road segments having similar traffic characteristics. An algorithm based on clustering and pattern mining rather than on adjacency relationships is proposed to find clusters with road segments having similar traffic characteristics. A multi-clustering strategy is adopted to achieve a trade-off between clustering accuracy and coverage. Finally, the proposed model is designed and implemented on the basis of a real-time algorithm. Results of experiments based on real FCD confirm the applicability, accuracy, and efficiency of the model. In addition, the results indicate that the model is practicable for traffic estimation on urban arterials and works well even when more than 70% of the probe data are missing.
Experimental search for solar hidden photons in the eV energy range using kinetic mixing with photons

International Nuclear Information System (INIS)

Mizumoto, T.; Ohta, R.; Horie, T.; Suzuki, J.; Minowa, M.; Inoue, Y.

2013-01-01

We have searched for solar hidden photons in the eV energy range using a dedicated hidden photon detector. The detector consisted of a parabolic mirror with a diameter of 500 mm and a focal length of 1007 mm installed in a vacuum chamber, and a photomultiplier tube at its focal point. The detector was attached to the Tokyo axion helioscope, Sumico which has a mechanism to track the sun. From the result of the measurement, we found no evidence for the existence of hidden photons and set a limit on the photon-hidden photon mixing parameter χ depending on the hidden photon mass m γ'
Sharp Contradiction for Local-Hidden-State Model in Quantum Steering

Science.gov (United States)

Chen, Jing-Ling; Su, Hong-Yi; Xu, Zhen-Peng; Pati, Arun Kumar

2016-08-01

In quantum theory, no-go theorems are important as they rule out the existence of a particular physical model under consideration. For instance, the Greenberger-Horne-Zeilinger (GHZ) theorem serves as a no-go theorem for the nonexistence of local hidden variable models by presenting a full contradiction for the multipartite GHZ states. However, the elegant GHZ argument for Bell’s nonlocality does not go through for bipartite Einstein-Podolsky-Rosen (EPR) state. Recent study on quantum nonlocality has shown that the more precise description of EPR’s original scenario is “steering”, i.e., the nonexistence of local hidden state models. Here, we present a simple GHZ-like contradiction for any bipartite pure entangled state, thus proving a no-go theorem for the nonexistence of local hidden state models in the EPR paradox. This also indicates that the very simple steering paradox presented here is indeed the closest form to the original spirit of the EPR paradox.
Discovering Hidden Controlling Parameters using Data Analytics and Dimensional Analysis

Science.gov (United States)

Del Rosario, Zachary; Lee, Minyong; Iaccarino, Gianluca

2017-11-01

Dimensional Analysis is a powerful tool, one which takes a priori information and produces important simplifications. However, if this a priori information - the list of relevant parameters - is missing a relevant quantity, then the conclusions from Dimensional Analysis will be incorrect. In this work, we present novel conclusions in Dimensional Analysis, which provide a means to detect this failure mode of missing or hidden parameters. These results are based on a restated form of the Buckingham Pi theorem that reveals a ridge function structure underlying all dimensionless physical laws. We leverage this structure by constructing a hypothesis test based on sufficient dimension reduction, allowing for an experimental data-driven detection of hidden parameters. Both theory and examples will be presented, using classical turbulent pipe flow as the working example. Keywords: experimental techniques, dimensional analysis, lurking variables, hidden parameters, buckingham pi, data analysis. First author supported by the NSF GRFP under Grant Number DGE-114747.
Searching for confining hidden valleys at LHCb, ATLAS, and CMS

Science.gov (United States)

Pierce, Aaron; Shakya, Bibhushan; Tsai, Yuhsin; Zhao, Yue

2018-05-01

We explore strategies for probing hidden valley scenarios exhibiting confinement. Such scenarios lead to a moderate multiplicity of light hidden hadrons for generic showering and hadronization similar to QCD. Their decays are typically soft and displaced, making them challenging to probe with traditional LHC searches. We show that the low trigger requirements and excellent track and vertex reconstruction at LHCb provide a favorable environment to search for such signals. We propose novel search strategies in both muonic and hadronic channels. We also study existing ATLAS and CMS searches and compare them with our proposals at LHCb. We find that the reach at LHCb is generically better in the parameter space we consider here, even with optimistic background estimations for ATLAS and CMS searches. We discuss potential modifications at ATLAS and CMS that might make these experiments competitive with the LHCb reach. Our proposed searches can be applied to general hidden valley models as well as exotic Higgs boson decays, such as in twin Higgs models.

Single-hidden-layer feed-forward quantum neural network based on Grover learning.

Science.gov (United States)

Liu, Cheng-Yi; Chen, Chein; Chang, Ching-Ter; Shih, Lun-Min

2013-09-01

In this paper, a novel single-hidden-layer feed-forward quantum neural network model is proposed based on some concepts and principles in the quantum theory. By combining the quantum mechanism with the feed-forward neural network, we defined quantum hidden neurons and connected quantum weights, and used them as the fundamental information processing unit in a single-hidden-layer feed-forward neural network. The quantum neurons make a wide range of nonlinear functions serve as the activation functions in the hidden layer of the network, and the Grover searching algorithm outstands the optimal parameter setting iteratively and thus makes very efficient neural network learning possible. The quantum neuron and weights, along with a Grover searching algorithm based learning, result in a novel and efficient neural network characteristic of reduced network, high efficient training and prospect application in future. Some simulations are taken to investigate the performance of the proposed quantum network and the result show that it can achieve accurate learning. Copyright © 2013 Elsevier Ltd. All rights reserved.
A Self-Adaptive Hidden Markov Model for Emotion Classification in Chinese Microblogs

Directory of Open Access Journals (Sweden)

Li Liu

2015-01-01

we propose a modified version of hidden Markov model (HMM classifier, called self-adaptive HMM, whose parameters are optimized by Particle Swarm Optimization algorithms. Since manually labeling large-scale dataset is difficult, we also employ the entropy to decide whether a new unlabeled tweet shall be contained in the training dataset after being assigned an emotion using our HMM-based approach. In the experiment, we collected about 200,000 Chinese tweets from Sina Weibo. The results show that the F-score of our approach gets 76% on happiness and fear and 65% on anger, surprise, and sadness. In addition, the self-adaptive HMM classifier outperforms Naive Bayes and Support Vector Machine on recognition of happiness, anger, and sadness.
Nurture Hidden Talents: Transform School Culture into One That Values Teacher Expertise

Science.gov (United States)

Zimmerman, Diane P.

2014-01-01

This article looks into the school culture where teacher expertise is often hidden and underused. While the media-rich culture places a high value on talent, the irony is that talent is underrated in most schools, and educators often remain silent about their hidden talents. Many school cultures are not conducive to dialogue that supports displays…
Long memory of financial time series and hidden Markov models with time-varying parameters

DEFF Research Database (Denmark)

Nystrup, Peter; Madsen, Henrik; Lindström, Erik

Hidden Markov models are often used to capture stylized facts of daily returns and to infer the hidden state of financial markets. Previous studies have found that the estimated models change over time, but the implications of the time-varying behavior for the ability to reproduce the stylized...... facts have not been thoroughly examined. This paper presents an adaptive estimation approach that allows for the parameters of the estimated models to be time-varying. It is shown that a two-state Gaussian hidden Markov model with time-varying parameters is able to reproduce the long memory of squared...... daily returns that was previously believed to be the most difficult fact to reproduce with a hidden Markov model. Capturing the time-varying behavior of the parameters also leads to improved one-step predictions....
Photoacoustic imaging of hidden dental caries by using a bundle of hollow optical fibers

Science.gov (United States)

Koyama, Takuya; Kakino, Satoko; Matsuura, Yuji

2018-02-01

Photoacoustic imaging system using a bundle of hollow-optical fibers to detect hidden dental caries is proposed. Firstly, we fabricated a hidden caries model with a brown pigment simulating a common color of caries lesion. It was found that high frequency ultrasonic waves are generated from hidden carious part when radiating Nd:YAG laser light with a 532 nm wavelength to occlusal surface of model tooth. We calculated by Fourier transform and found that the waveform from the carious part provides frequency components of approximately from 0.5 to 1.2 MHz. Then a photoacoustic imaging system using a bundle of hollow optical fiber was fabricated for clinical applications. From intensity map of frequency components in 0.5-1.2 MHz, photoacoustic images of hidden caries in the simulated samples were successfully obtained.
Hidden loss

DEFF Research Database (Denmark)

Kieffer-Kristensen, Rikke; Johansen, Karen Lise Gaardsvig

2013-01-01

to participate. RESULTS: All children were affected by their parents' ABI and the altered family situation. The children's expressions led the authors to identify six themes, including fear of losing the parent, distress and estrangement, chores and responsibilities, hidden loss, coping and support. The main......PRIMARY OBJECTIVE: The purpose of this study was to listen to and learn from children showing high levels of post-traumatic stress symptoms after parental acquired brain injury (ABI), in order to achieve an in-depth understanding of the difficulties the children face in their everyday lives...... finding indicates that the children experienced numerous losses, many of which were often suppressed or neglected by the children to protect the ill parents. CONCLUSIONS: The findings indicated that the children seemed to make a special effort to hide their feelings of loss and grief in order to protect...
Hidden Markov models: the best models for forager movements?

Science.gov (United States)

Joo, Rocio; Bertrand, Sophie; Tam, Jorge; Fablet, Ronan

2013-01-01

One major challenge in the emerging field of movement ecology is the inference of behavioural modes from movement patterns. This has been mainly addressed through Hidden Markov models (HMMs). We propose here to evaluate two sets of alternative and state-of-the-art modelling approaches. First, we consider hidden semi-Markov models (HSMMs). They may better represent the behavioural dynamics of foragers since they explicitly model the duration of the behavioural modes. Second, we consider discriminative models which state the inference of behavioural modes as a classification issue, and may take better advantage of multivariate and non linear combinations of movement pattern descriptors. For this work, we use a dataset of >200 trips from human foragers, Peruvian fishermen targeting anchovy. Their movements were recorded through a Vessel Monitoring System (∼1 record per hour), while their behavioural modes (fishing, searching and cruising) were reported by on-board observers. We compare the efficiency of hidden Markov, hidden semi-Markov, and three discriminative models (random forests, artificial neural networks and support vector machines) for inferring the fishermen behavioural modes, using a cross-validation procedure. HSMMs show the highest accuracy (80%), significantly outperforming HMMs and discriminative models. Simulations show that data with higher temporal resolution, HSMMs reach nearly 100% of accuracy. Our results demonstrate to what extent the sequential nature of movement is critical for accurately inferring behavioural modes from a trajectory and we strongly recommend the use of HSMMs for such purpose. In addition, this work opens perspectives on the use of hybrid HSMM-discriminative models, where a discriminative setting for the observation process of HSMMs could greatly improve inference performance.
Hidden Markov models: the best models for forager movements?

Directory of Open Access Journals (Sweden)

Rocio Joo

Full Text Available One major challenge in the emerging field of movement ecology is the inference of behavioural modes from movement patterns. This has been mainly addressed through Hidden Markov models (HMMs. We propose here to evaluate two sets of alternative and state-of-the-art modelling approaches. First, we consider hidden semi-Markov models (HSMMs. They may better represent the behavioural dynamics of foragers since they explicitly model the duration of the behavioural modes. Second, we consider discriminative models which state the inference of behavioural modes as a classification issue, and may take better advantage of multivariate and non linear combinations of movement pattern descriptors. For this work, we use a dataset of >200 trips from human foragers, Peruvian fishermen targeting anchovy. Their movements were recorded through a Vessel Monitoring System (∼1 record per hour, while their behavioural modes (fishing, searching and cruising were reported by on-board observers. We compare the efficiency of hidden Markov, hidden semi-Markov, and three discriminative models (random forests, artificial neural networks and support vector machines for inferring the fishermen behavioural modes, using a cross-validation procedure. HSMMs show the highest accuracy (80%, significantly outperforming HMMs and discriminative models. Simulations show that data with higher temporal resolution, HSMMs reach nearly 100% of accuracy. Our results demonstrate to what extent the sequential nature of movement is critical for accurately inferring behavioural modes from a trajectory and we strongly recommend the use of HSMMs for such purpose. In addition, this work opens perspectives on the use of hybrid HSMM-discriminative models, where a discriminative setting for the observation process of HSMMs could greatly improve inference performance.
Chimpanzees (Pan troglodytes) use markers to monitor the movement of a hidden item.

Science.gov (United States)

Beran, Michael J; Beran, Mary M; Menzel, Charles R

2005-10-01

Four chimpanzees (Pan troglodytes) monitored the movement of hidden items in arrays of opaque cups. A chocolate candy was hidden in an array of four cups and temporarily presented paper markers indicated the location of the candy (which otherwise was not visible). These markers were either non-symbolic or symbolic (lexigram) stimuli that in other contexts acted as a label for the hidden candy, and the array was either rotated 180 degrees after the marker was removed or the array remained in the same location. For three of four chimpanzees, performance was better than chance in all conditions and there was no effect of the type of marker. These experiments indicate that chimpanzees can track the movement of a hidden item in an array of identical cups even when they never see the item itself, but only see a temporarily presented marker for the location of that item. However, there was no benefit to the use of symbolic as opposed to non-symbolic stimuli in this performance.
Significance of hidden advertising of the media business models in Latvia

OpenAIRE

Rožukalne, Anda

2012-01-01

Since 2002 parliamentary and municipal elections in Latvia, media content researches have shown a considerable amount of hidden advertising: media publish information that is paid-for, yet not identified as advertising, assigning this information with the qualities of independent content, therefore misleading its audience. In order to analyze this practice, a research was commissioned to find out why Latvian media publish hidden advertising, what is the force behind this practice, who are com...
Enhanced axion-photon coupling in GUT with hidden photon

Science.gov (United States)

Daido, Ryuji; Takahashi, Fuminobu; Yokozaki, Norimi

2018-05-01

We show that the axion coupling to photons can be enhanced in simple models with a single Peccei-Quinn field, if the gauge coupling unification is realized by a large kinetic mixing χ = O (0.1) between hypercharge and unbroken hidden U(1)H. The key observation is that the U(1)H gauge coupling should be rather strong to induce such large kinetic mixing, leading to enhanced contributions of hidden matter fields to the electromagnetic anomaly. We find that the axion-photon coupling is enhanced by about a factor of 10-100 with respect to the GUT-axion models with E / N = 8 / 3.
Multistability and hidden attractors in a multilevel DC/DC converter

DEFF Research Database (Denmark)

Zhusubaliyev, Zhanybai T.; Mosekilde, Erik

2015-01-01

An attracting periodic, quasiperiodic or chaotic set of a smooth, autonomous system may be referred to as a "hidden attractor" if its basin of attraction does not overlap with the neighborhood of an unstable equilibrium point. Historically, this condition has implied that the basin of attraction...... produce complicated structures of attracting and repelling states organized around the basic switching cycle. This leads us to suggest the existence of hidden attractors in such systems as well. In this case, the condition will be that the basin of attraction does not overlap with the fixed point...
Exploring inequality violations by classical hidden variables numerically

International Nuclear Information System (INIS)

Vongehr, Sascha

2013-01-01

There are increasingly suggestions for computer simulations of quantum statistics which try to violate Bell type inequalities via classical, common cause correlations. The Clauser–Horne–Shimony–Holt (CHSH) inequality is very robust. However, we argue that with the Einstein–Podolsky–Rosen setup, the CHSH is inferior to the Bell inequality, although and because the latter must assume anti-correlation of entangled photon singlet states. We simulate how often quantum behavior violates both inequalities, depending on the number of photons. Violating Bell 99% of the time is argued to be an ideal benchmark. We present hidden variables that violate the Bell and CHSH inequalities with 50% probability, and ones which violate Bell 85% of the time when missing 13% anti-correlation. We discuss how to present the quantum correlations to a wide audience and conclude that, when defending against claims of hidden classicality, one should demand numerical simulations and insist on anti-correlation and the full amount of Bell violation. -- Highlights: •The widely assumed superiority of the CHSH fails in the EPR problem. •We simulate Bell type inequalities behavior depending on the number of photons. •The core of Bell’s theorem in the EPR setup is introduced in a simple way understandable to a wide audience. •We present hidden variables that violate both inequalities with 50% probability. •Algorithms have been supplied in form of Mathematica programs
Mass spectra of hidden-charm molecular pentaquarks states

International Nuclear Information System (INIS)

Patel, Smruti; Vinodkumar, P.C.

2016-01-01

Very recently, the LHCb Collaboration has reported two hidden-charmed resonances P_c(4380) and P_c(4450) consistent with pentaquark states in the Λ_b"0 → K"-J/Ψp process with masses (widths) (4380 ±8 ± 29) MeV ((205 ±18 ± 86) MeV) and (4449.8 ±1.7 ± 2.5) MeV ((39 ±5 ±19) MeV), respectively. The observation of the P_c states has aroused the theorist's strong interest in the hidden-charm pentaquark states. They have been studied in various frameworks, such as the molecule-like pentaquark states, the diquark-diquark-antiquark type pentaquark states, the diquark-triquark type pentaquark states, re-scattering effects, etc. An identification of pentaquark states as exotic hadron has been one of the long standing problems in the physics of strong interaction and quantum chromodynamics (QCD). A decade ago lots of discussion were made about pentaquarks states but due to lack of further experimental evidences the study of pentaquarks have been almost gone in the darkness. But, recent remarkable observation of two resonances i.e. P_c(4380) and P_c(4450) with hidden charm and the minimal quark content cc-baruud provided new impact for studies of pentaquark states and opens a new window to study the exotic hadronic matter
Zero velocity interval detection based on a continuous hidden Markov model in micro inertial pedestrian navigation

Science.gov (United States)

Sun, Wei; Ding, Wei; Yan, Huifang; Duan, Shunli

2018-06-01

Shoe-mounted pedestrian navigation systems based on micro inertial sensors rely on zero velocity updates to correct their positioning errors in time, which effectively makes determining the zero velocity interval play a key role during normal walking. However, as walking gaits are complicated, and vary from person to person, it is difficult to detect walking gaits with a fixed threshold method. This paper proposes a pedestrian gait classification method based on a hidden Markov model. Pedestrian gait data are collected with a micro inertial measurement unit installed at the instep. On the basis of analyzing the characteristics of the pedestrian walk, a single direction angular rate gyro output is used to classify gait features. The angular rate data are modeled into a univariate Gaussian mixture model with three components, and a four-state left–right continuous hidden Markov model (CHMM) is designed to classify the normal walking gait. The model parameters are trained and optimized using the Baum–Welch algorithm and then the sliding window Viterbi algorithm is used to decode the gait. Walking data are collected through eight subjects walking along the same route at three different speeds; the leave-one-subject-out cross validation method is conducted to test the model. Experimental results show that the proposed algorithm can accurately detect different walking gaits of zero velocity interval. The location experiment shows that the precision of CHMM-based pedestrian navigation improved by 40% when compared to the angular rate threshold method.
Hidden supersymmetry and large N

International Nuclear Information System (INIS)

Alfaro, J.

1988-01-01

In this paper we present a new method to deal with the leading order in the large-N expansion of a quantum field theory. The method uses explicitly the hidden supersymmetry that is present in the path-integral formulation of a stochastic process. In addition to this we derive a new relation that is valid in the leading order of the large-N expansion of the hermitian-matrix model for any spacetime dimension. (orig.)
Long Memory of Financial Time Series and Hidden Markov Models with Time-Varying Parameters

DEFF Research Database (Denmark)

Nystrup, Peter; Madsen, Henrik; Lindström, Erik

2016-01-01

Hidden Markov models are often used to model daily returns and to infer the hidden state of financial markets. Previous studies have found that the estimated models change over time, but the implications of the time-varying behavior have not been thoroughly examined. This paper presents an adaptive...... to reproduce with a hidden Markov model. Capturing the time-varying behavior of the parameters also leads to improved one-step density forecasts. Finally, it is shown that the forecasting performance of the estimated models can be further improved using local smoothing to forecast the parameter variations....
Hidden Broad-line Regions in Seyfert 2 Galaxies: From the Spectropolarimetric Perspective

International Nuclear Information System (INIS)

Du, Pu; Wang, Jian-Min; Zhang, Zhi-Xiang

2017-01-01

The hidden broad-line regions (BLRs) in Seyfert 2 galaxies, which display broad emission lines (BELs) in their polarized spectra, are a key piece of evidence in support of the unified model for active galactic nuclei (AGNs). However, the detailed kinematics and geometry of hidden BLRs are still not fully understood. The virial factor obtained from reverberation mapping of type 1 AGNs may be a useful diagnostic of the nature of hidden BLRs in type 2 objects. In order to understand the hidden BLRs, we compile six type 2 objects from the literature with polarized BELs and dynamical measurements of black hole masses. All of them contain pseudobulges. We estimate their virial factors, and find the average value is 0.60 and the standard deviation is 0.69, which agree well with the value of type 1 AGNs with pseudobulges. This study demonstrates that (1) the geometry and kinematics of BLR are similar in type 1 and type 2 AGNs of the same bulge type (pseudobulges), and (2) the small values of virial factors in Seyfert 2 galaxies suggest that, similar to type 1 AGNs, BLRs tend to be very thick disks in type 2 objects.
Finite-time Lyapunov dimension and hidden attractor of the Rabinovich system

OpenAIRE

Kuznetsov, N. V.; Leonov, G. A.; Mokaev, T. N.; Prasad, A.; Shrimali, M. D.

2015-01-01

The Rabinovich system, describing the process of interaction between waves in plasma, is considered. It is shown that the Rabinovich system can exhibit a hidden attractor in the case of multistability as well as a classical self-excited attractor. The hidden attractor in this system can be localized by analytical/numerical methods based on the continuation and perpetual points. The concept of finite-time Lyapunov dimension is developed for numerical study of the dimension of attractors. A con...
Collective multipartite Einstein-Podolsky-Rosen steering: more secure optical networks.

Science.gov (United States)

Wang, Meng; Gong, Qihuang; He, Qiongyi

2014-12-01

Collective multipartite Einstein-Podolsky-Rosen (EPR) steering is a type of quantum correlation shared among N parties, where the EPR paradox of one party can only be realized by performing local measurements on all the remaining N-1 parties. We formalize the collective tripartite steering in terms of local hidden state model and give the steering inequalities that act as signatures and suggest how to optimize collective tripartite steering in specific optical schemes. The special entangled states with property of collective multipartite steering may have potential applications in ultra-secure multiuser communication networks where the issue of trust is critical.

Intense gamma-ray lines from hidden vector dark matter decay

International Nuclear Information System (INIS)

Arina, Chiara; Hambye, Thomas

2009-12-01

Scenarios with hidden, spontaneously broken, non-abelian gauge groups contain a natural dark matter candidate, the hidden vector, whose longevity is due to an accidental custodial symmetry in the renormalizable Lagrangian. Nevertheless, non-renormalizable dimension six operators break the custodial symmetry and induce the decay of the dark matter particle at cosmological times. We discuss in this paper the cosmic ray signatures of this scenario and we show that the decay of hidden vector dark matter particles generically produce an intense gamma ray line which could be observed by the Fermi-LAT experiment, if the scale of custodial symmetry breaking is close to the Grand Unification scale. This gamma line proceeds directly from a tree level dark matter 2-body decay in association with a Higgs boson. Within this model we also perform a determination of the relic density constraints taking into account the dark matter annihilation processes with one dark matter particle in the final state. The corresponding direct detection rates can be easily of order the current experimental sensitivities. (orig.)
Intense gamma-ray lines from hidden vector dark matter decay

Energy Technology Data Exchange (ETDEWEB)

Arina, Chiara; Hambye, Thomas [Universite Libre de Bruxelles (Belgium). Service de Physique Theorique; Ibarra, Alejandro [Technische Univ. Muenchen, Garching (Germany). Physik-Department; Weniger, Christoph [Deutsches Elektronen-Synchrotron (DESY), Hamburg (Germany)

2009-12-15

Scenarios with hidden, spontaneously broken, non-abelian gauge groups contain a natural dark matter candidate, the hidden vector, whose longevity is due to an accidental custodial symmetry in the renormalizable Lagrangian. Nevertheless, non-renormalizable dimension six operators break the custodial symmetry and induce the decay of the dark matter particle at cosmological times. We discuss in this paper the cosmic ray signatures of this scenario and we show that the decay of hidden vector dark matter particles generically produce an intense gamma ray line which could be observed by the Fermi-LAT experiment, if the scale of custodial symmetry breaking is close to the Grand Unification scale. This gamma line proceeds directly from a tree level dark matter 2-body decay in association with a Higgs boson. Within this model we also perform a determination of the relic density constraints taking into account the dark matter annihilation processes with one dark matter particle in the final state. The corresponding direct detection rates can be easily of order the current experimental sensitivities. (orig.)
Intense gamma-ray lines from hidden vector dark matter decay

International Nuclear Information System (INIS)

Arina, Chiara; Hambye, Thomas; Ibarra, Alejandro; Weniger, Christoph

2010-01-01

Scenarios with hidden, spontaneously broken, non-abelian gauge groups contain a natural dark matter candidate, the hidden vector, whose longevity is due to an accidental custodial symmetry in the renormalizable Lagrangian. Nevertheless, non-renormalizable dimension six operators break the custodial symmetry and induce the decay of the dark matter particle at cosmological times. We discuss in this paper the cosmic ray signatures of this scenario and we show that the decay of hidden vector dark matter particles generically produce an intense gamma ray line which could be observed by the Fermi-LAT experiment, if the scale of custodial symmetry breaking is close to the Grand Unification scale. This gamma line proceeds directly from a tree level dark matter 2-body decay in association with a Higgs boson. Within this model we also perform a determination of the relic density constraints taking into account the dark matter annihilation processes with one dark matter particle in the final state. The corresponding direct detection rates can be easily of order the current experimental sensitivities
The Hidden Cost of Buying a Computer.

Science.gov (United States)

Johnson, Michael

1983-01-01

In order to process data in a computer, application software must be either developed or purchased. Costs for modifications of the software package and maintenance are often hidden. The decision to buy or develop software packages should be based upon factors of time and maintenance. (MLF)
Theoretical analysis of hidden photon searches in high-precision experiments

International Nuclear Information System (INIS)

Beranek, Tobias

2014-01-01

Although the Standard Model of particle physics (SM) provides an extremely successful description of the ordinary matter, one knows from astronomical observations that it accounts only for around 5% of the total energy density of the Universe, whereas around 30% are contributed by the dark matter. Motivated by anomalies in cosmic ray observations and by attempts to solve questions of the SM like the (g-2) μ discrepancy, proposed U(1) extensions of the Standard Model gauge group SU(3) x SU(2) x U(1) have raised attention in recent years. In the considered U(1) extensions a new, light messenger particle γ', the hidden photon, couples to the hidden sector as well as to the electromagnetic current of the SM by kinetic mixing. This allows for a search for this particle in laboratory experiments exploring the electromagnetic interaction. Various experimental programs have been started to search for the γ' boson, such as in electron-scattering experiments, which are a versatile tool to explore various physics phenomena. One approach is the dedicated search in fixed-target experiments at modest energies as performed at MAMI or at JLAB. In these experiments the scattering of an electron beam off a hadronic target e→e(A,Z)l + l - is investigated and a search for a very narrow resonance in the invariant mass distribution of the l + l - pair is performed. This requires an accurate understanding of the theoretical basis of the underlying processes. For this purpose it is demonstrated in the first part of this work, in which way the hidden photon can be motivated from existing puzzles encountered at the precision frontier of the SM. The main part of this thesis deals with the analysis of the theoretical framework for electron scattering fixed-target experiments searching for hidden photons. As a first step, the cross section for the bremsstrahlung emission of hidden photons in such experiments is studied. Based on these results, the applicability of the Weizsaecker
Sterile neutrino, hidden dark matter and their cosmological signatures

International Nuclear Information System (INIS)

Das, Subinoy

2012-01-01

Though thermal dark matter has been the central idea behind the dark matter candidates, it is highly possible that dark matter of the universe is non-thermal in origin or it might be in thermal contact with some hidden or dark sector but not with standard model. Here we explore the cosmological bounds as well as the signatures on two types of non-thermal dark matter candidates. First we discuss a hidden dark matter with almost no interaction (or very feeble) with standard model particles so that it is not in thermal contact with visible sector but we assume it is thermalized with in a hidden sector due to some interaction. While encompassing the standard cold WIMP scenario, we do not require the freeze-out process to be non-relativistic. Rather, freeze-out may also occur when dark matter particles are semi-relativistic or relativistic. Especially we focus on the warm dark matter scenario in this set up and find the constraints on the warm dark matter mass, cross-section and hidden to visible sector temperature ratio which accounts for the observed dark-matter density, satisfies the Tremaine-Gunn bound on dark-matter phase space density and has a free-streaming length consistent with cosmological constraints on the matter power spectrum. Our method can also be applied to keV sterile neutrino dark matter which is not thermalized with standard model but is thermalized with in a dark sector. The second part of this proceeding focuses on an exotic dark matter candidate which arises from the existence of eV mass sterile neutrino through a late phase transition. Due to existence of a strong scalar force the light sterile states get trapped into stable degenerate micro nuggets. We find that its signature in matter power spectra is close to a warm dark matter candidate.
Who, 'we'? The Constitution and the Singular Identity of the Collective

DEFF Research Database (Denmark)

Nissen, Morten

2017-01-01

is viewed as struggling for recognition through a performative branding hidden behind a radically situated self-conception. Finally, an emerging web-portal collective is modeled as a co-authoring of counselling with art and research that seeks to reflect itself as at once concrete and universal. Through...
Exposing the Hidden-Web Induced by Ajax

NARCIS (Netherlands)

Mesbah, A.; Van Deursen, A.

2008-01-01

AJAX is a very promising approach for improving rich interactivity and responsiveness of web applications. At the same time, AJAX techniques increase the totality of the hidden web by shattering the metaphor of a web ‘page’ upon which general search engines are based. This paper describes a
KMEANS CLUSTERING FOR HIDDEN MARKOV MODEL

NARCIS (Netherlands)

Perrone, M.P.; Connell, S.D.

2004-01-01

An unsupervised kmeans clustering algorithm for hidden Markov models is described and applied to the task of generating subclass models for individual handwritten character classes. The algorithm is compared to a related clustering method and shown to give a relative change in the error rate of as
Algorithms for a parallel implementation of Hidden Markov Models with a small state space

DEFF Research Database (Denmark)

Nielsen, Jesper; Sand, Andreas

2011-01-01

Two of the most important algorithms for Hidden Markov Models are the forward and the Viterbi algorithms. We show how formulating these using linear algebra naturally lends itself to parallelization. Although the obtained algorithms are slow for Hidden Markov Models with large state spaces...
Testing string vacua in the lab. From a hidden CMB to dark forces in flux compactifications

Energy Technology Data Exchange (ETDEWEB)

Cicoli, Michele; Goodsell, Mark; Ringwald, Andreas [Deutsches Elektronen-Synchrotron DESY, Hamburg (Germany). Theory Group; Jaeckel, Joerg [Durham Univ. (United Kingdom). Inst. for Particle Physics Phenomenolgy

2011-03-15

We perform a detailed analysis of the phenomenological properties of hidden Abelian gauge bosons with a kinetic mixing with the ordinary photon within type IIB flux compactifications. We study the interplay between moduli stabilisation and the Green-Schwarz mechanism that gives mass to the hidden photon paying particular attention to the role of D-terms. We present two generic classes of explicit Calabi-Yau examples with an isotropic and an anisotropic shape of the extra dimensions showing how the last case turns out to be very promising to make contact with current experiments. In fact, anisotropic compactifications lead naturally to a GeV-scale hidden photon (''dark forces'' that can be searched for in beam dump experiments) for an intermediate string scale; or even to an meV-scale hidden photon (which could lead to a ''hidden CMB'' and can be tested by light-shining-through-a-wall experiments) in the case of TeV-scale strings. (orig.)
Has Bell's inequality a general meaning for hidden-variable theories

International Nuclear Information System (INIS)

Lochak, G.

1976-01-01

The proof given by J. S. Bell of an inequality between mean values of measurement results which, according to him, would be characteristic of any local hidden-parameter theory, is analyzed. It is shown that Bell's proof is based upon a hypothesis already contained in von Neumann's famous theorem: It consists in the admission that hidden values of parameters must obey the same statistical laws as observed values. This hypothesis contradicts in advance well known and certainly correct statistical relations in measurement results: one must therefore reject the type of theory considered by Bell, and his inequality has no general meaning
Swallowing sound detection using hidden markov modeling of recurrence plot features

International Nuclear Information System (INIS)

Aboofazeli, Mohammad; Moussavi, Zahra

2009-01-01

Automated detection of swallowing sounds in swallowing and breath sound recordings is of importance for monitoring purposes in which the recording durations are long. This paper presents a novel method for swallowing sound detection using hidden Markov modeling of recurrence plot features. Tracheal sound recordings of 15 healthy and nine dysphagic subjects were studied. The multidimensional state space trajectory of each signal was reconstructed using the Taken method of delays. The sequences of three recurrence plot features of the reconstructed trajectories (which have shown discriminating capability between swallowing and breath sounds) were modeled by three hidden Markov models. The Viterbi algorithm was used for swallowing sound detection. The results were validated manually by inspection of the simultaneously recorded airflow signal and spectrogram of the sounds, and also by auditory means. The experimental results suggested that the performance of the proposed method using hidden Markov modeling of recurrence plot features was superior to the previous swallowing sound detection methods.
Swallowing sound detection using hidden markov modeling of recurrence plot features

Energy Technology Data Exchange (ETDEWEB)

Aboofazeli, Mohammad [Faculty of Engineering, Department of Electrical and Computer Engineering, University of Manitoba, Winnipeg, Manitoba, R3T 5V6 (Canada)], E-mail: umaboofa@cc.umanitoba.ca; Moussavi, Zahra [Faculty of Engineering, Department of Electrical and Computer Engineering, University of Manitoba, Winnipeg, Manitoba, R3T 5V6 (Canada)], E-mail: mousavi@ee.umanitoba.ca

2009-01-30

Automated detection of swallowing sounds in swallowing and breath sound recordings is of importance for monitoring purposes in which the recording durations are long. This paper presents a novel method for swallowing sound detection using hidden Markov modeling of recurrence plot features. Tracheal sound recordings of 15 healthy and nine dysphagic subjects were studied. The multidimensional state space trajectory of each signal was reconstructed using the Taken method of delays. The sequences of three recurrence plot features of the reconstructed trajectories (which have shown discriminating capability between swallowing and breath sounds) were modeled by three hidden Markov models. The Viterbi algorithm was used for swallowing sound detection. The results were validated manually by inspection of the simultaneously recorded airflow signal and spectrogram of the sounds, and also by auditory means. The experimental results suggested that the performance of the proposed method using hidden Markov modeling of recurrence plot features was superior to the previous swallowing sound detection methods.
Hidden conformal symmetry of a rotating black hole with four charges

International Nuclear Information System (INIS)

Shao Kainan; Zhang Zhibai

2011-01-01

Kerr/CFT correspondence exhibits many remarkable connections between the near-horizon Kerr black hole and a conformal field theory (CFT). Recently, Castro, Maloney, and Strominger showed that a hidden conformal symmetry exists in the solution space of a Kerr black hole. In this paper we investigate a rotating black hole with four independent U(1) charges derived from string theory which is known as the four-dimensional Cvetic-Youm solution, and we prove that the same hidden conformal symmetry also holds. We obtain the exact black hole entropy using the temperatures derived. The entropy and absorption cross section agree with the previous results [M. Cvetic and F. Larsen, Nucl. Phys. B506, 107 (1997).] and [M. Cvetic and F. Larsen, J. High Energy Phys. 09 (2009) 088.]. In addition, we clarify a previous explanation on the temperatures of the Cvetic-Youm solution's dual CFT. This work provides more robust derivation of the hidden conformal symmetry of Kerr-like black holes and as well as Kerr/CFT correspondence.
Implications of the measured angular anisotropy at the hidden order transition of URu2Si2

Science.gov (United States)

Chandra, P.; Coleman, P.; Flint, R.; Trinh, J.; Ramirez, A. P.

2018-05-01

The heavy fermion compound URu2Si2 continues to attract great interest due to the long-unidentified nature of the hidden order that develops below 17.5 K. Here we discuss the implications of an angular survey of the linear and nonlinear susceptibility of URu2Si2 in the vicinity of the hidden order transition [1]. While the anisotropic nature of spin fluctuations and low-temperature quasiparticles was previously established, our recent results suggest that the order parameter itself has intrinsic Ising anisotropy, and that moreover this anisotropy extends far above the hidden order transition. Consistency checks and subsequent questions for future experimental and theoretical studies of hidden order are discussed.
Hidden sector dark matter and the Galactic Center gamma-ray excess: a closer look

Science.gov (United States)

Escudero, Miguel; Witte, Samuel J.; Hooper, Dan

2017-11-01

Stringent constraints from direct detection experiments and the Large Hadron Collider motivate us to consider models in which the dark matter does not directly couple to the Standard Model, but that instead annihilates into hidden sector particles which ultimately decay through small couplings to the Standard Model. We calculate the gamma-ray emission generated within the context of several such hidden sector models, including those in which the hidden sector couples to the Standard Model through the vector portal (kinetic mixing with Standard Model hypercharge), through the Higgs portal (mixing with the Standard Model Higgs boson), or both. In each case, we identify broad regions of parameter space in which the observed spectrum and intensity of the Galactic Center gamma-ray excess can easily be accommodated, while providing an acceptable thermal relic abundance and remaining consistent with all current constraints. We also point out that cosmic-ray antiproton measurements could potentially discriminate some hidden sector models from more conventional dark matter scenarios.
Hidden Sector Dark Matter and the Galactic Center Gamma-Ray Excess: A Closer Look

Energy Technology Data Exchange (ETDEWEB)

Escudero, Miguel; Witte, Samuel J.; Hooper, Dan

2017-09-20

Stringent constraints from direct detection experiments and the Large Hadron Collider motivate us to consider models in which the dark matter does not directly couple to the Standard Model, but that instead annihilates into hidden sector particles which ultimately decay through small couplings to the Standard Model. We calculate the gamma-ray emission generated within the context of several such hidden sector models, including those in which the hidden sector couples to the Standard Model through the vector portal (kinetic mixing with Standard Model hypercharge), through the Higgs portal (mixing with the Standard Model Higgs boson), or both. In each case, we identify broad regions of parameter space in which the observed spectrum and intensity of the Galactic Center gamma-ray excess can easily be accommodated, while providing an acceptable thermal relic abundance and remaining consistent with all current constraints. We also point out that cosmic-ray antiproton measurements could potentially discriminate some hidden sector models from more conventional dark matter scenarios.
ESO's Hidden Treasures Brought to Light

Science.gov (United States)

2011-01-01

ESO's Hidden Treasures 2010 astrophotography competition attracted nearly 100 entries, and ESO is delighted to announce the winners. Hidden Treasures gave amateur astronomers the opportunity to search ESO's vast archives of astronomical data for a well-hidden cosmic gem. Astronomy enthusiast Igor Chekalin from Russia won the first prize in this difficult but rewarding challenge - the trip of a lifetime to ESO's Very Large Telescope at Paranal, Chile. The pictures of the Universe that can be seen in ESO's releases are impressive. However, many hours of skilful work are required to assemble the raw greyscale data captured by the telescopes into these colourful images, correcting them for distortions and unwanted signatures of the instrument, and enhancing them so as to bring out the details contained in the astronomical data. ESO has a team of professional image processors, but for the ESO's Hidden Treasures 2010 competition, the experts decided to give astronomy and photography enthusiasts the opportunity to show the world what they could do with the mammoth amount of data contained in ESO's archives. The enthusiasts who responded to the call submitted nearly 100 entries in total - far exceeding initial expectations, given the difficult nature of the challenge. "We were completely taken aback both by the quantity and the quality of the images that were submitted. This was not a challenge for the faint-hearted, requiring both an advanced knowledge of data processing and an artistic eye. We are thrilled to have discovered so many talented people," said Lars Lindberg Christensen, Head of ESO's education and Public Outreach Department. Digging through many terabytes of professional astronomical data, the entrants had to identify a series of greyscale images of a celestial object that would reveal the hidden beauty of our Universe. The chance of a great reward for the lucky winner was enough to spur on the competitors; the first prize being a trip to ESO's Very Large
Poisson-Gaussian Noise Reduction Using the Hidden Markov Model in Contourlet Domain for Fluorescence Microscopy Images

Science.gov (United States)

Yang, Sejung; Lee, Byung-Uk

2015-01-01

In certain image acquisitions processes, like in fluorescence microscopy or astronomy, only a limited number of photons can be collected due to various physical constraints. The resulting images suffer from signal dependent noise, which can be modeled as a Poisson distribution, and a low signal-to-noise ratio. However, the majority of research on noise reduction algorithms focuses on signal independent Gaussian noise. In this paper, we model noise as a combination of Poisson and Gaussian probability distributions to construct a more accurate model and adopt the contourlet transform which provides a sparse representation of the directional components in images. We also apply hidden Markov models with a framework that neatly describes the spatial and interscale dependencies which are the properties of transformation coefficients of natural images. In this paper, an effective denoising algorithm for Poisson-Gaussian noise is proposed using the contourlet transform, hidden Markov models and noise estimation in the transform domain. We supplement the algorithm by cycle spinning and Wiener filtering for further improvements. We finally show experimental results with simulations and fluorescence microscopy images which demonstrate the improved performance of the proposed approach. PMID:26352138

Cultural competence in medical education: aligning the formal, informal and hidden curricula.

Science.gov (United States)

Paul, David; Ewen, Shaun C; Jones, Rhys

2014-12-01

The concept of cultural competence has become reified by inclusion as an accreditation standard in the US and Canada, in New Zealand it is demanded through an Act of Parliament, and it pervades discussion in Australian medical education discourse. However, there is evidence that medical graduates feel poorly prepared to deliver cross-cultural care (Weissman et al. in J Am Med Assoc 294(9):1058-1067, 2005) and many commentators have questioned the effectiveness of cultural competence curricula. In this paper we apply Hafferty's taxonomy of curricula, the formal, informal and hidden curriculum (Hafferty in Acad Med 73(4):403-407, 1998), to cultural competence. Using an example across each of these curricular domains, we highlight the need for curricular congruence to support cultural competence development among learners. We argue that much of the focus on cultural competence has been in the realm of formal curricula, with existing informal and hidden curricula which may be at odds with the formal curriculum. The focus of the formal, informal and hidden curriculum, we contend, should be to address disparities in health care outcomes. In conclusion, we suggest that without congruence between formal, informal and hidden curricula, approaches to addressing disparity in health care outcomes in medical education may continue to represent reform without change.
The Hidden Curriculum of Veterinary Education: Mediators and Moderators of Its Effects.

Science.gov (United States)

Roder, Carrie A; May, Stephen A

The "hidden curriculum" has long been supposed to have an effect on students' learning during their clinical education, and in particular in shaping their ideas of what it means to be a professional. Despite this, there has been little evidence linking specific changes in professional attitudes to the individual components of the hidden curriculum. This study aimed to recognize those components that led to a change in students' professional attitudes at a UK veterinary school, as well as to identify the attitudes most affected. Observations were made of 11 student groups across five clinical rotations, followed by semi-structured interviews with 23 students at the end of their rotation experience. Data were combined and analyzed thematically, taking both an inductive and deductive approach. Views about the importance of technical competence and communication skills were promoted as a result of students' interaction with the hidden curriculum, and tensions were revealed in relation to their attitudes toward compassion and empathy, autonomy and responsibility, and lifestyle ethic. The assessment processes of rotations and the clinical service organization served to communicate the messages of the hidden curriculum, bringing about changes in student professional attitudes, while student-selected role models and the student rotation groups moderated the effects of these influences.
The Hidden Gifts of Quiet Kids

Science.gov (United States)

Trierweiler, Hannah

2006-01-01

The author relates that she was an introvert child. It has always taken her time and energy to find her place in a group. As a grown-up, she still needed quiet time to regroup during a busy day. In this article, the author presents an interview with Marti Olsen Laney, author of "The Hidden Gifts of the Introverted Child." During the interview,…
A Rose By Other Names: Some General Musings on Lawrence and Colleagues' Hidden Curriculum Scoping Review.

Science.gov (United States)

Hafferty, Frederic W; Martimianakis, Maria Athina

2017-11-07

In this Commentary, the authors explore the scoping review by Lawrence and colleagues by challenging their conclusion that with over 25 years' worth of "ambiguous and seemingly ubiquitous use" of the hidden curriculum construct in health professions education scholarship, it is time to either move to a more uniform definitional foundation or abandon the term altogether. The commentary authors counter these remedial propositions by foregrounding the importance of theoretical diversity and the conceptual richness afforded when the hidden curriculum construct is used as an entry point for studying the interstitial space between the formal and a range of other-than-formal domains of learning. Further, they document how tightly-delimited scoping strategies fail to capture the wealth of educational scholarship that operates within a hidden curriculum framework, including "hidden" hidden curriculum articles, studies that employ alternative constructs, and investigations that target important tacit socio-cultural influences on learners and faculty without formally deploying the term. They offer examples of how the hidden curriculum construct, while undergoing significant transformation in its application within the field of health professions education, has created the conceptual foundation for the application of a number of critical perspectives that make visible the field's political investments in particular forms of knowing and associated practices. Finally, the commentary authors invite readers to consider the methodological promise afforded by conceptual heterogeneity, particularly strands of scholarship that resituate the hidden curriculum concept within the magically expansive dance of social relationships, social learning, and social life that form the learning environments of health professions education.
The Missing Books of Magic from Sandvik: In search for hidden books and secret knowledge

Directory of Open Access Journals (Sweden)

Åsa Ljungström

2014-05-01

Full Text Available This article aims at defining a privately-owned manuscript from the end of the eighteenth century; a notebook of charms, recipes and ritual prescriptions, presumed to be connected with known manuscripts of magic, that were kept secret and hidden away. The study attempts to reconstruct the context of ‘The Sandvik Notebook’, in order to find out who penned it, when, and why. What kind of knowledge was sought: was it collected for antiquarian reasons, for esoteric interest, or for practical use – such as curing livestock and human beings? Was it copied from books or collected from peasant informants, and could it be related to the extant manuscripts ‘The Black Book’ and ‘The Red Book’, objects of the same line of enquiry? The three manuscripts are from Sandvik Manor, of the joint parish Burseryd-Sandvik, Sweden.
Prediction of super-heavy N⁎ and Λ⁎ resonances with hidden beauty

International Nuclear Information System (INIS)

Wu Jiajun; Zhao Lu; Zou, B.S.

2012-01-01

The meson-baryon coupled channel unitary approach with the local hidden gauge formalism is extended to the hidden beauty sector. A few narrow N ⁎ and Λ ⁎ resonances around 11 GeV are predicted as dynamically generated states from the interactions of heavy beauty mesons and baryons. Production cross sections of these predicted resonances in pp and ep collisions are estimated as a guide for the possible experimental search at relevant facilities.
Locality or non-locality in quantum mechanics: hidden variables without ''spooky action-at-a-distance''

International Nuclear Information System (INIS)

Aharonov, Y.; Scully, M.

2001-01-01

The folklore notion of the ''Non-Locality of Quantum Mechanics'' is examined from the point of view of hidden-variables theories according to Belinfante's classification in his Survey of Hidden Variables Theories. It is here shown that in the case of EPR, there exist hidden variables theories that successfully reproduce quantum-mechanical predictions, but which are explicitly local. Since such theories do not fall into Belinfante's classification, we propose an expanded classification which includes similar theories, which we term as theories of the ''third'' kind. Causal implications of such theories are explored. (orig.)
Hidden magnetism in periodically modulated one dimensional dipolar fermions

Science.gov (United States)

Fazzini, S.; Montorsi, A.; Roncaglia, M.; Barbiero, L.

2017-12-01

The experimental realization of time-dependent ultracold lattice systems has paved the way towards the implementation of new Hubbard-like Hamiltonians. We show that in a one-dimensional two-components lattice dipolar Fermi gas the competition between long range repulsion and correlated hopping induced by periodically modulated on-site interaction allows for the formation of hidden magnetic phases, with degenerate protected edge modes. The magnetism, characterized solely by string-like nonlocal order parameters, manifests in the charge and/or in the spin degrees of freedom. Such behavior is enlighten by employing Luttinger liquid theory and numerical methods. The range of parameters for which hidden magnetism is present can be reached by means of the currently available experimental setups and probes.
Notas sobre Feral y las cigüeñas, de Fernando Alonso, y la "Historia del califa cigüeña" (Wilhelm Hauff, Sara Cone Bryant

Directory of Open Access Journals (Sweden)

Hans Christian Hagedorn

2011-01-01

Full Text Available En el presente estudio se analizan las fuentes de la versión de la "Historia del califa cigüeña", incluida en la narración Feral y las cigüeñas (1971, de Fernando Alonso. Para ello se tienen en cuenta el cuento original del autor postromántico alemán Wilhelm Hauff ("Die Geschichte von Kalif Storch", 1825, y la adaptación de este cuento que Sara Cone Bryant realizó para su libro How to tell stories to children (1905, traducción española: El arte de contar cuentos, 1965.
Identification of hidden failures in control systems: a functional modelling approach

International Nuclear Information System (INIS)

Jalashgar, A.; Modarres, M.

1996-01-01

This paper presents a model which encompasses knowledge about a process control system's functionalities in a function-oriented failure analysis task. The technique called Hybrid MFM-GTST, mainly utilizes two different function - oriented methods (MFM and GTST) to identify all functions of the system components, and hence possible sources of hidden failures in process control systems. Hidden failures are referred to incipient failures within the system that in long term may lead to loss of major functions. The features of the method are described and demonstrated by using an example of a process control system
Heisenberg (and Schrödinger, and Pauli) on hidden variables

Science.gov (United States)

Bacciagaluppi, Guido; Crull, Elise

In this paper, we discuss various aspects of Heisenberg's thought on hidden variables in the period 1927-1935. We also compare Heisenberg's approach to others current at the time, specifically that embodied by von Neumann's impossibility proof, but also views expressed mainly in correspondence by Pauli and by Schrödinger. We shall base ourselves mostly on published and unpublished materials that are known but little-studied, among others Heisenberg's own draft response to the EPR paper. Our aim will be not only to clarify Heisenberg's thought on the hidden-variables question, but in part also to clarify how this question was understood more generally at the time.
Anti-pairing in learning of a neural network with redundant hidden units

International Nuclear Information System (INIS)

Kwon, Chulan; Kim, Hyong Kyun

2005-01-01

We study the statistical mechanics of learning from examples between the two-layered committee machines with different numbers of hidden units using the replica theory. The number M of hidden units of the student network is larger than the number M T of those of the target network called the teacher. We choose the networks to have binary synaptic weights, ±1, which makes it possible to compare the calculation with the Monte Carlo simulation. We propose an effective teacher as a virtual target network which has the same M hidden units as the student and gives identical outputs with those of the original teacher. This is a way of making a conjecture for a ground state of a thermodynamic system, given by the weights of the effective teacher in our study. We suppose that the weights on M T hidden units of the effective teacher are the same as those of the original teacher while those on M - M T redundant hidden units are composed of anti-pairs, {1, - 1}, with probability 1 - p in the limit p → 0. For p = 0 exact, there are no terms related to the effective teacher in the calculation, for the contributions of anti-pairs to outputs are exactly cancelled. In the limit p → 0, however, we find that the learnt weights of the student are actually equivalent to those of the suggested effective teacher, which is not possible from the calculation for p = 0. p plays the role of a symmetry breaking parameter for anti-pairing ordering, which is analogous to the magnetic field for the Ising model. A first-order phase transition is found to be signalled by breaking of symmetry in permuting hidden units. Above a critical number of examples, the student is shown to learn perfectly the effective teacher. Anti-pairing can be measured by a set of order parameters; zero in the permutation-symmetric phase and nonzero in the permutation symmetry breaking phase. Results from the Monte Carlo simulation are shown to be in good agreement with those from the replica calculation
Hidden neuronal correlations in cultured networks

International Nuclear Information System (INIS)

Segev, Ronen; Baruchi, Itay; Hulata, Eyal; Ben-Jacob, Eshel

2004-01-01

Utilization of a clustering algorithm on neuronal spatiotemporal correlation matrices recorded during a spontaneous activity of in vitro networks revealed the existence of hidden correlations: the sequence of synchronized bursting events (SBEs) is composed of statistically distinguishable subgroups each with its own distinct pattern of interneuron spatiotemporal correlations. These findings hint that each of the SBE subgroups can serve as a template for coding, storage, and retrieval of a specific information
Low energy theorems of hidden local symmetries

International Nuclear Information System (INIS)

Harada, Masayasu; Kugo, Taichiro; Yamawaki, Koichi.

1994-01-01

We prove to all orders of the loop expansion the low energy theorems of hidden local symmetries in four-dimensional nonlinear sigma models based on the coset space G/H, with G and H being arbitrary compact groups. Although the models are non-renormalizable, the proof is done in an analogous manner to the renormalization proof of gauge theories and two-dimensional nonlinear sigma models by restricting ourselves to the operators with two derivatives (counting a hidden gauge boson field as one derivative), i.e., with dimension 2, which are the only operators relevant to the low energy limit. Through loop-wise mathematical induction based on the Ward-Takahashi identity for the BRS symmetry, we solve renormalization equation for the effective action up to dimension-2 terms plus terms with the relevant BRS sources. We then show that all the quantum corrections to the dimension-2 operators, including the finite parts as well as the divergent ones, can be entirely absorbed into a re-definition (renormalization) of the parameters and the fields in the dimension-2 part of the tree-level Lagrangian. (author)
Constraints on hidden photons from current and future observations of CMB spectral distortions

International Nuclear Information System (INIS)

Kunze, Kerstin E.; Vázquez-Mozo, Miguel Á.

2015-01-01

A variety of beyond the standard model scenarios contain very light hidden sector U(1) gauge bosons undergoing kinetic mixing with the photon. The resulting oscillation between ordinary and hidden photons leads to spectral distortions of the cosmic microwave background. We update the bounds on the mixing parameter χ 0 and the mass of the hidden photon m γ' for future experiments measuring CMB spectral distortions, such as PIXIE and PRISM/COrE. For 10 −14 eV∼< m γ' ∼< 10 −13 eV, we find the kinetic mixing angle χ 0 has to be less than 10 −8 at 95% CL. These bounds are more than an order of magnitude stronger than those derived from the COBE/FIRAS data
Home-Explorer: Ontology-Based Physical Artifact Search and Hidden Object Detection System

Directory of Open Access Journals (Sweden)

Bin Guo

2008-01-01

Full Text Available A new system named Home-Explorer that searches and finds physical artifacts in a smart indoor environment is proposed. The view on which it is based is artifact-centered and uses sensors attached to the everyday artifacts (called smart objects in the real world. This paper makes two main contributions: First, it addresses, the robustness of the embedded sensors, which is seldom discussed in previous smart artifact research. Because sensors may sometimes be broken or fail to work under certain conditions, smart objects become hidden ones. However, current systems provide no mechanism to detect and manage objects when this problem occurs. Second, there is no common context infrastructure for building smart artifact systems, which makes it difficult for separately developed applications to interact with each other and uneasy for them to share and reuse knowledge. Unlike previous systems, Home-Explorer builds on an ontology-based knowledge infrastructure named Sixth-Sense, which makes it easy for the system to interact with other applications or agents also based on this ontology. The hidden object problem is also reflected in our ontology, which enables Home-Explorer to deal with both smart objects and hidden objects. A set of rules for deducing an object's status or location information and for locating hidden objects are described and evaluated.
Hidden symmetry of the quantum Calogero-Moser system

DEFF Research Database (Denmark)

Kuzentsov, Vadim b

1996-01-01

The hidden symmetry of the quantum Calogero-Moser system with an inverse-square potential is algebraically demonstrated making use of Dunkl's operators. We find the underlying algebra explaining the super-integrability phenomenon for this system. Applications to related multi-variable Bessel...... functions are also discussed....
Hidden hyperchaos and electronic circuit application in a 5D self-exciting homopolar disc dynamo

Science.gov (United States)

Wei, Zhouchao; Moroz, Irene; Sprott, J. C.; Akgul, Akif; Zhang, Wei

2017-03-01

We report on the finding of hidden hyperchaos in a 5D extension to a known 3D self-exciting homopolar disc dynamo. The hidden hyperchaos is identified through three positive Lyapunov exponents under the condition that the proposed model has just two stable equilibrium states in certain regions of parameter space. The new 5D hyperchaotic self-exciting homopolar disc dynamo has multiple attractors including point attractors, limit cycles, quasi-periodic dynamics, hidden chaos or hyperchaos, as well as coexisting attractors. We use numerical integrations to create the phase plane trajectories, produce bifurcation diagram, and compute Lyapunov exponents to verify the hidden attractors. Because no unstable equilibria exist in two parameter regions, the system has a multistability and six kinds of complex dynamic behaviors. To the best of our knowledge, this feature has not been previously reported in any other high-dimensional system. Moreover, the 5D hyperchaotic system has been simulated using a specially designed electronic circuit and viewed on an oscilloscope, thereby confirming the results of the numerical integrations. Both Matlab and the oscilloscope outputs produce similar phase portraits. Such implementations in real time represent a new type of hidden attractor with important consequences for engineering applications.
Search for dark matter in the hidden-photon sector with a large spherical mirror

CERN Document Server

Veberic, Darko; Doebrich, Babette; Engel, Ralph; Jaeckel, Joerg; Kowalski, Marek; Lindner, Axel; Mathes, Hermann-Josef; Redondo, Javier; Roth, Markus; Schaefer, Christoph; Ulrich, Ralf

2015-01-01

If dark matter consists of hidden-sector photons which kinetically mix with regular photons, a tiny oscillating electric-field component is present wherever we have dark matter. In the surface of conducting materials this induces a small probability to emit single photons almost perpendicular to the surface, with the corresponding photon frequency matching the mass of the hidden photons. We report on a construction of an experimental setup with a large ~14 m2 spherical metallic mirror that will allow for searches of hidden-photon dark matter in the eV and sub-eV range by application of different electromagnetic radiation detectors. We discuss sensitivity and accessible regions in the dark matter parameter space.
Bayesian structural inference for hidden processes

Science.gov (United States)

Strelioff, Christopher C.; Crutchfield, James P.

2014-04-01

We introduce a Bayesian approach to discovering patterns in structurally complex processes. The proposed method of Bayesian structural inference (BSI) relies on a set of candidate unifilar hidden Markov model (uHMM) topologies for inference of process structure from a data series. We employ a recently developed exact enumeration of topological ɛ-machines. (A sequel then removes the topological restriction.) This subset of the uHMM topologies has the added benefit that inferred models are guaranteed to be ɛ-machines, irrespective of estimated transition probabilities. Properties of ɛ-machines and uHMMs allow for the derivation of analytic expressions for estimating transition probabilities, inferring start states, and comparing the posterior probability of candidate model topologies, despite process internal structure being only indirectly present in data. We demonstrate BSI's effectiveness in estimating a process's randomness, as reflected by the Shannon entropy rate, and its structure, as quantified by the statistical complexity. We also compare using the posterior distribution over candidate models and the single, maximum a posteriori model for point estimation and show that the former more accurately reflects uncertainty in estimated values. We apply BSI to in-class examples of finite- and infinite-order Markov processes, as well to an out-of-class, infinite-state hidden process.

Hidden ion population of the magnetosphere

International Nuclear Information System (INIS)

Olsen, R.C.

1982-01-01

Particle data from two geosynchronous satellites (Applied Technology Satellite 6 and SCATHA) show a normally hidden ion population appearing when the satellites are in the earth's shadow. Ion and electron data show the spacecraft potential dropping from +10 V in sunlight to +4 and +5 V in eclipse at local midnight, in low-energy (T/sub e/ -2 ), isotropic ion population appears which was invisible in sunlight because of the larger positive spacecraft potential. Higher-energy populations generally cover the tails of the hidden ion populations, so they cannot be inferred from daylight data. The isotropic populations appears only in a few percent of the spacecraft eclipse events, appearing only at times of low Kp (2 or less, preceded by a day with Σ Kp< or =20). A low-energy (T = 1--2 eV) field-aligned population often appears with and without the isotropic population, at slightly higher flux levels. These fluxes are visible in sunlight, but again the distribution functions obtained in eclipse differ from those that would be inferred from daylight data. Measurement of the thermal plasma population on a consistent basis, particularly in the plasma sheet, will require some method of controlling the detector potential with respect to the ambient plamsa
Teachers’ work ability: a study of relationships between collective efficacy and self-efficacy beliefs

Directory of Open Access Journals (Sweden)

Guidetti G

2018-05-01

Full Text Available Gloria Guidetti,1 Sara Viotti,1 Andreina Bruno,2 Daniela Converso1 1Department of Psychology, University of Turin, Turin, Italy; 2Department of Education Science, University of Genoa, Genoa, Italy Introduction: Work ability constitutes one of the most studied well-being indicators related to work. Past research highlighted the relationship with work-related resources and demands, and personal resources. However, no studies highlight the role of collective and self-efficacy beliefs in sustaining work ability. Purpose: The purpose of this study was to examine whether and by which mechanism work ability is linked with individual and collective efficacies in a sample of primary and middle school teachers. Materials and methods: Using a dataset consisting of 415 primary and middle school Italian teachers, the analysis tested for the mediating role of self-efficacy between collective efficacy and work ability. Results: Mediational analysis highlights that teachers’ self-efficacy totally mediates the relationship between collective efficacy and perceived work ability. Conclusion: Results of this study enhance the theoretical knowledge and empirical evidence regarding the link between teachers’ collective efficacy and self-efficacy, giving further emphasis to the concept of collective efficacy in school contexts. Moreover, the results contribute to the study of well-being in the teaching profession, highlighting a process that sustains and promotes levels of work ability through both collective and personal resources. Keywords: collective efficacy, mediation, self-efficacy, teachers, work ability
Prediction of Annual Rainfall Pattern Using Hidden Markov Model ...

African Journals Online (AJOL)

ADOWIE PERE

Hidden Markov model is very influential in stochastic world because of its ... the earth from the clouds. The usual ... Rainfall modelling and ... Markov Models have become popular tools ... environment sciences, University of Jos, plateau state,.
On the approximation by single hidden layer feedforward neural networks with fixed weights

OpenAIRE

Guliyev, Namig J.; Ismailov, Vugar E.

2017-01-01

International audience; Feedforward neural networks have wide applicability in various disciplines of science due to their universal approximation property. Some authors have shown that single hidden layer feedforward neural networks (SLFNs) with fixed weights still possess the universal approximation property provided that approximated functions are univariate. But this phenomenon does not lay any restrictions on the number of neurons in the hidden layer. The more this number, the more the p...
On E(11) of M-theory: 1. Hidden Symmetries of Maximal Supergravities and Lego of Dynkin Diagrams

International Nuclear Information System (INIS)

Nurmagambetov, A.J.

2007-01-01

We review a graphical way of classifying hidden symmetry algebras and groups of D=11, 10 maximal supergravities in terms of Dynkin diagrams, the shapes of which are determined by the bosonic field content of supergravities supermultiplets. The approach we follow is tightly related to the West's conjecture on a hidden symmetry of M-theory, and we discuss benefits of the approach in compare to other ways of searching for hidden symmetries of String Theory
Generalized inequalities for quantum correlations with hidden variables

International Nuclear Information System (INIS)

Vinduska, M.

1991-01-01

Renowned inequalities for quantum correlations are generalized for the case when quantum system cannot be described with an absolute independent measure of the probability. Such a formulation appears to be suitable for the formulation of the hidden variables theory in terms of non-Euclidean geometry. 10 refs
A Constraint Model for Constrained Hidden Markov Models

DEFF Research Database (Denmark)

Christiansen, Henning; Have, Christian Theil; Lassen, Ole Torp

2009-01-01

A Hidden Markov Model (HMM) is a common statistical model which is widely used for analysis of biological sequence data and other sequential phenomena. In the present paper we extend HMMs with constraints and show how the familiar Viterbi algorithm can be generalized, based on constraint solving ...
Securing Localization With Hidden and Mobile Base Stations

DEFF Research Database (Denmark)

Capkun, Srdjan; Srivastava, Mani; Cagalj, Mario

2006-01-01

localization based on hidden and mobile base stations. Our approach enables secure localization with a broad spectrum of localization techniques: ultrasonic or radio, based on received signal strength or signal time of flight. Through several examples we show how this approach can be used to secure nodecentric...
Learning about gender on campus: an analysis of the hidden curriculum for medical students.

Science.gov (United States)

Cheng, Ling-Fang; Yang, Hsing-Chen

2015-03-01

Gender sensitivity is a crucial factor in the provision of quality health care. This paper explores acquired gendered values and attitudes among medical students through an analysis of the hidden curriculum that exists within formal medical classes and informal learning. Discourse analysis was adopted as the research method. Data were collected from the Bulletin Board System (BBS), which represented an essential communication platform among students in Taiwan before the era of Facebook. The study examined 197 gender-related postings on the BBS boards of nine of 11 universities with a medical department in Taiwan, over a period of 10 years from 2000 to 2010. The five distinctive characteristics of the hidden curriculum were as follows: (i) gendered stereotypes of physiological knowledge; (ii) biased treatment of women; (iii) stereotyped gender-based division of labour; (iv) sexual harassment and a hostile environment, and (v) ridiculing of lesbian, gay, bisexual and transgender (LGBT) people. Both teachers and students co-produced a heterosexual masculine culture and sexism, including 'benevolent sexism' and 'hostile sexism'. As a result, the self-esteem and learning opportunities of female and LGBT students have been eroded. The paper explores gender dynamics in the context of a hidden curriculum in which heterosexual masculinity and stereotyped sexism are prevalent as norms. Both teachers and students, whether through formal medical classes or informal extracurricular interactive activities, are noted to contribute to the consolidation of such norms. The study tentatively suggests three strategies for integrating gender into medical education: (i) by separating physiological knowledge from gender stereotyping in teaching; (ii) by highlighting the importance of gender sensitivity in the language used within and outside the classroom by teachers and students, and (iii) by broadening the horizons of both teachers and students by recounting examples of the lived
Duality and hidden symmetries in interacting particle systems

NARCIS (Netherlands)

Giardinà, C.; Kurchan, J.; Redig, F.H.J.; Vafayi, K.

2009-01-01

In the context of Markov processes, both in discrete and continuous setting, we show a general relation between duality functions and symmetries of the generator. If the generator can be written in the form of a Hamiltonian of a quantum spin system, then the "hidden" symmetries are easily derived.
Statistical identification with hidden Markov models of large order splitting strategies in an equity market

Science.gov (United States)

Vaglica, Gabriella; Lillo, Fabrizio; Mantegna, Rosario N.

2010-07-01

Large trades in a financial market are usually split into smaller parts and traded incrementally over extended periods of time. We address these large trades as hidden orders. In order to identify and characterize hidden orders, we fit hidden Markov models to the time series of the sign of the tick-by-tick inventory variation of market members of the Spanish Stock Exchange. Our methodology probabilistically detects trading sequences, which are characterized by a significant majority of buy or sell transactions. We interpret these patches of sequential buying or selling transactions as proxies of the traded hidden orders. We find that the time, volume and number of transaction size distributions of these patches are fat tailed. Long patches are characterized by a large fraction of market orders and a low participation rate, while short patches have a large fraction of limit orders and a high participation rate. We observe the existence of a buy-sell asymmetry in the number, average length, average fraction of market orders and average participation rate of the detected patches. The detected asymmetry is clearly dependent on the local market trend. We also compare the hidden Markov model patches with those obtained with the segmentation method used in Vaglica et al (2008 Phys. Rev. E 77 036110), and we conclude that the former ones can be interpreted as a partition of the latter ones.
77 FR 8253 - Notice of Proposed Settlement Agreement and Opportunity for Public Comment: Hidden Lane Landfill...

Science.gov (United States)

2012-02-14

... ENVIRONMENTAL PROTECTION AGENCY [FRL-9631-3] Notice of Proposed Settlement Agreement and Opportunity for Public Comment: Hidden Lane Landfill Superfund Site ACTION: Notice. SUMMARY: In accordance... (``DOJ'') on behalf of EPA, in connection with the Hidden Lane Landfill Superfund Site, Sterling, Loudoun...
Belief propagation and replicas for inference and learning in a kinetic Ising model with hidden spins

International Nuclear Information System (INIS)

Battistin, C; Roudi, Y; Hertz, J; Tyrcha, J

2015-01-01

We propose a new algorithm for inferring the state of hidden spins and reconstructing the connections in a synchronous kinetic Ising model, given the observed history. Focusing on the case in which the hidden spins are conditionally independent of each other given the state of observable spins, we show that calculating the likelihood of the data can be simplified by introducing a set of replicated auxiliary spins. Belief propagation (BP) and susceptibility propagation (SusP) can then be used to infer the states of hidden variables and to learn the couplings. We study the convergence and performance of this algorithm for networks with both Gaussian-distributed and binary bonds. We also study how the algorithm behaves as the fraction of hidden nodes and the amount of data are changed, showing that it outperforms the Thouless–Anderson–Palmer (TAP) equations for reconstructing the connections. (paper)
Black holes, hidden symmetries, and complete integrability.

Science.gov (United States)

Frolov, Valeri P; Krtouš, Pavel; Kubizňák, David

2017-01-01

The study of higher-dimensional black holes is a subject which has recently attracted vast interest. Perhaps one of the most surprising discoveries is a realization that the properties of higher-dimensional black holes with the spherical horizon topology and described by the Kerr-NUT-(A)dS metrics are very similar to the properties of the well known four-dimensional Kerr metric. This remarkable result stems from the existence of a single object called the principal tensor. In our review we discuss explicit and hidden symmetries of higher-dimensional Kerr-NUT-(A)dS black hole spacetimes. We start with discussion of the Killing and Killing-Yano objects representing explicit and hidden symmetries. We demonstrate that the principal tensor can be used as a "seed object" which generates all these symmetries. It determines the form of the geometry, as well as guarantees its remarkable properties, such as special algebraic type of the spacetime, complete integrability of geodesic motion, and separability of the Hamilton-Jacobi, Klein-Gordon, and Dirac equations. The review also contains a discussion of different applications of the developed formalism and its possible generalizations.
Hidden Markov Model for quantitative prediction of snowfall

Indian Academy of Sciences (India)

A Hidden Markov Model (HMM) has been developed for prediction of quantitative snowfall in Pir-Panjal and Great Himalayan mountain ranges of Indian Himalaya. The model predicts snowfall for two days in advance using daily recorded nine meteorological variables of past 20 winters from 1992–2012. There are six ...
Hidden Markov models applied to a subsequence of the Xylella fastidiosa genome

Directory of Open Access Journals (Sweden)

Silva Cibele Q. da

2003-01-01

Full Text Available Dependencies in DNA sequences are frequently modeled using Markov models. However, Markov chains cannot account for heterogeneity that may be present in different regions of the same DNA sequence. Hidden Markov models are more realistic than Markov models since they allow for the identification of heterogeneous regions of a DNA sequence. In this study we present an application of hidden Markov models to a subsequence of the Xylella fastidiosa DNA data. We found that a three-state model provides a good description for the data considered.
A Multilayer Hidden Markov Models-Based Method for Human-Robot Interaction

Directory of Open Access Journals (Sweden)

Chongben Tao

2013-01-01

Full Text Available To achieve Human-Robot Interaction (HRI by using gestures, a continuous gesture recognition approach based on Multilayer Hidden Markov Models (MHMMs is proposed, which consists of two parts. One part is gesture spotting and segment module, the other part is continuous gesture recognition module. Firstly, a Kinect sensor is used to capture 3D acceleration and 3D angular velocity data of hand gestures. And then, a Feed-forward Neural Networks (FNNs and a threshold criterion are used for gesture spotting and segment, respectively. Afterwards, the segmented gesture signals are respectively preprocessed and vector symbolized by a sliding window and a K-means clustering method. Finally, symbolized data are sent into Lower Hidden Markov Models (LHMMs to identify individual gestures, and then, a Bayesian filter with sequential constraints among gestures in Upper Hidden Markov Models (UHMMs is used to correct recognition errors created in LHMMs. Five predefined gestures are used to interact with a Kinect mobile robot in experiments. The experimental results show that the proposed method not only has good effectiveness and accuracy, but also has favorable real-time performance.
How to Find a Hidden World at the Large Hadron Collider

CERN Document Server

Wells, James D.

2008-01-01

I discuss how the Large Hadron Collider era should broaden our view of particle physics research, and apply this thinking to the case of Hidden Worlds. I focus on one of the simplest representative cases of a Hidden World, and detail the rich implications it has for LHC physics, including universal suppression of Higgs boson production, trans-TeV heavy Higgs boson signatures, heavy-to-light Higgs boson decays, weakly coupled exotic gauge bosons, and Higgs boson decays to four fermions via light exotic gauge bosons. Some signatures may be accessible in the very early stages of collider operation, whereas others motivate a later high-lumonosity upgrade.
Selection of hidden layer nodes in neural networks by statistical tests

International Nuclear Information System (INIS)

Ciftcioglu, Ozer

1992-05-01

A statistical methodology for selection of the number of hidden layer nodes in feedforward neural networks is described. The method considers the network as an empirical model for the experimental data set subject to pattern classification so that the selection process becomes a model estimation through parameter identification. The solution is performed for an overdetermined estimation problem for identification using nonlinear least squares minimization technique. The number of the hidden layer nodes is determined as result of hypothesis testing. Accordingly the redundant network structure with respect to the number of parameters is avoided and the classification error being kept to a minimum. (author). 11 refs.; 4 figs.; 1 tab
On the production of hidden-flavored hadronic states at high energy

Science.gov (United States)

Wang, Wei

2018-04-01

I discuss the production mechanism of hidden-flavored hadrons at high energy. Using e+e‑ collisions and light-meson pair production in high energy exclusive processes, I demonstrate that hidden quark pairs do not necessarily participate in short-distance hard scattering. Implications are then explored in a few examples. Finally, I discuss the production mechanism of X(3872) in hadron collisions, where some misunderstandings have arisen in the literature. Supported by the Thousand Talents Plan for Young Professionals, National Natural Science Foundation of China (11575110, 11655002, 11735010, 11747611), Natural Science Foundation of Shanghai (15DZ2272100) and Scientific Research Foundation for Re- turned Overseas Chinese Scholars, Ministry of Education

Minimal spontaneously broken hidden sector and its impact on Higgs boson physics at the CERN Large Hadron Collider

International Nuclear Information System (INIS)

Schabinger, Robert; Wells, James D.

2005-01-01

Little experimental data bears on the question of whether there is a spontaneously broken hidden sector that has no Standard Model quantum numbers. Here we discuss the prospects of finding evidence for such a hidden sector through renormalizable interactions of the Standard Model Higgs boson with a Higgs boson of the hidden sector. We find that the lightest Higgs boson in this scenario has smaller rates in standard detection channels, and it can have a sizeable invisible final state branching fraction. Details of the hidden sector determine whether the overall width of the lightest state is smaller or larger than the Standard Model width. We compute observable rates, total widths and invisible decay branching fractions within the general framework. We also introduce the 'A-Higgs Model', which corresponds to the limit of a hidden sector Higgs boson weakly mixing with the Standard Model Higgs boson. This model has only one free parameter in addition to the mass of the light Higgs state and it illustrates most of the generic phenomenology issues, thereby enabling it to be a good benchmark theory for collider searches. We end by presenting an analogous supersymmetry model with similar phenomenology, which involves hidden sector Higgs bosons interacting with MSSM Higgs bosons through D-terms
Atlas of solar hidden photon emission

Energy Technology Data Exchange (ETDEWEB)

Redondo, Javier [Departamento de Física Teórica, Universidad de Zaragoza,Pedro Cerbuna 12, E-50009, Zaragoza (Spain); Max-Planck-Institut für Physik, Werner-Heisenberg-Institut,Föhringer Ring 6, 80805 München (Germany)

2015-07-20

Hidden photons, gauge bosons of a U(1) symmetry of a hidden sector, can constitute the dark matter of the universe and a smoking gun for large volume compactifications of string theory. In the sub-eV mass range, a possible discovery experiment consists on searching the copious flux of these particles emitted from the Sun in a helioscope setup à la Sikivie. In this paper, we compute in great detail the flux of HPs from the Sun, a necessary ingredient for interpreting such experiments. We provide a detailed exposition of transverse photon-HP oscillations in inhomogenous media, with special focus on resonance oscillations, which play a leading role in many cases. The region of the Sun emitting HPs resonantly is a thin spherical shell for which we justify an averaged-emission formula and which implies a distinctive morphology of the angular distribution of HPs on Earth in many cases. Low mass HPs with energies in the visible and IR have resonances very close to the photosphere where the solar plasma is not fully ionised and requires building a detailed model of solar refraction and absorption. We present results for a broad range of HP masses (from 0–1 keV) and energies (from the IR to the X-ray range), the most complete atlas of solar HP emission to date.
Atlas of solar hidden photon emission

Energy Technology Data Exchange (ETDEWEB)

Redondo, Javier, E-mail: redondo@mpp.mpg.de [Departamento de Física Teórica, Universidad de Zaragoza, Pedro Cerbuna 12, E-50009, Zaragoza, España (Spain)

2015-07-01

Hidden photons, gauge bosons of a U(1) symmetry of a hidden sector, can constitute the dark matter of the universe and a smoking gun for large volume compactifications of string theory. In the sub-eV mass range, a possible discovery experiment consists on searching the copious flux of these particles emitted from the Sun in a helioscope setup à la Sikivie. In this paper, we compute in great detail the flux of HPs from the Sun, a necessary ingredient for interpreting such experiments. We provide a detailed exposition of transverse photon-HP oscillations in inhomogenous media, with special focus on resonance oscillations, which play a leading role in many cases. The region of the Sun emitting HPs resonantly is a thin spherical shell for which we justify an averaged-emission formula and which implies a distinctive morphology of the angular distribution of HPs on Earth in many cases. Low mass HPs with energies in the visible and IR have resonances very close to the photosphere where the solar plasma is not fully ionised and requires building a detailed model of solar refraction and absorption. We present results for a broad range of HP masses (from 0–1 keV) and energies (from the IR to the X-ray range), the most complete atlas of solar HP emission to date.
Pentaquarks with hidden charm as hadroquarkonia

Energy Technology Data Exchange (ETDEWEB)

Eides, Michael I. [University of Kentucky, Department of Physics and Astronomy, Lexington, KY (United States); Petersburg Nuclear Physics Institute, St. Petersburg (Russian Federation); Petrov, Victor Yu. [Petersburg Nuclear Physics Institute, St. Petersburg (Russian Federation); Polyakov, Maxim V. [Petersburg Nuclear Physics Institute, St. Petersburg (Russian Federation); Ruhr-Universitaet Bochum, Institut fuer Theoretische Physik II, Bochum (Germany)

2018-01-15

We consider hidden charm pentaquarks as hadroquarkonium states in a QCD inspired approach. Pentaquarks arise naturally as bound states of quarkonia excitations and ordinary baryons. The LHCb P{sub c}(4450) pentaquark is interpreted as a ψ{sup '}-nucleon bound state with spin-parity J{sup P} = 3/2{sup -}. The partial decay width Γ(P{sub c}(4450) → J/ψ + N) ∼ 11 MeV is calculated and turned out to be in agreement with the experimental data for P{sub c}(4450). The P{sub c}(4450) pentaquark is predicted to be a member of one of the two almost degenerate hidden-charm baryon octets with spin-parities J{sup P} = 1/2{sup -}, 3/2{sup -}. The masses and decay widths of the octet pentaquarks are calculated. The widths are small and comparable with the width of the P{sub c}(4450) pentaquark, and the masses of the octet pentaquarks satisfy the Gell-Mann-Okubo relation. Interpretation of pentaquarks as loosely bound Σ{sub c} anti D* and Σ{sub c}{sup *} anti D* deuteronlike states is also considered. We determine quantum numbers of these bound states and calculate their masses in the one-pion exchange scenario. The hadroquarkonium and molecular approaches to exotic hadrons are compared and the relative advantages and drawbacks of each approach are discussed. (orig.)
Well-Being Impacts of Human-Elephant Conflict in Khumaga, Botswana: Exploring Visible and Hidden Dimensions

Directory of Open Access Journals (Sweden)

Allison L Mayberry

2017-01-01

Full Text Available High densities of wild African savannah elephants (Loxodonta africana combined with widespread human land-use have increased human-elephant conflict in northern Botswana. Visible impacts (e.g. crop/property damage, injury/fatality of elephants on human well-being are well documented in scholarly literature while hidden impacts (e.g. emotional stress, restricted mobility are less so. This research uses qualitative methods to explore human experiences with elephants and perceived impacts of elephants on human well-being. Findings reveal participants are concerned about food insecurity and associated visible impacts of elephant crop raids. Findings also reveal participants are concerned about reduced safety and restricted mobility as hidden impacts threatening livelihoods and everyday life. Both visible and hidden impacts of elephants contribute to people's negative feelings towards elephants, as does the broader political context. This research emphasises the importance of investigating both visible and hidden impacts of elephants on human well-being to foster holistic understanding of human-elephant conflict scenarios and to inform future mitigation strategies.
Aero Engine Component Fault Diagnosis Using Multi-Hidden-Layer Extreme Learning Machine with Optimized Structure

Directory of Open Access Journals (Sweden)

Shan Pang

2016-01-01

Full Text Available A new aero gas turbine engine gas path component fault diagnosis method based on multi-hidden-layer extreme learning machine with optimized structure (OM-ELM was proposed. OM-ELM employs quantum-behaved particle swarm optimization to automatically obtain the optimal network structure according to both the root mean square error on training data set and the norm of output weights. The proposed method is applied to handwritten recognition data set and a gas turbine engine diagnostic application and is compared with basic ELM, multi-hidden-layer ELM, and two state-of-the-art deep learning algorithms: deep belief network and the stacked denoising autoencoder. Results show that, with optimized network structure, OM-ELM obtains better test accuracy in both applications and is more robust to sensor noise. Meanwhile it controls the model complexity and needs far less hidden nodes than multi-hidden-layer ELM, thus saving computer memory and making it more efficient to implement. All these advantages make our method an effective and reliable tool for engine component fault diagnosis tool.
… To be hidden does not mean to be merely revealed – Part 2

Directory of Open Access Journals (Sweden)

Annette Krause

2015-12-01

Full Text Available This text revisits the long-term project Hidden Curriculum (HC, initiated by Annette Krauss, that addresses unquestioned routines, hierarchies of knowledge and the role of the body in learning processes from the perspective of secondary/high school education (in the research on a hidden curriculum. The first part of this text (www.medienimpulse.at/articles/view/848 entailed a deeper analysis of educational studies on the phenomenon of hidden curriculum in relation to the feminist and critical pedagogies of bell hooks, Paulo Freire and Jacques Rancière. The aim of the second part is to address academic canons and corporeality within educational settings and to investigate the physicality of everyday norms through revisiting the framework, results and processes of the collaborative research of the HC project with secondary/high school students.
Job Clubs: Getting into the Hidden Labor Market.

Science.gov (United States)

Kimeldorf, Martin; Tornow, Janice A.

1984-01-01

A job club approach for secondary disabled youth focuses on mastering job seeking skills by behaviorally sequenced steps learned in situational experiences within a self-help group process framework. Students learn to penetrate the hidden job market, to use social networking via the telephone, and to participate successfully in job interviews. (CL)
Hidden Markov models and other machine learning approaches in computational molecular biology

Energy Technology Data Exchange (ETDEWEB)

Baldi, P. [California Inst. of Tech., Pasadena, CA (United States)

1995-12-31

This tutorial was one of eight tutorials selected to be presented at the Third International Conference on Intelligent Systems for Molecular Biology which was held in the United Kingdom from July 16 to 19, 1995. Computational tools are increasingly needed to process the massive amounts of data, to organize and classify sequences, to detect weak similarities, to separate coding from non-coding regions, and reconstruct the underlying evolutionary history. The fundamental problem in machine learning is the same as in scientific reasoning in general, as well as statistical modeling: to come up with a good model for the data. In this tutorial four classes of models are reviewed. They are: Hidden Markov models; artificial Neural Networks; Belief Networks; and Stochastic Grammars. When dealing with DNA and protein primary sequences, Hidden Markov models are one of the most flexible and powerful alignments and data base searches. In this tutorial, attention is focused on the theory of Hidden Markov Models, and how to apply them to problems in molecular biology.
Quasiparticle scattering image in hidden order phases and chiral superconductors

Energy Technology Data Exchange (ETDEWEB)

Thalmeier, Peter [Max Planck Institute for Chemical Physics of Solids, 01187 Dresden (Germany); Akbari, Alireza, E-mail: alireza@apctp.org [Asia Pacific Center for Theoretical Physics, Pohang, Gyeongbuk 790-784 (Korea, Republic of); Department of Physics, and Max Planck POSTECH Center for Complex Phase Materials, POSTECH, Pohang 790-784 (Korea, Republic of)

2016-02-15

The technique of Bogoliubov quasiparticle interference (QPI) has been successfully used to investigate the symmetry of unconventional superconducting gaps, also in heavy fermion compounds. It was demonstrated that QPI can distinguish between the d-wave singlet candidates in CeCoIn{sub 5}. In URu{sub 2}Si{sub 2} presumably a chiral d-wave singlet superconducting (SC) state exists inside a multipolar hidden order (HO) phase. We show that hidden order leaves an imprint on the symmetry of QPI pattern that may be used to determine the essential question whether HO in URu{sub 2}Si{sub 2} breaks the in-plane rotational symmetry or not. We also demonstrate that the chiral d-wave SC gap leads to a crossover to a quasi-2D QPI spectrum below T{sub c} which sharpens the HO features. Furthermore we investigate the QPI image of chiral p-wave multigap superconductor Sr{sub 2}RuO{sub 4}. - Highlights: • The chiral multigap structure of Sr{sub 2}RuO{sub 4} leads to rotation of QPI spectrum with bias voltage. • 5f band reconstruction in hidden order phase of URu{sub 2}Si{sub 2} is obtained from two orbital model. • The chiral superconductivity in URu{sub 2}Si{sub 2} leads to quasi-2D quasiparticle interference (QPI).
Heavy superpartners with less tuning from hidden sector renormalisation

International Nuclear Information System (INIS)

Hardy, Edward

2014-01-01

In supersymmetric extensions of the Standard Model, superpartner masses consistent with collider bounds typically introduce significant tuning of the electroweak scale. We show that hidden sector renormalisation can greatly reduce such a tuning if the supersymmetry breaking, or mediating, sector runs through a region of strong coupling not far from the weak scale. In the simplest models, only the tuning due to the gaugino masses is improved, and a weak scale gluino mass in the region of 5 TeV may be obtained with an associated tuning of only one part in ten. In models with more complex couplings between the visible and hidden sectors, the tuning with respect to sfermions can also be reduced. We give an example of a model, with low scale gauge mediation and superpartner masses allowed by current LHC bounds, that has an overall tuning of one part in twenty
Using hidden Markov models to align multiple sequences.

Science.gov (United States)

Mount, David W

2009-07-01

A hidden Markov model (HMM) is a probabilistic model of a multiple sequence alignment (msa) of proteins. In the model, each column of symbols in the alignment is represented by a frequency distribution of the symbols (called a "state"), and insertions and deletions are represented by other states. One moves through the model along a particular path from state to state in a Markov chain (i.e., random choice of next move), trying to match a given sequence. The next matching symbol is chosen from each state, recording its probability (frequency) and also the probability of going to that state from a previous one (the transition probability). State and transition probabilities are multiplied to obtain a probability of the given sequence. The hidden nature of the HMM is due to the lack of information about the value of a specific state, which is instead represented by a probability distribution over all possible values. This article discusses the advantages and disadvantages of HMMs in msa and presents algorithms for calculating an HMM and the conditions for producing the best HMM.
Religion, Spirituality, and the Hidden Curriculum: Medical Student and Faculty Reflections.

Science.gov (United States)

Balboni, Michael J; Bandini, Julia; Mitchell, Christine; Epstein-Peterson, Zachary D; Amobi, Ada; Cahill, Jonathan; Enzinger, Andrea C; Peteet, John; Balboni, Tracy

2015-10-01

Religion and spirituality play an important role in physicians' medical practice, but little research has examined their influence within the socialization of medical trainees and the hidden curriculum. The objective is to explore the role of religion and spirituality as they intersect with aspects of medicine's hidden curriculum. Semiscripted, one-on-one interviews and focus groups (n = 33 respondents) were conducted to assess Harvard Medical School student and faculty experiences of religion/spirituality and the professionalization process during medical training. Using grounded theory, theme extraction was performed with interdisciplinary input (medicine, sociology, and theology), yielding a high inter-rater reliability score (kappa = 0.75). Three domains emerged where religion and spirituality appear as a factor in medical training. First, religion/spirituality may present unique challenges and benefits in relation to the hidden curriculum. Religious/spiritual respondents more often reported to struggle with issues of personal identity, increased self-doubt, and perceived medical knowledge inadequacy. However, religious/spiritual participants less often described relationship conflicts within the medical team, work-life imbalance, and emotional stress arising from patient suffering. Second, religion/spirituality may influence coping strategies during encounters with patient suffering. Religious/spiritual trainees described using prayer, faith, and compassion as means for coping whereas nonreligious/nonspiritual trainees discussed compartmentalization and emotional repression. Third, levels of religion/spirituality appear to fluctuate in relation to medical training, with many trainees experiencing an increase in religiousness/spirituality during training. Religion/spirituality has a largely unstudied but possibly influential role in medical student socialization. Future study is needed to characterize its function within the hidden curriculum. Copyright �
Properties of solar generators with reflectors and radiators

Science.gov (United States)

Ebeling, W. D.; Rex, D.; Bierfischer, U.

1980-06-01

Radiation cooled concentrator systems using silicon and GaAs cells were studied. The principle of radiation cooling by the reflector surfaces is discussed for cylindrical parabolic reflectors (SARA), truncated hexagonal pyramids, and a small trough configuration. Beam paths, collection properties for imperfect orientation, and thermal optimization parameters were analyzed. The three concentrating systems with radiation cooling offer advantages over the plane panel and over the large trough. With silicon solar cells they exhibit considerably lower solar cell consumption per Kw and also lower mass per kW. With GaAs cells the SARA system reduces the number of solar cells needed per kW to less than 10%. Also in all other cases SARA offers the best values for alpha and F sub sol, as long as narrow angular tolerances of the panel orientation can be met. Analysis of the energy collecting properties for imperfect orientation shows the superiority of the hexagonal concentrator. This device can produce power for even large angles between the sun and the panel normal.
A Fast SVD-Hidden-nodes based Extreme Learning Machine for Large-Scale Data Analytics.

Science.gov (United States)

Deng, Wan-Yu; Bai, Zuo; Huang, Guang-Bin; Zheng, Qing-Hua

2016-05-01

Big dimensional data is a growing trend that is emerging in many real world contexts, extending from web mining, gene expression analysis, protein-protein interaction to high-frequency financial data. Nowadays, there is a growing consensus that the increasing dimensionality poses impeding effects on the performances of classifiers, which is termed as the "peaking phenomenon" in the field of machine intelligence. To address the issue, dimensionality reduction is commonly employed as a preprocessing step on the Big dimensional data before building the classifiers. In this paper, we propose an Extreme Learning Machine (ELM) approach for large-scale data analytic. In contrast to existing approaches, we embed hidden nodes that are designed using singular value decomposition (SVD) into the classical ELM. These SVD nodes in the hidden layer are shown to capture the underlying characteristics of the Big dimensional data well, exhibiting excellent generalization performances. The drawback of using SVD on the entire dataset, however, is the high computational complexity involved. To address this, a fast divide and conquer approximation scheme is introduced to maintain computational tractability on high volume data. The resultant algorithm proposed is labeled here as Fast Singular Value Decomposition-Hidden-nodes based Extreme Learning Machine or FSVD-H-ELM in short. In FSVD-H-ELM, instead of identifying the SVD hidden nodes directly from the entire dataset, SVD hidden nodes are derived from multiple random subsets of data sampled from the original dataset. Comprehensive experiments and comparisons are conducted to assess the FSVD-H-ELM against other state-of-the-art algorithms. The results obtained demonstrated the superior generalization performance and efficiency of the FSVD-H-ELM. Copyright © 2016 Elsevier Ltd. All rights reserved.
高中體育班的潛在課程 The Hidden Curriculum Experienced by Senior

Directory of Open Access Journals (Sweden)

林佳瑩 Chia-Yin Lin

2013-06-01

Full Text Available 本研究以臺灣北部地區一所高中體育班二年級學生為研究參與者，研究者採用學校民族誌的方式，透過參與觀察和訪談，瞭解高中體育班學生從學校生活中學到何種潛在課程、這些潛在課程的本質與影響，以及學生如何詮釋潛在課程。研究發現，高中體育班潛在課程帶有二元分類的色彩，體育班學生從分流制度、課堂學習、專長訓練、師生互動及同儕關係五個面向中分別學到區隔、等待、試煉、分類及競合的潛在課程。在學習經驗與角色認同等因素的影響之下，體育班學生對學校制度中隱藏的潛在課程作出不同的洞察與詮釋，進而影響其對課程知識的看法、學習態度與行為、人際互動及生涯發展。 The purpose of this study was to explore the hidden curriculum encountered by a class of second-year senior high school physical education majors in northern Taiwan. The study adopted a school ethnography approach. Based on data collected through participant observation and interviews, the study explored the nature and effects of the hidden curriculum that the students experienced in their high school life, and the ways in which they interpreted this curriculum. The results indicated that the hidden curriculum was somewhat polarized: through the five dimensions of ability tracking, classroom learning, sports training, teacher-student interaction and peer relations, they learned about stratification, waiting, practicing, categorization and competition. In addition, the hidden curriculum had an impact on the students’ knowledge, behavior, attitudes, interpersonal relationships, self-concept and career development.
TeraHertz imaging of hidden paint layers on canvas

NARCIS (Netherlands)

Adam, A.J.L.; Planken, P.C.M.; Meloni, S.; Dik, J.

2009-01-01

We show terahertz reflection images of hidden paint layers in a painting on canvas and compare the results with X-ray Radiography and Infrared Reflectography. Our terahertz measurements show strong reflections from both the canvas/paint interface and from the raw umber/lead white interface,
Book review: Troubling possibility, hidden fires and secret drawers ...

African Journals Online (AJOL)

Book review: Troubling possibility, hidden fires and secret drawers: Tiyambe Zeleza's smouldering charcoal. H.F. Ross. Abstract. No Abstract. Full Text: EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT · AJOL African Journals Online. HOW TO USE AJOL.
Hidden flows and waste processing--an analysis of illustrative futures.

Science.gov (United States)

Schiller, F; Raffield, T; Angus, A; Herben, M; Young, P J; Longhurst, P J; Pollard, S J T

2010-12-14

An existing materials flow model is adapted (using Excel and AMBER model platforms) to account for waste and hidden material flows within a domestic environment. Supported by national waste data, the implications of legislative change, domestic resource depletion and waste technology advances are explored. The revised methodology offers additional functionality for economic parameters that influence waste generation and disposal. We explore this accounting system under hypothetical future waste and resource management scenarios, illustrating the utility of the model. A sensitivity analysis confirms that imports, domestic extraction and their associated hidden flows impact mostly on waste generation. The model offers enhanced utility for policy and decision makers with regard to economic mass balance and strategic waste flows, and may promote further discussion about waste technology choice in the context of reducing carbon budgets.
Hidden histories: challenges for pedagogy and participation

OpenAIRE

Morrice, Linda

2013-01-01

Higher Education has become and an increasingly diverse and globalised system in which the binaries between ‘traditional’ and ‘non-traditional’ students, exclusion and inclusion have less resonance and analytical purchase. Drawing on research with refugees Linda will suggest that higher education can be marked simultaneously by belonging and recognition, deficit and exclusion. Complex differences and inequalities remain hidden and unspoken, raising new questions and challenges for pedagogy an...

Costs of Quality: Exploratory Analysis of Hidden Elements and Prioritization using Analytic Hierarchy Process

Directory of Open Access Journals (Sweden)

Sailaja A

2015-02-01

Full Text Available Cost of Quality analysis is emerged as an effective tool for the industrial managers for pinpointing the deficiencies in the system as well as for identifying the improvement areas by highlighting the cost reduction opportunities. However , this analysis will be fully effective only if it is further extended to identify the cost incurred in ensuring quality in all areas of the supply chain including the hidden costs and costs of missed out opportunities. Most of the hidden elements of quality costs are difficult to track and not accounted by the traditional accounting tools. An exploratory analysis is made in this research to identify the hidden elements of quality costs in manufacturing industry. Further, the identified cost elements are classified into various groups for better analysis and, finally, prioritized to identify the vital few among them. Analytic Hierarchy Process (AHP technique which is one of the most popular Multi Criteria Decision Method (MCDM and Pareto analysis were used in this study for prioritizing the hidden quality cost elements based on their degree of impact on overall cost of quality. By this analysis, the key cost elements which are to be addressed to reduce the overall cost of quality are identified.
A scheme of hidden-structure attribute-based encryption with multiple authorities

Science.gov (United States)

Ling, J.; Weng, A. X.

2018-05-01

In the most of the CP-ABE schemes with hidden access structure, both all the user attributes and the key generation are managed by only one authority. The key generation efficiency will decrease as the number of user increases, and the data will encounter security issues as the only authority is attacked. We proposed a scheme of hidden-structure attribute-based encryption with multiple authorities, which introduces multiple semi-trusted attribute authorities, avoiding the threat even though one or more authorities are attacked. We also realized user revocation by managing a revocation list. Based on DBDH assumption, we proved that our scheme is of IND-CMA security. The analysis shows that our scheme improves the key generation efficiency.
A Stochastic Flows Approach for Asset Allocation with Hidden Economic Environment

Directory of Open Access Journals (Sweden)

Tak Kuen Siu

2015-01-01

Full Text Available An optimal asset allocation problem for a quite general class of utility functions is discussed in a simple two-state Markovian regime-switching model, where the appreciation rate of a risky share changes over time according to the state of a hidden economy. As usual, standard filtering theory is used to transform a financial model with hidden information into one with complete information, where a martingale approach is applied to discuss the optimal asset allocation problem. Using a martingale representation coupled with stochastic flows of diffeomorphisms for the filtering equation, the integrand in the martingale representation is identified which gives rise to an optimal portfolio strategy under some differentiability conditions.
Hidden Scale Invariance in Condensed Matter

DEFF Research Database (Denmark)

Dyre, J. C.

2014-01-01

. This means that the phase diagram becomes effectively one-dimensional with regard to several physical properties. Liquids and solids with isomorphs include most or all van der Waals bonded systems and metals, as well as weakly ionic or dipolar systems. On the other hand, systems with directional bonding...... (hydrogen bonds or covalent bonds) or strong Coulomb forces generally do not exhibit hidden scale invariance. The article reviews the theory behind this picture of condensed matter and the evidence for it coming from computer simulations and experiments...
The hidden costs of nuclear power

International Nuclear Information System (INIS)

Keough, C.

1981-01-01

The two basic hidden costs of nuclear power are public money and public health. Nuclear power appears to be economical because many of the costs of producins electricity in these plants are paid by the federal government. So, like it or not, the citizens are footing the bill with their taxes. Design and development of plants have been paid for with public money, and disposal and cleanup costs will also be paid in this manner. The economic and health costs associated with nuclear accidents are staggering
Uncovering the Hidden Costs of Offshoring

DEFF Research Database (Denmark)

Larsen, Marcus M.; Manning, Stephan; Pedersen, Torben

2013-01-01

This study investigates estimation errors due to hidden costs—the costs of implementation that are neglected in strategic decision-making processes—in the context of services offshoring. Based on data from the Offshoring Research Network, we find that decision makers are more likely to make cost......-estimation errors given increasing configuration and task complexity in captive offshoring and offshore outsourcing, respectively. Moreover, we show that experience and a strong orientation toward organizational design in the offshoring strategy reduce the cost-estimation errors that follow from complexity. Our...
Einstein-Bohr controversy and theory of hidden variables

Czech Academy of Sciences Publication Activity Database

Lokajíček, Miloš V.

2010-01-01

Roč. 8, č. 4 (2010), s. 638-645 ISSN 1303-5150 R&D Projects: GA MŠk LA08015 Institutional research plan: CEZ:AV0Z10100502 Keywords : Schroedinger equation * EPR paradox * hidden variables Subject RIV: BF - Elementary Particles and High Energy Physics Impact factor: 0.697, year: 2010 http://arxiv.org/abs/1004.3005
Hidden symmetries of the Principal Chiral Model unveiled

International Nuclear Information System (INIS)

Devchand, C.; Schiff, J.

1996-12-01

By relating the two-dimensional U(N) Principal Chiral Model to a Simple linear system we obtain a free-field parametrization of solutions. Obvious symmetry transformations on the free-field data give symmetries of the model. In this way all known 'hidden symmetries' and Baecklund transformations, as well as a host of new symmetries, arise. (author). 21 refs
Optimisation of Hidden Markov Model using Baum–Welch algorithm

Indian Academy of Sciences (India)

Home; Journals; Journal of Earth System Science; Volume 126; Issue 1. Optimisation of Hidden Markov Model using Baum–Welch algorithm for prediction of maximum and minimum temperature over Indian Himalaya. J C Joshi Tankeshwar Kumar Sunita Srivastava Divya Sachdeva. Volume 126 Issue 1 February 2017 ...
Epitope discovery with phylogenetic hidden Markov models.

LENUS (Irish Health Repository)

Lacerda, Miguel

2010-05-01

Existing methods for the prediction of immunologically active T-cell epitopes are based on the amino acid sequence or structure of pathogen proteins. Additional information regarding the locations of epitopes may be acquired by considering the evolution of viruses in hosts with different immune backgrounds. In particular, immune-dependent evolutionary patterns at sites within or near T-cell epitopes can be used to enhance epitope identification. We have developed a mutation-selection model of T-cell epitope evolution that allows the human leukocyte antigen (HLA) genotype of the host to influence the evolutionary process. This is one of the first examples of the incorporation of environmental parameters into a phylogenetic model and has many other potential applications where the selection pressures exerted on an organism can be related directly to environmental factors. We combine this novel evolutionary model with a hidden Markov model to identify contiguous amino acid positions that appear to evolve under immune pressure in the presence of specific host immune alleles and that therefore represent potential epitopes. This phylogenetic hidden Markov model provides a rigorous probabilistic framework that can be combined with sequence or structural information to improve epitope prediction. As a demonstration, we apply the model to a data set of HIV-1 protein-coding sequences and host HLA genotypes.
Hidden Markov Model for Stock Selection

Directory of Open Access Journals (Sweden)

Nguyet Nguyen

2015-10-01

Full Text Available The hidden Markov model (HMM is typically used to predict the hidden regimes of observation data. Therefore, this model finds applications in many different areas, such as speech recognition systems, computational molecular biology and financial market predictions. In this paper, we use HMM for stock selection. We first use HMM to make monthly regime predictions for the four macroeconomic variables: inflation (consumer price index (CPI, industrial production index (INDPRO, stock market index (S&P 500 and market volatility (VIX. At the end of each month, we calibrate HMM’s parameters for each of these economic variables and predict its regimes for the next month. We then look back into historical data to find the time periods for which the four variables had similar regimes with the forecasted regimes. Within those similar periods, we analyze all of the S&P 500 stocks to identify which stock characteristics have been well rewarded during the time periods and assign scores and corresponding weights for each of the stock characteristics. A composite score of each stock is calculated based on the scores and weights of its features. Based on this algorithm, we choose the 50 top ranking stocks to buy. We compare the performances of the portfolio with the benchmark index, S&P 500. With an initial investment of $100 in December 1999, over 15 years, in December 2014, our portfolio had an average gain per annum of 14.9% versus 2.3% for the S&P 500.
On the significance of bell's inequality for hidden-variable theories

International Nuclear Information System (INIS)

De Baere, W.

1984-01-01

It is explicitly shown that Bell's derivation of the generalized Bell inequality and its subsequent interpretation depend on an implicit hypothesis concerning the reproducibility of some set of hidden variables in different runs of the same experiment
Risk from the frontlines of a hidden epidemic sexuality, masculinities ...

African Journals Online (AJOL)

Risk from the frontlines of a hidden epidemic sexuality, masculinities and social pressures ... It frames risk in the context of the dynamics governing sexuality, underlined ... MSM risk and practice, in these contexts, are consequently shaped by ...
Hidden beauty baryon states in the local hidden gauge approach with heavy quark spin symmetry

Energy Technology Data Exchange (ETDEWEB)

Xiao, C.W.; Oset, E. [Centro Mixto Universidad de Valencia-CSIC, Institutos de Investigacion de Paterna, Departamento de Fisica Teorica and IFIC, Valencia (Spain)

2013-11-15

Using a coupled-channel unitary approach, combining the heavy quark spin symmetry and the dynamics of the local hidden gauge, we investigate the meson-baryon interaction with hidden beauty and obtain several new states of N around 11 GeV. We consider the basis of states {eta}{sub b} N, {Upsilon};N, B {Lambda}{sub b}, B {Sigma}{sub b}, B{sup *}{Lambda}{sub b}, B{sup *}{Sigma}{sub b}, B{sup *}{Sigma}{sub b}{sup *} and find four basic bound states which correspond to B {Sigma}{sub b}, B {Sigma}{sub b}{sup *}, B{sup *}{Sigma}{sub b} and B{sup *}{Sigma}{sub b}{sup *}, decaying mostly into {eta}{sub b} N and {Upsilon}N and with a binding energy about 50-130 MeV with respect to the thresholds of the corresponding channel. All of them have isospin I = 1/2, and we find no bound states or resonances in I = 3/2. The B {Sigma}{sub b} state appears in J = 1/2, the B {Sigma}{sub b}{sup *} in J = 3/2, the B{sup *}{Sigma}{sub b} appears nearly degenerate in J = 1/2, 3/2 and the B{sup *}{Sigma}{sub b}{sup *} appears nearly degenerate in J = 1/2, 3/2, 5/2. These states have a width from 2-110 MeV, with conservative estimates of uncertainties, except for the one in J = 5/2 which has zero width since it cannot decay into any of the states of the basis chosen. We make generous estimates of the uncertainties and find that within very large margins these states appear bound. (orig.)
Collecting behavioural data using the world wide web: considerations for researchers.

Science.gov (United States)

Rhodes, S D; Bowie, D A; Hergenrather, K C

2003-01-01

To identify and describe advantages, challenges, and ethical considerations of web based behavioural data collection. This discussion is based on the authors' experiences in survey development and study design, respondent recruitment, and internet research, and on the experiences of others as found in the literature. The advantages of using the world wide web to collect behavioural data include rapid access to numerous potential respondents and previously hidden populations, respondent openness and full participation, opportunities for student research, and reduced research costs. Challenges identified include issues related to sampling and sample representativeness, competition for the attention of respondents, and potential limitations resulting from the much cited "digital divide", literacy, and disability. Ethical considerations include anonymity and privacy, providing and substantiating informed consent, and potential risks of malfeasance. Computer mediated communications, including electronic mail, the world wide web, and interactive programs will play an ever increasing part in the future of behavioural science research. Justifiable concerns regarding the use of the world wide web in research exist, but as access to, and use of, the internet becomes more widely and representatively distributed globally, the world wide web will become more applicable. In fact, the world wide web may be the only research tool able to reach some previously hidden population subgroups. Furthermore, many of the criticisms of online data collection are common to other survey research methodologies.
The Global Hidden Hunger Indices and Maps: An Advocacy Tool for Action

Science.gov (United States)

Muthayya, Sumithra; Rah, Jee Hyun; Sugimoto, Jonathan D.; Roos, Franz F.; Kraemer, Klaus; Black, Robert E.

2013-01-01

The unified global efforts to mitigate the high burden of vitamin and mineral deficiency, known as hidden hunger, in populations around the world are crucial to the achievement of most of the Millennium Development Goals (MDGs). We developed indices and maps of global hidden hunger to help prioritize program assistance, and to serve as an evidence-based global advocacy tool. Two types of hidden hunger indices and maps were created based on i) national prevalence data on stunting, anemia due to iron deficiency, and low serum retinol levels among preschool-aged children in 149 countries; and ii) estimates of Disability Adjusted Life Years (DALYs) attributed to micronutrient deficiencies in 136 countries. A number of countries in sub-Saharan Africa, as well as India and Afghanistan, had an alarmingly high level of hidden hunger, with stunting, iron deficiency anemia, and vitamin A deficiency all being highly prevalent. The total DALY rates per 100,000 population, attributed to micronutrient deficiencies, were generally the highest in sub-Saharan African countries. In 36 countries, home to 90% of the world’s stunted children, deficiencies of micronutrients were responsible for 1.5-12% of the total DALYs. The pattern and magnitude of iodine deficiency did not conform to that of other micronutrients. The greatest proportions of children with iodine deficiency were in the Eastern Mediterranean (46.6%), European (44.2%), and African (40.4%) regions. The current indices and maps provide crucial data to optimize the prioritization of program assistance addressing global multiple micronutrient deficiencies. Moreover, the indices and maps serve as a useful advocacy tool in the call for increased commitments to scale up effective nutrition interventions. PMID:23776712
The global hidden hunger indices and maps: an advocacy tool for action.

Science.gov (United States)

Muthayya, Sumithra; Rah, Jee Hyun; Sugimoto, Jonathan D; Roos, Franz F; Kraemer, Klaus; Black, Robert E

2013-01-01

The unified global efforts to mitigate the high burden of vitamin and mineral deficiency, known as hidden hunger, in populations around the world are crucial to the achievement of most of the Millennium Development Goals (MDGs). We developed indices and maps of global hidden hunger to help prioritize program assistance, and to serve as an evidence-based global advocacy tool. Two types of hidden hunger indices and maps were created based on i) national prevalence data on stunting, anemia due to iron deficiency, and low serum retinol levels among preschool-aged children in 149 countries; and ii) estimates of Disability Adjusted Life Years (DALYs) attributed to micronutrient deficiencies in 136 countries. A number of countries in sub-Saharan Africa, as well as India and Afghanistan, had an alarmingly high level of hidden hunger, with stunting, iron deficiency anemia, and vitamin A deficiency all being highly prevalent. The total DALY rates per 100,000 population, attributed to micronutrient deficiencies, were generally the highest in sub-Saharan African countries. In 36 countries, home to 90% of the world's stunted children, deficiencies of micronutrients were responsible for 1.5-12% of the total DALYs. The pattern and magnitude of iodine deficiency did not conform to that of other micronutrients. The greatest proportions of children with iodine deficiency were in the Eastern Mediterranean (46.6%), European (44.2%), and African (40.4%) regions. The current indices and maps provide crucial data to optimize the prioritization of program assistance addressing global multiple micronutrient deficiencies. Moreover, the indices and maps serve as a useful advocacy tool in the call for increased commitments to scale up effective nutrition interventions.
First Direct-Detection Constraints on eV-Scale Hidden-Photon Dark Matter with DAMIC at SNOLAB

Energy Technology Data Exchange (ETDEWEB)

Aguilar-Arevalo, A.; Amidei, D.; Bertou, X.; Butner, M.; Cancelo, G.; Castañeda Vázquez, A.; Cervantes Vergara, B. A.; Chavarria, A. E.; Chavez, C. R.; de Mello Neto, J. R. T.; D’Olivo, J. C.; Estrada, J.; Fernandez Moroni, G.; Gaïor, R.; Guardincerri, Y.; Hernández Torres, K. P.; Izraelevitch, F.; Kavner, A.; Kilminster, B.; Lawson, I.; Letessier-Selvon, A.; Liao, J.; Matalon, A.; Mello, V. B. B.; Molina, J.; Privitera, P.; Ramanathan, K.; Sarkis, Y.; Schwarz, T.; Settimo, M.; Sofo Haro, M.; Thomas, R.; Tiffenberg, J.; Tiouchichine, E.; Torres Machado, D.; Trillaud, F.; You, X.; Zhou, J.

2017-04-05

We present direct detection constraints on the absorption of hidden-photon dark matter with particle masses in the range 1.2-30 eV$c^{-2}$ with the DAMIC experiment at SNOLAB. Under the assumption that the local dark matter is entirely constituted of hidden photons, the sensitivity to the kinetic mixing parameter $\\kappa$ is competitive with constraints from solar emission, reaching a minimum value of 2.2$\\times$$10^{-14}$ at 17 eV$c^{-2}$. These results are the most stringent direct detection constraints on hidden-photon dark matter with masses 3-12 eV$c^{-2}$ and the first demonstration of direct experimental sensitivity to ionization signals $<$12 eV from dark matter interactions.
Crisis Entrepreneurs and Hidden Crises : Illustrative Examples of Interactional

NARCIS (Netherlands)

Prof. Cees van Woerkum; dr. Annette Klarenbeek

2012-01-01

We examine the ways in which a hidden crisis can be exposed from a communication point of view. In which way can organisations create general awareness of a crisis and try to understand the dynamic nature of interactions? With the help of discourse analysis, we have examined the interactional
Hidden Markov model for improved ultrasound-based presence detection

NARCIS (Netherlands)

Jaramillo Garcia, P.A.; Linnartz, J.P.M.G.

2015-01-01

Adaptive lighting systems typically use a presence detector to save energy by switching off lights in unoccupied rooms. However, it is highly annoying when lights are erroneously turned off while a user is present (false negative, FN). This paper focuses on the estimation of presence, using a Hidden

The role of food and nutrition system approaches in tackling hidden hunger.

Science.gov (United States)

Burchi, Francesco; Fanzo, Jessica; Frison, Emile

2011-02-01

One of the World's greatest challenges is to secure sufficient and healthy food for all, and to do so in an environmentally sustainable manner. This review explores the interrelationships of food, health, and environment, and their role in addressing chronic micronutrient deficiencies, also known as "hidden hunger", affecting over two billion people worldwide. While the complexity and underlying determinants of undernutrition have been well-understood for decades, the scaling of food and nutrition system approaches that combine sustainable agriculture aimed at improved diet diversity and livelihoods have been limited in their development and implementation. However, an integrated system approach to reduce hidden hunger could potentially serve as a sustainable opportunity.
Smoothing tautologies, hidden dynamics, and sigmoid asymptotics for piecewise smooth systems

Science.gov (United States)

Jeffrey, Mike R.

2015-10-01

Switches in real systems take many forms, such as impacts, electronic relays, mitosis, and the implementation of decisions or control strategies. To understand what is lost, and what can be retained, when we model a switch as an instantaneous event, requires a consideration of so-called hidden terms. These are asymptotically vanishing outside the switch, but can be encoded in the form of nonlinear switching terms. A general expression for the switch can be developed in the form of a series of sigmoid functions. We review the key steps in extending Filippov's method of sliding modes to such systems. We show how even slight nonlinear effects can hugely alter the behaviour of an electronic control circuit, and lead to "hidden" attractors inside the switching surface.
Light hidden-sector U(1)s in string compactifications

Energy Technology Data Exchange (ETDEWEB)

Goodsell, Mark; Ringwald, Andreas

2010-02-15

We review the case for light U(1) gauge bosons in the hidden-sector of heterotic and type II string compactifications, present estimates of the size of their kinetic mixing with the visible-sector hypercharge U(1), and discuss their possibly very interesting phenomenological consequences in particle physics and cosmology. (orig.)
Light hidden-sector U(1)s in string compactifications

International Nuclear Information System (INIS)

Goodsell, Mark; Ringwald, Andreas

2010-02-01

We review the case for light U(1) gauge bosons in the hidden-sector of heterotic and type II string compactifications, present estimates of the size of their kinetic mixing with the visible-sector hypercharge U(1), and discuss their possibly very interesting phenomenological consequences in particle physics and cosmology. (orig.)
PELACAKAN DAN PENGENALAN WAJAH MENGGUNAKAN METODE EMBEDDED HIDDEN MARKOV MODELS

Directory of Open Access Journals (Sweden)

Arie Wirawan Margono

2004-01-01

Full Text Available Tracking and recognizing human face becomes one of the important research subjects nowadays, where it is applicable in security system like room access, surveillance, as well as searching for person identity in police database. Because of applying in security case, it is necessary to have robust system for certain conditions such as: background influence, non-frontal face pose of male or female in different age and race. The aim of this research is to develop software which combines human face tracking using CamShift algorithm and face recognition system using Embedded Hidden Markov Models. The software uses video camera (webcam for real-time input, video AVI for dynamic input, and image file for static input. The software uses Object Oriented Programming (OOP coding style with C++ programming language, Microsoft Visual C++ 6.0® compiler, and assisted by some libraries of Intel Image Processing Library (IPL and Intel Open Source Computer Vision (OpenCV. System testing shows that object tracking based on skin complexion using CamShift algorithm comes out well, for tracking of single or even two face objects at once. Human face recognition system using Embedded Hidden Markov Models method has reach accuracy percentage of 82.76%, using 341 human faces in database that consists of 31 individuals with 11 poses and 29 human face testers. Abstract in Bahasa Indonesia : Pelacakan dan pengenalan wajah manusia merupakan salah satu bidang yang cukup berkembang dewasa ini, dimana aplikasi dapat diterapkan dalam bidang keamanan (security system seperti ijin akses masuk ruangan, pengawasan lokasi (surveillance, maupun pencarian identitas individu pada database kepolisian. Karena diterapkan dalam kasus keamanan, dibutuhkan sistem yang handal terhadap beberapa kondisi, seperti: pengaruh latar belakang, pose wajah non-frontal terhadap pria maupun wanita dalam perbedaan usia dan ras. Tujuan penelitiam ini adalah untuk membuat perangkat lunak yang menggabungkan
Results from the solar hidden photon search (SHIPS)

International Nuclear Information System (INIS)

Schwarz, Matthias; Schneide, Magnus; Susol, Jaroslaw; Wiedemann, Guenter; Redondo, Javier

2015-02-01

We present the results of a search for transversely polarised hidden photons (HPs) with ∝3 eV energies emitted from the Sun. These hypothetical particles, known also as paraphotons or dark sector photons, are theoretically well motivated for example by string theory inspired extensions of the Standard Model. Solar HPs of sub-eV mass can convert into photons of the same energy (photon<->HP oscillations are similar to neutrino flavour oscillations). At SHIPS this would take place inside a long light-tight high-vacuum tube, which tracks the Sun. The generated photons would then be focused into a low-noise photomultiplier at the far end of the tube. Our analysis of 330 h of data (and 330 h of background characterisation) reveals no signal of photons from solar hidden photon conversion. We estimate the rate of newly generated photons due to this conversion to be smaller than 25 mHz/m 2 at the 95%C.L. Using this and a recent model of solar HP emission, we set stringent constraints on χ, the coupling constant between HPs and photons, as a function of the HP mass.
Results from the Solar Hidden Photon Search (SHIPS)

Energy Technology Data Exchange (ETDEWEB)

Schwarz, Matthias; Schneide, Magnus; Susol, Jaroslaw; Wiedemann, Günter [Hamburger Sternwarte, Gojenbergsweg 112, D-21029 Hamburg (Germany); Knabbe, Ernst-Axel; Lindner, Axel; Ringwald, Andreas [Deutsches Elektronen-Synchrotron DESY, Notkestraße 85, D-22607 Hamburg (Germany); Redondo, Javier, E-mail: mschwarz@hs.uni-hamburg.de, E-mail: ernst-axel.knabbe@desy.de, E-mail: Axel-lindner@desy.de, E-mail: jredondo@unizar.es, E-mail: Andreas.Ringwald@desy.de, E-mail: mschneide@hs.uni-hamburg.de, E-mail: jsusol@hs.uni-hamburg.de, E-mail: gwiedemann@hs.uni-hamburg.de [Departamento de Física Teórica, Universidad de Zaragoza, Pedro Cerbuna 12, E-50009, Zaragoza (Spain)

2015-08-01

We present the results of a search for transversely polarised hidden photons (HPs) with ∼ 3 eV energies emitted from the Sun. These hypothetical particles, known also as paraphotons or dark sector photons, are theoretically well motivated for example by string theory inspired extensions of the Standard Model. Solar HPs of sub-eV mass can convert into photons of the same energy (photon ↔ HP oscillations are similar to neutrino flavour oscillations). At SHIPS this would take place inside a long light-tight high-vacuum tube, which tracks the Sun. The generated photons would then be focused into a low-noise photomultiplier at the far end of the tube. Our analysis of 330 h of data (and 330 h of background characterisation) reveals no signal of photons from solar hidden photon conversion. We estimate the rate of newly generated photons due to this conversion to be smaller than 25 mHz/m{sup 2} at the 95% C.L . Using this and a recent model of solar HP emission, we set stringent constraints on χ, the coupling constant between HPs and photons, as a function of the HP mass.
Results from the solar hidden photon search (SHIPS)

Energy Technology Data Exchange (ETDEWEB)

Schwarz, Matthias; Schneide, Magnus; Susol, Jaroslaw; Wiedemann, Guenter [Hamburg Univ. (Germany). Sternwarte; Knabbe, Ernst-Axel; Lindner, Axel; Ringwald, Andreas [Deutsches Elektronen-Synchrotron (DESY), Hamburg (Germany); Redondo, Javier [Zaragoza Univ. (Spain). Dept. de Fisica Teorica; Max-Planck-Institut fuer Physik, Muenchen (Germany)

2015-02-15

We present the results of a search for transversely polarised hidden photons (HPs) with ∝3 eV energies emitted from the Sun. These hypothetical particles, known also as paraphotons or dark sector photons, are theoretically well motivated for example by string theory inspired extensions of the Standard Model. Solar HPs of sub-eV mass can convert into photons of the same energy (photon<->HP oscillations are similar to neutrino flavour oscillations). At SHIPS this would take place inside a long light-tight high-vacuum tube, which tracks the Sun. The generated photons would then be focused into a low-noise photomultiplier at the far end of the tube. Our analysis of 330 h of data (and 330 h of background characterisation) reveals no signal of photons from solar hidden photon conversion. We estimate the rate of newly generated photons due to this conversion to be smaller than 25 mHz/m{sup 2} at the 95%C.L. Using this and a recent model of solar HP emission, we set stringent constraints on χ, the coupling constant between HPs and photons, as a function of the HP mass.
Results from the Solar Hidden Photon Search (SHIPS)

Energy Technology Data Exchange (ETDEWEB)

Schwarz, Matthias [Hamburger Sternwarte, Gojenbergsweg 112, D-21029 Hamburg (Germany); Knabbe, Ernst-Axel; Lindner, Axel [Deutsches Elektronen-Synchrotron DESY, Notkestraße 85, D-22607 Hamburg (Germany); Redondo, Javier [Departamento de Física Teórica, Universidad de Zaragoza, Pedro Cerbuna 12, E-50009, Zaragoza (Spain); Max-Planck-Institut für Physik (Werner-Heisenberg-Institut), Föhringer Ring 6, D-80805 München (Germany); Ringwald, Andreas [Deutsches Elektronen-Synchrotron DESY, Notkestraße 85, D-22607 Hamburg (Germany); Schneide, Magnus; Susol, Jaroslaw; Wiedemann, Günter [Hamburger Sternwarte, Gojenbergsweg 112, D-21029 Hamburg (Germany)

2015-08-07

We present the results of a search for transversely polarised hidden photons (HPs) with ∼3 eV energies emitted from the Sun. These hypothetical particles, known also as paraphotons or dark sector photons, are theoretically well motivated for example by string theory inspired extensions of the Standard Model. Solar HPs of sub-eV mass can convert into photons of the same energy (photon ↔ HP oscillations are similar to neutrino flavour oscillations). At SHIPS this would take place inside a long light-tight high-vacuum tube, which tracks the Sun. The generated photons would then be focused into a low-noise photomultiplier at the far end of the tube. Our analysis of 330 h of data (and 330 h of background characterisation) reveals no signal of photons from solar hidden photon conversion. We estimate the rate of newly generated photons due to this conversion to be smaller than 25 mHz/m{sup 2} at the 95% C.L. Using this and a recent model of solar HP emission, we set stringent constraints on χ, the coupling constant between HPs and photons, as a function of the HP mass.
Completing Quantum Mechanics with Quantized Hidden Variables

OpenAIRE

van Enk, S. J.

2015-01-01

I explore the possibility that a quantum system S may be described completely by the combination of its standard quantum state $|\\psi\\rangle$ and a (hidden) quantum state $|\\phi\\rangle$ (that lives in the same Hilbert space), such that the outcome of any standard projective measurement on the system S is determined once the two quantum states are specified. I construct an algorithm that retrieves the standard quantum-mechanical probabilities, which depend only on $|\\psi\\rangle$, by assuming t...
Employing open/hidden administration in psychotherapy research: A randomized-controlled trial of expressive writing

Science.gov (United States)

Tondorf, Theresa; Kaufmann, Lisa-Katrin; Degel, Alexander; Locher, Cosima; Birkhäuer, Johanna; Gerger, Heike; Ehlert, Ulrike

2017-01-01

Psychotherapy has been shown to be effective, but efforts to prove specific effects by placebo-controlled trials have been practically and conceptually hampered. We propose that adopting open/hidden designs from placebo research would offer a possible way to establish specificity in psychotherapy. Therefore, we tested the effects of providing opposing treatment rationales in an online expressive writing intervention on affect in healthy subjects. Results indicate that it was possible to conduct the expressive writing intervention both covertly and openly, but that participants in the hidden administration condition did not fully benefit from the otherwise effective expressive writing intervention in the long-run. Effect sizes between open and hidden administration groups were comparable to pre-post effect sizes of the intervention. While this finding is important for the understanding of psychotherapy's effects per se, it also proves that alternative research approaches to establish specificity are feasible and informative in psychotherapy research. Trial registration: German Clinical Trials Register DRKS00009428 PMID:29176768
Kinetic mixing of the photon with hidden U(1)s in string phenomenology

International Nuclear Information System (INIS)

Abel, S.A.; Khoze, V.V.; Jaeckel, J.

2008-03-01

Embeddings of the standard model in type II string theory typically contain a variety of U(1) gauge factors arising from D-branes in the bulk. In general, there is no reason why only one of these - the one corresponding to weak hypercharge - should be massless. Observations require that standard model particles must be neutral (or have an extremely small charge) under additional massless U(1)s, i.e. the latter have to belong to a so called hidden sector. The exchange of heavy messengers, however, can lead to a kinetic mixing between the hypercharge and the hidden-sector U(1)s, that is testable with near future experiments. This provides a powerful probe of the hidden sectors and, as a consequence, of the string theory realisation itself. In the present paper, we show, using a variety of methods, how the kinetic mixing can be derived from the underlying type II string compactification, involving supersymmetric and nonsupersymmetric configurations of D-branes, both in large volumes and in warped backgrounds with fluxes. We first demonstrate by explicit example that kinetic mixing occurs in a completely supersymmetric set-up where we can use conformal field theory techniques. We then develop a supergravity approach which allows us to examine the phenomenon in more general backgrounds, where we find that kinetic mixing is natural in the context of flux compactifications. We discuss the phenomenological consequences for experiments at the low-energy frontier, searching for signatures of light, sub-electronvolt or even massless hidden-sector U(1) gauge bosons and minicharged particles. (orig.)
Kinetic mixing of the photon with hidden U(1)s in string phenomenology

Energy Technology Data Exchange (ETDEWEB)

Abel, S.A.; Khoze, V.V. [Durham Univ. (United Kingdom). Inst. for Particle Physics Phenomenology; Goodsell, M.D. [Laboratoire de Physique Theorique et Hautes Energies, Paris (France); Jaeckel, J. [Durham Univ. (United Kingdom). Inst. for Particle Physics Phenomenology]|[Heidelberg Univ. (Germany). Inst. fuer Theoretische Physik; Ringwald, A. [Deutsches Elektronen-Synchrotron (DESY), Hamburg (Germany)

2008-03-15

Embeddings of the standard model in type II string theory typically contain a variety of U(1) gauge factors arising from D-branes in the bulk. In general, there is no reason why only one of these - the one corresponding to weak hypercharge - should be massless. Observations require that standard model particles must be neutral (or have an extremely small charge) under additional massless U(1)s, i.e. the latter have to belong to a so called hidden sector. The exchange of heavy messengers, however, can lead to a kinetic mixing between the hypercharge and the hidden-sector U(1)s, that is testable with near future experiments. This provides a powerful probe of the hidden sectors and, as a consequence, of the string theory realisation itself. In the present paper, we show, using a variety of methods, how the kinetic mixing can be derived from the underlying type II string compactification, involving supersymmetric and nonsupersymmetric configurations of D-branes, both in large volumes and in warped backgrounds with fluxes. We first demonstrate by explicit example that kinetic mixing occurs in a completely supersymmetric set-up where we can use conformal field theory techniques. We then develop a supergravity approach which allows us to examine the phenomenon in more general backgrounds, where we find that kinetic mixing is natural in the context of flux compactifications. We discuss the phenomenological consequences for experiments at the low-energy frontier, searching for signatures of light, sub-electronvolt or even massless hidden-sector U(1) gauge bosons and minicharged particles. (orig.)
First Direct-Detection Constraints on eV-Scale Hidden-Photon Dark Matter with DAMIC at SNOLAB.

Science.gov (United States)

Aguilar-Arevalo, A; Amidei, D; Bertou, X; Butner, M; Cancelo, G; Castañeda Vázquez, A; Cervantes Vergara, B A; Chavarria, A E; Chavez, C R; de Mello Neto, J R T; D'Olivo, J C; Estrada, J; Fernandez Moroni, G; Gaïor, R; Guardincerri, Y; Hernández Torres, K P; Izraelevitch, F; Kavner, A; Kilminster, B; Lawson, I; Letessier-Selvon, A; Liao, J; Matalon, A; Mello, V B B; Molina, J; Privitera, P; Ramanathan, K; Sarkis, Y; Schwarz, T; Settimo, M; Sofo Haro, M; Thomas, R; Tiffenberg, J; Tiouchichine, E; Torres Machado, D; Trillaud, F; You, X; Zhou, J

2017-04-07

We present direct detection constraints on the absorption of hidden-photon dark matter with particle masses in the range 1.2-30 eV c^{-2} with the DAMIC experiment at SNOLAB. Under the assumption that the local dark matter is entirely constituted of hidden photons, the sensitivity to the kinetic mixing parameter κ is competitive with constraints from solar emission, reaching a minimum value of 2.2×10^{-14} at 17 eV c^{-2}. These results are the most stringent direct detection constraints on hidden-photon dark matter in the galactic halo with masses 3-12 eV c^{-2} and the first demonstration of direct experimental sensitivity to ionization signals dark matter interactions.
The incompatibility between local hidden variable theories and the ...

Indian Academy of Sciences (India)

I discuss in detail the result that the Bell's inequalities derived in the context of local hidden variable theories for discrete quantized observables can be satisfied only if a fundamental conservation law is violated on the average. This result shows that such theories are physically nonviable, and makes the demarcating criteria ...
Unpacking the Hidden Efficacies of Learning in Productive Failure

Science.gov (United States)

Hung, David; Chen, Victor; Lim, Seo Hong

2009-01-01

This paper describes a framework for learning where learners undergo experimentations with the phenomena at hand according to progressive and staged goals. Bowling is used as a case study in this paper. The premise for experimentations is that learners can experience hidden efficacies, including the formation of "bad habits." A distinction is made…
Exact Sampling and Decoding in High-Order Hidden Markov Models

NARCIS (Netherlands)

Carter, S.; Dymetman, M.; Bouchard, G.

2012-01-01

We present a method for exact optimization and sampling from high order Hidden Markov Models (HMMs), which are generally handled by approximation techniques. Motivated by adaptive rejection sampling and heuristic search, we propose a strategy based on sequentially refining a lower-order language
HMMEditor: a visual editing tool for profile hidden Markov model

Directory of Open Access Journals (Sweden)

Cheng Jianlin

2008-03-01

Full Text Available Abstract Background Profile Hidden Markov Model (HMM is a powerful statistical model to represent a family of DNA, RNA, and protein sequences. Profile HMM has been widely used in bioinformatics research such as sequence alignment, gene structure prediction, motif identification, protein structure prediction, and biological database search. However, few comprehensive, visual editing tools for profile HMM are publicly available. Results We develop a visual editor for profile Hidden Markov Models (HMMEditor. HMMEditor can visualize the profile HMM architecture, transition probabilities, and emission probabilities. Moreover, it provides functions to edit and save HMM and parameters. Furthermore, HMMEditor allows users to align a sequence against the profile HMM and to visualize the corresponding Viterbi path. Conclusion HMMEditor provides a set of unique functions to visualize and edit a profile HMM. It is a useful tool for biological sequence analysis and modeling. Both HMMEditor software and web service are freely available.
Hidden Markov Model of atomic quantum jump dynamics in an optically probed cavity

DEFF Research Database (Denmark)

Gammelmark, S.; Molmer, K.; Alt, W.

2014-01-01

We analyze the quantum jumps of an atom interacting with a cavity field. The strong atom- field interaction makes the cavity transmission depend on the time dependent atomic state, and we present a Hidden Markov Model description of the atomic state dynamics which is conditioned in a Bayesian...... manner on the detected signal. We suggest that small variations in the observed signal may be due to spatial motion of the atom within the cavity, and we represent the atomic system by a number of hidden states to account for both the small variations and the internal state jump dynamics. In our theory...
Low-lying 1/2-hidden strange pentaquark states in the constituent quark model

Institute of Scientific and Technical Information of China (English)

Hui Li; Zong-Xiu Wu; Chun-Sheng An; Hong Chen

2017-01-01

We investigate the spectrum of the low-lying 1/2-hidden strange pentaquark states,employing the constituent quark model,and looking at two ways within that model of mediating the hyperfine interaction between quarks-Goldstone boson exchange and one gluon exchange.Numerical results show that the lowest 1/2-hidden strange pentaquark state in the Goldstone boson exchange model lies at ～ 1570 MeV,so this pentaquark configuration may form a notable component in S11(1535) if the Goldstone boson exchange model is applied.This is consistent with the prediction that S11 (1535) couples very strongly to strangeness channels.

Regional differences, socio-demographics, and hidden population of HIV/AIDS in India.

Science.gov (United States)

Kumar, Rajeev; Suar, Damodar; Singh, Sanjay Kumar

2017-02-01

This study examines the prevalence of HIV/AIDS in different regions of India, their socio-demographic indicators, and the presence of hidden population infected with HIV. Secondary data analyzed were obtained from national and international agencies. Considering the prevalence of HIV/AIDS in India, the low-prevalence regions in the last decade have shown a steady increase in recent years. Productive age, urbanization, male gender, lower level of education, minority religions, low income, and mobile occupations are associated with HIV pandemic. The hidden population vulnerable to HIV/AIDS are: street children, homeless population, and refugees. These observations can help map the high-risk behavior groups and formulate targeted strategies to curb the HIV menace.
The Role of Food and Nutrition System Approaches in Tackling Hidden Hunger

Directory of Open Access Journals (Sweden)

Emile Frison

2011-01-01

Full Text Available One of the World’s greatest challenges is to secure sufficient and healthy food for all, and to do so in an environmentally sustainable manner. This review explores the interrelationships of food, health, and environment, and their role in addressing chronic micronutrient deficiencies, also known as “hidden hunger”, affecting over two billion people worldwide. While the complexity and underlying determinants of undernutrition have been well-understood for decades, the scaling of food and nutrition system approaches that combine sustainable agriculture aimed at improved diet diversity and livelihoods have been limited in their development and implementation. However, an integrated system approach to reduce hidden hunger could potentially serve as a sustainable opportunity.
Measurement problem and local hidden variables with entangled photons

Directory of Open Access Journals (Sweden)

Muchowski Eugen

2017-12-01

Full Text Available It is shown that there is no remote action with polarization measurements of photons in singlet state. A model is presented introducing a hidden parameter which determines the polarizer output. This model is able to explain the polarization measurement results with entangled photons. It is not ruled out by Bell’s Theorem.
[Case-control study on effect of rivaroxaban on the risk of hidden bleeding after total hip arthroplasty].

Science.gov (United States)

Li, Jun; Jing, Jue-Hua; Shi, Zhan-Jun; Zhou, Yun

2014-01-01

To investigate the risk of hidden blood loss about applying rivaroxaban after total hip arthroplasty. From October 2009 to May 2012,88 patients with femoral head necrosis were treated with primary total hip arthroplasty. All the patients were divided into Rivaroxaban group(44 cases)and control group(44 cases). There were 25 males and 19 females in the Rivaroxaban group, with an average age of (58.48 +/- 15.19) years old; in the control group,24 patients were male and 20 patients were female, with an average age of (61.11 +/- 13.54) years old. The patients in the Rivaroxaban group took Rivaroxaban orally from the first day after operation with a dose of 10 mg each day, and treatment course was 14 days. The patients in the control group took placebo orally at the same time. Dominant blood loss and transfusion were recorded, blood routine examinations were taken before operation and at 3 days after operation. The total blood loss and hidden blood loss were calculated according to the formula. The mean total blood loss was (1509.56 +/- 325.23) ml and the hidden blood loss was(581.47 +/- 215.01) ml, accounting for (37.88 +/- 10.42)% in the Rivaroxaban group. The mean total blood loss was (1262.30 +/- 397.95) ml and the hidden blood loss was (395.59 +/- 97.33) ml, accounting for (30.62 +/- 0.20)% in the control group. The total blood loss, hidden blood loss and transfusion in the Rivaroxaban group was significantly more than those in control group,b ut there was no significant difference on dominant blood loss between two groups. Rivaroxaban increased the overall bleeding risk of total hip arthroplasty, especially hidden bleeding risk, which should be careful used.
The hidden face of the petroleum

International Nuclear Information System (INIS)

Laurent, E.

2006-02-01

For the first time, a book reveals what that was hidden to the public opinions: why the petroleum crisis of 1973 what only a manipulation, an arrangement between the OPEC and the petroleum companies, why the data concerning the petroleum reserves are wrong and increased by the producers countries, how Washington used the Saudi petroleum weapon to create the Soviet Union fall, and why from march 2001 maps of the Iraq (where were drawn the future petroleum explorations) were working documents for the vice President Cheney and petroleum managers for the ''secret society''. (A.L.B.)
Thermoelectric generator hidden in a shirt with a fabric radiator

NARCIS (Netherlands)

Leonov, V.; Vullers, R.J.M.; Hoof, C.V.

2012-01-01

Integration of thermopiles in garments has been performed in this work in different ways. It is shown that textile has a minor effect on power generation, which enables completely hidden and unobtrusive energy harvester. A one-milliwatt thermoelectric generator is then integrated between two layers
A masking index for quantifying hidden glitches

OpenAIRE

Berti-Equille, Laure; Loh, J. M.; Dasu, T.

2015-01-01

Data glitches are errors in a dataset. They are complex entities that often span multiple attributes and records. When they co-occur in data, the presence of one type of glitch can hinder the detection of another type of glitch. This phenomenon is called masking. In this paper, we define two important types of masking and propose a novel, statistically rigorous indicator called masking index for quantifying the hidden glitches. We outline four cases of masking: outliers masked by missing valu...
Cold dark matter from the hidden sector

International Nuclear Information System (INIS)

Arias, Paola; Pontificia Univ. Catolica de Chile, Santiago

2012-02-01

Weakly interacting slim particles (WISPs) such as hidden photons (HP) and axion-like particles (ALPs) have been proposed as cold dark matter candidates. They might be produced non-thermally via the misalignment mechanism, similarly to cold axions. In this talk we review the main processes of thermalisation of HP and we compute the parameter space that may survive as cold dark matter population until today. Our findings are quite encouraging for experimental searches in the laboratory in the near future.
Cold dark matter from the hidden sector

Energy Technology Data Exchange (ETDEWEB)

Arias, Paola [Deutsches Elektronen-Synchrotron (DESY), Hamburg (Germany); Pontificia Univ. Catolica de Chile, Santiago (Chile). Facultad de Fisica

2012-02-15

Weakly interacting slim particles (WISPs) such as hidden photons (HP) and axion-like particles (ALPs) have been proposed as cold dark matter candidates. They might be produced non-thermally via the misalignment mechanism, similarly to cold axions. In this talk we review the main processes of thermalisation of HP and we compute the parameter space that may survive as cold dark matter population until today. Our findings are quite encouraging for experimental searches in the laboratory in the near future.
New diagnostic technology and hidden pits and fissures caries

Directory of Open Access Journals (Sweden)

Fabrizio Guerra

2015-10-01

Full Text Available The accuracy in pits and fissures caries detection is of paramount importance in dental caries primary and secondary prevention. A combination of visual examination and probing is currently the mainstay of occlusal caries diagnosis. Unfortunately, these types of inspection alone may leave a certain number of pit and fissure caries undetected. The Vista Cam iX fluorescence camera (Durr Dental, Bietigheim-Bissingen, Germany is a novel dental diagnostic tool for quantitative assessment of dental caries with high specificity for carious lesions detection. In the presented cases photographic images, representing the visual diagnostic approach, are applied as integration to VistaCam iX Proof images. A step-by-step sequence of inspection and assessment of operative treatment need is presented in a case of hidden pit and fissure caries on a permanent molar. Based on the reported case, it could be observed that VistaCam iX Proof shows promising results in hidden pits and fissures caries detection and could be considered a non-invasive examination method that facilitate the detection of early lesions and a potential diagnostic aid.
The hidden X-ray breaks in afterglow light curves

International Nuclear Information System (INIS)

Curran, P. A.; Wijers, R. A. M. J.; Horst, A. J. van der; Starling, R. L. C.

2008-01-01

Gamma-Ray Burst (GRB) afterglow observations in the Swift era have a perceived lack of achromatic jet breaks compared to the BeppoSAX, or pre-Swift era. Specifically, relatively few breaks, consistent with jet breaks, are observed in the X-ray light curves of these bursts. If these breaks are truly missing, it has serious consequences for the interpretation of GRB jet collimation and energy requirements, and the use of GRBs as standard candles.Here we address the issue of X-ray breaks which are possibly 'hidden' and hence the light curves are misinterpreted as being single power-laws. We show how a number of precedents, including GRB 990510 and GRB 060206, exist for such hidden breaks and how, even with the well sampled light curves of the Swift era, these breaks may be left misidentified. We do so by synthesising X-ray light curves and finding general trends via Monte Carlo analysis. Furthermore, in light of these simulations, we discuss how to best identify achromatic breaks in afterglow light curves via multi-wavelength analysis
Automatic Hidden-Web Table Interpretation by Sibling Page Comparison

Science.gov (United States)

Tao, Cui; Embley, David W.

The longstanding problem of automatic table interpretation still illudes us. Its solution would not only be an aid to table processing applications such as large volume table conversion, but would also be an aid in solving related problems such as information extraction and semi-structured data management. In this paper, we offer a conceptual modeling solution for the common special case in which so-called sibling pages are available. The sibling pages we consider are pages on the hidden web, commonly generated from underlying databases. We compare them to identify and connect nonvarying components (category labels) and varying components (data values). We tested our solution using more than 2,000 tables in source pages from three different domains—car advertisements, molecular biology, and geopolitical information. Experimental results show that the system can successfully identify sibling tables, generate structure patterns, interpret tables using the generated patterns, and automatically adjust the structure patterns, if necessary, as it processes a sequence of hidden-web pages. For these activities, the system was able to achieve an overall F-measure of 94.5%.
Revealing the hidden faults in the SE flank of Mt. Etna using radon in-soil gas measurement.

Science.gov (United States)

Johnová, K; Thinová, L; Giammanco, S

2014-07-01

Although there are many methods for investigating tectonic structures, many faults remain hidden, and they can endanger the life and property of people living along them. The slopes of volcanoes are covered with such hidden faults, near which strong earthquakes and gas releases can appear. Revealing hidden faults can therefore contribute significantly to the protection of people living in volcanic areas. In the study, seven different techniques were used for making measurements of in-soil radon concentrations in order to search for hidden faults on the SE flank of the Mt. Etna volcano. These reported methods had previously been proved to be useful tools for investigating fault structures. The main aim of the experiment presented here was to evaluate the usability of these methods in the geological conditions of the Mt. Etna region, and to find the best place for continual radon monitoring using a permanent station in the near future. © The Author 2014. Published by Oxford University Press. All rights reserved. For Permissions, please email: journals.permissions@oup.com.
Interpretation of non-Markovian stochastic Schroedinger equations as a hidden-variable theory

International Nuclear Information System (INIS)

Gambetta, Jay; Wiseman, H.M.

2003-01-01

Do diffusive non-Markovian stochastic Schroedinger equations (SSEs) for open quantum systems have a physical interpretation? In a recent paper [Phys. Rev. A 66, 012108 (2002)] we investigated this question using the orthodox interpretation of quantum mechanics. We found that the solution of a non-Markovian SSE represents the state the system would be in at that time if a measurement was performed on the environment at that time, and yielded a particular result. However, the linking of solutions at different times to make a trajectory is, we concluded, a fiction. In this paper we investigate this question using the modal (hidden variable) interpretation of quantum mechanics. We find that the noise function z(t) appearing in the non-Markovian SSE can be interpreted as a hidden variable for the environment. That is, some chosen property (beable) of the environment has a definite value z(t) even in the absence of measurement on the environment. The non-Markovian SSE gives the evolution of the state of the system 'conditioned' on this environment hidden variable. We present the theory for diffusive non-Markovian SSEs that have as their Markovian limit SSEs corresponding to homodyne and heterodyne detection, as well as one which has no Markovian limit
Two-Stage Hidden Markov Model in Gesture Recognition for Human Robot Interaction

Directory of Open Access Journals (Sweden)

Nhan Nguyen-Duc-Thanh

2012-07-01

Full Text Available Hidden Markov Model (HMM is very rich in mathematical structure and hence can form the theoretical basis for use in a wide range of applications including gesture representation. Most research in this field, however, uses only HMM for recognizing simple gestures, while HMM can definitely be applied for whole gesture meaning recognition. This is very effectively applicable in Human-Robot Interaction (HRI. In this paper, we introduce an approach for HRI in which not only the human can naturally control the robot by hand gesture, but also the robot can recognize what kind of task it is executing. The main idea behind this method is the 2-stages Hidden Markov Model. The 1st HMM is to recognize the prime command-like gestures. Based on the sequence of prime gestures that are recognized from the 1st stage and which represent the whole action, the 2nd HMM plays a role in task recognition. Another contribution of this paper is that we use the output Mixed Gaussian distribution in HMM to improve the recognition rate. In the experiment, we also complete a comparison of the different number of hidden states and mixture components to obtain the optimal one, and compare to other methods to evaluate this performance.
Phenomenological constraints imposed by the hidden sector in the flipped SU(5)xU(1) superstring model

Energy Technology Data Exchange (ETDEWEB)

Leontaris, G.K.; Rizos, J.; Tamvakis, K. (Ioannina Univ. (Greece). Theoretical Physics Div.)

1990-06-28

We calculate the trilinear superpotential of the hidden sector of the three generation flipped SU(5)xU(1)xU(1){sup 4}xSO(10)xSU(4) superstring model. We perform a renormalization group analysis of the model taking into account the hidden sector. We find that, in all relevant cases, fractionally charged tetraplets of the hidden SO(6) gauge group are confined at a high scale. Nevertheless, their contribution to the observable U(1) gauge coupling evolution results in a drastic reduction of the available freedom in the values of a{sub 3}(m{sub w}), sin{sup 2}{theta}{sub w} and M{sub x} that allow superunification. (orig.).
The hidden costs of installing xpert machines in a tuberculosis high ...

African Journals Online (AJOL)

The hidden costs of installing xpert machines in a tuberculosis high-burden country: experiences from Nigeria. Saddiq Tsimiri Abdurrahman, Nnamdi Emenyonu, Olusegun Joshua Obasanya, Lovett Lawson, Russell Dacombe, Muhammad Muhammad, Olanrewaju Oladimeji, Luis Eduardo Cuevas ...
Hidden Broad Line Seyfert 2 Galaxies in the CfA and 12micron Samples

OpenAIRE

Tran, Hien D.

2001-01-01

We report the results of a spectropolarimetric survey of the CfA and 12micron samples of Seyfert 2 galaxies (S2s). Polarized (hidden) broad line regions (HBLRs) are confirmed in a number of galaxies, and several new cases (F02581-1136, MCG -3-58-7, NGC 5995, NGC 6552, NGC 7682) are reported. The 12micron S2 sample shows a significantly higher incidence of HBLR (50%) than its CfA counterpart (30%), suggesting that the latter may be incomplete in hidden AGNs. Compared to the non-HBLR S2s, the H...
A New Chaotic Flow with Hidden Attractor: The First Hyperjerk System with No Equilibrium

Science.gov (United States)

Ren, Shuili; Panahi, Shirin; Rajagopal, Karthikeyan; Akgul, Akif; Pham, Viet-Thanh; Jafari, Sajad

2018-02-01

Discovering unknown aspects of non-equilibrium systems with hidden strange attractors is an attractive research topic. A novel quadratic hyperjerk system is introduced in this paper. It is noteworthy that this non-equilibrium system can generate hidden chaotic attractors. The essential properties of such systems are investigated by means of equilibrium points, phase portrait, bifurcation diagram, and Lyapunov exponents. In addition, a fractional-order differential equation of this new system is presented. Moreover, an electronic circuit is also designed and implemented to verify the feasibility of the theoretical model.
A hidden bias in a common calorimeter calibration scheme

International Nuclear Information System (INIS)

Lincoln, Don; Morrow, Greg; Kasper, Peter

1994-01-01

In this paper, a common calorimeter calibration scheme is explored and a hidden bias found. Since this bias mimics a non-linearity in response in the calorimeter, it must be understood and removed from the calibration before true non-linearities are investigated. The effect and its removal are explored and understood through straightforward calculus and algebra. ((orig.))

Some links on this page may take you to non-federal websites. Their policies may differ from this site.