Components in aqueous Hibiscus rosa-sinensis flower extract inhibit in vitro melanoma cell growth
Directory of Open Access Journals (Sweden)
Karina H. Goldberg
2017-01-01
Full Text Available Skin cancer is extremely common, and melanoma causes about 80% of skin cancer deaths. In fact, melanoma kills over 50 thousand people around the world each year, and these numbers are rising. Clearly, standard treatments are not effectively treating melanoma, and alternative therapies are needed to address this problem. Hibiscus tea has been noted to have medicinal properties, including anticancer effects. Extracts from Hibiscus have been shown to inhibit the growth of a variety of cancer cells. In particular, recent studies found that polyphenols extracted from Hibiscus sabdariffa by organic solvents can inhibit melanoma cell growth. However, effects of aqueous extracts from Hibiscus rosa-sinesis flowers, which are commonly used to make traditional medicinal beverages, have not been examined on melanoma cells. Here, we report that aqueous H. rosa-sinesis flower extract contains compounds that inhibit melanoma cell growth in a dose dependent manner at concentrations that did not affect the growth of nontransformed cells. In addition, these extracts contain low molecular weight growth inhibitory compounds below 3 kD in size that combine with larger compounds to more effectively inhibit melanoma cell growth. Future work should identify these compounds, and evaluate their potential to prevent and treat melanoma and other cancers.
(Psidium guajava), hibiscus (Hibiscus-rosa sinensis)
African Journals Online (AJOL)
SAM
2014-04-30
Hibiscus-rosa ... properly before consumption to avoid ingestion of possible food pathogens that cause food-borne ... depending on the one that most supports their growth ..... boundary leaf, these compounds which include CO2,.
Mutagenesis of hibiscus rosa-sinensis
International Nuclear Information System (INIS)
Shuhaimi Shamsudin; Shakinah Salleh; Mohd Nazir Basiran
2005-01-01
Mutation induction is an alternative method to create more variation in Hibiscus rosa-sinensis. Radiosensitivity test was carried out to determine the effective doses for irradiation of stem cuttings. Stem cuttings of Hibiscus rosa-sinensis were irradiated at 10, 20, 30 and 60 Gy using a gamma cell with a Co-60 source at a dose rate of 1.66 Gys -1 . Irradiated stem cuttings were planted in sand-beds and data on the number of growing shoots were taken. Increasing gamma ray doses resulted in a reduction of growing shoots on the irradiated stem cuttings. It was shown that the LD50 for the stem cuttings was 36.2 Gy and at 75% growth was 17.15 Gy. Based on these results, 20 to 30 Gy were chosen for irradiation of the stem cuttings to induce mutation in Hibiscus rosa-sinensis. Irradiated stem cuttings were then planted into sand-beds for rooting. After one month, the rooted stems were transferred into polybags and allowed to grow under 70% shade provided by plastic netting and the variants were subsequently observed. Three variants with variation in flower shapes and colours were obtained. (Author)
Breeding of Hibiscus rosa-sinensis for garden use in Denmark
DEFF Research Database (Denmark)
Kuligowska, Katarzyna; Simonsen, Maria Boye; Lütken, Henrik Vlk
2013-01-01
-sinensis for increased chilling tolerance by conventional breeding is unlikely because there is a lack of genetic information in relation to this trait within this species. In the Hibiscus genus, cold hardiness is available, but only in a few species. Attempts to create cold tolerant Hibiscus plants resembling H. rosa......Hibiscus rosa-sinensis is an ornamental shrub in tropical and subtropical regions. Limitation of its use as an outdoor ornamental plant in a temperate climate is due to chilling sensitivity. Cold hardiness is a highly complex trait, involving multiple genes. Improvement of H. rosa......-sinensis suitable for Nordic climate have not been successful so far. In ornamental breeding wide hybridization is a major source of genetic variation, and can also be a promising approach to introgress cold hardiness in H. rosa-sinensis. The objective of the present study is to evaluate the possibilities...
Directory of Open Access Journals (Sweden)
Yusraini Dian Inayati Siregar
2017-03-01
Full Text Available Ekstraksi dan Uji Stabilitas Zat Warna Alami dari Bunga Kembang Sepatu (Hibiscus rosa-sinensis L dan Bunga Rosela (Hibiscus sabdariffa L telah dilakukan. Penelitian bertujuan untuk mengekstraksi bunga kembang sepatu dan bunga rosella dengan mencari temperatur dan konsentrasi yang optimum untuk mendapatkan pigmen dari bunga kembang sepatu dan bunga rosella dengan pelarut air dan etanol, selain itu dilakukan juga uji stabilitas zat warna. Analisa kadar zat warna dilakukan dengan metode spektrofotometri. Hasil ekstrasi optimum menggunakan metode maserasi dengan pelarut air adalah pada temperatur 90°C dan dengan pelarut etanol pada konsentrasi 96 %.Uji stabilitas warna memberikan hasil sebagai berikut: a Kondisi penyimpanan, sinar matahari dan sinar lampu dapat mempengaruhi stabilitas zat warna ekstrak Hibiscus rosa-sinensis L dan Hibiscus sabdariffa L dengan meningkatnya nilai absorbansi pada kedua ekstrak. b Penambahan oksidator, H2O2 dapat mempengaruhi stabilitas zat warna ekstrak Hibiscus rosa-sinensis L dan Hibiscus sabdariffa L dengan perubahan dari ekstrak berwarna menjadi ekstrak tidak berwarna karena menghasilkan turunan asam benzoat. c Nilai pH yang semakin meningkat, dari pH 4 ke pH 5, mempengaruhi stabilitas zat warna ekstrak Hibiscus rosa-sinensis L dan Hibiscus sabdariffa L dengan perubahan ekstrak berwarna menjadi tidak berwarna karena terbentuknya basa kuinodal. Kata Kunci: Ekstraksi, Hibiscus rosa-sinensis L, Hibiscus sabdariffa L, Spektrofotometri UV-Vis
Directory of Open Access Journals (Sweden)
Siti Nuryanti
2012-05-01
Full Text Available Titration acid-base needs indicator to show the change of color on interval of hydrogen exponent/degree of acid (pH. Indicator of synthetic which always be used have disadvantages like chemical pollution, stock and expensive of pro- duction cost. The research has been carried out to substitute the synthetic indicator with herbal indicator extracted from flower crown of Hibiscus rosa sinensis L extract. The herbal indicator was extracted from the flower crown Hibiscus rosa sinensis L using a mixture methanol-acetic acid. Then it was evaluated with phenolphthalein and methyl orange(E merck comparer to titration the acid-base, they are strong acid-strong base, weak base-strong acid and weak acid-strong base. The result of research show that herbal indicator of flower crown Hibiscus rosa sinensis L to show theequivalent point in all titrations give peer result with the comparison. With the research result hoped that indicatortitration acid-base flower crown Hibiscus rosa sinensis L is able to as replace synthetic indicator (metyl orange andphenolphtalein which always be used before. ABSTRAK Titrasi asam-basa memerlukan indikator untuk menunjukkan perubahan warna pada setiap interval derajad keasaman (pH. Indikator sintetis yang digunakan selama ini mempunyai beberapa kelemahan seperti polusi kimia, ketersediaan dan biaya produksi mahal. Upaya penelitian sudah dilakukan untuk menggantikan indikator sintetis dengan indikator dari ekstrak mahkota bunga sepatu. Indikator herbal tersebut dibuat dengan cara mengekstrak mahkota bunga Hibiscus rosa sinensis L dengan mengunakan pelarut metanol-asam asetat. Kemudian dievaluasi dengan indikator pembanding fenolftalein dan metil oranye (produksi E merck untuk titrasi asam-basa yaitu asam kuat-basa kuat, basa lemah-asam kuat dan asam lemah-basa kuat. Dari hasil penelitian diketahui bahwa indikator dari mahkota bunga sepatu untuk menunjukkan titik ekivalen dalam titrasi tersebut memberikan hasil yang
Analysis of MINT hibiscus rosa-sinensis mutants
International Nuclear Information System (INIS)
Shakinah Salleh; Shuhaimi Shamsudin; Putri Noor Faizah MM Tahir; Mohd Nazir Basiran
2006-01-01
Gamma irradiation is an alternative method to create new cultivars of Hibiscus rosa-sinensis in Malaysia. Increasing gamma ray doses resulted in a reduction of growing shoots on the irradiated stem cuttings. The LD50 for the stem cuttings was 36.2 Gy and at 75% growth was 17.15 Gy. Based on these results, 20 to 30 Gy were chosen for irradiation of the stem cuttings to induce mutation in Hibiscus rosa-sinensis. Irradiated stem cuttings were then planted into sand-beds for rooting. After one month, the rooted stems were transferred into polybags and allowed to grow under 70% shade provided by plastic netting and the variants were subsequently observed. Three new cultivars with variations in flower size and colours were obtained. The plants were propagated for five generations to achieve the stable mutants. Anthocyanins analysis is being carried out to measure the amount of anthocyanins in each cultivar. Pelargonidin chloride, Cyanidin chloride and Delphinidin chloride are used as standards for the analysis. (Author)
Studies on the constituents of hibiscus rosa-sinensis
International Nuclear Information System (INIS)
Hossain, M.A.; Tarafdar, S.A.
2003-01-01
A new flavone derivative, furano flavone (1) was isolated along with ovalichalcone (2) from the leaves and stems of Hibiscus rosa-sinensis (Malvaceae). The structure of furanoflavone (1) was identified as 5-methoxy-3' methyl-3', 4'-methylenedioxyfurano(2,3; 7,8) flavone by spectroscopic and chemical analysis. (author)
Membrane Stabilizing Activity And Phytochemistry Of Hibiscus rosa ...
African Journals Online (AJOL)
The human erythrocyte membrane stabilizing activity of saline extract of Hibiscus rosa-sinensis leaves was investigated as part of efforts at validating its use as anti-arthritic and anti-inflammatory agent. The results of the membrane stabilizing activity of the extract, when compared to two non-steroidal anti-inflammatory drugs ...
Analgesic activity of Hibiscus rosa sinensis Linn in rat
Directory of Open Access Journals (Sweden)
Alka Sawarkar
Full Text Available The plant Hibiscus rosa sinensis Linn. belongs to family Malvacecae and Considering various medicinal properties of this plant, the leaves were collected and studied for Extractability percentage, analgesic. The herb Hibiscus rosa sinensis belonging to the family Malvacecae and is commonly known as jasvand. It is cultivated in garden throughout India native country probably china. The buds have a sweet odour and bitter taste, cooling, astringent, remove burning sensations of the body and relieve pain. In the present study aqueous, alcoholic Extracts of dried leaves of Hibiscus rosasinensis was prepared. The extractability percentage of leaves was 20%. The extract showed marked analgesic activity in a dose dependent manner. Aqueous and alcoholic extracts produced significant results at both doses (P<0.01, the findings indicated the analgesic activity of the leaves of the plant. [Vet World 2009; 2(9.000: 353-354
Kholkute, S D; Mudgal, V; Udupa, K N
1977-02-01
The postcoital antifertility properties of benzene hot extracts of Hibiscus rosa sinensis flowers, leaves, and stembarks, collected during the winter, spring, rainy, and summer seasons, were investigated in female rats. Only extracts from the flowers of the plant were 100% effective in preventing pregnancy. Those flowers collected during the winter showed the greatest potency, followed by those collected in the spring, rainy season, and summer, in decreasing order. Benzene extracts of flowers collected from Hibiscus mutabilis, Hibiscus schizopetalus, and Malvasicus grandiflorus, plants resembling Hibiscus rosa sinensis in petaloid structure, did not markedly affect pregnancy.
Siregar, Yusraini Dian Inayati; Nurlela, Nurlela
2011-01-01
Ekstraksi dan Uji Stabilitas Zat Warna Alami dari Bunga Kembang Sepatu (Hibiscus rosa-sinensis L) dan Bunga Rosela (Hibiscus sabdariffa L) telah dilakukan. Penelitian bertujuan untuk mengekstraksi bunga kembang sepatu dan bunga rosella dengan mencari temperatur dan konsentrasi yang optimum untuk mendapatkan pigmen dari bunga kembang sepatu dan bunga rosella dengan pelarut air dan etanol, selain itu dilakukan juga uji stabilitas zat warna. Analisa kadar zat warna dilakukan dengan metode spektr...
Gauthaman, Karunakaran K; Saleem, Mohamed TS; Thanislas, Peter T; Prabhu, Vinoth V; Krishnamoorthy, Karthikeyan K; Devaraj, Niranjali S; Somasundaram, Jayaprakash S
2006-01-01
Background The present study investigates the cardioprotective effects of Hibiscus rosa sinensis in myocardial ischemic reperfusion injury, particularly in terms of its antioxidant effects. Methods The medicinal values of the flowers of Hibiscus rosa sinensis (Chinese rose) have been mentioned in ancient literature as useful in disorders of the heart. Dried pulverized flower of Hibiscus rosa sinensis was administered orally to Wistar albino rats (150–200 gms) in three different doses [125, 250 and 500 mg/kg in 2% carboxy methyl cellulose (CMC)], 6 days per week for 4 weeks. Thereafter, rats were sacrificed; either for the determination of baseline changes in cardiac endogenous antioxidants [superoxide dismutase, reduced glutathione and catalase] or the hearts were subjected to isoproterenol induced myocardial necrosis. Results There was significant increase in the baseline contents of thiobarbituric acid reactive substances (TBARS) [a measure of lipid per oxidation] with both doses of Hibiscus Rosa sinensis. In the 250 mg/kg treated group, there was significant increase in superoxide dismutase, reduced glutathione, and catalase levels but not in the 125 and 500 mg/kg treated groups. Significant rise in myocardial thiobarbituric acid reactive substances and loss of superoxide dismutase, catalase and reduced glutathione (suggestive of increased oxidative stress) occurred in the vehicle treated hearts subjected to in vivo myocardial ischemic reperfusion injury. Conclusion It may be concluded that flower of Hibiscus rosa sinensis (250 mg/kg) augments endogenous antioxidant compounds of rat heart and also prevents the myocardium from isoproterenol induced myocardial injury. PMID:16987414
Cytotoxic Activity of the Leaf and Stem Extracts of Hibiscus rosa ...
African Journals Online (AJOL)
Methods: The crude petroleum ether, ethyl acetate and methanol extracts of the leaf and stem of Hibiscus rosa sinensis were prepared using cold extraction method. The in vitro cytotoxic activity of the extracts (20 - 100 μg/ml) was evaluated on leukaemic cancer cell line (K-562) and Mardin-Darby kidney cell line (MDBK) ...
Antihyperlipidemic activity of Hibiscus rosa-sinensis Linn. ethanolic extract fractions
Mukesh Singh Sikarwar; M B Patil
2015-01-01
Aim: The study investigates the antihyperlipidemic effect of Hibiscus rosa-sinensis Linn. (Malvaceae) ethanolic extract fractions in triton and atherogenic diet-induced hyperlipidemic rats. Materials and Methods: Oral administrations of 500 mg/kg body weight of various fractions of selected plant were evaluated for possible antihyperlipidemic activity in triton and atherogenic diet-induced hyperlipidemic rats for duration of 48 h and 14 days respectively. In triton model, hyperlipidemia was i...
Directory of Open Access Journals (Sweden)
Marcelo Negrini
2017-10-01
Full Text Available Maconellicoccus hirsutus Green, 1908 (Hemiptera: Pseudococcidae is an introduced pest that threatens fruit and ornamental plant production in Brazil. Reported in Brazil for the first time in 2010, in the state of Roraima, M. hirsutus, has spread rapidly to other regions of the country. The objective of this study was to investigate the biology of M. hirsutus on Hibiscus rosa-sinensis L. (Malvaceae leaves in laboratory conditions with climatic parameters similar to those of the Brazilian North and Northeast (27 ± 1 °C, 60 ± 10% relative humidity and 12 hours light and 12 hours dark. Eighty M. hirsutus nymphs were individualized on rooted H. rosa-sinensis leaves and their survival, mortality, sex ratio, and egg numbers per female emerged were recorded. Maconellicoccus hirsutus can have up to nine generations per year, taking 6.5 days to double its population size. The female numbers of this pest are about three times higher than those for its male counterparts, with 98 eggs per female and 97% viability. The survival curve of the species is type I, that is, mortality rates are higher in adulthood. Maconellicoccus hirsutus, especially, a pest of fruit trees and ornamental plants, presents great potential for population growth in Brazilian tropical conditions. = Maconellicoccus hirsutus Green, 1908 (Hemiptera: Pseudococcidae é uma praga introduzida que ameaça a produção de frutas e plantas ornamentais no Brasil. Registrada no Brasil pela primeira vez em 2010, no estado de Roraima, M. hirsutus se espalhou rapidamente para outras regiões do país. O objetivo deste estudo foi investigar a biologia de M. hirsutus em folhas de Hibiscus rosa-sinensis L. (Malvaceae, em condições de laboratório com parâmetros climáticos semelhantes aos das regiões Norte e Nordeste do Brasil (27 ± 1 °C, 60 ± 10 % de umidade relativa e 12 h de luz e 12 h de escuro. Oitenta ninfas de M. hirsutus foram individualizadas em folhas enraizadas de H. rosa-sinensis e
Afiune, Luana Alves Freitas; Leal-Silva, Thaís; Sinzato, Yuri Karen; Moraes-Souza, Rafaianne Queiroz; Soares, Thaigra Sousa; Campos, Kleber Eduardo; Fujiwara, Ricardo Toshio; Herrera, Emilio; Damasceno, Débora Cristina
2017-01-01
Purpose The Hibiscus rosa-sinensis flower is widely used in Brazilian traditional medicine for the treatment of diabetes and has shown antifertility activity in female Wistar rats. However, there is no scientific confirmation of its effect on diabetes and pregnancy. The aim of this study was evaluate the effect of aqueous extract of H. rosa-sinensis flowers on maternal-fetal outcome in pregnant rats with diabetes. Methods Diabetes was induced by streptozotocin (STZ, 40 mg/kg) in virgin, adult, female Wistar rats. After diabetes induction, the rats were mated. The pregnant rats were distributed into four groups (n minimum = 11 animals/group): non-diabetic, non-diabetic treated, diabetic, and diabetic treated. Oral aqueous extract of Hibiscus rosa-sinensis was administered to rats in the treatment groups during pregnancy. At term pregnancy, maternal reproductive outcomes, fetal parameters, and biochemical parameters were analyzed. Results The non-diabetic treated group showed decreased high density lipoprotein cholesterol, increased atherogenic index (AI) and coronary artery risk index (CRI), and increased preimplantation loss rate compared to the non-diabetic group. Although treatment with H. rosa-sinensis led to no toxicity, it showed deleterious effects on cardiac and reproductive functions. However, the diabetic treated group showed increased maternal and fetal weights, reduced AI and CRI, and reduced preimplantation loss rate compared to the untreated diabetic group. Conclusion Our results demonstrate beneficial effects of this flower only in pregnant rats with diabetes and their offspring. Although these findings cannot be extrapolated to human clinical use, they show that the indiscriminate intake of H. rosa-sinensis may be harmful to healthy individuals and its use should be completely avoided in pregnancy. PMID:28644857
Afiune, Luana Alves Freitas; Leal-Silva, Thaís; Sinzato, Yuri Karen; Moraes-Souza, Rafaianne Queiroz; Soares, Thaigra Sousa; Campos, Kleber Eduardo; Fujiwara, Ricardo Toshio; Herrera, Emilio; Damasceno, Débora Cristina; Volpato, Gustavo Tadeu
2017-01-01
The Hibiscus rosa-sinensis flower is widely used in Brazilian traditional medicine for the treatment of diabetes and has shown antifertility activity in female Wistar rats. However, there is no scientific confirmation of its effect on diabetes and pregnancy. The aim of this study was evaluate the effect of aqueous extract of H. rosa-sinensis flowers on maternal-fetal outcome in pregnant rats with diabetes. Diabetes was induced by streptozotocin (STZ, 40 mg/kg) in virgin, adult, female Wistar rats. After diabetes induction, the rats were mated. The pregnant rats were distributed into four groups (n minimum = 11 animals/group): non-diabetic, non-diabetic treated, diabetic, and diabetic treated. Oral aqueous extract of Hibiscus rosa-sinensis was administered to rats in the treatment groups during pregnancy. At term pregnancy, maternal reproductive outcomes, fetal parameters, and biochemical parameters were analyzed. The non-diabetic treated group showed decreased high density lipoprotein cholesterol, increased atherogenic index (AI) and coronary artery risk index (CRI), and increased preimplantation loss rate compared to the non-diabetic group. Although treatment with H. rosa-sinensis led to no toxicity, it showed deleterious effects on cardiac and reproductive functions. However, the diabetic treated group showed increased maternal and fetal weights, reduced AI and CRI, and reduced preimplantation loss rate compared to the untreated diabetic group. Our results demonstrate beneficial effects of this flower only in pregnant rats with diabetes and their offspring. Although these findings cannot be extrapolated to human clinical use, they show that the indiscriminate intake of H. rosa-sinensis may be harmful to healthy individuals and its use should be completely avoided in pregnancy.
Directory of Open Access Journals (Sweden)
Luana Alves Freitas Afiune
Full Text Available The Hibiscus rosa-sinensis flower is widely used in Brazilian traditional medicine for the treatment of diabetes and has shown antifertility activity in female Wistar rats. However, there is no scientific confirmation of its effect on diabetes and pregnancy. The aim of this study was evaluate the effect of aqueous extract of H. rosa-sinensis flowers on maternal-fetal outcome in pregnant rats with diabetes.Diabetes was induced by streptozotocin (STZ, 40 mg/kg in virgin, adult, female Wistar rats. After diabetes induction, the rats were mated. The pregnant rats were distributed into four groups (n minimum = 11 animals/group: non-diabetic, non-diabetic treated, diabetic, and diabetic treated. Oral aqueous extract of Hibiscus rosa-sinensis was administered to rats in the treatment groups during pregnancy. At term pregnancy, maternal reproductive outcomes, fetal parameters, and biochemical parameters were analyzed.The non-diabetic treated group showed decreased high density lipoprotein cholesterol, increased atherogenic index (AI and coronary artery risk index (CRI, and increased preimplantation loss rate compared to the non-diabetic group. Although treatment with H. rosa-sinensis led to no toxicity, it showed deleterious effects on cardiac and reproductive functions. However, the diabetic treated group showed increased maternal and fetal weights, reduced AI and CRI, and reduced preimplantation loss rate compared to the untreated diabetic group.Our results demonstrate beneficial effects of this flower only in pregnant rats with diabetes and their offspring. Although these findings cannot be extrapolated to human clinical use, they show that the indiscriminate intake of H. rosa-sinensis may be harmful to healthy individuals and its use should be completely avoided in pregnancy.
Sartiami, Dewi; Watson, Gillian W.; Mohamad Roff, M. N.; Idris, A. B.
2016-11-01
A survey of mealybugs (Hemiptera: Coccomorpha: Pseudococcidae) attacking the national flower of Malaysia, Hibiscus rosa-sisnensis L. and Hibiscus spp. (Malvaceae) was conducted in Selangor and Kuala Lumpur, Malaysia, from January to March 2016. Adult females were mounted on microscope slides in Canada balsam. The five species identified were Ferrisia dasylirii (Cockerell), Maconellicoccus hirsutus (Green), Paracoccus marginatus Williams and Granara de Willink, Phenacoccus solenopsis (Tinsley) and Pseudococcus jackbeardsleyi Gimpel & Miller. Two of these, the invasive species Ferrisia dasylirii and P. solenopsis were introduced and first recorded in Malaysia.
Nagarajappa, Ramesh; Batra, Mehak; Sharda, Archana J; Asawa, Kailash; Sanadhya, Sudhanshu; Daryani, Hemasha; Ramesh, Gayathri
2015-01-01
To assess and compare the antimicrobial potential and determine the minimum inhibitory concentration (MIC) of Jasminum grandiflorum and Hibiscus rosa-sinensis extracts as potential anti-pathogenic agents in dental caries. Aqueous and ethanol (cold and hot) extracts prepared from leaves of Jasminum grandiflorum and Hibiscus rosa-sinensis were screened for in vitro antimicrobial activity against Streptococcus mutans and Lactobacillus acidophilus using the agar well diffusion method. The lowest concentration of every extract considered as the minimum inhibitory concentration (MIC) was determined for both test organisms. Statistical analysis was performed with one-way analysis of variance (ANOVA). At lower concentrations, hot ethanol Jasminum grandiflorum (10 μg/ml) and Hibiscus rosa-sinensis (25 μg/ml) extracts were found to have statistically significant (P≤0.05) antimicrobial activity against S. mutans and L. acidophilus with MIC values of 6.25 μg/ml and 25 μg/ml, respectively. A proportional increase in their antimicrobial activity (zone of inhibition) was observed. Both extracts were found to be antimicrobially active and contain compounds with therapeutic potential. Nevertheless, clinical trials on the effect of these plants are essential before advocating large-scale therapy.
Trivellini, Alice; Cocetta, Giacomo; Hunter, Donald A; Vernieri, Paolo; Ferrante, Antonio
2016-10-01
Flowers are complex systems whose vegetative and sexual structures initiate and die in a synchronous manner. The rapidity of this process varies widely in flowers, with some lasting for months while others such as Hibiscus rosa-sinensis survive for only a day. The genetic regulation underlying these differences is unclear. To identify key genes and pathways that coordinate floral organ senescence of ephemeral flowers, we identified transcripts in H. rosa-sinensis floral organs by 454 sequencing. During development, 2053 transcripts increased and 2135 decreased significantly in abundance. The senescence of the flower was associated with increased abundance of many hydrolytic genes, including aspartic and cysteine proteases, vacuolar processing enzymes, and nucleases. Pathway analysis suggested that transcripts altering significantly in abundance were enriched in functions related to cell wall-, aquaporin-, light/circadian clock-, autophagy-, and calcium-related genes. Finding enrichment in light/circadian clock-related genes fits well with the observation that hibiscus floral development is highly synchronized with light and the hypothesis that ageing/senescence of the flower is orchestrated by a molecular clock. Further study of these genes will provide novel insight into how the molecular clock is able to regulate the timing of programmed cell death in tissues. © The Author 2016. Published by Oxford University Press on behalf of the Society for Experimental Biology.
Silva, Analú Barbosa da; Wiest, José Maria; Carvalho, Heloisa Helena Chaves
2016-01-01
Resumo O Hibiscus rosa-sinensis L. e o Hibiscus syriacus L., da família Malvaceae, são utilizados na área ornamental e gastronômica internacional, mas, nos últimos anos, vêm ganhando espaço como flores comestíveis não convencionais na alimentação alternativa. Este estudo objetivou quantificar a composição centesimal, pectina e compostos fitoquímicos dessas variedades de hibisco comparados com o potencial antioxidante detectado. As amostras das flores foram coletadas em uma propriedade agroeco...
Hibiscus rosa- sinensis leaf extract as coagulant aid in leachate treatment
Awang, Nik Azimatolakma; Aziz, Hamidi Abdul
2012-12-01
Hibiscus rosa- sinensis is a biodegradable material that has remained untested for flocculating properties. The objective of this study is to examine the efficiency of coagulation-flocculation processes for the removal of color, iron (Fe3+), suspended solids, turbidity and ammonia nitrogen(NH3-N), from landfill leachate using 4,000 mg/L alum in conjunction with H. rosa- sinensis leaf extract (HBaqs). Hydroxyl (O-H) and (carboxyl) C=O functional groups along the HBaqs chain help to indulge flocculating efficiency of HBaqs via bridging. The experiments confirm the positive coagulation properties of HBaqs. The Fe3+ removal rate using 4,000 mg/L alum as sole coagulant was approximately 60 %, and increased to 100 % when 4,000 mg/L alum was mixed with 500 mg/L HBaqs. By mixing, 4,000 mg/L alum with 100-500 mg/L HBaqs, 72 % of SS was removed as compared with only 45 % reduction using 4,000 mg/L alum as sole coagulant.
The Role of Leaves in Photocontrol of Flower Bud Abscission in Hibiscus rosa-sinensis L. 'Nairobi'
Meeteren, van U.; Gelder, van A.
2000-01-01
When compared with exposure to darkness, exposing Hibiscus rosa-sinensis L. 'Nairobi' plants to red light (635 to 685 nm, 2.9 μmol?m-2?s-1) delayed flower bud abscission, while exposure to far-red light (705 to 755 nm, μmol?m-2?s-1) accelerated this process. Flower bud abscission in response to
Pillai, Sneha S; Mini, S
2016-03-01
The prevalence of diabetes mellitus is becoming more and more serious and reaches epidemic proportions worldwide. Scientific research is constantly looking for new agents that could be used as dietary functional ingredients in the fight against diabetes. The objective of the present study was to evaluate the effect of ethyl acetate fraction of Hibiscus rosa sinensis Linn. petals on experimental diabetes at a dose of 25 mg/kg body weight and it was compared with standard anti-diabetic drug metformin. The elevated levels of serum glucose (398.56 ± 35.78) and glycated haemoglobin (12.89 ± 1.89) in diabetic rats were significantly decreased (156.89 ± 14.45 and 6.12 ± 0.49, respectively) by Hibiscus rosa sinensis petals (EHRS) administration. Hepatotoxicity marker enzyme levels in serum were normalized. The fraction supplementation restored the glycogen content by regulating the activities of glycogen metabolizing enzymes. It significantly modulated the expressions of marker genes involved in glucose homeostasis signalling pathway. Histopathological analysis of liver and pancreas supported our findings. The overall effect was comparable with metformin. Hence, our study reveals the role of hibiscus petals for alleviation of diabetes complications, thus it can be propagated as a nutraceutical agent.
Pethe, Mohan; Yelwatkar, Samir; Manchalwar, Smita; Gujar, Vijay
2017-08-01
Aim and Objective The current study sought to investigate antidiabetic, hypolipidimic, antioxidant and histopathological effects of floral extract of Hibiscus rosa sinensis in Alloxan induced Diabetes in rats. Materials and Methods Study was conducted on 6 groups with 6 wistar rats in each group for the period of 4 weeks. Group I: served as normal control (NC), rats administered with gum acacia 1 ml daily, group II: consider as diabetic control (DC) treated with alloxon 150 mg/kg body wt. Whereas Hibiscus rosa-sinensis flower extract was given orally in group III (DE1), group IV (DE2), group V (DE3) at doses of 50, 100 and 200 mg/kg body weight dissolved in distilled water respectively. Group VI (DG) was given glibenclamide (5 mg/kg) as a standard drug and results were compared in reference to it. Results The results indicate that the test compound HEFHR (Hydroalcoholic extract of flower Hibiscus rosa-sinensis) has significant and sustained oral antidiabetic activity, comparable with the hypoglycemic effect of Glibenclamide and Sulphonylurea. Flower extract of HRS was more efficacious in lipid lowering effect and in antioxidative activity than glibenclamide. After 28 day treatment with flower extract, size of islets was significantly increased and necrosis and atrophy of islets were significantly improved; also increase in number and diameter of cell islets appeared to be regular as compared to the diabetic group. Conclusion HEFHR possesses significant antidiabetic, hypolipidemic and antioxidant properties as well as regeneration of beta cells in rats. Further evaluation of HEFHR is in progress. © Georg Thieme Verlag KG Stuttgart · New York.
Kaleemullah, M.; Jiyauddin, K.; Thiban, E.; Rasha, S.; Al-Dhalli, S.; Budiasih, S.; Gamal, O.E.; Fadli, A.; Eddy, Y.
2016-01-01
Currently, the use of natural gums and mucilage is of increasing importance in pharmaceutical formulations as valuable drug excipient. Natural plant-based materials are economic, free of side effects, biocompatible and biodegradable. Therefore, Ketoprofen matrix tablets were formulated by employing Hibiscus rosa-sinensis leaves mucilage as natural polymer and HPMC (K100M) as a synthetic polymer to sustain the drug release from matrix system. Direct compression method was used to develop susta...
Ramelan, A. H.; Wahyuningsih, S.; Rosyida, N. A.; Supriyanto, E.; Saputro, S.; Hanif, Q. A.; Rinawati, L.
2016-02-01
Anthocyanin extracted from Hibiscus (Hibiscus rosa sinensis L) as a photosensitizer in nanostructured-TiO2 dye sensitized solar cells has been fabricated. Ultravisible visible absorption spectra of anthocyanin show an ability absorbing light in the visible region. While the nanostructed-TiO2 powder in this research was prepared by sol-gel method following annealled at a temperature of 600°C. Subsequently, the TiO2 nanostructures were characterized by XRD, XRF, and SEM. The difractogram X-ray results shown that TiO2 was built from f anatase and rutile phase. Element analysis of synthesized TiO2 by X-ray Fluorecence (XRF) shown the TiO2 content of 98,67 wt%. TiO2 layer prepared at different thickness showed the average size of cavity about 0.83 µm. These several thickness of solar cells were fabricated and were immersed into anthocyanin for 24 hours to gain sensitized TiO2 photoanode for Dye sensitised solar cells (DSSCs). These DSSCS performance were measured using I-V Keithley 2602A. The results exhibited that the sample with a TiO2 layer thickness of 4.75 ± 0.8 µm has the highest efficiency.
Fullerene-Based Symmetry in Hibiscus rosa-sinensis Pollen
Andrade, Kleber; Guerra, Sara; Debut, Alexis
2014-01-01
The fullerene molecule belongs to the so-called super materials. The compound is interesting due to its spherical configuration where atoms occupy positions forming a mechanically stable structure. We first demonstrate that pollen of Hibiscus rosa-sinensis has a strong symmetry regarding the distribution of its spines over the spherical grain. These spines form spherical hexagons and pentagons. The distance between atoms in fullerene is explained applying principles of flat, spherical, and spatial geometry, based on Euclid’s “Elements” book, as well as logic algorithms. Measurements of the pollen grain take into account that the true spine lengths, and consequently the real distances between them, are measured to the periphery of each grain. Algorithms are developed to recover the spatial effects lost in 2D photos. There is a clear correspondence between the position of atoms in the fullerene molecule and the position of spines in the pollen grain. In the fullerene the separation gives the idea of equal length bonds which implies perfectly distributed electron clouds while in the pollen grain we suggest that the spines being equally spaced carry an electrical charge originating in forces involved in the pollination process. PMID:25003375
Microbial composition of guava (Psidium guajava), hibiscus ...
African Journals Online (AJOL)
Microbial composition of guava (Psidium guajava), hibiscus (Hibiscus-rosa sinensis), mango (Mangifera indica) and pumpkin (Telfairia occidentalis Hook) ... African Journal of Biotechnology ... The microbial genera isolated from this study showed that, both human and plant pathogens can colonize plants' phyllosphere.
Hibiscus Rosa Sinensis Leaves: Analysis Of Proximate, Antioxidant Activities And Inorganic Compound
International Nuclear Information System (INIS)
Saiful Irwan Zubairi; Nurul Shahreda Jaies
2014-01-01
A variety of herbal plants species has been used in traditional medicine. Most of these plants contained several potent bio-active ingredients and nutrients that could give potential positive effects to the health such as antioxidant and antipyretic. Hibiscus rosa sinensis, commonly known as Bunga raya, have similar concoction characteristic to tea which contain antioxidants that help to control cholesterol. In addition, mucilage that was found in the leaves could helps to reduce extreme body heat during fever (which potentially acts as an antipyretic). Therefore, this preliminary study on the fresh and dried H. rosa sinensis leaves was carried out to analyze and identify the nutrients content, anti-oxidants and inorganic material. Total phenolic content (TPC) method was used for both fresh and dried leaves prior to the antioxidant activities of DPPH free radicals scavenging and ferric ion reducing antioxidant power (FRAP) as to confirm the existence of antioxidant constituents. Meanwhile, the composition of heavy metals was studied using inductively coupled plasma mass spectrometry (ICP-MS). The proximate analysis of the fresh leaves showed the presence of moisture content (9.03 %), protein (10.44 %), fat (6.43 %), crude fiber (11.55 %), ash (11.22 %) and carbohydrate (51.33 %). Meanwhile, the inorganic contents are as follows: cadmium (Cd), chromium (Cr), arsenic (As), nickel (Ni), lead (Pb), iron (Fe) and zinc (Zn). Furthermore, the antioxidant activities of FRAP and DPPH showed that dried leaves of H. rosa sinensis was higher than the fresh leaves (p < 0.05) irrespective of any solvent used. The positive correlation between TPC and two other antioxidant activities of DPPH and FRAP (p < 0.05) indicates the presence of antioxidant components in the acetone and water extracts. Therefore, the high availability of essential nutritional component, anti-oxidants and low concentration of hazardous inorganic matter in H. rosa sinensis leaves enable it to be used as one
Comparison of leaf anatomical characteristics of hibiscus rosa-sinensis grown in faisalabad region
International Nuclear Information System (INIS)
Noman, A.; Ali, Q.; Mehmood, T.; Iftikhar, T.; Mahmeed, M.
2014-01-01
The genetic potential of different plant species to different environmental conditions differ in relation to different physiological, biochemical and anatomical characteristics. Of these varying attributes leaf anatomical characteristics play most important role for the establishment of that cultivar in varied environmental conditions. So, the present study was conducted to assess the inter-cultivar genetic potential of Hibiscus in relation to leaf anatomical characteristics. To fulfill the study requirements Hibiscus rosa-sinensis and its six cultivars (were well adapted to their specific natural habitat) were collected from different locations of district Faisalabad Pakistan that have great environmental changes round the year. Results showed significant variability among cultivars in relation to analyzed anatomical characteristics. Cultivars Lemon shiffon and Wilder's white emerge more promising among others by possessing more epidermal thickness, increased epidermal cell area, high cortical cell area and incremented stomatal density as compared with other cultivars. On the other hand, cultivars Cooperi alba, Mrs. George Davis and Frank green possessed least cortex cell area, lowest xylem region thickness and minimum phloem region thickness respectively. Overall, it can be concluded that anatomical genetic potential has endorsed cultivars Lemon chiffon and Wilder's white with enormous capability to grow well under variable environments. (author)
Bhaskar, Anusha; Nithya, V.
2012-01-01
Objective: To investigate the wound-healing potency of the ethanolic extract of the flowers of Hibiscus rosa sinensis. Materials and Methods: The wound-healing activity of H. rosa sinensis (5 and 10% w/w) on Wistar albino rats was studied using three different models viz., excision, incision and dead space wound. The parameters studied were breaking strength in incision model, granulation tissue dry weight, breaking strength and collagen content in dead space wound model, percentage of wound contraction and period of epithelization in excision wound model. The granulation tissue formed on days 4, 8, 12, and 16 (post-wound) was used to estimate total collagen, hexosamine, protein, DNA and uronic acid. Data were analyzed by Analysis of Variance (ANOVA) test. P<0.05 was considered statistically significant. Results: The extract increased cellular proliferation and collagen synthesis at the wound site, as evidenced by increase in DNA, total protein and total collagen content of granulation tissues. The extract-treated wounds were found to heal much faster as indicated by improved rates of epithelialization and wound contraction. The extract of H. rosa sinensis significantly (P<0.001) increased the wound-breaking strength in the incision wound model compared to controls. The extract-treated wounds were found to epithelialize faster, and the rate of wound contraction was significantly (P<0.001) increased as compared to control wounds. Wet and dry granulation tissue weights in a dead space wound model increased significantly (P<0.001). There was a significant increase in wound closure rate, tensile strength, dry granuloma weight, wet granuloma weight and decrease in epithelization period in H. rosa sinensis-treated group as compared to control and standard drug-treated groups. Conclusion: The ethanolic extract of H. rosa sinensis had greater wound-healing activity than the nitrofurazone ointment. PMID:23248396
Green synthesis of gold and silver nanoparticles using Hibiscus rosa sinensis
Philip, Daizy
2010-03-01
Biological synthesis of gold and silver nanoparticles of various shapes using the leaf extract of Hibiscus rosa sinensis is reported. This is a simple, cost-effective, stable for long time and reproducible aqueous room temperature synthesis method to obtain a self-assembly of Au and Ag nanoparticles. The size and shape of Au nanoparticles are modulated by varying the ratio of metal salt and extract in the reaction medium. Variation of pH of the reaction medium gives silver nanoparticles of different shapes. The nanoparticles obtained are characterized by UV-vis, transmission electron microscopy (TEM), X-ray diffraction (XRD) and FTIR spectroscopy. Crystalline nature of the nanoparticles in the fcc structure are confirmed by the peaks in the XRD pattern corresponding to (1 1 1), (2 0 0), (2 2 0) and (3 1 1) planes, bright circular spots in the selected area electron diffraction (SAED) and clear lattice fringes in the high-resolution TEM image. From FTIR spectra it is found that the Au nanoparticles are bound to amine groups and the Ag nanoparticles to carboxylate ion groups.
Directory of Open Access Journals (Sweden)
M. Kaleemullah
2017-07-01
Full Text Available Currently, the use of natural gums and mucilage is of increasing importance in pharmaceutical formulations as valuable drug excipient. Natural plant-based materials are economic, free of side effects, biocompatible and biodegradable. Therefore, Ketoprofen matrix tablets were formulated by employing Hibiscus rosa-sinensis leaves mucilage as natural polymer and HPMC (K100M as a synthetic polymer to sustain the drug release from matrix system. Direct compression method was used to develop sustained released matrix tablets. The formulated matrix tablets were evaluated in terms of physical appearance, weight variation, thickness, diameter, hardness, friability and in vitro drug release. The difference between the natural and synthetic polymers was investigated concurrently. Matrix tablets developed from each formulation passed all standard physical evaluation tests. The dissolution studies of formulated tablets revealed sustained drug release up to 24 h compared to the reference drug Apo Keto® SR tablets. The dissolution data later were fitted into kinetic models such as zero order equation, first order equation, Higuchi equation, Hixson Crowell equation and Korsmeyer-Peppas equation to study the release of drugs from each formulation. The best formulations were selected based on the similarity factor (f2 value of 50% and more. Through the research, it is found that by increasing the polymers concentration, the rate of drug release decreased for both natural and synthetic polymers. The best formulation was found to be F3 which contained 40% Hibiscus rosa-sinensis mucilage polymer and showed comparable dissolution profile to the reference drug with f2 value of 78.03%. The release kinetics of this formulation has shown to follow non-Fickian type which involved both diffusion and erosion mechanism. Additionally, the statistical results indicated that there was no significant difference (p > 0.05 between the F3 and reference drug in terms of MDT and
Kaleemullah, M; Jiyauddin, K; Thiban, E; Rasha, S; Al-Dhalli, S; Budiasih, S; Gamal, O E; Fadli, A; Eddy, Y
2017-07-01
Currently, the use of natural gums and mucilage is of increasing importance in pharmaceutical formulations as valuable drug excipient. Natural plant-based materials are economic, free of side effects, biocompatible and biodegradable. Therefore, Ketoprofen matrix tablets were formulated by employing Hibiscus rosa-sinensis leaves mucilage as natural polymer and HPMC (K100M) as a synthetic polymer to sustain the drug release from matrix system. Direct compression method was used to develop sustained released matrix tablets. The formulated matrix tablets were evaluated in terms of physical appearance, weight variation, thickness, diameter, hardness, friability and in vitro drug release. The difference between the natural and synthetic polymers was investigated concurrently. Matrix tablets developed from each formulation passed all standard physical evaluation tests. The dissolution studies of formulated tablets revealed sustained drug release up to 24 h compared to the reference drug Apo Keto® SR tablets. The dissolution data later were fitted into kinetic models such as zero order equation, first order equation, Higuchi equation, Hixson Crowell equation and Korsmeyer-Peppas equation to study the release of drugs from each formulation. The best formulations were selected based on the similarity factor ( f 2 ) value of 50% and more. Through the research, it is found that by increasing the polymers concentration, the rate of drug release decreased for both natural and synthetic polymers. The best formulation was found to be F3 which contained 40% Hibiscus rosa-sinensis mucilage polymer and showed comparable dissolution profile to the reference drug with f 2 value of 78.03%. The release kinetics of this formulation has shown to follow non-Fickian type which involved both diffusion and erosion mechanism. Additionally, the statistical results indicated that there was no significant difference (p > 0.05) between the F3 and reference drug in terms of MDT and T50% with p
Nayak, Debasis; Ashe, Sarbani; Rauta, Pradipta Ranjan; Nayak, Bismita
2015-10-01
Green synthesis of metallic nanoparticles has lured the world from the chemical and physical approaches owing to its rapid, non-hazardous and economic aspect of production mechanism. In this study, silver nanoparticles (AgNPs) were synthesised using petal extracts of Hibiscus rosa-sinensis. The AgNPs displayed characteristic surface plasmon resonance peak at around 421 nm having a mean particle size of 76.25±0.17 nm and carried a charge of -41±0.2 mV. The X-ray diffraction patterns displayed typical peaks of face centred cubic crystalline silver. The surface morphology was characterised by scanning electron microscopy and atomic force microscopy. Fourier transform infrared spectroscopy studies confirmed the surface modifications of the functional groups for the synthesis of AgNPs. Furthermore, the synthesised AgNPs displayed proficient antimicrobial activity against pathogenic strains of Vibrio cholerae, Escherichia coli, Klebsiella pneumoniae and Staphylococcus aureus.
Fairuzi, Afiza Ahmad; Bonnia, Noor Najmi; Akhir, Rabiatuladawiyah Md.; Akil, Hazizan Md; Yahya, Sabrina M.; Rahman, Norafifah A.
2018-05-01
Synthesis of silver nanoparticles has been developed by using aqueous leaves extract (ALE) of Hibiscus rosa sinensis (H. rosa sinensis) and Imperata cylindrica (I. cylindrica). Both plants extract acts as reducing and capping agent. The colour change in reaction mixture (pale yellow to dark brown) was observed during the synthesis process. The formation of silver nanoparticles was confirmed by surface Plasmon Resonance (SPR) at range 300-700 nm for both leaves using UV-Vis Spectroscopy. The reduction of silver ions to silver nanoparticles was completed within 2 hour for H. rosa sinensis and 30 minutes for I. cylindrica extract. The synthesized nanoparticles were characterized using UV-Vis spectroscopy, field emission scanning electron microscope (FESEM) and Fourier transform infrared (FTIR) spectroscopy. The morphology of silver nanoparticles was found to be different when synthesized using different plant extract. In addition, this study also reported on the effect of silver nanoparticles on the degradation of organic dye by sodium borohydride (NaBH4). The silver nanoparticles synthesis by aqueous leaf extract demonstrates rapid, simple and inexpensive method compared to the conventional physical and physical methods. The efficiency of silver nanoparticles as a promising candidate for the catalysis of organic dyes by NaBH4 through the electron transfer is established in the present study.
Energy Technology Data Exchange (ETDEWEB)
Bansal, M.P.; Nanda, K.K.
1981-01-01
In rooting tests with stem cuttings, IAA oxidase activity was found to be very high in Salix tetrasperma and Populus 'Robusta' both of which rooted profusely, less in Hibiscus rosa-sinensis which rooted but weakly and insignificant in Eucalyptus citriodora, which did not root at all. Proteins extracted from the stem cuttings of E. citriodora inhibited IAA oxidase activity, and also root formation on hypocotyl cuttings of Phaseolus mungo.
Five new Chinese hibiscus cultivars are products from a planned hibiscus breeding program conducted by the inventors at Poplarville, MS. The goal of the research is to produce new clones with a combination of desirable horticultural traits. Desirable floral traits include early bloom, uniform flower...
Desti
2018-05-01
The research about palynological study of pollen impacted by the haze of Hibiscus rosa-sinensis from Riau Province and its development as a teaching material for plant anatomy has been conducted in Biology Laboratory of Islamic University of Riau. The objective of this research is to find out of the pollen morphology of H. rosa-sinensis and the result of this study developed for teaching materials for plant anatomy subject. The method is descriptive. The analysis data used descriptive qualitative. The result showed that pollen has several characteristics which can be observed which is impacted by the haze. Pollen was observed is single pollen type, spheroidal sarcoid, polyphenoporate aperture type and exterior ornament. From result of research can be concluded that there is difference of pollen analysis between plant observed. Implication of research results in learning in the form of teaching materials for Plant Anatomy subject. Based on the validation results, it is known that the teaching materials that have been prepared can be used in the learning with percentage level achievement of 90.91% for teaching materials. The subject matter of Plant Anatomy which has been prepared based on the research result can be used in the learning process
Morus alba o Hibiscus rosa-sinensis como sustituto parcial de soya en dietas integrales para conejos
Directory of Open Access Journals (Sweden)
P. E. Lara
2012-01-01
Full Text Available Los conejos pueden aprovechar los nutrientes contenidos en los forrajes y subproductos agrícolas eficientemente gracias a la fermentación cecal y a la cecotrofía. Los objetivos del presente trabajo fueron: evaluar la tasa de crecimiento y el rendimiento de la canal en conejos alimentados con minibloques de harina de morera (Morus alba o tulipán (Hibiscus rosa-sinensis en sustitución parcial de pasta de soya; y determinar el consumo y digestibilidad de la dieta. Para esto, se utilizaron 18 conejos de 30 días de edad, distribuidos al azar en tres dietas experimentales (n=6, ac (alimento convencional, mbm (minibloque con 30% de morera y, mbt (minibloque con 27% de tulipán, durante nueve semanas. La ganancia diaria y el rendimiento en canal fue mejor (p0.10 en los tres grupos. Es factible sustituir parcialmente la proteína de la soya por harina de hojas de morera o tulipán, aunque presentan una menor respuesta productiva con respecto a la alimentación convencional.
International Nuclear Information System (INIS)
Saiful Irwan Zubairi; Haizulizam Suradi; Syazwan Aizad Abdul Mutalib; Zetty Shafiqa Othman; Norshahida Bustaman; Wan Ros Maryana Wan Musa
2014-01-01
Hibiscus rosa-sinensis or commonly known as 'Hibiscus' is a kind of decorative flowers which often grown in a subtropical countries. This plant is often used in the preparation of traditional medicine because of its pharmacological properties that are capable of treating number of health problems. The plant contains several essential bio-active substances and nutrients especially in its flowers and leaves. One of the bioactive substances is β-sitosterol which is abundant in the leaf crude extract. Hibiscus leaves water extract yielded mucilage which is widely used in lowering high body temperature due to fever (antipyretic). Therefore, the main objective of this paper was to determine the maximum concentration of mucilage and time of exhaustive extraction from fresh and dried leaves using a Peleq's mathematical model. Moreover, several analyses were conducted such as qualitative analysis to determine the presence of bioactive substances using high performance liquid chromatography (HPLC) and determination of functional groups by means of fourier transform infrared method (FTIR). Physical properties of the extracts were evaluated to determine its acidity and viscosity of the mucilage with respect to different shear stress. The result show that the extract of dried Hibiscus leaves exhibited high in its concentrations even though the achieved exhaustive extraction was relatively slow as compared to fresh leaves (p < 0.05). Based on the HPLC analysis, the main bio-active substances of β-sitosterol was only existed in fresh leaves samples. The absence of β-sitosterol in dried leaves extract was caused by the loss of other important bio-active substances which possess surfactant capability, due to thermal degradation of drying process or the component itself was deteriorated during the pre-preparation drying process. Furthermore, the FTIR analysis shows that the same composition of the absorption peaks for both extracts with the highest absorption of O-H bonds was
Trivellini, Alice; Ferrante, Antonio; Vernieri, Paolo; Serra, Giovanni
2011-01-01
The effect of the complex relationship between ethylene and abscisic acid (ABA) on flower development and senescence in Hibiscus rosa-sinensis L. was investigated. Ethylene biosynthetic (HrsACS and HrsACO) and receptor (HrsETR and HrsERS) genes were isolated and their expression evaluated in three different floral tissues (petals, style–stigma plus stamens, and ovaries) of detached buds and open flowers. This was achieved through treatment with 0.1 mM 1-aminocyclopropane-1-carboxylic acid (ACC) solution, 500 nl l−1 methylcyclopropene (1-MCP), and 0.1 mM ABA solution. Treatment with ACC and 1-MCP confirmed that flower senescence in hibiscus is ethylene dependent, and treatment with exogenous ABA suggested that ABA may play a role in this process. The 1-MCP impeded petal in-rolling and decreased ABA content in detached open flowers after 9 h. This was preceded by an earlier and sequential increase in ABA content in 1-MCP-treated petals and style–stigma plus stamens between 1 h and 6 h. ACC treatment markedly accelerated flower senescence and increased ethylene production after 6 h and 9 h, particularly in style–stigma plus stamens. Ethylene evolution was positively correlated in these floral tissues with the induction of the gene expression of ethylene biosynthetic and receptor genes. Finally, ABA negatively affected the ethylene biosynthetic pathway and tissue sensitivity in all flower tissues. Transcript abundance of HrsACS, HrsACO, HrsETR, and HrsERS was reduced by exogenous ABA treatment. This research underlines the regulatory effect of ABA on the ethylene biosynthetic and perception machinery at a physiological and molecular level when inhibitors or promoters of senescence are exogenously applied. PMID:21841180
Directory of Open Access Journals (Sweden)
Vinoth Kumar Megraj Khandelwal
2011-01-01
Full Text Available Hemidesmus indicus (L. R. Br. (HI and Hibiscus rosa-sinensis L. (HRS are widely used traditional medicine. We investigated cardioprotective effects of these plants applied for 15 min at concentrations of 90, 180, and 360 μg/mL in Langendorff-perfused rat hearts prior to 25-min global ischemia/120-min reperfusion (I/R. Functional recovery (left ventricular developed pressure—LVDP, and rate of development of pressure, reperfusion arrhythmias, and infarct size (TTC staining served as the endpoints. A transient increase in LVDP (32%–75% occurred at all concentrations of HI, while coronary flow (CF was significantly increased after HI 180 and 360. Only a moderate increase in LVDP (21% and 55% and a tendency to increase CF was observed at HRS 180 and 360. HI and HRS at 180 and 360 significantly improved postischemic recovery of LVDP. Both the drugs dose-dependently reduced the numbers of ectopic beats and duration of ventricular tachycardia. The size of infarction was significantly decreased by HI 360, while HRS significantly reduced the infarct size at all concentrations in a dose-dependent manner. Thus, it can be concluded that HI might cause vasodilation, positive inotropic effect, and cardioprotection, while HRS might cause these effects at higher concentrations. However, further study is needed to elucidate the exact mechanism of their actions.
Trubitsin, Boris V; Vershubskii, Alexey V; Priklonskii, Vladimir I; Tikhonov, Alexander N
2015-11-01
In this work, using the EPR and PAM-fluorometry methods, we have studied induction events of photosynthetic electron transport in Hibiscus rosa-sinensis leaves. The methods used are complementary, providing efficient tools for in situ monitoring of P700 redox transients and photochemical activity of photosystem II (PSII). The induction of P700(+) in dark-adapted leaves is characterized by the multiphase kinetics with a lag-phase, which duration elongates with the dark-adaptation time. Analyzing effects of the uncoupler monensin and artificial electron carrier methylviologen (MV) on photooxidation of P700 and slow induction of chlorophyll a fluorescence (SIF), we could ascribe different phases of transient kinetics of electron transport processes in dark-adapted leaves to the following regulatory mechanisms: (i) acceleration of electron transfer on the acceptor side of PSI, (ii) pH-dependent modulation of the intersystem electron flow, and (iii) re-distribution of electron fluxes between alternative (linear, cyclic, and pseudocyclic) pathways. Monensin significantly decreases a level of P700(+) and inhibits SIF. MV, which mediates electron flow from PSI to O2 with consequent formation of H2O2, promotes a rapid photooxidation of P700 without any lag-phase peculiar to untreated leaves. MV-mediated water-water cycle (H2O→PSII→PSI→MV→O2→H2O2→H2O) is accompanied by generation of ascorbate free radicals. This suggests that the ascorbate peroxidase system of defense against reactive oxygen species is active in chloroplasts of H. rosa-sinensis leaves. In DCMU-treated chloroplasts with inhibited PSII, the contribution of cyclic electron flow is insignificant as compared to linear electron flow. For analysis of induction events, we have simulated electron transport processes within the framework of our generalized mathematical model of oxygenic photosynthesis, which takes into account pH-dependent mechanisms of electron transport control and re-distribution of
Comparison of Antioxidative Activity among Different Types of Hibiscus
Uezu, Eiko; Fu, Churan; Kyan, Chie; Nago, Chihiro; 上江洲, 榮子; 付, 楚然; 喜屋武,千 恵; 名護, ちひろ
2013-01-01
Increased longevity among the population of Okinawa has led to considerable international interest in the role that the local diet and custom might play in this phenomenon. The research has indicated that flowers used for the food have potential health benefit. To explore their value as functional foods, the antioxidative properties of Hibiscus rosa-sinensis, which is the most common flower in Okinawa, was evaluated. The antioxidative activity of three types of the flower-red, orange, and yel...
Directory of Open Access Journals (Sweden)
Rinza Rahmawati Samsudin
2017-12-01
Tujuan penelitian ini adalah untuk mengetahui pengaruh bioaktifitas ekstrak bunga sepatu (Hibiscus rosa-sinensis l. terhadap kadar kolesterol darah mencit (Mus musculus yang mengalami hiperkolesterolemia dengan diet tinggi lemak. Penelitian ini merupakan penelitian eksperimental murni, dengan menggunakan rancangan randomized post-test only control group design. Bunga sepatu mengandung pigmen antosianin yang termasuk golongan flavonoid yang berperan sebagai antioksidan. Sebanyak dua puluh delapan mencit dibagi menjadi empat kelompok (K1, K2, K3 dan K4. Kelompok K1 adalah kelompok yang mendapat perlakukan pakan tinggi lemak dan aquadest setelah aklimatasi. Kelompok K2, K3, dan K4 adalah kelompok terapi yang mendapat perlakukan pakan tinggi lemak, ekstrak bunga septum sebanyak 1 ml dan aquadest setelah aklimatasi. Pemberian pakan tinggi lemak berlangsung selama 28 hari. Selama penelitian berlangsung penimbangan berat badan tikus dilakukan sebanyak lima kali. Hasil penelitian menunjukan bahwa pemberian 1 ml ekstrak bunga sepatu selama dua puluh delapan hari dapat menurunkan kadar kolesterol mencit dimana nilai p<0.05. Kata kunci: ekstrak bunga sepatu, kadar kolesterol, diet tinggi lemak
Colorimetric Analysis of Hibiscus Beverages and their Potential Antioxidant Properties.
Camelo-Méndez, G A; Vanegas-Espinoza, P E; Escudero-Gilete, M L; Heredia, F J; Paredes-López, O; Del Villar-Martínez, A A
2018-05-25
In food industry, roselle beverages and their subproducts could be functional ingredients since they are an excellent source of bioactive compounds with improved performance due to their important anthocyanins content. The aim of this study was to analyze anthocyanin content and antioxidant properties of aqueous infusions elaborated with color contrasting Hibiscus materials and design a mathematical model in order to predict color-composition relationship. Color measurements of beverages from roselle (Negra, Sudan and Rosa) were made by transmission spectrophotometry, anthocyanins quantification was determined by HPLC, and antioxidant potential was evaluated by in vitro methods (ABTS and FRAP assays). Beverages prepared with particle size minor of 250 μm presented until 4- and 2- times more anthocyanins content and antioxidant capacity respectively, in comparison to beverages prepared with powders with particle size major of 750 μm. Positive correlations among pigments composition and color parameters were found (p Hibiscus beverages with high anthocyanin content. The obtained models could be an important tool to be used in food industry for pigment characterization or functional compounds with potential health benefits.
Calidad seminal en ovinos pelibuey con inclusión de Hibiscus rosa-sinensis en la dieta
Directory of Open Access Journals (Sweden)
José Maza Gamboa
2015-01-01
Full Text Available La alimentación de los ovinos en el trópico representa del 48 a 90 % de los costos de producción, además, el uso de granos hace dependientes a los ovinocultores del mercado internacional. Ganancias de peso moderadas se han obtenido con follaje de plantas arbustivas, sin embargo, algunas plantas como el Tulipán (Hibiscus rosa-sinensis presentan compuestos que pueden actuar como fito-estrógenos, lo que puede comprometer el uso potencial en la alimentación de sementales ovinos pelibuey. Método: doce sementales ovinos Pelibuey, de 24±3 meses de edad, con un peso de 44±5 kg y una condición corporal de 2.3 +0.3 en una escala de 1 a 5 fueron asignados a 2 tratamientos (n=6 durante 45 días. En dietas con base en pasto de corte (Pennisetum purpureum x P. Typhoides var. CT-115, para el tratamiento 1 (T1, se utilizó alimento comercial (500 g d-1 por ovino con 16% de PC; y para el tratamiento 2 (T2, 20% de Tulipán (451 g MS/ kg MV, ~1.6 kg d-1 por ovino. Al finalizar la prueba se evaluó la calidad seminal, las variables de respuesta fueron: volumen del eyaculado (Vol, ml y a través del Análisis de Semen Asistido por Computadora (CASA la concentración espermática (CE, Millones por ml y ocho parámetros de motilidad individual: velocidad curvilínea (VCL, μ/s, velocidad rectilínea (VSL, μ/s, velocidad promedio (VAP, μ/s, índice de linealidad (LIN, %, índice de rectitud (STR, %, índice de oscilación (WOB, %, amplitud media del desplazamiento lateral de la cabeza (ALH, μ y frecuencia de batido de cola (BCF, Hz. Para determinar las diferencias entre las medias para tratamientos para Vol y CE, VCL, VSL y VAP se utilizó una t de Student; para los parámetros de motilidad individual se realizó una reducción de factores y una clasificación en dos fases de los índices obtenidos para caracterizar las subpoblaciones espermáticas por motilidad. Los análisis fueron realizados con el software SPSS 15.0 para Windows Resultados: no se
Biswas, S.; Kumbhakar, P.
2017-02-01
We have reported here, for the first time, to the best of our knowledge, a high nonlinear refractive index (n2e) of a natural pigment extracted from Hibiscus rosa-sinensis leaves by using spatial self-phase modulation technique (SSPM) with a low power CW He-Ne laser radiation at 632.8 nm. It is found by UV-Vis absorption spectroscopic analysis that chlrophyll-a, chlrophyll-b and carotenoid are present in the pigment extract with 56%, 25% and 19%, respectively. The photoluminescence (PL) emission characteristics of the extracted samples have also been measured at room temperature as well as in the temperature range of 283-333 K to investigate the effect of temperature on luminescent properties of the sample. By analyzing the SSPM experimental data, the nonlinear refractive index value of pigment extract has been determined to be 3.5 × 10- 5 cm2/W. The large nonlinear refractive index has been assigned due to asymmetrical structure, molecular reorientation and thermally induced nonlinearity in the sample. The presented results might open new avenues for the green and economical technique of syntheses of organic dyes with such a large nonlinear optical property.
Sarkar, Biswatrish; Kumar, Dhananjay; Sasmal, Dinakar; Mukhopadhyay, Kunal
2014-01-01
Anthocyanin extracts (AEs) from Ocimum tenuiflorum (leaf), Hibiscus rosa-sinensis (petal) and Hibiscus sabdariffa (calyx) were investigated and compared for in vitro antioxidant activity and DNA damage protective property. Total phenolic content (TPC) and total anthocyanin content (TAC) of the AEs were determined and the major anthocyanins were characterised. In vitro antioxidant activities were assessed by ferric-reducing antioxidant power (FRAP) assay, 2,2-diphenyl-1-picryl hydrazyl (DPPH) radical-scavenging activity, 2-deoxy-D-ribose degradation assay and lipid peroxidation assay. The protective property of the AEs was also examined against oxidative DNA damage by H2O2 and UV using pUC19 plasmid. All the AEs particularly those from O. tenuiflorum demonstrated efficient antioxidant activity and protected DNA from damage. Strong correlation between antioxidant capacity and TPC and TAC was observed. Significant correlation between antioxidant capacity and TPC and TAC ascertained that phenolics and anthocyanins were the major contributors of antioxidant activity.
Shen, Hui-Min; Chen, Chun; Jiang, Ji-Yang; Zheng, Yi-Lin; Cai, Wen-Feng; Wang, Bin; Ling, Zhen; Tang, Liu; Wang, Yuan-Hang; Shi, Gang-Gang
2017-02-23
Hibiscus rosa-sinensis L. (HRS), a folk medicine named Zhujin in China, possess anti-tumor, antioxidant, antibacterial, low density lipoprotein oxidation prevention and macrophage death prevention effects. The leaves and red flowers of HRS have been traditionally used to treat with furuncle and ulceration. To investigate the efficacy and possible mechanism of the N-butyl alcohol extract of HRS (NHRS) red flowers in wound healing by analyzing the collagen fiber deposition, angiogenic activity and macrophages action of the NHRS. In an excisional wound healing model in rats, different concentrations of NHRS, or recombinant bovine basic fibroblast growth factor (rbFGF), were respectively applied twice daily for 9 days. Histopathology was assessed on day 9 via hematoxylin and eosin (HE) and Masson's trichrome (MT) staining, and immunohistochemistry for vascular endothelial growth factor (VEGF), transforming growth factor-β1 (TGF-β1) and CD68. Immunomodulation by NHRS was evaluated by a carbon clearance test in mice. Wound healing post-surgery was greater in the rbFGF-control, NHRS-M and MHRS-H groups than in the model and 5% dimethylsulfoxide (DMSO)-control groups after the third day. By the sixth day the wound contraction of NHRS-M and MHRS-H groups was much higher than the rbFGF-control group. HE and MT staining revealed that epithelialization, fibroblast distribution, collagen deposition of NHRS-M- and NHRS-H-control groups were significantly higher than the model group. Moreover, immunohistochemistry showed more intense staining of VEGF, TGF-β1 and CD68 in the rbFGF- and NHRS-control groups, compared to that in model and 5% DMSO-control groups. The clearance and phagocytic indices of NHRS-M- and NHRS-H-control groups were significantly higher than that of the carboxyl methyl cellulose (CMC) group in mice. NHRS accelerates wound repair via enhancing the macrophages activity, accelerating angiogenesis and collagen fiber deposition response mediated by VEGF and TGF
Zheoat, Ahmed M.; Gray, Alexander I.; Igoli, John O.; Kennedy, Alan R.; Ferro, Valerie A.
2017-01-01
The biologically active title compounds have been isolated from Hibiscus sabdariffa plants, hibiscus acid as a dimethyl sulfoxide monosolvate [systematic name: (2S,3R)-3-hy?droxy-5-oxo-2,3,4,5-tetra?hydro?furan-2,3-di?carb?oxy?lic acid dimethyl sulfoxide monosolvate], C6H6O7?C2H6OS, (I), and hibiscus acid dimethyl ester [systematic name: dimethyl (2S,3R)-3-hy?droxy-5-oxo-2,3,4,5-tetra?hydro?furan-2,3-di?carboxyl?ate], C8H10O7, (II). Compound (I) forms a layered structure with alternating laye...
Sortiment Hibiscus in beweging
Hoffman, M.H.A.
2010-01-01
Hibiscus is hot. Op Plantarium 2009 werden maar liefst acht nieuwe cultivars ter keuring aangeboden. Bovendien winnen de laatste jaren ook andere soorten dan de bekende Hibiscus syriacus aan populariteit
Studies on mutation breeding of hibiscus Syriacus
International Nuclear Information System (INIS)
Song, Heui Sub; Lee, Ki Woon; Im, Yong Taek
1994-12-01
Hibiscus(Hibiscus syracuse L.) has been know as a national flower of Korea science old times. Although there are some ancient records that the Hibiscus had been planted in large quantities in Korea, Japanese had dug out all the good plants of Hibiscus in this country during their colonial period. But Hibiscus has such a characteristics of self-incompatibility that all the plants exist as a hybrid naturally and have heterogeneous genes. Therefore many good characters can be taken out from the surviving plants. Many domestic 78 varieties of Hibiscus syracuse were collected and propagated 26 varieties cuttings. Radiosensitivity of gamma-ray irradiated Hibiscus syracuse were investigated the germination rate, survival rate, plant height was with the increase of 4 kR better than control. The radiation doses of 10-12 kR are recommended for mutation breeding of Hibiscus. 6 figs, 11 tabs, 41 refs. (Author)
Studies on mutation breeding of hibiscus Syriacus
Energy Technology Data Exchange (ETDEWEB)
Song, Heui Sub; Lee, Ki Woon; Im, Yong Taek [Korea Atomic Energy Research Institute, Taejon (Korea, Republic of)
1994-12-01
Hibiscus(Hibiscus syracuse L.) has been know as a national flower of Korea science old times. Although there are some ancient records that the Hibiscus had been planted in large quantities in Korea, Japanese had dug out all the good plants of Hibiscus in this country during their colonial period. But Hibiscus has such a characteristics of self-incompatibility that all the plants exist as a hybrid naturally and have heterogeneous genes. Therefore many good characters can be taken out from the surviving plants. Many domestic 78 varieties of Hibiscus syracuse were collected and propagated 26 varieties cuttings. Radiosensitivity of gamma-ray irradiated Hibiscus syracuse were investigated the germination rate, survival rate, plant height was with the increase of 4 kR better than control. The radiation doses of 10-12 kR are recommended for mutation breeding of Hibiscus. 6 figs, 11 tabs, 41 refs. (Author).
James A. Allen
2002-01-01
The genus Hibiscus includes about 200 species distributed primarily in the tropical and subtropical regions of the world. It is a highly variable genus, with relatively few characteristics in common (Wagner and others 1990). Hibiscus tiliaceus is one of the most widespread species in the genus, with a pantropical, mainly...
Zheoat, Ahmed M; Gray, Alexander I; Igoli, John O; Kennedy, Alan R; Ferro, Valerie A
2017-09-01
The biologically active title compounds have been isolated from Hibiscus sabdariffa plants, hibiscus acid as a dimethyl sulfoxide monosolvate [systematic name: (2 S ,3 R )-3-hy-droxy-5-oxo-2,3,4,5-tetra-hydro-furan-2,3-di-carb-oxy-lic acid dimethyl sulfoxide monosolvate], C 6 H 6 O 7 ·C 2 H 6 OS, (I), and hibiscus acid dimethyl ester [systematic name: dimethyl (2 S ,3 R )-3-hy-droxy-5-oxo-2,3,4,5-tetra-hydro-furan-2,3-di-carboxyl-ate], C 8 H 10 O 7 , (II). Compound (I) forms a layered structure with alternating layers of lactone and solvent mol-ecules, that include a two-dimensional hydrogen-bonding construct. Compound (II) has two crystallographically independent and conformationally similar mol-ecules per asymmetric unit and forms a one-dimensional hydrogen-bonding construct. The known absolute configuration for both compounds has been confirmed.
International Nuclear Information System (INIS)
Gingasu, D.; Mindru, I.; Patron, L.; Caleron-Moreno, J.M.; Mocioiu, O.C.; Preda, S.; Stanica, N.; Nita, S.; Dobre, N.; Popa, M.; Gradisteanu, G.; Chifiriuc, M. C.
2016-01-01
The cobalt ferrite (CoFe_2O_4) and silver-cobalt ferrite (Ag-CoFe_2O_4) nanoparticles were obtained through self-combustion and wet ferritization methods using aqueous extracts of Hibiscus rosa-sinensis flower and leaf. X-ray diffraction, scanning electron microscopy, Fourier transform infrared spectroscopy, and magnetic measurements were used for the characterization of the obtained oxide powders. The antimicrobial activity of the cobalt ferrite and silver-cobalt ferrite nanoparticles against Gram-positive and Gram-negative bacteria, as well as fungal strains, was investigated by qualitative and quantitative assays. The most active proved to be the Ag-CoFe_2O_4 nanoparticles, particularly those obtained through self-combustion using hibiscus leaf extract, which exhibited very low minimal inhibitory concentration values (0.031-0.062 mg/ml) against all tested microbial strains, suggesting their potential for the development of novel antimicrobial agents.
Directory of Open Access Journals (Sweden)
Dana Gingasu
2016-01-01
Full Text Available The cobalt ferrite (CoFe2O4 and silver-cobalt ferrite (Ag-CoFe2O4 nanoparticles were obtained through self-combustion and wet ferritization methods using aqueous extracts of Hibiscus rosa-sinensis flower and leaf. X-ray diffraction, scanning electron microscopy, Fourier transform infrared spectroscopy, and magnetic measurements were used for the characterization of the obtained oxide powders. The antimicrobial activity of the cobalt ferrite and silver-cobalt ferrite nanoparticles against Gram-positive and Gram-negative bacteria, as well as fungal strains, was investigated by qualitative and quantitative assays. The most active proved to be the Ag-CoFe2O4 nanoparticles, particularly those obtained through self-combustion using hibiscus leaf extract, which exhibited very low minimal inhibitory concentration values (0.031–0.062 mg/mL against all tested microbial strains, suggesting their potential for the development of novel antimicrobial agents.
Directory of Open Access Journals (Sweden)
C. R. Sahu
2016-01-01
Full Text Available Piroxicam is one of the important therapeutic nonsteroidal anti-inflammatory class of drugs used mainly to suppress pain and inflammation in arthritis and other musculoskeletal disorders. Besides being anti-inflammatory, these drugs are analgesic and antipyretic often used for the relief of nonspecific fever condition. Recently, piroxicam has also gained attention as an effective therapy for tumors, colorectal, and invasive bladder cancers. The objective of the current study is to evaluate the protective effects of the alcoholic leaf extract of Hibiscus rosa-sinensis (AEH, Malvaceae, against piroxicam-induced toxicity in mice. Sixty adult Swiss albino mice ( Mus musculus were divided into four groups ( n = 10, which included a control group, a group treated orally with AEH (30 mg kg –1 b.w. for 15 days, a group treated orally with piroxicam (6.6 mg kg –1 b.w. for 15 days, and another group treated orally with piroxicam and AEH for 15 days. The results indicated that treatment with piroxicam alone resulted in a significant increase in the activities of serum marker enzymes, namely, aspartate transaminase, alanine transaminase, and alkaline phosphatase with profound hepatic lipid peroxidation as evidenced by a marked increment in the level of thoibarbituric acid reactive substances along with a distinct diminution in reduced glutathoine content and various antioxidant enzymes such as superoxide dismutase, catalase, and glutathione peroxidase in the liver. However, treatment with AEH during piroxicam treatment retrieved or partially antagonized the effects induced by piroxicam toward the normal values of controls. Histopathological observations also corroborate with the above findings. It can be concluded that AEH exhibited a protective action against piroxicam toxicity and effective in combating oxidative stress-induced hepatic damage.
Salvator Rosa e Napoli / Salvator Rosa and Naples
Directory of Open Access Journals (Sweden)
Daniela De Liso
2017-12-01
Full Text Available Salvator Rosa (Napoli, 1615- Roma 1673 fu pittore e poeta tra i più interessanti del secolo diciassettesimo. Il saggio intende indagare il complesso rapporto artistico e personale che Rosa ebbe con la città di Napoli, in cui era nato e dalla quale era quasi fuggito quando era poco più che un ragazzo. Attraverso una lettura delle principali fonti biobibliografiche a lui contemporanee, di alcune delle sue tele, dei versi delle Satire e di stralci delle lettere che a Napoli dedicherà, s’intende sottolineare che della capitale del Meridione la scrittura e l’arte di Salvator Rosa sono in grado di restituirci un’immagine altra rispetto a quella topica di Napoli gentile, perla luminosa di quella Campania felix che proprio nel Seicento attrae pittori e poeti da ogni parte d’Europa. Nei versi di Rosa, come nella scrittura in prosa, Napoli è, infatti, croce e delizia, prigione da cui fuggire e porto di quell’agognato ritorno che, al di là delle leggendarie asserzioni di alcuni biografi romantici, mai avverrà. Salvator Rosa (Naples, 1615- Rome, 1673 was a painter and poet among the most interesting of the seventeenth century. The essay intends to investigate the complex artistic and personal relationship that Rosa had with the city of Naples, where she was born and from which she had fled when she was little more than a boy. Through a reading of the main biobibliographic sources to him contemporary, some of his canvases, the verses of the Satire and the excerpts of the letters that Naples will dedicate, it is meant to point out that in the capital of the South the writing and art of Salvator Rosa are Able to give us an image other than the topical one of Napoli's kind, bright pearl of the Campania felix that in the seventeenth century attracts painters and poets from all over Europe. In the lines of Rosa, as in prose writing, Naples is, in fact, a cross and delight, a prison from which to flee and bring about that auspicious return that
Sreedevi, Gudapati; Prasad, Yenumula Gerard; Prabhakar, Mathyam; Rao, Gubbala Ramachandra; Vennila, Sengottaiyan; Venkateswarlu, Bandi
2013-01-01
Temperature-driven development and survival rates of the mealybug, Phenacoccussolenopsis Tinsley (Hemiptera: Pseudococcidae) were examined at nine constant temperatures (15, 20, 25, 27, 30, 32, 35 and 40°C) on hibiscus ( Hibiscus rosa -sinensis L.). Crawlers successfully completed development to adult stage between 15 and 35°C, although their survival was affected at low temperatures. Two linear and four nonlinear models were fitted to describe developmental rates of P . solenopsis as a function of temperature, and for estimating thermal constants and bioclimatic thresholds (lower, optimum and upper temperature thresholds for development: Tmin, Topt and Tmax, respectively). Estimated thresholds between the two linear models were statistically similar. Ikemoto and Takai’s linear model permitted testing the equivalence of lower developmental thresholds for life stages of P . solenopsis reared on two hosts, hibiscus and cotton. Thermal constants required for completion of cumulative development of female and male nymphs and for the whole generation were significantly lower on hibiscus (222.2, 237.0, 308.6 degree-days, respectively) compared to cotton. Three nonlinear models performed better in describing the developmental rate for immature instars and cumulative life stages of female and male and for generation based on goodness-of-fit criteria. The simplified β type distribution function estimated Topt values closer to the observed maximum rates. Thermodynamic SSI model indicated no significant differences in the intrinsic optimum temperature estimates for different geographical populations of P . solenopsis . The estimated bioclimatic thresholds and the observed survival rates of P . solenopsis indicate the species to be high-temperature adaptive, and explained the field abundance of P . solenopsis on its host plants. PMID:24086597
'Lufkin Red' and 'Lufkin White' winter-hardy hibiscus (Hibiscus x laevis All.)
USDA ARS announces the release of ‘Lufkin Red’ and ‘Lufkin White’ winter-hardy native hibiscuses.Both clones have desirable horticultural traits in combination with demonstrated high levels of field resistance to the leaf spot complex that is problematic on winter-hardy hibiscus clones in areas wit...
Rosa red, Rosa eagle: simply Rosa Luxemburgo
Directory of Open Access Journals (Sweden)
Beatriz Rajland
2010-10-01
Full Text Available Rosa Luxemburgo was a complete revolutionary in her theoretical production and action. An internationalist, she was a communist in action and in participatory thinking, who was dedicated to defending working class interests, with a constant concerned for liberty, democracy, complete development and for fighting bureaucracy. She was distinguished for not accepting traditional formulas, while remaining very rigorous with herself, never ceasing to reformulate her ideas and actions, which in her understanding, had a special value in a liberating political struggle. Today, the ?battle of ideas? acquires a very important place in Latin America and the Caribbean, as basic support in the articulation of the social and political realms, and the construction of a future of emancipation, of which Rosa Luxemburgo was a pioneer.
Hibiscus acetosella 'Sahara Sunset'
The Agricultural Research Service, United States Department of Agriculture, hereby release to nurserymen a new African Hibiscus, Hibiscus acetosella Welw. ex Hiern., named ‘Sahara Sunset’. This cultivar, tested as HAC06-11 was selected from a group seedlings grown at the Thad Cochran Southern Horti...
... uterus; reduce swelling; and work like antibiotics to kill bacteria and worms. ... Herbs and supplements that might lower blood pressureHibiscus may lower blood pressure. Using it along with other ...
Directory of Open Access Journals (Sweden)
Melissa Agüero
2014-01-01
Full Text Available Las tisanas de rosa de Jamaica (Hibiscus sabdariffa son consumidas en Costa Rica por su conocido efecto cardioprotector asociado a la presencia de compuestos fenólicos, principalmente antocianinas. Este trabajo estableció diferencias en el perfil de compuestos fenólicos y su actividad anti-radical entre diferentes comercializadores de tisanas de Hibiscus sabdariffa en Costa Rica. Se identificaron cualitativamente taninos, flavonoides y antocianinas. Se cuantificó la cantidad total de compuestos fenólicos por el método de Folin-Ciocalteu y se cuantificó la actividad antioxidante con el método de DPPH. Todas las marcas comerciales demostraron presencia de compuestos fenólicos, incluyendo antocianinas; sin embargo, se encontraron diferencias significativas en el contenido de compuestos fenólicos y actividad anti-radical, entre los diferentes productores de tisanas. Por ello, se concluye que en el mercado costarricense, el perfil en compuestos fenólicos de las tisanas en estudio varía de acuerdo con el productor.
Studies on mutant breeding of Hibiscus syriacus
International Nuclear Information System (INIS)
Song, Hi Sup; Kim, Jin Kyu; Lee, Ki Un; Kim, Young Taik.
1997-01-01
Hibiscus has been known as a national flower of Korea. Hibiscus has such a characteristic of self-incompatibility that all the plant exist as natural hybrids and have heterogeneous genes. Many domestic 91 varieties of Hibiscus syriacus were collected. Radiosensitivity of H. Syriacus irradiated with γ-ray was investigated in plant cuttings. The plant height was reduced by 45% in 5KR irradiated group, compared to control group. The radiation dose of 5KR could be recommended for mutation breeding of Hibiscus cuttings. Radiosensitivity of γ-ray irradiated Hibiscus seed were investigated. The germination rate, survival rate and plant height was better in the 4KR irradiation plot than control. The radiation dose of 10∼12KR are recommended for mutation breeding of Hibiscus. Promising mutant lines were selected form the varieties of Hwarang, Wolsan no. 176, Ilpyondansim, Emille, Hanol, Yongkwang, Saeyongkwang, Chungmu, Imjinhong, Arang, Hungdansim-1 and Hongdansim-2. (author). 66 refs., 16 tabs., 13 figs
Studies on mutant breeding of Hibiscus syriacus
Energy Technology Data Exchange (ETDEWEB)
Song, Hi Sup; Kim, Jin Kyu; Lee, Ki Un; Kim, Young Taik
1997-01-01
Hibiscus has been known as a national flower of Korea. Hibiscus has such a characteristic of self-incompatibility that all the plant exist as natural hybrids and have heterogeneous genes. Many domestic 91 varieties of Hibiscus syriacus were collected. Radiosensitivity of H. Syriacus irradiated with {gamma}-ray was investigated in plant cuttings. The plant height was reduced by 45% in 5KR irradiated group, compared to control group. The radiation dose of 5KR could be recommended for mutation breeding of Hibiscus cuttings. Radiosensitivity of {gamma}-ray irradiated Hibiscus seed were investigated. The germination rate, survival rate and plant height was better in the 4KR irradiation plot than control. The radiation dose of 10{approx}12KR are recommended for mutation breeding of Hibiscus. Promising mutant lines were selected form the varieties of Hwarang, Wolsan no. 176, Ilpyondansim, Emille, Hanol, Yongkwang, Saeyongkwang, Chungmu, Imjinhong, Arang, Hungdansim-1 and Hongdansim-2. (author). 66 refs., 16 tabs., 13 figs.
Ethnomedicines used in Trinidad and Tobago for reproductive problems.
Lans, Cheryl
2007-03-15
, Capraria biflora, Cordia curassavica, Croton gossypifolius, Entada polystachya, Leonotis nepetaefolia, Eryngium foetidum, Aristolochia rugosa, Aristolochia trilobata and Ambrosia cumanenesis. Native Caribbean plants have been less studied that those from Africa, India and Europe. Chamaesyce hirta has scientific support but as a diuretic. Other plants with level 3 validity for reproductive issues are: Achyranthes indica, Coleus aromaticus, Hibiscus rosa-sinesis, Parthenium hysterophorus and Ruta graveolens. The non-experimental validation method can be used to advise the public on which plants are safe, effective and useful, and which are not; pending clinical trials. This is especially important since so few clinical trials are conducted on Caribbean plants.
African Journal of Biotechnology - Vol 13, No 18 (2014)
African Journals Online (AJOL)
Microbial composition of guava (Psidium guajava), hibiscus (Hibiscus-rosa sinensis), mango (Mangifera indica) and pumpkin (Telfairia occidentalis Hook) phyllosphere · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. CB Chikere, CC Azubuike ...
Mujica Puntilla, Ramón; Brading, David A.; Saranyana, Josep Ignasi
2013-01-01
Rosa limensis es un ensayo interdisciplinario de historia cultural que resalta los orígenes religiosos del nacionalismo peruano. Basaso en los expedientes inéditos del proceso ordinario (1617-1618) y apostólico (1630-1632) de beatificación y canonizacíon, el libro analiza el universo místico y visionario de santa Rosa de Lima (1586-1617), la primera santa america. Pese a haber sido cuestionada por la Inquisición limeña e identificada con las herterodoxias alumbradistas españolas, aquí se rast...
ROSA full-core and DNBR capabilities
International Nuclear Information System (INIS)
Gibcus, H.P.M.; Verhagen, F.C.M.; Wakker, P.H.
2013-01-01
The latest developments of the ROSA (Reloading Optimization by Simulated Annealing) code system with an emphasis on the first full-core version and the minimum DNBR (Departure from Nucleate Boiling Ratio) as a new optimization parameter are presented. Designing the core loading pattern of nuclear power plants is becoming a more and more complex task. This task becomes even more complicated if asymmetries in the core loading pattern arise, for instance due to damaged fuel assemblies. For over almost 2 decades ROSA, NRG's (Nuclear Research and consultancy Group) loading pattern optimization code system for PWRs, has proven to be a valuable tool to reactor operators in accomplishing this task. To improve the use of ROSA for designing asymmetric loading patterns, NRG has developed a full-core version of ROSA besides the original quarter-core version which requires rotational symmetry in the computational domain. The extension of ROSA with DNBR as an optimization parameter is part of ROSA's continuous development. (orig.)
ROSA full-core and DNBR capabilities
International Nuclear Information System (INIS)
Gibcus, H.P.M.; Verhagen, F.C.M.; Wakker, P.H.
2012-01-01
This paper presents the latest developments of the ROSA (Reloading Optimization by Simulated Annealing) code system with an emphasis on the first full-core version and the minimum DNBR (Departure from Nucleate Boiling Ratio) as a new optimization parameter. Designing the core loading pattern of nuclear power plants is becoming a more and more complex task. This task becomes even more complicated if asymmetries in the core loading pattern arise, for instance due to damaged fuel assemblies. For over almost two decades ROSA, NRG's (Nuclear Research and consultancy Group) loading pattern optimization code system for PWRs, has proven to be a valuable tool to reactor operators in accomplishing this task. To improve the use of ROSA for designing asymmetric loading patterns, NRG has developed a full-core version of ROSA besides the original quarter-core version which requires rotational symmetry in the computational domain. The extension of ROSA with DNBR as an optimization parameter is part of ROSA's continuous development. (orig.)
Effect of Hibiscus sabdariffa on obesity in MSG mice.
Alarcon-Aguilar, Francisco J; Zamilpa, Alejandro; Perez-Garcia, Ma Dolores; Almanza-Perez, Julio C; Romero-Nuñez, Eunice; Campos-Sepulveda, Efrain A; Vazquez-Carrillo, Laura I; Roman-Ramos, Ruben
2007-10-08
The aim of the present investigation was determine whether a standardized Hibiscus sabdariffa calyces aqueous extract has an effect on body weight in an obese animal model induced by the administration of monosodium glutamate. Hibiscus sabdariffa aqueous extract, containing 33.64 mg of total anthocyanins per each 120 mg of extract, was orally administered (120 mg/kg/day) for 60 days to healthy and obese mice, and body weight gain, food and liquid intake, aspartate aminotransferase (AST), alanine aminotransferase (ALT), cholesterol, and triglycerides levels were measured. Hibiscus sabdariffa administration significantly reduced body weight gain in obese mice and increased liquid intake in healthy and obese mice. ALT levels were significantly increased on the 15th and 45th days in obese mice, but AST levels did not show significant changes. Mortality was not observed in the Hibiscus sabdariffa treated groups. Triglycerides and cholesterol levels showed non-significant reductions in animals treated with Hibiscus sabdariffa. Our data confirm the anti-obesity effect of Hibiscus sabdariffa reported by the Mexican population.
Estado nutrimental del agroecosistema rosa (Rosa spp. en la ladera este del Iztaccíhuatl
Directory of Open Access Journals (Sweden)
Steinger Cortés Jiménez
2017-07-01
Full Text Available Aproximadamente 3000 ha se encuentran plantadas con rosas (Rosa spp. en el estado de Puebla. El valor estimado generado por esta actividad es 625 millones de pesos y permite incorporar a la mujer a la economía regional. El uso de fertilización nitrogenada en rosa de corte, mayor a 7000 kg ha-1, es excesiva y afecta la salud del suelo y la economía de los productores. Los objetivos del trabajo fueron: (1 evaluar el estado actual de la fertilidad de los suelos en la zona de producción de rosa del DDR 05 San Martín Texmelucan y (2 estudiar el efecto del aporte de tres fuentes de materia orgánica en la producción, calidad y estado nutrimental de tres variedades de rosas, así como en la condición física de los suelos. Para ello se evaluaron algunas propiedades químicas en muestras de suelo de 112 invernaderos localizados en cuatro unidades edafoclimáticas. Se usaron tres tipos de materia orgánica (MO: compost comercial, estiércol de bovino y gallinaza y tres variedades de rosa: Anastasia, Selena y Latin. El diseño fue completamente al azar modificado y se realizaron análisis de varianza y comparaciones de medias. Los suelos presentaron condiciones de fertilidad contrastantes. La gallinaza aumentó el rendimiento en la variedad Anastasia y el compost en la variedad Selena. La calidad de las tres variedades de rosas aumentó con el aporte de las tres fuentes de MO a los tres meses, pero disminuyó a los nueve meses. Las tres fuentes de MO aportaron niveles similares de macroelementos a la planta y mejoraron la condición física del suelo al aumentar el porcentaje de macroagregados en todos los tratamientos. El mayor porcentaje de macroagregados se obtuvo por la adición de compost en los suelos con las variedades Anastasia y Selena. Los suelos de los invernaderos del agrosistema rosa (Rosa spp. presentaron características químicas y condiciones de fertilidad contrastantes, producto de una variabilidad edafoclimática. Las fuentes de
Direct genetic transformation of Hibiscus sabdariffa L.
African Journals Online (AJOL)
Administrator
After 60 days evaluation point, the assessment of the transformation by PCR revealed that H. sabdariffa line tested, carried the nptII gene. Key words: Hibiscus sabdariffa, genetic transformation. INTRODUCTION. Hibiscus sabdariffa is a crop widely cultivated in Sub. Saharan Africa, growing on sandy soils after the harvest.
Studies on mutation breeding of hibiscus syriacuse
Energy Technology Data Exchange (ETDEWEB)
Song, Hee Sub; Kim, Jin Kyu; Lee, Ki Un; Lim, Yong Taek [Korea Atomic Energy Research Institute, Taejon (Korea, Republic of)
1995-12-01
Hibiscus has been known as a national flower of Korea. Hibiscus has ahch a characteristic of self-incompatibility that all the plants exist as natural hybrids and have heterogeneous genes. Thirth two domestic varieties were propagated. Radiosensitivity of H. syriacus irradiated with gamma ray was investigated in plant cuttings. The plant height was reduced by 45 percent in 5 kR irradiated group compared to control group. The radiation dose of 5 kR could be rrecommended for mutation breeding of Hibiscus cuttings. Promising mutant lines were selected form the varieties of Hwarang Wolsan 176, I1pyondansim and Emille. 6 tabs., 2 figs., 13 refs., 4 ills. (Author).
Studies on mutation breeding of hibiscus syriacuse
International Nuclear Information System (INIS)
Song, Hee Sub; Kim, Jin Kyu; Lee, Ki Un; Lim, Yong Taek
1995-12-01
Hibiscus has been known as a national flower of Korea. Hibiscus has ahch a characteristic of self-incompatibility that all the plants exist as natural hybrids and have heterogeneous genes. Thirth two domestic varieties were propagated. Radiosensitivity of H. syriacus irradiated with gamma ray was investigated in plant cuttings. The plant height was reduced by 45 percent in 5 kR irradiated group compared to control group. The radiation dose of 5 kR could be rrecommended for mutation breeding of Hibiscus cuttings. Promising mutant lines were selected form the varieties of Hwarang Wolsan 176, I1pyondansim and Emille. 6 tabs., 2 figs., 13 refs., 4 ills. (Author)
[Molecular identification of Hibiscus syriacus and its adulterants using ITS2 barcode].
Liu, Yi-Mei; Jin, Li-Na; Xiong, Yong-Xin; Wu, Lan; Chen, Ke-Li
2014-03-01
To identify Hibiscus syriacus and its adulterants using DNA barcoding technique. Nine samples of five species were PCR amplified and sequenced, and twelve samples were downloaded from the GenBank. The intra-specific and interspecific K2P distances were calculated, and neighbor-joining( NJ) tree was constructed by MEGA 5.0. The results showed the intra-specific genetic distances of Hibiscus syriacus were ranged from 0.009 to 0.056, which were far lower than inter-specific genetic distances between Hibiscus syriacus and its adulterants (0.236 - 0.301). Variable sites within Hibiscus syriacus ranged from 2 to 9 which were far less than the adulterants (45 - 52); Different samples of Hibiscus syriacus were gathered together and could be distinguished from its adulterants by NJ tree. ITS2 can discriminate Hibiscus syriacus from its adulterants correctly. The ITS2 region is an efficient barcode for authentication of Hibiscus syriacus and its adulterants.
International Nuclear Information System (INIS)
Panagopoulos, I.; Bornman, J.F.; Björn, L.O.
1989-01-01
The effects of UV-C (254 nm) and UV-B (280-320 nm) on chlorophyll fluorescence induction and ultraweak luminescence (UL) in detached leaves of Hibiscus rosa-sinensis L. were investigated. UL from leaves exposed to UV-B and UV-C radiation reached a maximum 72 h after irradiation. In both cases most of the light was of a wavelength over 600 nm. An increase in the percentage of long wavelength light with time was detected. UV radiation increased peroxidase activity, which also reached a maximum 72 h after irradiation. UV-B and UV-C both reduced variable chlorophyll fluorescence. No effect on the amount of chlorophyll or UV screening pigments was observed with the short-term irradiation used in this investigation. (author)
Directory of Open Access Journals (Sweden)
Daniele Begmeier
2014-02-01
Full Text Available Current research investigates the extraction process of total polyphenols from hibiscus (Hibiscus sabdariffa L. and waxweed (Brazilian name: ‘sete-sangrias’ (Cuphea carthagenensis and evaluates the antioxidant potential of their extracts. The extraction stage comprised investigation on the following parameters: i solvents (acetone and ethanol pure and fractioned with water; ii variables (temperature, stirring, solvent ratio, time and pH. Total polyphenols were quantified by Folin-Ciocalteau reagent and antioxidant activity was determined by ABTS•+ (2,2′-Azino-bis(3-ethylbenzothiazoline-6-sulfonic acid and DPPH (2,2-diphenyl-1-picrylhydrazyl radical scavenging assay. Results showed that, depending on experimental conditions, total phenolic contents for hibiscus and waxweed ranged between 460.86 mg GAE 100 g-1 and 5012.54 mg GAE 100 g-1 and between 462.86 mg GAE 100 g-1 and 4215.99 mg GAE 100 g-1, respectively. Waxweed had a higher antioxidant activity when compared to that of hibiscus by both ABTS•+ and DPPH. Data showed that hibiscus and waxweed have a significant amount of polyphenols which may be extracted in mild processing conditions and then employed as natural antioxidant sources in industrial processes.
Changes in protein patterns and in vivo protein synthesis during senescence of hibiscus petals
International Nuclear Information System (INIS)
Woodson, W.R.; Handa, A.K.
1986-01-01
Changes in proteins associated with senescence of the flowers of Hibiscus rosa-sinensis was studied using SDS-PAGE. Total extractable protein from petals decreased with senescence. Changes were noted in patterns of proteins from aging petals. Flower opening and senescence was associated with appearance and disappearance of several polypeptides. One new polypeptide with an apparent mw of 41 kd was first seen the day of flower opening and increased to over 9% of the total protein content of senescent petal tissue. Protein synthesis during aging was investigated by following uptake and incorporation of 3 H-leucine into TCA-insoluble fraction of petal discs. Protein synthesis, as evidenced by the percent of label incorporated into the TCA-insoluble fraction, was greatest (32%) the day before flower opening. Senescent petal tissue incorporated 4% of label taken up into protein. Proteins were separated by SDS-PAGE and labelled polypeptides identified by fluorography. In presenescent petal tissue, radioactivity was distributed among several major polypeptides. In senescent tissue, much of the radioactivity was concentrated in the 41 kd polypeptide
Antioxidant and drug detoxification potentials of Hibiscus sabdariffa anthocyanin extract.
Ajiboye, Taofeek O; Salawu, Nasir A; Yakubu, Musa T; Oladiji, Adenike T; Akanji, Musbau A; Okogun, Joseph I
2011-04-01
The antioxidant and drug metabolizing potentials of Hibiscus anthocyanin extract in CCl(4)- induced oxidative damage of rat liver was investigated. Hibiscus anthocyanin extract effectively scavenge α-diphenyl-β-picrylhydrazyl (DPPH) radical, superoxide ion, and hydrogen peroxide. It produced a 92% scavenging effect of DPPH radical at a concentration of 2.0 mg/mL. Hibiscus anthocyanin extract produced a 69 and 90% scavenging effect on superoxide ion and hydrogen peroxide, respectively, at 1.0 mg/mL, which compared favorably with the synthetic antioxidant (butylated hydroanisole and α-tocopherol). A reducing power of this anthocyanin was examined using K(3)Fe(CN)(6). Hibiscus anthocyanin extract has reducing power that is approximately 2-fold that of the synthetic antioxidant, butylated hydroanisole. Hibiscus anthocyanin extract produced a significantly increase and completely attenuated the CCl(4)-mediated decrease in antioxidant enzymes (e.g., catalase, superoxide dismutase, glutathione peroxidase, and glutathione reductase). However, the level of nonenzymic antioxidant molecules (i.e., vitamins C and E) were significant preserved by Hibiscus anthocyanin extract. There was an induction of phase II drug-detoxifying enzymes: glutathione S-transferase, NAD(H):quinone oxidoreductase, and uridyl diphosphoglucuronosyl transferase by 65, 45, and 57%, respectively. In view of these properties, Hibiscus sabdariffa anthocyanin extract can act as a prophylactic by intervening as a free radical scavenger both in vitro and in vivo as well as inducing the phase II drug detoxification enzymes.
Ethnomedicines used in Trinidad and Tobago for reproductive problems
Directory of Open Access Journals (Sweden)
Lans Cheryl
2007-03-01
hysterophorus, Wedelia trilobata, Abelmoschus moschatus, Capraria biflora, Cordia curassavica, Croton gossypifolius, Entada polystachya, Leonotis nepetaefolia, Eryngium foetidum, Aristolochia rugosa, Aristolochia trilobata and Ambrosia cumanenesis. Conclusion Native Caribbean plants have been less studied that those from Africa, India and Europe. Chamaesyce hirta has scientific support but as a diuretic. Other plants with level 3 validity for reproductive issues are: Achyranthes indica, Coleus aromaticus, Hibiscus rosa-sinesis, Parthenium hysterophorus and Ruta graveolens. The non-experimental validation method can be used to advise the public on which plants are safe, effective and useful, and which are not; pending clinical trials. This is especially important since so few clinical trials are conducted on Caribbean plants.
African Journals Online (AJOL)
AISA
Roselle (Hibiscus sabdariffa L.) is a malvaceae cultivated mainly for food and manufacture of textile fibers. ... confection d'un jus délicieux appelé « bissap » ... sorgho. La production africaine ne représente qu'environ 2 % de la production mondiale de fibres textiles. Les travaux conduits sur cette plante en Afrique ont ...
La España de Rosas Blancas = The Spain of Rosas Blancas
Directory of Open Access Journals (Sweden)
Óscar Gual Boronat
2015-06-01
Full Text Available Mediante la lectura del cuaderno femenino español Rosas blancas, publicado por la editorial Toray entre 1958 y 1965, tratamos de estudiar la capacidad del cómic para reflejar el papel de la mujer durante una de las etapas clave de la dictadura franquista. Tras trazar un recorrido por los tebeos sentimentales de la década de 1940 (Azucena y las primeras revistas modernas para niñas (Florita y Sissi, analizaremos el contenido de dicha publicación. En ese análisis percibiremos cómo Rosas blancas prolongará determinados mitos de aquellas historietas al tiempo que introducirá nuevas perspectivas en consonancia con lo que estaba sucediendo en la sociedad española.Through the reading of the Spanish female comic-book Rosas blancas, published by Editorial Toray between 1958 and 1965, we try to explore the ability of comics to reflect the role of women during the key stages of the Franco dictatorship. After a study of the sentimental comics of the 1940s (Azucena and the first modern magazines for girls (Florita and Sissi, we analyse the content of this publication. In this analysis we perceive how Rosas blancas extend certain myths while those cartoons introduce new perspectives in line with what was happening in the Spanish society.
Afshari, Kasra; Samavati, Vahid; Shahidi, Seyed-Ahmad
2015-03-01
The effects of ultrasonic power, extraction time, extraction temperature, and the water-to-raw material ratio on extraction yield of crude polysaccharide from the leaf of Hibiscus rosa-sinensis (HRLP) were optimized by statistical analysis using response surface methodology. The response surface methodology (RSM) was used to optimize HRLP extraction yield by implementing the Box-Behnken design (BBD). The experimental data obtained were fitted to a second-order polynomial equation using multiple regression analysis and also analyzed by appropriate statistical methods (ANOVA). Analysis of the results showed that the linear and quadratic terms of these four variables had significant effects. The optimal conditions for the highest extraction yield of HRLP were: ultrasonic power, 93.59 W; extraction time, 25.71 min; extraction temperature, 93.18°C; and the water to raw material ratio, 24.3 mL/g. Under these conditions, the experimental yield was 9.66±0.18%, which is well in close agreement with the value predicted by the model 9.526%. The results demonstrated that HRLP had strong scavenging activities in vitro on DPPH and hydroxyl radicals. Copyright © 2014 Elsevier B.V. All rights reserved.
Isolation and Characterization of Anthocyanins from Hibiscus sabdariffa Flowers.
Grajeda-Iglesias, Claudia; Figueroa-Espinoza, Maria C; Barouh, Nathalie; Baréa, Bruno; Fernandes, Ana; de Freitas, Victor; Salas, Erika
2016-07-22
The intense red-colored Hibiscus sabdariffa flowers are an inexpensive source of anthocyanins with potential to be used as natural, innocuous, and health-beneficial colorants. An anthocyanin-rich extract from hibiscus flowers was obtained by ultrasound-assisted extraction. By a single-step process fractionation using a Sep-Pak C18 cartridge, the main hibiscus anthocyanins, delphinidin-3-O-sambubioside (Dp-samb) and cyanidin-3-O-sambubioside (Cy-samb), were separated and then characterized via NMR and HPLC-ESIMS data. Since Dp-samb was the most abundant anthocyanin identified in the extract, its colorant properties were studied by the pH jumps method, which allowed the calculation of the single acid-base equilibrium (pK'a 2.92), the acidity (pKa 3.70), and the hydration constants (pKh 3.02). Moreover, by using size-exclusion chromatography, new cyanidin-derived anthocyanins (with three or more sugar units) were successfully identified and reported for the first time in the hibiscus extract.
Effects of aqueous extracts of Hibiscus sabdariffa calyces and ...
African Journals Online (AJOL)
The effects of aqueous extracts of the leaves of Ocimum gratissimum and calyces of Hibiscus sabdariffa on intestinal transit were determined in experimental rats The leaves of Ocimum gratissimum were oven dried and then pulverized. The dried calyces of Hibiscus sabdariffa were also pulverized. 10% extracts of both ...
Alarcón-Alonso, Javier; Zamilpa, Alejandro; Aguilar, Francisco Alarcón; Herrera-Ruiz, Maribel; Tortoriello, Jaime; Jimenez-Ferrer, Enrique
2012-02-15
Hibiscus sabdariffa L. (Malvaceae) populary known in Mexico as "Jamaica", "flor de Jamaica", has widely used in Mexican Traditional Medicine as antihypertensive and diuretic, although the latter activity has been reported the present work show evidence about the diuretic, natriuretic and potassium-sparing effects. To evaluate the diuretic activity of Hibiscus sabdariffa aqueous extract on in vivo and in situ models. The Hibiscus sabdariffa aqueous extract was administrated in increasing doses and evaluated the diuresis produced and disposal of electrolytes. Moreover, in isolated kidney was determined the renal filtration rate with plant extract, furosemide and amiloride. The yield of Hibiscus sabdariffa aqueous extraction was 28.3% and the chemical standardization from 1 g of extract was: 56.5 mg delphinidin-3-O-sambubioside, 20.8 mg/g cyanidin-3-O-sambubioside, 3.2 mg/g quercetin, 2.1 mg/g rutin and 2.7 mg/g chlorogenic acid. The diuretic and natriuretic effect of Hibiscus sabdariffa aqueous extract showed a dose-dependent behavior. The pharmacological constants of natriuretic effect was ED50=86 mg/kg and Emax=0.9 mEq/100 g/5 h. In the model of kidney in situ was observed that renal filtration increased 48% with the aqueous extract of Hibiscus sabdariffa and an additive effect when was perfuse with furosemide. The compound presents in Hibiscus sabdariffa as quercetin had effect on the vascular endothelium causing oxide nitric release, increasing renal vasorelaxation by increasing kidney filtration. Therefore, the diuretic effect of Hibiscus sabdariffa may be mediated by nitric oxide release. Copyright © 2011 Elsevier Ireland Ltd. All rights reserved.
Aendekerk, T.G.L.
2003-01-01
Onderzoek naar de invloed van pH en de voedingsoplossing op groeiafwijkingen bij Hibiscus. Gegevens in bijgaande tabellen: 1) Gebruikte voedingsoplossingen (waarden in mmol/l); 2) Beoordeling bij gebruikte voedingsoplossingen; 3) Optimale voedingsoplossingen (waarden in mmol/l) in twee periodes; 4)
Two New Disease-Resistant Hibiscus: 'Lufkin Red' and 'Lufkin White'
The Agricultural Research Service, United States Department of Agriculture, has released Hibiscus laevis ‘Lufkin Red’ and ‘Lufkin White’, two new hardy native ornamental hibiscus. These cultivars are recommended for trial by gardeners and horticulturists as summer flowering perennial landscape pl...
A review on phytochemistry and therapeutic uses of Hibiscus sabdariffa L.
Riaz, Ghazala; Chopra, Rajni
2018-06-01
Hibiscus sabdariffa L. (roselle) belonging to the Malvaceae family is widely grown in many countries. This plant is often used in the traditional medicine being rich in phytochemicals like polyphenols especially anthocyanins, polysaccharides and organic acids thus having enormous prospective in modern therapeutic uses. The study aimed to review and document all the available evidence and information about the calyces of Hibiscus sabdariffa (roselle) with the special focus on their nutritional composition, bioactive constituents and therapeutic uses. The electronic database was searched up to 2017, using keywords Hibiscus sabdariffa, chemical constituents of roselle, therapeutic uses of roselle. Journals, books and conference proceedings were also searched. The review provides valuable information about the nutraceutical component of Hibiscus sabdariffa L. and their utilization for curing various degenerative diseases like hypertension, hyperlipidemia, cancer and other inflammatory diseases of liver and kidney. Their toxicological effects have also been discussed from a safety point of view. Most studies supported and provided the scientific basis for the statement that Hibiscus sabdariffa and their active constituents play an important role in the prevention of chronic and degenerative diseases that are associated with oxidative stress. Our study suggests, that good research is needed, to establish a potential strategy that can balance the pharmacological and toxic effects of roselle and standardized fingerprint of Hibiscus sabdariffa is required internationally for quality control. Copyright © 2018 Elsevier Masson SAS. All rights reserved.
Economic optimization of PWR cores with ROSA
International Nuclear Information System (INIS)
Verhagen, F.C.M.; Wakker, P.H.
2005-01-01
The core-loading pattern is decisive for fuel cycle economics, fuel safety parameters and economic planning for future cycles. ROSA, NRG's loading pattern optimization code system for PWRs, has proven for over a decade to be a valuable tool to reactor operators for improving their fuel management economics. ROSA uses simulated annealing as loading pattern optimization technique, in combination with an extremely fast 3-D neutronics code for loading pattern calculations. The code is continuously extended with new optimization parameters and rules. This paper outlines recent developments of the ROSA code system and discusses results of PWR specific applications of ROSA. Core designs with a large variety of challenging constraints have been realized with ROSA. As a typical example, for the 193 assembly, Vantage 5H/RFA-2 fueled TVA's Watts Bar unit 1, a cycle 4 core with 76 feed assemblies was designed. This was followed by a high-energy cycle 5 with only 77 feed assemblies and approximately 535 days of natural cycle length. Subsequently, an economical core using 72 bundles was designed for cycle 6. This resulted in considerable savings in the cost of feed assemblies for reloads. The typical accuracy of ROSA compared to results of license codes in within ±0.02 for normalized assembly powers, ±0.03 for maximum enthalpy rise hot channel factor (F ΔH ), and ±3 days for natural cycle length. (author)
Effects of ultraviolet radiation on Hibiscus rosa-sinensis, Beta vulgaris and Helianthus annuus
Energy Technology Data Exchange (ETDEWEB)
Panagopoulos, I.
1992-12-31
It is believed that increased levels of ultraviolet B-radiation (UV-B;280-320 nm) will result in serious threat to plant. In the present study the effects of UV (particularly UV-B) were studied on chlorophyll fluorescence, ultraweak luminescence (UL) and plant growth. Parameters related to light emission were determined, and the effects of UV-B on hypocotyl elongation and levels of free IAA were examined. The plants were grown in greenhouse or in growth chambers and exposed to short or long term UV-B simulating different levels of ozone depletion. Short exposure of Hibiscus leaves to UV resulted in a gradual increase in both UL and peroxidase activity followed by a decline after 72 h and a decrease in variable chlorophyll fluorescence. The action of UV-B on sugar beet plants depended on light quality and irradiance and infection by Cercospora beticola Sacc. The interaction between UV-B and the disease resulted in a large reduction of dry weight and enhanced UL. The lowest Chl a and growth was found in plants grown under low irradiance and exposed to UV-B supplemented with UV-A (320-400 nm). UVB also inhibited photosystem II, increased UL and peroxidase activity. Under relatively high PAR, UV-B increased dry weight of laminae and UL but no effect on Chl content. Sugar beet plants grown with light depleted in the 320-400 nm region of the spectrum and exposed to UV-B died. Low levels of UV-B did neither affected hypocotyl elongation nor amounts of free IAA in sunflower plants grown under low (LL; 143 {mu}mol m{sup -2}s{sup -1}) or high PAR (HL; 800 {mu}mol m{sup -2}s{sup -1}). Three times more daily UV-B increased the amount of free IAA, but inhibited hypocotyl elongation. Higher F{sub v}/F{sub max} and F690/F735, Chl a and carotenoids were found in plants exposed to low UV-B. Indeed, UV-B can be harmful but may also have enhancing effects on plants. (au) (114 refs.).
Effects of ultraviolet radiation on Hibiscus rosa-sinensis, Beta vulgaris and Helianthus annuus
Energy Technology Data Exchange (ETDEWEB)
Panagopoulos, I.
1992-01-01
It is believed that increased levels of ultraviolet B-radiation (UV-B;280-320 nm) will result in serious threat to plant. In the present study the effects of UV (particularly UV-B) were studied on chlorophyll fluorescence, ultraweak luminescence (UL) and plant growth. Parameters related to light emission were determined, and the effects of UV-B on hypocotyl elongation and levels of free IAA were examined. The plants were grown in greenhouse or in growth chambers and exposed to short or long term UV-B simulating different levels of ozone depletion. Short exposure of Hibiscus leaves to UV resulted in a gradual increase in both UL and peroxidase activity followed by a decline after 72 h and a decrease in variable chlorophyll fluorescence. The action of UV-B on sugar beet plants depended on light quality and irradiance and infection by Cercospora beticola Sacc. The interaction between UV-B and the disease resulted in a large reduction of dry weight and enhanced UL. The lowest Chl a and growth was found in plants grown under low irradiance and exposed to UV-B supplemented with UV-A (320-400 nm). UVB also inhibited photosystem II, increased UL and peroxidase activity. Under relatively high PAR, UV-B increased dry weight of laminae and UL but no effect on Chl content. Sugar beet plants grown with light depleted in the 320-400 nm region of the spectrum and exposed to UV-B died. Low levels of UV-B did neither affected hypocotyl elongation nor amounts of free IAA in sunflower plants grown under low (LL; 143 [mu]mol m[sup -2]s[sup -1]) or high PAR (HL; 800 [mu]mol m[sup -2]s[sup -1]). Three times more daily UV-B increased the amount of free IAA, but inhibited hypocotyl elongation. Higher F[sub v]/F[sub max] and F690/F735, Chl a and carotenoids were found in plants exposed to low UV-B. Indeed, UV-B can be harmful but may also have enhancing effects on plants. (au) (114 refs.).
Effects of ultraviolet radiation on Hibiscus rosa-sinensis, Beta vulgaris and Helianthus annuus
International Nuclear Information System (INIS)
Panagopoulos, I.
1992-01-01
It is believed that increased levels of ultraviolet B-radiation (UV-B;280-320 nm) will result in serious threat to plant. In the present study the effects of UV (particularly UV-B) were studied on chlorophyll fluorescence, ultraweak luminescence (UL) and plant growth. Parameters related to light emission were determined, and the effects of UV-B on hypocotyl elongation and levels of free IAA were examined. The plants were grown in greenhouse or in growth chambers and exposed to short or long term UV-B simulating different levels of ozone depletion. Short exposure of Hibiscus leaves to UV resulted in a gradual increase in both UL and peroxidase activity followed by a decline after 72 h and a decrease in variable chlorophyll fluorescence. The action of UV-B on sugar beet plants depended on light quality and irradiance and infection by Cercospora beticola Sacc. The interaction between UV-B and the disease resulted in a large reduction of dry weight and enhanced UL. The lowest Chl a and growth was found in plants grown under low irradiance and exposed to UV-B supplemented with UV-A (320-400 nm). UVB also inhibited photosystem II, increased UL and peroxidase activity. Under relatively high PAR, UV-B increased dry weight of laminae and UL but no effect on Chl content. Sugar beet plants grown with light depleted in the 320-400 nm region of the spectrum and exposed to UV-B died. Low levels of UV-B did neither affected hypocotyl elongation nor amounts of free IAA in sunflower plants grown under low (LL; 143 μmol m -2 s -1 ) or high PAR (HL; 800 μmol m -2 s -1 ). Three times more daily UV-B increased the amount of free IAA, but inhibited hypocotyl elongation. Higher F v /F max and F690/F735, Chl a and carotenoids were found in plants exposed to low UV-B. Indeed, UV-B can be harmful but may also have enhancing effects on plants. (au) (114 refs.)
Decrease of Plasma Glucose by Hibiscus taiwanensis in Type-1-Like Diabetic Rats
Wang, Lin-Yu; Chung, Hsien-Hui
2013-01-01
Hibiscus taiwanensis (Malvaceae) is widely used as an alternative herb to treat disorders in Taiwan. In the present study, it is used to screen the effect on diabetic hyperglycemia in streptozotocin-induced diabetic rats (STZ-diabetic rats). The extract of Hibiscus taiwanensis showed a significant plasma glucose-lowering action in STZ-diabetic rats. Stems of Hibiscus taiwanensis are more effective than other parts to decrease the plasma glucose in a dose-dependent manner. Oral administration of Hibiscus taiwanensis three times daily for 3 days into STZ-diabetic rats increased the sensitivity to exogenous insulin showing an increase in insulin sensitivity. Moreover, similar repeated administration of Hibiscus taiwanensis for 3 days in STZ-diabetic rats produced a marked reduction of phosphoenolpyruvate carboxykinase (PEPCK) expression in liver and an increased expression of glucose transporter subtype 4 (GLUT 4) in skeletal muscle. Taken together, our results suggest that Hibiscus taiwanensis has the ability to lower plasma glucose through an increase in glucose utilization via elevation of skeletal GLUT 4 and decrease of hepatic PEPCK in STZ-diabetic rats. PMID:23690841
Directory of Open Access Journals (Sweden)
M. Sadat Alizadeh
2017-12-01
Full Text Available Introduction: The pink hibiscus mealybug, Maconellicoccushirsutus (Green (Hem.:Pseudococcidae is one of the serious economic pests of agricultural crops in tropical and subtropical regions.This pesthas spread through Asia, Africa, America and Australia, and infests more than 330 host plants which some of them have the important role in theeconomy. This sap-feeding insect secrets honeydew which provides suitablemedium for black sooty moldgrowth. It also releases a toxin during feeding, which results in severe stunting, decline, and deformation of twigs. It has recorded as a pest on different host plants in southern Iranian provinces since the 1990s.In Khuzestan province, it was first observed on Chinese hibiscus shrubs in urban landscapes of Ahvaz in February 2009. The evergreen hibiscus shrub is very common in the urban landscape of warmcities of Khuzestan province. The severity of mealybug damage to hibiscus shrubs causedto becut off in some regions. As there is no data on the biology of M. hirsutus in Iran,in the present study, the biologyof this pestwas investigatedat different temperatures in laboratory conditions as well as its population fluctuations on Chinese hibiscus shrubs in urban landscapes of Ahvaz. Materials and methods: Biology of the pest species was evaluated at five laboratory constant temperatures 15, 20, 25, 30and 35±2°C (65±5% RH and a photoperiod of L: D 14:10 h on Chinese hibiscus leaves in plastic boxes (8×6×2 cm. Number ofM. hirsutusgenerations was also studied in clip cages on hibiscus shrubs in Ahvaz urban landscapes within a year. Population fluctuations of the insect were also investigated on those shrubs in two different regions of Ahvaz for 16 months. For this purpose, random sampling was done on five shrubs in each region bi-weekly. Eight twigs, 5 cm in length, were cut from the upper and lower halves of each shrub quadrant and a number of all mealybug developmental stages per twig were counted and recorded
Study of large nonlinear change phase in Hibiscus Sabdariffa
Trejo-Durán, M.; Alvarado-Méndez, E.; Andrade-Lucio, J. A.; Rojas-Laguna, R.; Vázquez-Guevara, M. A.
2015-09-01
High intensities electromagnetic energy interacting with organic media gives rise to nonlinear optical effects. Hibiscus Sabdariffa is a flower whose concentrated solution presents interesting nonlinear optical properties. This organic material shows an important self-phase modulation with changes bigger than 2π. We present a diffraction ring patterns study of the Hibiscus Sabdariffa solution. Numerical results of transmittance, with refraction and simultaneous absorption, are shown.
PHARMACOLOGICAL EFFECTS AND THERAPEUTIC PROPERTIES OF HIBISCUS CANNABINUS- A REVIEW
Ali Esmail Al-Snafi
2018-01-01
The phytochemical analysis of Hibiscus cannabinus showed the presence of phytosterols, flavonoids, polyphenols, tannins, steroids, alkaloids, saponins, lignans, essential oils, glucosides such as cannabiscitrin, cannabiscetin and anthocyanin glycoside. The pharmacological studies revealed that Hibiscus cannabinus possessed cytotoxic, anthelmintic, antibacterial, antiulcer, antidiabetic, hypolipidemic, antioxidant, immunological, haematinic and hepatoprotective effects. This review will highli...
Ramirez-Rodrigues, Milena M; Plaza, Maria L; Azeredo, Alberto; Balaban, Murat O; Marshall, Maurice R
2011-04-01
Hibiscus cold (25 °C) and hot (90 °C) water extracts were prepared in various time-temperature combinations to determine equivalent extraction conditions regarding their physicochemical and phytochemical properties. Equivalent anthocyanins concentration was obtained at 25 °C for 240 min and 90 °C for 16 min. Total phenolics were better extracted with hot water that also resulted in a higher antioxidant capacity in these extracts. Similar polyphenolic profiles were observed between fresh and dried hibiscus extracts. Hibiscus acid and 2 derivatives were found in all extracts. Hydroxybenzoic acids, caffeoylquinic acids, flavonols, and anthocyanins constituted the polyphenolic compounds identified in hibiscus extracts. Two major anthocyanins were found in both cold and hot extracts: delphynidin-3-sambubioside and cyanidin-3-sambubioside. In general, both cold and hot extractions yielded similar phytochemical properties; however, under cold extraction, color degradation was significantly lower and extraction times were 15-fold longer. Hibiscus beverages are prepared from fresh or dried calyces by a hot extraction and pasteurized, which can change organoleptic, nutritional, and color attributes. Nonthermal technologies such as dense phase carbon dioxide may maintain their fresh-like color, flavor, and nutrients. This research compares the physicochemical and phytochemical changes resulting from a cold and hot extraction of fresh and dried hibiscus calyces and adds to the knowledge of work done on color, quality attributes, and antioxidant capacity of unique tropical products. In addition, the research shows how these changes could lead to alternative nonthermal processes for hibiscus.
Estado Actual de Peronospora sparsa, Causante del Mildiu Velloso en Rosa ( Rosa sp.)
Pablo Israel Álvarez Romero
2013-01-01
La rosa ( Rosa sp.) es una ornamental de importancia en México. Es afectada por un complejo de enfermedades, destacándose el Mildiu velloso ocasionado por el Chromista Per onospora sparsa que incide en la producti vidad, calidad, comercia lización y costos de producción, las pérdidas llegan hasta el 100 % de los ta llos florales. Entre los fungicidas empleados para el control del Mildiu velloso se destacan: fosetil-Al, dimetomorph, c y m o x a n i l , m e t a l a x y l . A l m o m e n t o e x...
Relationships between anthocyanins and other compounds and sensory acceptability of Hibiscus drinks.
Bechoff, Aurélie; Cissé, Mady; Fliedel, Geneviève; Declemy, Anne-Laure; Ayessou, Nicolas; Akissoe, Noel; Touré, Cheikh; Bennett, Ben; Pintado, Manuela; Pallet, Dominique; Tomlins, Keith I
2014-04-01
Chemical composition of Hibiscus drinks (Koor and Vimto varieties, commercial and traditional, infusions and syrups) (n=8) was related to sensory evaluation and acceptance. Significant correlations between chemical composition and sensory perception of drinks were found (i.e. anthocyanin content and Hibiscus taste) (pHibiscus drink and anthocyanin content. The study showed that the distinctions between the acceptability groups are very clear with respect to the chemical composition and rating of sensory attributes. Copyright © 2013 Elsevier Ltd. All rights reserved.
«Magma»: as origens de Guimarães Rosa
Directory of Open Access Journals (Sweden)
Luiz Cláudio Vieira de Oliveira
2011-10-01
Full Text Available Resumo: Leitura de Magma, de Guimarães Rosa, com o objetivo de indicar a presença de temas, fragmentos, personagens, expressões e recursos estilísticos ali existentes, em outros textos do autor, cronologicamente posteriores.Palavras-chave: Literatura brasileira; Guimarães Rosa; Magma.Résumé: Lecture de Magma, de Guimarães Rosa, ayant l’objectif de montrer la présence de quelques sujets, fragments, personnages, expressions et traits stylistiques, que y sont présents, et aussi dans autres textes du même auteur, chronologiquement postérieurs.Mots-clés: Littérature brésilienne; Guimarães Rosa; Magma.Keywords: Brazilian literature; Guimarães Rosa; Magma.
Directory of Open Access Journals (Sweden)
Eliane Gonçalves da Silva
2009-09-01
Full Text Available Plantas de hibisco com superbrotamento e definhamento seguido de morte têm sido observadas nos municípios de São Paulo, Campinas e Piracicaba. Como os sintomas são sugestivos daqueles induzidos por fitoplasmas, o presente trabalho buscou identificar o possível fitoplasma associado com a doença. Assim, 14 plantas sintomáticas de hibisco foram coletadas em Piracicaba (SP e submetidas ao PCR duplo com os primers P1/Tint-R16F2n/R2 e ao exame em microscópio eletrônico de transmissão. A identificação foi realizada por análise de RFLP com as enzimas de restrição BfaI, DraI, HaeIII, HhaI, HpaII, MboI, MseI, RsaI e TaqI. Testes de transmissão foram conduzidos com enxertia de ramos e uso de Cuscuta subinclusa. Os resultados de nested-PCR revelaram a presença consistente de fitoplasmas em todas as plantas sintomáticas e foram confirmados pela observação de corpúsculos pleomórficos no floema, através da microscopia eletrônica. A análise de RFLP mostrou que o fitoplasma encontrado em hibisco pertence ao grupo 16SrXV, o mesmo grupo do Candidatus Phytoplasma brasiliense. O fitoplasma foi transmitido de planta doente para sadia, tanto pela enxertia como pela C. subinclusa, demonstrando ser o agente do superbrotamento do hibisco.Ornamental hibiscus have been affected by shoot proliferation and decline followed by death in several cities in São Paulo State, especially São Paulo, Campinas and Piracicaba. As the symptoms are suggestives of those induced by phytoplasmas, the present work aimed to identify the possible phytoplasma associated with the disease. Fourteen symptomatic hibiscus were sampled in Piracicaba, submitted to nested-PCR with the primers P1/Tint-R16F2n/R2 and processed by transmission electron microscopy. The identification was made by RFLP analyses with the restriction enzymes BfaI, DraI, HaeIII, HhaI, HpaII, MboI, MseI, RsaI, and TaqI. Transmission assays were performed by grafting and Cuscuta subinclusa. The presence
The Effects of Cold Stress on Photosynthesis in Hibiscus Plants
Paredes, Miriam; Quiles, María José
2015-01-01
The present work studies the effects of cold on photosynthesis, as well as the involvement in the chilling stress of chlororespiratory enzymes and ferredoxin-mediated cyclic electron flow, in illuminated plants of Hibiscus rosa-sinensis. Plants were sensitive to cold stress, as indicated by a reduction in the photochemistry efficiency of PSII and in the capacity for electron transport. However, the susceptibility of leaves to cold may be modified by root temperature. When the stem, but not roots, was chilled, the quantum yield of PSII and the relative electron transport rates were much lower than when the whole plant, root and stem, was chilled at 10°C. Additionally, when the whole plant was cooled, both the activity of electron donation by NADPH and ferredoxin to plastoquinone and the amount of PGR5 polypeptide, an essential component of the cyclic electron flow around PSI, increased, suggesting that in these conditions cyclic electron flow helps protect photosystems. However, when the stem, but not the root, was cooled cyclic electron flow did not increase and PSII was damaged as a result of insufficient dissipation of the excess light energy. In contrast, the chlororespiratory enzymes (NDH complex and PTOX) remained similar to control when the whole plant was cooled, but increased when only the stem was cooled, suggesting the involvement of chlororespiration in the response to chilling stress when other pathways, such as cyclic electron flow around PSI, are insufficient to protect PSII. PMID:26360248
Dharm Dutt; J. S. Upadhyaya; C. H. Tyagi
2010-01-01
Hibiscus cannabinus, Hibiscus sabdariffa, and Cannabinus sativa, which are renewable non-woody fiber resources having characteristics similar to that of softwood (bast fibers), when used together with hardwood (core fibers), gave higher pulp yield with good mechanical strength properties when using an alkaline sulphite-anthraquinone (AS-AQ) pulping process rather than a conventional kraft pulping process and bleached more readily than kraft and soda pulps with a CEHH bleaching sequence. A com...
Prediction of ROSA-III experiment
International Nuclear Information System (INIS)
Soda, Kunihisa
1978-06-01
ROSA-III experiment with the simulated BWR system is to investigate thermal hydraulic behavior as well as ECCS performance in a postulated loss-of-coolant accident. RUN 701 assumes average core power, high and low pressure core sprays and low pressure injection of ECCS. Prediction of experiment RUN 701 was made with computer code RELAP-4J. The results indicate the need for ROSA-III pump characteristics to be clarified and for liquid level formation model to be improved. Comparison of the prediction results with the experimental data should reveal the areas of modifications in calculation model. (auth.)
The effectiveness of Hibiscus sabdariffa in the treatment of hypertension: a systematic review.
Wahabi, H A; Alansary, L A; Al-Sabban, A H; Glasziuo, P
2010-02-01
Hypertension is a common global health problem with significant mortality and morbidity. Hibiscus sabdariffa is a plant known in many countries and is consumed as hot and cold drinks In addition to its use in folk medicine; it has been suggested as treatment for many conditions including hypertension. The objectives of this review were to examine the evidence of effectiveness and safety of hibiscus in the treatment of hypertension. We searched several medical databases (MEDLINE, EMBASE, CINAHL, Cochrane Central Register of Controlled Trials, and the specialized register of the Cochrane Hypertension Group and the general engine Google) to January 2009. We included randomized controlled trials that had examined Hibiscus's effectiveness and safety in the treatment of primary hypertension in adults. Two authors independently selected the trials for the review, extracted the data, and critically appraised the included studies. Four trials, with a total of 390 patients, met our inclusion criteria. Two studies compared Hibiscus sabdariffa to black tea; one study compared it to captopril and one to lisinopril. The studies found that Hibiscus had greater blood pressure reduction than tea but less than the ACE-inhibitors. However, all studies, except one, were short term and of poor quality with a Jadad scoring of Hibiscus sabdariffa for the treatment of primary hypertension in adults. Copyright 2009 Elsevier GmbH. All rights reserved.
In vitro inhibitory activities of the extract of Hibiscus sabdariffa L ...
African Journals Online (AJOL)
In vitro inhibitory activities of the extract of Hibiscus sabdariffa L. (family malvaceae) on selected cytochrome p450 isoforms. SS Johnson, FT Oyelola, T Ari, H Juho. Abstract. Literature is scanty on the interaction potential of Hibiscus sabdariffa L., plant extract with other drugs and the affected targets. This study was ...
Sensibilidade da rosa 'Osiana' ao etileno
Directory of Open Access Journals (Sweden)
Delaine Cristina Cordeiro
2011-01-01
Full Text Available Os objetivos deste trabalho foram determinar a sensibilidade e as respostas da rosa cultivar Osiana (Rosa × hybrida à presença de etileno ao longo da vida pós-colheita. Para determinar a sensibilidade da flor ao etileno, hastes foram cortadas e colocadas em câmaras herméticas e em seguida tratadas por 24 horas com diferentes concentrações de etileno variando de 0,0; 0,1; 1,0; 10; 100 e 1000 µL L-1do ar no interior da câmara. A rosa teve a vida pós-colheita reduzida pelo etileno, quando exposta a concentração igual ou superior a 10 µL L-1 de etileno. As flores tratadas com no mínimo de 10 µL L-1de etileno desenvolveram necrose, murcha e abscisão prematura das pétalas ainda túrgidas. As concentrações de 0,1 e 1,0 µL L-1de etileno estimularam a abertura do botão floral durante o período de 24 horas de exposição ao etileno, sem no entanto, reduzir a vida pós-colheita. A rosa 'Osiana' pode ser classificada como uma cultivar sensível ao etileno e a concentração influência os processos estimulados.
Effect of extract of Hibiscus on the ultrastructure of the testis in adult mice.
Mahmoud, Yomna Ibrahim
2012-07-01
Hibiscus sabdariffa extract is a popular beverage in many tropical and sub-tropical countries. Although, Hibiscus tea is known for its medicinal effects for thousands of years, scientific evidence of its systemic safety is very limited. The current study aimed to assess the potential adverse effects of H. sabdariffa extract on sperm morphology and testicular ultrastructure of albino mice. Thirty adult male albino mice were divided into three equal groups and were given: (a) distilled water, (b) cold Hibiscus aqueous extract, and (c) boiled Hibiscus aqueous extract. Hibiscus extract was administered orally daily for 4 weeks in a dose of 200 mg/kg body weight/mouse. Twenty-four hours after the last treatment, mice were decapitated and the testes and epididymides were excised and processed for transmission electron microscopy to assess ultrastructural and sperm abnormalities. The results clearly demonstrate that aqueous extracts from dried calyx of H. sabdariffa, either cold or boiled, alter normal sperm morphology and testicular ultrastructure and adversely influence the male reproductive fertility in albino mice. The current data suggest that Hibiscus extract should be consumed with caution, and reasonable estimates of the human risk associated with its consumption should be provided. Copyright © 2011 Elsevier GmbH. All rights reserved.
Radiosensitivity and chimera formation in Hibiscus syriacus
International Nuclear Information System (INIS)
Kwon, S.H.; Won, J.L.
1980-01-01
Radiosensitivity of gamma-irradiated Hibiscus syriacus and chimera formation were investigated. The lethal dose-50 percent with respect to seeding and cuttings was 15kR and 2 approximately 3 kR respectively, chlorophyll mutation rate of seeds irradiated with 15 kR being about 13 percent. The degree of chimeric leaf mutants from the buds by radiation treatment depends on the bud position of the branch. Buds of the middle part of V 1 branch seemed to be more multi-cellular condition than the upper and low part when irradiation was made. It is assumed that at least two primordia of V 2 branch were already differentiated from the V 1 branch in Hibiscus syriacus plant. (Author)
Extraction and the Fatty Acid Profile of Rosa acicularis Seed Oil.
Du, Huanan; Zhang, Xu; Zhang, Ruchun; Zhang, Lu; Yu, Dianyu; Jiang, Lianzhou
2017-12-01
Rosa acicularis seed oil was extracted from Rosa acicularis seeds by the ultrasonic-assisted aqueous enzymatic method using cellulase and protease. Based on a single experiment, Plackett-Burman design was applied to ultrasonic-assisted aqueous enzymatic extraction of wild rose seed oil. The effects of enzyme amount, hydrolysis temperature and initial pH on total extraction rate of wild rose seed oil was studied by using Box-Behnken optimize methodology. Chemical characteristics of a sample of Rosa acicularis seeds and Rosa acicularis seed oil were characterized in this work. The tocopherol content was 200.6±0.3 mg/100 g oil. The Rosa acicularis seed oil was rich in linoleic acid (56.5%) and oleic acid (34.2%). The saturated fatty acids included palmitic acid (4%) and stearic acid (2.9%). The major fatty acids in the sn-2 position of triacylglycerol in Rosa acicularis oil were linoleic acid (60.6%), oleic acid (33.6%) and linolenic acid (3.2%). According to the 1,3-random-2-random hypothesis, the dominant triacylglycerols were LLL (18%), LLnL (1%), LLP (2%), LOL (10%), LLSt (1.2%), PLP (0.2%), LLnP (0.1%), LLnO (0.6%) and LOP (1.1%). This work could be useful for developing applications for Rosa acicularis seed oil.
Sortiment Hibiscus voortdurend in beweging
Hoffman, M.H.A.
2010-01-01
Hibiscus is hot en volop in ontwikkeling. Op Plantarium 2009 werden maarliefst acht nieuwe cultivars ter keuring aangeboden. In naamlijsten van 2005 staan ruim 150 cultivars geregistreerd, terwijl dit er in de naamlijst van 1995 slechts 60 waren. Alle reden om op een rijtje te zetten wat er bekend
DEFF Research Database (Denmark)
Paulsen, E; Skov, Per Stahl; Andersen, Klaus Ejner
1998-01-01
cacti, Stephanotis floribunda, Euphorbia pulcherrima and Gerbera reactions. Other new species implicated in immediate-type reactions included Ficus pumila, Gardenia jasminoides, Hibiscus rosa-sinensis, Campanula, Columnea, Epipremnum aureum, Pelargonium and Primula vulgaris. Because of the high...
2010-07-01
... 33 Navigation and Navigable Waters 3 2010-07-01 2010-07-01 false Waters of Santa Rosa Sound and..., Fla. 334.730 Section 334.730 Navigation and Navigable Waters CORPS OF ENGINEERS, DEPARTMENT OF THE ARMY, DEPARTMENT OF DEFENSE DANGER ZONE AND RESTRICTED AREA REGULATIONS § 334.730 Waters of Santa Rosa...
Kapepula, Paulin Mutwale; Kabamba Ngombe, Nadege; Tshisekedi Tshibangu, Pascal; Tsumbu, César; Franck, Thierry; Mouithys-Mickalad, Ange; Mumba, Dieudonné; Tshala-Katumbay, Désiré; Serteyn, Didier; Tits, Monique; Angenot, Luc; Kalenda, Pascal Dibungi T; Frédérich, Michel
2017-12-01
Methanolic and dichloromethane extracts from the leaves of Congolese Hibiscus species were characterised by chromatographic and spectroscopic techniques and their in vitro biochemical activities against ROS production were evaluated in cellular models and on an enzyme, myeloperoxidase (MPO), involved in inflammation. Hibiscus acetosella has a chemical fingerprint different from Hibiscus cannabinus and Hibiscus sabdariffa both having similar fingerprints. Major compounds were polyphenols, represented mainly by caffeoyl-hydroxycitric acid for H. acetosella and neochlorogenic acid for the two other species. All extracts displayed high cellular antioxidant activity with IC 50 values ranging from 0.5 to 3 μg mL -1 using lucigenin on neutrophils. Dichloromethane extracts showed more efficient effects on extracellular ROS production and MPO activity. Antioxidant and anti-inflammatory activities of caffeoyl-hydroxycitric acid were significantly higher than those of neochlorogenic acid. The bioactivities of Hibiscus species were positively correlated with their phytochemical content and could justify their use as local nutraceutical resources and medicines.
Potensi Diversifikasi Rosela Herbal (Hibiscus Sabdariffa L.) untuk Pangan dan Kesehatan
Nurnasari, Elda; Khuluq, Ahmad Dhiaul
2017-01-01
Tanaman penghasil serat alami dari genus Hibiscus yang cukup populer di Indonesia adalah rosela (Hibiscus sabdariffa L.). Nilai kemanfaatan rosela sangat luas baik untuk pangan dan kesehatan, sehingga potensi diversifikasi rosela cukup besar. Tujuan penulisan review ini adalah untuk memberikan informasi kandungan fitokimia potensial tanaman rosela herbal yang memiliki efek farmakologis dan fisiologis serta beberapa diversifikasi produk makanan, minuman dan produk kesehatan. Bagian tanaman ro...
ANTIMICROBIAL ACTIVITY OF ROSA CANINA FLOWERS AGAINST SELECTED MICROORGANISMS
Directory of Open Access Journals (Sweden)
Katarína Rovná
2015-02-01
Full Text Available Rosa canina flowers were screened against various plant pathogenic microbial strains to study the antimicrobial properties of the plant. Ethanolic and methanolic extracts of flowers were screened applying agar well diffusion method against two Gram-negative bacteria including Escherichia coli CCM 3988 and Pseudomonas aeruginosa CCM 1960 and three microscopic filamentous fungi strains Aspergillus niger, Fusarium culmorum and Alternaria alternata, respectively. The best antimicrobial effect of ethanolic extract of Rosa canina flowers was found against Pseudomonas aeruginosa and the best antimicrobial effect of methanolic extract of Rosa canina flowers was found against Escherichia coli.
analysis of genetic diversity and relationship of Chinese Rosa rugosa
African Journals Online (AJOL)
Administrator
2011-05-30
May 30, 2011 ... Rosa rugosa is a deciduous shrub of the genus Rosa, having prickly stems ... eastern Shandong province and Tumen River estuary ..... Smithsonian Institution, Washington DC, USA. Sokolov SY ... Distribution of trees and.
Profile of the Phenolic Compounds of Rosa rugosa Petals
Directory of Open Access Journals (Sweden)
Andrzej Cendrowski
2017-01-01
Full Text Available Rosa rugosa petals are a rich source of phenolic compounds, which determined their antioxidant properties. The aim of this study was to determine the polyphenolic composition of not processed petals of Rosa rugosa collected from the commodity crops and to determine the variability of the contained therein polyphenols between harvesting seasons. Twenty polyphenols were identified by UPLC-ESI-MS. The main fraction of polyphenols was ellagitannins, which are 69 to 74% of the total polyphenols of the petals. In the petals of Rosa rugosa, four anthocyanins have been identified: cyanidin 3,5-di-O-glucoside, peonidin 3-O-sophoroside, peonidin 3,5-di-O-glucoside, and peonidin 3-O-glucoside, of which the predominant peonidin 3,5-di-O-glucoside represented approx. 85% of all the determined anthocyanin compounds. It was found that the petals of Rosa rugosa are a valuable source of bioactive compounds and can be considered as a healthy valuable resource.
Showande, S J; Adegbolagun, O M; Igbinoba, S I; Fakeye, T O
2017-12-01
Increasing number of patients use herbs with their medications. Such practice may result in beneficial or harmful herb-drug interactions. A recent survey reported that some participants co-administered Hibiscus sabdariffa, a widely used beverage, or tea, with their antihyperlipidaemic medications. This study therefore evaluated the effect of concomitant administration of Hibiscus sabdariffa calyces' extracts with simvastatin on hyperlipidaemia and pharmacokinetics of the drug in vivo. Factorial experimental designs were used to evaluate the comparative effectiveness and interactions between simvastatin and aqueous extract of Hibiscus sabdariffa (AEHS) on lipid profile parameters in hyperlipidaemia-induced Wistar rats. Different combinations of low (AEHS 250 mg/kg; simvastatin 10 mg/kg) and high doses (AEHS 500 mg/kg; simvastatin 20 mg/kg) were administered individually and concurrently daily for 2 and 4 weeks. Lipid profile parameters were assessed at these treatment periods. Subsequently, the effect of aqueous beverage of Hibiscus sabdariffa (ABHS) on the pharmacokinetics of single-dose 40 mg simvastatin was also evaluated in six healthy human volunteers using two-period randomized crossover design. Blood samples were collected at predetermined times for 24 hours. The plasma obtained was analysed for simvastatin using RP-HPLC/UV method. Aqueous extract of Hibiscus sabdariffa reduced total cholesterol (T c ) better than simvastatin (P = .031). Low-dose AEHS and low-dose simvastatin used concomitantly caused 38.3% and 57.4% reductions in T c and triglyceride levels, respectively, compared with low-dose simvastatin (P Hibiscus sabdariffa lowered T c better than simvastatin and enhanced the antihyperlipidaemic activity of the drug when co-administered at low doses in an animal model. However, aqueous beverage of Hibiscus sabdariffa caused a significant herb-drug interaction resulting in overall reduction in exposure to simvastatin in humans. Caution should
Hot and cold water infusion aroma profiles of Hibiscus sabdariffa: fresh compared with dried.
Ramírez-Rodrigues, M M; Balaban, M O; Marshall, M R; Rouseff, R L
2011-03-01
Calyxes from the Roselle plant (Hibiscus sabdariffa L.) were used to prepare cold (22 °C for 4 h) and hot (98 °C for 16 min) infusions/teas from both fresh and dried forms. Aroma volatiles were extracted using static headspace SPME and analyzed using GC-MS and GC-O with 2 different columns (DB-5 and DB-Wax). Totals of 28, 25, 17, and 16 volatiles were identified using GC-MS in the dried hot extract (DHE), dried cold extract (DCE), fresh hot extract (FHE), and fresh cold extract (FCE) samples, respectively. In terms of total GC-MS peak areas DHE ≫ DCE > FHE ≫ FCE. Nonanal, decanal, octanal, and 1-octen-3-ol were among the major volatiles in all 4 beverage types. Thirteen volatiles were common to all 4 teas. Furfural and 5-methyl furfural were detected only in dried hibiscus beverages whereas linalool and 2-ethyl-1-hexanol were detected only in beverages from fresh hibiscus. In terms of aroma active volatiles, 17, 16, 13, and 10 aroma active volatiles were detected for DHE, DCE, FHE, and FCE samples, respectively. The most intense aroma volatiles were 1-octen-3-one and nonanal with a group of 4 aldehydes and 3 ketones common to all samples. Dried samples contained dramatically higher levels of lipid oxidation products such as hexanal, nonanal, and decanal. In fresh hibiscus extracts, linalool (floral, citrus) and octanal (lemon, citrus) were among the highest intensity aroma compounds but linalool was not detected in any of the dried hibiscus extracts. Hibiscus teas/infusions are one of the highest volume specialty botanical products in international commerce. The beverage is consumed for both sensory pleasure and health attributes and is prepared a number of ways throughout the world. Although color and taste attributes have been examined, little information is known about its aroma volatiles and no other study has compared extractions from both fresh and dried as well as extraction temperature differences. This is also, apparently, the first study to identify
Z-scan and optical limiting properties of Hibiscus Sabdariffa dye
Diallo, A.; Zongo, S.; Mthunzi, P.; Rehman, S.; Alqaradawi, S. Y.; Soboyejo, W.; Maaza, M.
2014-12-01
The intensity-dependent refractive index n 2 and the nonlinear susceptibility χ (3) of Hibiscus Sabdariffa dye solutions in the nanosecond regime at 532 nm are reported. More presicely, the variation of n 2, β, and real and imaginary parts of χ (3) versus the natural dye extract concentration has been carried out by z-scan and optical limiting techniques. The third-order nonlinearity of the Hibiscus Sabdariffa dye solutions was found to be dominated by nonlinear refraction, which leads to strong optical limiting of laser.
Can hibiscus tea lower blood pressure
Hibiscus sabdariffa is a common ingredient found in blended herbal teas, and beverages made from the dried calyces of this plant are popular worldwide. In vitro studies have shown that H. sabdariffa has antioxidant properties and, in animal models of hypertension, extracts of this plant lower blood ...
Phytochemical Screening and Antibacterial Activities Of HIBISCUS ...
African Journals Online (AJOL)
USER
Department of Applied Science, College of Science and Technology, ... results showed the presence of tannins, flavonoids, saponins and steroids in the methanolic extract of the leaves of Hibiscus sabdariffa L. The mean zones of inhibition of ...
A cilevirus infects ornamental hibiscus in Hawaii
Melzer, Michael J.; Simbajon, Nelson; Carillo, James; Borth, Wayne B.; Freitas-Astúa, Juliana; Kitajima, Elliot W.; Neupane, Kabi R.; Hu, John S.
2013-01-01
The complete nucleotide sequence of a virus infecting ornamental hibiscus (Hibiscus sp.) in Hawaii with symptoms of green ringspots on senescing leaves was determined from double-stranded RNA isolated from symptomatic tissue. Excluding polyadenylated regions at the 3′ termini, the bipartite RNA genome was 8748 and 5019 nt in length for RNA1 and RNA2, respectively. The genome organization was typical of a cilevirus: RNA1 encoded a large replication-associated protein with methyltransferase, protease, helicase and RNA-dependent RNA polymerase domains as well as a 29-kDa protein of unknown function. RNA2 possessed five open reading frames that potentially encoded proteins with molecular masses of 15, 7, 62, 32, and 24 kDa. The 32-kDa protein is homologous to 3A movement proteins of RNA viruses; the other proteins are of unknown function. A proteome comparison revealed that this virus was 92% identical to citrus leprosis virus cytoplasmic type 2 (CiLV-C2), a recently characterized cilevirus infecting citrus with leprosis-like symptoms in Colombia. The high sequence similarity suggests that the virus described in this study could be a strain of CiLV-C2, but since the new genus Cilevirus does not have species demarcation criteria established at present, the classification of this virus infecting hibiscus is open to interpretation. This study represents the first documented case of a cilevirus established in the United States and provides insight into the diversity within the genus Cilevirus. PMID:23732930
A cilevirus infects ornamental hibiscus in Hawaii.
Melzer, Michael J; Simbajon, Nelson; Carillo, James; Borth, Wayne B; Freitas-Astúa, Juliana; Kitajima, Elliot W; Neupane, Kabi R; Hu, John S
2013-11-01
The complete nucleotide sequence of a virus infecting ornamental hibiscus (Hibiscus sp.) in Hawaii with symptoms of green ringspots on senescing leaves was determined from double-stranded RNA isolated from symptomatic tissue. Excluding polyadenylated regions at the 3' termini, the bipartite RNA genome was 8748 and 5019 nt in length for RNA1 and RNA2, respectively. The genome organization was typical of a cilevirus: RNA1 encoded a large replication-associated protein with methyltransferase, protease, helicase and RNA-dependent RNA polymerase domains as well as a 29-kDa protein of unknown function. RNA2 possessed five open reading frames that potentially encoded proteins with molecular masses of 15, 7, 62, 32, and 24 kDa. The 32-kDa protein is homologous to 3A movement proteins of RNA viruses; the other proteins are of unknown function. A proteome comparison revealed that this virus was 92 % identical to citrus leprosis virus cytoplasmic type 2 (CiLV-C2), a recently characterized cilevirus infecting citrus with leprosis-like symptoms in Colombia. The high sequence similarity suggests that the virus described in this study could be a strain of CiLV-C2, but since the new genus Cilevirus does not have species demarcation criteria established at present, the classification of this virus infecting hibiscus is open to interpretation. This study represents the first documented case of a cilevirus established in the United States and provides insight into the diversity within the genus Cilevirus.
Interspecific hybridization among cultivars of hardy Hibiscus species section Muenchhusia
DEFF Research Database (Denmark)
Kuligowska, Katarzyna; Lütken, Henrik Vlk; Christensen, Brian
2016-01-01
Rose mallows belong to the Muenchhusia section of the Hibiscus genus. They represent a small group of cold tolerant North American plants and are popular ornamentals mainly because of their abundant, large and colorful flowers. Due to their geographical origin they are well suited for garden use...... in temperate regions worldwide. The aim of the study was to investigate hybridization barriers in crosses among cultivars of Hibiscus species from the Muenchhusia section: H. coccineus, H. laevis and H. moscheutos. Crossing barriers were identified as both pre- and post-zygotic. The analysis of pollen tube...
Hibiscus sabdariffa L., roselle calyx, from ethnobotany to pharmacology.
Carvajal-Zarrabal, Octavio; Barradas-Dermitz, Dulce María; Orta-Flores, Zaida; Hayward-Jones, Patricia Margaret; Nolasco-Hipólito, Cirilo; Aguilar-Uscanga, M Guadalupe; Miranda-Medina, Anilú; Bujang, Kopli Bin
2012-01-01
Using MEDLINE and SCOPUS databases, a review of the literature from the pioneering study of 1991 until 2010 was performed on the effects on biological models of Hibiscus sabdariffa L. roselle calyx, its extracts mainly in polar solvents, or pure components found in extracts, as well as their possible relationship to these effects. Three relevant effects on lipid metabolism, antihypertensive activity, and apoptosis were observed. Our chronological review of the studies mentioned in the literature provides another opportunity to see how humans compile scientific knowledge of a chemical structure-physiological activity relationship starting from an ethnobotanical-ethnopharmagognosy contribution. The chemical components that are the main active principles in the physiological activities of Hibiscus sabdariffa L. calyx are anthocyanins and polyphenols (protocatechuic acid and quercetin). Advances have also been made in the elucidation of action mechanisms. Additionally, it has become clear that the lack of standardization in terms of chemical components of the material arising from Hibiscus sabdariffa L. used in testing on biological models imposes limits on the possibility of carrying out comparative analyses between studies. Fortunately, more recent studies are overcoming this obstacle by reporting component concentrations of assumed active principles; however, complete analysis of the extract, if this is to be considered as a therapeutic agent, is not commonly reported in the aforesaid studies. If one of the eventual scenarios for Hibiscus sabdariffa L. calyx is as a therapeutic agent in communities with economic limitations, then studies of a pharmacological nature should guarantee the effectiveness, safety, and tolerability of this material, which is widely accepted to be associated with chemical complexity, thus making this knowledge necessary.
Hibiscus sabdariffa L., roselle calyx, from ethnobotany to pharmacology
Carvajal-Zarrabal, Octavio; Barradas-Dermitz, Dulce María; Orta-Flores, Zaida; Hayward-Jones, Patricia Margaret; Nolasco-Hipólito, Cirilo; Aguilar-Uscanga, M Guadalupe; Miranda-Medina, Anilú; Bujang, Kopli Bin
2012-01-01
Using MEDLINE and SCOPUS databases, a review of the literature from the pioneering study of 1991 until 2010 was performed on the effects on biological models of Hibiscus sabdariffa L. roselle calyx, its extracts mainly in polar solvents, or pure components found in extracts, as well as their possible relationship to these effects. Three relevant effects on lipid metabolism, antihypertensive activity, and apoptosis were observed. Our chronological review of the studies mentioned in the literature provides another opportunity to see how humans compile scientific knowledge of a chemical structure–physiological activity relationship starting from an ethnobotanical–ethnopharmagognosy contribution. The chemical components that are the main active principles in the physiological activities of Hibiscus sabdariffa L. calyx are anthocyanins and polyphenols (protocatechuic acid and quercetin). Advances have also been made in the elucidation of action mechanisms. Additionally, it has become clear that the lack of standardization in terms of chemical components of the material arising from Hibiscus sabdariffa L. used in testing on biological models imposes limits on the possibility of carrying out comparative analyses between studies. Fortunately, more recent studies are overcoming this obstacle by reporting component concentrations of assumed active principles; however, complete analysis of the extract, if this is to be considered as a therapeutic agent, is not commonly reported in the aforesaid studies. If one of the eventual scenarios for Hibiscus sabdariffa L. calyx is as a therapeutic agent in communities with economic limitations, then studies of a pharmacological nature should guarantee the effectiveness, safety, and tolerability of this material, which is widely accepted to be associated with chemical complexity, thus making this knowledge necessary. PMID:27186114
Wang, Ming Li; Morris, Brad; Tonnis, Brandon; Davis, Jerry; Pederson, Gary A
2012-07-04
The Hibiscus genus encompasses more than 300 species, but kenaf (Hibiscus cannabinus L.) and roselle (Hibiscus sabdariffa L.) are the two most economically important species within the genus. Seeds from these two Hibiscus species contain a relatively high amount of oil with two unusual fatty acids: dihydrosterculic and vernolic acids. The fatty acid composition in the oil can directly affect oil quality and its utilization. However, the variability in oil content and fatty acid composition for these two species is unclear. For these two species, 329 available accessions were acquired from the USDA germplasm collection. Their oil content and fatty acid composition were determined by nuclear magnetic resonance (NMR) and gas chromatography (GC), respectively. Using NMR and GC analyses, we found that Hibiscus seeds on average contained 18% oil and seed oil was composed of six major fatty acids (each >1%) and seven minor fatty acids (each Hibiscus cannabinus seeds contained significantly higher amounts of oil (18.14%), palmitic (20.75%), oleic (28.91%), vernolic acids (VA, 4.16%), and significantly lower amounts of stearic (3.96%), linoleic (39.49%), and dihydrosterculic acids (DHSA, 1.08%) than H. sabdariffa seeds (17.35%, 18.52%, 25.16%, 3.52%, 4.31%, 44.72%, and 1.57%, respectively). For edible oils, a higher oleic/linoleic (O/L) ratio and lower level of DHSA are preferred, and for industrial oils a high level of VA is preferred. Our results indicate that seeds from H. cannabinus may be of higher quality than H. sabdariffa seeds for these reasons. Significant variability in oil content and major fatty acids was also detected within both species. The variability in oil content and fatty acid composition revealed from this study will be useful for exploring seed utilization and developing new cultivars in these Hibiscus species.
Lifescience Database Archive (English)
Full Text Available MeCab user dictionary for science technology term Hibiscus 名詞 一般 * * * * フヨウ属 フヨウゾク フヨーゾク Thesaurus2015 200906098519206796 C LS06 UNKNOWN_1 Hibiscus
Phytochemical Screening and Antibacterial Activities of Hibiscus ...
African Journals Online (AJOL)
The phytochemical properties and the antibacterial potency of rosselle (Hibiscus sabdariffa L) leaf extracts were evaluated using the cold maceration method, agar diffusion method and qualitative phytochemical analysis respectively. The methanolic extract was tested against Salmonella typhi, Escherichia coli and ...
Inheritance of characters in kenaf (Hibiscus cannabinus)
African Journals Online (AJOL)
SERVER
2008-04-03
David and Adam, 1988). The plant belongs to the order Malvales, the family Malvaceae and the genus Hibiscus ... The varieties in relation to the character studied are as follows: NRG-NG-R5: Pink flowers with resistance to root ...
Folklore information from Assam for family planning and birth control.
Tiwari, K C; Majumder, R; Bhattacharjee, S
1982-11-01
The author collected folklore information on herbal treatments to control fertility from different parts of Assam, India. Temporary methods of birth control include Cissampelos pareira L. in combination with Piper nigrum L., root of Mimosa pudica L. and Hibiscus rosa-sinensis L. Plants used for permanent sterilization include Plumbago zeylanica L., Heliotropium indicum L., Salmalia malabrica, Hibiscus rosa-sinensis L., Plumeria rubra L., Bambusa rundinacea. Abortion is achieved through use of Osbeckia nepalensis or Carica papaya L. in combination with resin from Ferula narthex Boiss. It is concluded that there is tremendous scope for the collection of folklore about medicine, family planning agents, and other treatments from Assam and surrounding areas. Such a project requires proper understanding between the survey team and local people, tactful behavior, and a significant amount of time. Monetary rewards can also be helpful for obtaining information from potential respondents.
McKay, Diane L; Chen, C-Y Oliver; Saltzman, Edward; Blumberg, Jeffrey B
2010-02-01
In vitro studies show Hibiscus sabdariffa L., an ingredient found in many herbal tea blends and other beverages, has antioxidant properties, and, in animal models, extracts of its calyces have demonstrated hypocholesterolemic and antihypertensive properties. Our objective in this study was to examine the antihypertensive effects of H. sabdariffa tisane (hibiscus tea) consumption in humans. A randomized, double-blind, placebo-controlled clinical trial was conducted in 65 pre- and mildly hypertensive adults, age 30-70 y, not taking blood pressure (BP)-lowering medications, with either 3 240-mL servings/d of brewed hibiscus tea or placebo beverage for 6 wk. A standardized method was used to measure BP at baseline and weekly intervals. At 6 wk, hibiscus tea lowered systolic BP (SBP) compared with placebo (-7.2 +/- 11.4 vs. -1.3 +/- 10.0 mm Hg; P = 0.030). Diastolic BP was also lower, although this change did not differ from placebo (-3.1 +/- 7.0 vs. -0.5 +/- 7.5 mm Hg; P = 0.160). The change in mean arterial pressure was of borderline significance compared with placebo (-4.5 +/- 7.7 vs. -0.8 +/- 7.4 mm Hg; P = 0.054). Participants with higher SBP at baseline showed a greater response to hibiscus treatment (r = -0.421 for SBP change; P = 0.010). No effects were observed with regard to age, gender, or dietary supplement use. These results suggest daily consumption of hibiscus tea, in an amount readily incorporated into the diet, lowers BP in pre- and mildly hypertensive adults and may prove an effective component of the dietary changes recommended for people with these conditions.
Identifying salt stress-responsive transcripts from Roselle ( Hibiscus ...
African Journals Online (AJOL)
Hibiscus sabdariffa L.). Identifying the potentially novel transcripts responsible for salt stress tolerance in roselle will increase knowledge of the molecular mechanism underlying salt stress responses. In this study, differential display reverse ...
Lifescience Database Archive (English)
Full Text Available MeCab user dictionary for science technology term Hibiscus cannabinus 名詞 一般 * * * *... ケナフ ケナフ ケナフ Thesaurus2015 200906017528823668 C LS06 UNKNOWN_2 Hibiscus cannabinus
International Nuclear Information System (INIS)
Saisomboon, S.; Siri-Upathum, C.
1987-01-01
This paper describes a new method for measuring radiation dose by using natural pigments. The pigments were extracted from Hibiscus rosa sinensis L. and Canna indica L. and were irradiated with gamma ray. Doses of 30 rad and above are indicated by color changes
International Nuclear Information System (INIS)
Qadeer, M.; Hafiz, I. A.; Abbasi, N. A.; Ahmad, T.
2015-01-01
Among the highly fragrant Rosa species, Rosa gruss an teplitz and Rosa centifolia have high value in terms of commercial importance and economical trade. However, the absence of floral diversification and diversity in color patterns in these species acts as limiting factors in floriculture trade of these species. In the present study, we aimed to induce mutations using gamma radiations up to 120 Gy to observe the rate and the correlated effects on the several plant traits in micropropagated shoot tips of Rosa gruss an teplitz and Rosa centifolia. Irradiated shoot tips were micropropagated for one culture cycle and were acclimatized in a green house after in vitro rooting. Plants of irradiated population at 60 and 30 Gy showed 78.12 and 38.50 percentage less culture rooting percentage age as well as 23.82 and 7 percentage less flower size as compared to non irradiated population of Rosa gruss an teplitz and Rosa centifolia respectively. Moreover, flower color component a* (+ redness - green, 36.16 and 27.16) and chroma (37.77 and 27.5) depicted minimum while L* (Lightness, 45.12 and 76.64), b* (+ yellow - blue, 10.69 and -4.14) and hue angle (17.1 and -8.58) maximum value. Apart from these variations, mutants of Rosa gruss an teplitz also produced variegated, pink color and different shape flowers. Genetic variations observed among the putative mutants of Rosa gruss an teplitz and Rosa centifolia were evaluated using twelve decamer RAPD primers. Phylogenetic inferences showed large genetic diversity in putative mutants as compared to mother plant. (author)
Sonne, Michael; Villalta, Dino L; Andrews, David M
2012-01-01
The Rapid Office Strain Assessment (ROSA) was designed to quickly quantify risks associated with computer work and to establish an action level for change based on reports of worker discomfort. Computer use risk factors were identified in previous research and standards on office design for the chair, monitor, telephone, keyboard and mouse. The risk factors were diagrammed and coded as increasing scores from 1 to 3. ROSA final scores ranged in magnitude from 1 to 10, with each successive score representing an increased presence of risk factors. Total body discomfort and ROSA final scores for 72 office workstations were significantly correlated (R = 0.384). ROSA final scores exhibited high inter- and intra-observer reliability (ICCs of 0.88 and 0.91, respectively). Mean discomfort increased with increasing ROSA scores, with a significant difference occurring between scores of 3 and 5 (out of 10). A ROSA final score of 5 might therefore be useful as an action level indicating when immediate change is necessary. ROSA proved to be an effective and reliable method for identifying computer use risk factors related to discomfort. Copyright © 2011 Elsevier Ltd and The Ergonomics Society. All rights reserved.
Samuel, Anbu Jeba Sunilson John; Mohan, Syam; Chellappan, Dinesh Kumar; Kalusalingam, Anandarajagopal; Ariamuthu, Saraswathi
2012-05-07
The roots of Hibiscus vitifolius Linn. (Malvaceae) is used for the treatment of jaundice in the folklore system of medicine in India. This study is an attempt to evaluate the hepatoprotective activity of the roots of Hibiscus vitifolius against anti-tubercular drug induced hepatotoxicity. Hepatotoxicity was induced in albino rats of either sex by oral administration of a combination of three anti-tubercular drugs. Petroleum ether, chloroform, methanol and aqueous extracts of roots of Hibiscus vitifolius (400mg/kg/day) were evaluated for their possible hepatoprotective potential. All the extracts were found to be safe up to a dose of 2000mg/kg. Among the four extracts studied, oral administration of methanol extract of Hibiscus vitifolius at 400mg/kg showed significant difference in all the parameters when compared to control. There was a significant (PHibiscus vitifolius have potent hepatoprotective activity, thereby justifying its ethnopharmacological claim. Copyright © 2012 Elsevier Ireland Ltd. All rights reserved.
Hibiscus syriacus Extract from an Established Cell Culture Stimulates Skin Wound Healing
di Martino, O.; Tito, A.; De Lucia, A.; Cimmino, A.; Cicotti, F.; Apone, F.; Colucci, G.; Calabrò, V.
2017-01-01
Higher plants are the source of a wide array of bioactive compounds that support skin integrity and health. Hibiscus syriacus, family Malvaceae, is a plant of Chinese origin known for its antipyretic, anthelmintic, and antifungal properties. The aim of this study was to assess the healing and hydration properties of H. syriacus ethanolic extract (HSEE). We established a cell culture from Hibiscus syriacus leaves and obtained an ethanol soluble extract from cultured cells. The properties of th...
The Hibiscus panduriformis complex (Malvaceae) in Australia
Juswara, L.S.; Craven, L.A.
2005-01-01
The Hibiscus panduriformis Burm.f. species complex in Australia is revised. Six species are recognised, of which one is the widespread H. panduriformis; one, H. austrinus, is based upon H. panduriformis var. australis; and four represent new species, H. apodus, H. calcicola, H. fluvialis, and H.
A significant work on callus induction and somatic embryogenesis was realized for Hibiscus sabdariffa. Two genotypes (Hibiscus sabdariffa and Hibiscus sabdariffa var. altissima) two sugars (sucrose and glucose) and three concentrations (1 %, 2%, 3%) of each sugar, 3 explant types (root, hypocotyl, c...
Análisis de la evapotranspiración real en el cultivo de rosa
Esmeral Vargas, Yullayma Rosa
2011-01-01
La estimación de la evapotranspiración real, (ETc), para el cultivo de rosa (Rosa sp) constituye un elemento fundamental para lograr un uso eficiente del agua y un manejo adecuado del riego para el sector floricultor en Colombia. El objetivo de este trabajo fue determinar la ETc de Rosa (Rosa Sp) con técnicas de cultivo sin suelo bajo invernadero en la Sabana de Bogotá empleando el método de balance de agua diario. El diseño experimental fue completamente aleatorio. Se utilizaron tres tipos ...
The flower of Hibiscus trionum is both visibly and measurably iridescent.
Vignolini, Silvia; Moyroud, Edwige; Hingant, Thomas; Banks, Hannah; Rudall, Paula J; Steiner, Ullrich; Glover, Beverley J
2015-01-01
Living organisms can use minute structures to manipulate the reflection of light and display colours based on interference. There has been debate in recent literature over whether the diffractive optical effects produced by epoxy replicas of petals with folded cuticles persist and induce iridescence in the original flowers when the effects of petal pigment and illumination are taken into account. We explored the optical properties of the petal of Hibiscus trionum by macro-imaging, scanning and transmission electron microscopy, and visible and ultraviolet (UV) angle-resolved spectroscopy of the petal. The flower of Hibiscus trionum is visibly iridescent, and the iridescence can be captured photographically. The iridescence derives from a diffraction grating generated by folds of the cuticle. The iridescence of the petal can be quantitatively characterized by spectrometric measurements with several square-millimetres of sample area illuminated. The flower of Hibiscus trionum has the potential to interact with its pollinators (honeybees, other bees, butterflies and flies) through iridescent signals produced by its cuticular diffraction grating. © 2014 The Authors. New Phytologist © 2014 New Phytologist Trust.
The Aqueous Calyx Extract of Hibiscus sabdariffa Lowers Blood ...
African Journals Online (AJOL)
olayemitoyin
Pressure and Heart Rate via Sympathetic Nervous System. Dependent ... discharge of the sympathetic nervous system. Keywords: Hibiscus ... The constituents of HS include protein, fat, ... Talata Mafara central market, Zamfara state, Nigeria.
Kumar, Neeraj; Bhandari, Pamita; Singh, Bikram; Bari, Shamsher S
2009-02-01
Roses are one of the most important groups of ornamental plants and their fruits and flowers are used in a wide variety of food, nutritional products and different traditional medicines. The antioxidant activity of methanolic extracts from fresh flowers of three rose species (Rosa damascena, Rosa bourboniana and Rosa brunonii) was evaluated by 1,1-diphenyl-2-picryl hydrazyl (DPPH) free-radical method. The ability to scavenge DPPH radical was measured by the discoloration of the solution. The methanolic extract from R. brunonii exhibited maximum free-radical-scavenging activity (64.5+/-0.38%) followed by R. bourboniana (51.8+/-0.46%) and R. damascena (43.6+/-0.25%) at 100 microg/ml. Simultaneously, ultra-performance liquid chromatography coupled with electrospray ionization-quadrupole time-of-flight mass spectrometry (UPLC-ESI-QTOF-MS) was used to study phenolic composition in the methanolic extracts from the fresh flowers of rose species. The phenolic constituents were further investigated by direct infusion-ESI-QTOF-MS/MS in negative ion mode. Characteristic Electrospray ionization tandem mass spectrometry (ESI-MS/MS) spectra with other diagnostic fragment ions generated by retro Diels-Alder (RDA) fragmentation pathways were recorded for the flavonoids. Distinct similarities were observed in the relative distribution of polyphenolic compounds among the three species. The dominance of quercetin, kaempferol and their glycosides was observed in all the three species.
Preliminary characterization of residual biomass from Hibiscus ...
African Journals Online (AJOL)
Hibiscus sabdariffa calyces are mainly used for different agro-food and beverages applications. The residual biomass generated contains various useful substances that were extracted and characterized. It contained 23% (w/w) soluble pectic material, a food additive, extracted with hot acidified water (80°C, pH = 1.5) and ...
Detection of somaclonal variation in micropropagated Hibiscus ...
African Journals Online (AJOL)
The main objective of micropropagation is to produce clones i.e. plants which are phenotypically and genetically identical to the mother plants. The culture of organized meristems usually guarantees the production of true-to-type plants but variations in the progenies have been widely reported. Hibiscus sabdariffa L. plants ...
Aqueous extract of Hibiscus sabdarrifa calyx alleviates anemia and ...
African Journals Online (AJOL)
Aqueous extract of Hibiscus sabdarrifa calyx alleviates anemia and organ damage in Trypanosoma brucei brucei infected rats. IA Umar, E Daikwo, NG Maryoms, A Gidado, LB Buratai, FS Saka, MA Ibrahim ...
Bioremediation of textile effluent polluted soil using kenaf ( Hibiscus ...
African Journals Online (AJOL)
Bioremediation of textile effluent polluted soil using kenaf ( Hibiscus cannabinus Linn.) and composted ... Journal of Applied Sciences and Environmental Management. Journal Home ... Twelve-litre plastic pots were filled with 10 kg soil.
Indoor Air Purification by Potted Plants
DEFF Research Database (Denmark)
Dela Cruz, Majbrit
by allowing air exchange and continuous emission of a VOC or VOC mixture. The system was operational in dynamic and semi-dynamic mode which highlighted that experimental set-up can affect calculated removal rates. With exposure to toluene Hibiscus rosa-sinensis was not affected by an increase in light...
The genus Hibiscus (family Malvaceae) includes more than 250 species that vary from annual to perennial herbs, and shrubs to small trees that are native to tropical, sub-tropical and temperate climates. A study in 2010-2011 examined viruses associated with symptoms observed on hibiscus plants in It...
Diuretic effect of compounds from Hibiscus sabdariffa by modulation of the aldosterone activity.
Jiménez-Ferrer, Enrique; Alarcón-Alonso, Javier; Aguilar-Rojas, Arturo; Zamilpa, Alejandro; Jiménez-Ferrer C, Itzia; Tortoriello, Jaime; Herrera-Ruiz, Maribel
2012-12-01
Recent studies of Hibiscus sabdariffa Linn. have demonstrated that it presents diuretic, natriuretic, and potassium sparing effects. However, the mechanism that induces these effects has not yet been elucidated. The aim of this study was to explore the possible mechanism of action for the diuretic effect of Hibiscus sabdariffa extract and its fractions.The aqueous extract from this plant and the fractions obtained with solvents of different polarities were administered to adrenalectomized rats, and the diuretic effect was measured in the presence of deoxycorticosterone acetate (aldosterone analog).The effect on renal filtration was also evaluated in an in situ kidney model, and finally, the effect of diuretic active extracts on gene expression of the alpha subunit from the transporter (αENaC) of renal epithelial cell was quantified. The subsequent results were obtained: The aqueous extract of Hibiscus sabdariffa presented the following chemical composition, 32.4 mg/g delphinidin-3-O-sambubioside, 11.5 mg/g cyanidin-3-O-sambubioside, 11.5 mg/g quercetin, and chlorogenic acid 2.7 mg/g. The concentration of anthocyanins was diminished until disappearance due to decrease of the polarity of the solvents used in the extraction process, in contrast to the flavonoids and chlorogenic acid, which had their concentration increased. The diuretic effect caused by adrenalectomy in rats was reversed by deoxycorticosterone acetate activity. However, the effect of deoxycorticosterone acetate was antagonized by spironolactone, the aqueous extract of Hibiscus sabdariffa, and the acetonitrile : methanol 5 : 5 mixture extract, administered orally. A similar effect was observed on renal filtration obtained from the isolated kidney model.When the gene expression levels of αENaC was measured in adrenalectomized rats, it was observed that spironolactone, the aqueous extract of Hibiscus sabdariffa, the acetonitrile : methanol 5 : 5 mixture, as well as the
Face and Convergent Validity of Persian Version of Rapid Office Strain Assessment (ROSA Checklist
Directory of Open Access Journals (Sweden)
Afrouz Armal
2016-01-01
Full Text Available Objective: The aim of this work was the translation, cultural adaptation and validation of the Persian version of the Rapid Office Stress Assessment (ROSA checklist. Material & Methods: This methodological study was conducted according of IQOLA method. 100 office worker were selected in order to carry out a psychometric evaluation of the ROSA checklist by performing validity (face and convergent analyses. The convergent validity was evaluated using RULA checklist. Results: Upon major changes made to the ROSA checklist during the translation/cultural adaptation process, face validity of the Persian version was obtained. Spearman correlation coefficient between total score of ROSA check list and RULA checklist was significant (r=0.76, p<0.0001. Conclusion: The results indicated that the translated version of the ROSA checklist is acceptable in terms of face validity, convergent validity in target society, and hence provides a useful instrument for assessing Iranian office workers
Susan E. Meyer
2008-01-01
The genus Rosa is found primarily in the North Temperate Zone and includes about 200 species, with perhaps 20 that are native to the United States (table 1). Another 12 to 15 rose species have been introduced for horticultural purposes and are naturalized to varying degrees. The nomenclature of the genus is in a state of flux, making it difficult to number the species...
Adetutu, Adewale; Owoade, Abiodun O.
2013-01-01
Aims: Hibiscus sabdariffa is a medicinal plant that is consumed for its health benefits in Africa. The study was designed to investigate the hepatoprotective potentials of Hibiscus polyphenolic rich extract (HPE), (a group of phenolic compounds occurring in the dried calyx of Hibiscus sabdariffa) against CCl4-induced damaged in rats. Place and Duration of Study: Department of Biochemistry, Ladoke Akintola University of Technology, Ogbomosho, Nigeria, between January 2011 and June 2012. Method...
International Nuclear Information System (INIS)
1976-12-01
Results of the ROSA-II test simulating a loss-of-coolant accident in a light water reactor (LWR) are presented, including the test conditions and interpretation of the phenomena for test runs 411, 314, 315 and 316. (auth.)
Bioremediation of textile effluent polluted soil using kenaf (Hibiscus ...
African Journals Online (AJOL)
DR BADA
Bioremediation of textile effluent polluted soil using kenaf (Hibiscus cannabinus Linn.) and composted ... Lead, Cadmium, Chromium and Zinc levels in plants and soil were determined using Atomic ..... Contaminated land in the EC: Report of ...
Protective influence of Hibiscus sabdariffa , an edible medicinal ...
African Journals Online (AJOL)
The present study was undertaken to examine the protective influence of the alcoholic leaf extract of Hibiscus sabdariffa (Linn) Malvaceae (an indigenous edible medicinal plant used in Ayurvedic and traditional Medicine in India, China and Thailand) on oxidative stress during ammonium chloride induced ...
Oppression and Revolt in Chimamanda Adichie's Purple Hibiscus ...
African Journals Online (AJOL)
This paper examines the oppressive practice of Chimamanda Adichie's character – Eugene in Purple Hibiscus on members of his nuclear family. This oppression endangers normal familial relationship as the oppressed view their oppression as an infringement on their fundamental human rights. Therefore, they express ...
Microbial contaminants of cultured Hibiscus cannabinus and Telfaria ...
African Journals Online (AJOL)
Nine microbial contaminants comprising of five bacteria and four fungi species were isolated from Hibiscus cannabinus and Telfaria occidentalis cultured tissues. The rate of occurrence of bacteria isolates was higher than that of fungi. The bacterial isolates includes Pseudomonas syringae pv phaseolicoli, Bacillus ...
Phytomining of heavy metals from soil by Hibiscus radiatus using phytoremediationtechnology (Part-2)
Panchal, K. J.; Subramanian, R. B.; Gohil, T. P.
2017-12-01
Metal ions are not only valuable intermediates in metal extraction, but also important raw materials fortechnical applications. They possess some unique but, identical physical and chemical properties, whichmake them useful probes of low temperature geochemical reactions. Heavy metals are natural constituentsof the earth's crust, but indiscriminate human activities have drastically altered their geochemical cyclesand biochemical balance. Metal concentration in soil typically ranges from less than one to as high as100,000 mg/kg. Heavy metal contaminations of land resources continue to be the focus of numerousenvironmental studies and attract a great deal of attention worldwide. This is attributed to nobiodegradabilityand persistence of heavy metals in soils. Prolonged exposure to heavy metals such ascadmium, copper, lead, nickel, and zinc can cause deleterious health effects in humans. Complexation,separation, and removal of metal ions have become increasingly attractive areas of research and have ledto new technical developments like phytoremediation that has numerous biotechnological implications ofunderstanding of plant metal accumulation. Hibiscus radiatus is newly identified as a potential heavymetal hypreaccumulator. In this study Hibiscus radiatus was subjected for in vitro heavy metalaccumulation, to explore the accumulation pattern of four heavy metals viz Cadmium, Lead, Nickel andZinc in various parts of Hibiscus radiatus plant parts. Translocation of metals in Hibiscus radiatus plant parts from soil makes this plant an eligible candidate to remove heavy metals from soil.
Studies on the chemical constituents, antioxidants and membrane ...
African Journals Online (AJOL)
The chemical constituents, antioxidant and membrane stability activities of Hibiscus rosa sinensis Linn. (Malvaceae) flower were determined. The total anthocyanin was 165 mg / kg with about 6 % reduction due to fermentation. Tannin, ascorbic acid, and total polyphenol were 11.8 g / kg; 478 mg / kg; and 14.4 mg / g, ...
Zanotti, Stefano; Canalis, Ernesto
2016-05-01
Activation of Notch1 in osteocytes of Rosa(Notch) mice, where a loxP-flanked STOP cassette and the Nicd coding sequence were targeted to the reverse orientation splice acceptor (Rosa)26 locus, causes osteopetrosis associated with suppressed Sost expression and enhanced Wnt signaling. To determine whether Sost downregulation mediates the effects of Notch activation in osteocytes, Rosa(Notch) mice were crossed with transgenics expressing Cre recombinase or SOST under the control of the dentin matrix protein (Dmp)1 promoter. Dmp1-SOST transgenics displayed vertebral osteopenia and a modest femoral cancellous and cortical bone phenotype, whereas hemizygous Dmp1-Cre transgenics heterozygous for the Rosa(Notch) allele (Dmp1-Cre;Rosa(Notch)) exhibited osteopetrosis. The phenotype of Notch activation in osteocytes was prevented in Dmp1-Cre;Rosa(Notch) mice hemizygous for the Dmp1-SOST transgene. The effect was associated with downregulated Notch signaling and suppressed Dmp1 and Rosa26 expression. To test whether SOST regulates Notch expression in osteocytes, cortical bone cultures from Dmp1-Cre;Rosa(Notch) mice or from Rosa(Notch) control littermates were exposed to recombinant human SOST. The addition of SOST had only modest effects on Notch target gene mRNA levels and suppressed Dmp1, but not Cre or Rosa26, expression. These findings suggest that prevention of the Dmp1-Cre;Rosa(Notch) skeletal phenotype by Dmp1-SOST is not secondary to SOST expression but to interactions among the Dmp1-SOST and Dmp1-Cre transgenes and the Rosa26 locus. In conclusion, the Dmp1-SOST transgene suppresses the expression of the Dmp1-Cre transgene and of Rosa26. © 2015 Wiley Periodicals, Inc.
Radical Scavenging Activity From Ethanolic Extract Of Malvaceae Family’s Flowers
Artanti, A. N.; Rahmadanny, N.; Prihapsara, F.
2018-04-01
Sea hibiscus flower (Hibiscus tiliaceus L.), shoe flower (Hibiscus rosa-sinensis L.), and turk’s cap flower (Malvaviscus arboreus Cav.) are a plant that belongs to the same family, Malvaceae. There are expected contain of anthocyanins as active compound. Several studied shows that some flowers could protect human body from free radical danger exposure. This study has been done to examine ethanolic extract from malvaceae family’s which has potency as radical scavenger. Antiradical activity assay was determined by DPPH method with IC50 value as parameter. Based on the study the malvaceae family’s flower was contain of tannins, polyphenols, saponin, and anthocyanine. The radical scavenging activity respectively from the lowest to the higest activity are vitamin c (4,05 ppm ± 0,094), Turk’s cap flower (6,80 ppm ± 0,22), shoe flower (14,62 ppm ± 0,104) and sea hibiscus flower (38,8 ppm ± 0,086). The three of the extract was having strong antioxidant activity.
De roodrandzandbij Andrena rosae in de Zuid-Hollandse Biesbosch (Hymenoptera: Apoidea: Andrenidae).
Meer, van der F.; Reemer, M.; Peeters, T.M.J.
2006-01-01
Andrena rosae in the Zuid-Hollandse Biesbosch (Hymenoptera: Apoidea: Andrenidae) Andrena rosae is a fairly large, black and red mining bee. It has declined dramatically in the 20th century in northwestern Europe. In the Netherlands the species only survived in and around the Biesbosch, at the
Ramírez-Rodrigues, Milena M; Plaza, Maria L; Azeredo, Alberto; Balaban, Murat O; Marshall, Maurice R
2012-10-01
The effect of dense phase carbon dioxide (DPCD) processing (34.5 MPa, 8% CO₂, 6.5 min, and 40 °C) on phytochemical, sensory and aroma compounds of hibiscus beverage was compared to a conventional thermal process (HTST) (75 °C for 15 s) and a control (untreated beverage) during refrigerated storage (4 °C). The overall likeability of the hibiscus beverage for all treatments was not affected by storage up to week 5. DPCD process retained more aroma volatiles as compared to HTST. Aroma profiles in the beverages were mainly composed of alcohols and aldehydes with 1-octen-3-ol, decanal, octanal, 1-hexanol, and nonanal as the compounds with the highest relative percentage peak areas. A loss of only 9% anthocyanins was observed for the DPCD processed hibiscus beverage. Phytochemical profiles in the hibiscus beverage included caffeoylquinic acids, anthocyanins, and flavonols. No major changes in total phenolics and antioxidant capacity occurred during the 14 weeks of storage. Copyright © 2012 Elsevier Ltd. All rights reserved.
Nađpal, Jelena D; Lesjak, Marija M; Šibul, Filip S; Anačkov, Goran T; Četojević-Simin, Dragana D; Mimica-Dukić, Neda M; Beara, Ivana N
2016-02-01
The aim of this study was to compare phenolic profile, vitamin C content, antioxidant, anti-inflammatory and cytotoxic activity of rose hips and the preserves (purée and jam) of two Rosa species: renowned Rosa canina L. and unexplored Rosa arvensis Huds. The liquid chromatography-tandem mass spectrometry analysis of 45 phenolics resulted in quantification of 14 compounds, with quercitrin, gallic and protocatechuic acids as the most dominant. High antioxidant potential of R. canina and a moderate activity of R. arvensis extracts were determined through several assays. Purée of both species and methanol extract of air-dried R. canina hips showed some anti-inflammatory (cyclooxygenase-1 and 12-lipooxygense inhibition potency) activity. Purée of R. canina exerted cytotoxic activity only against the HeLa cell line among several others (HeLa, MCF7, HT-29 and MRC-5). The presented results support traditional use of rose hips and their fruit preserves as food with health and nutritional benefits. Copyright © 2015 Elsevier Ltd. All rights reserved.
Nishikawa, Tracy
2013-01-01
The Santa Rosa Plain is home to approximately half of the population of Sonoma County, California, and faces growth in population and demand for water. Water managers are confronted with the challenge of meeting the increasing water demand with a combination of water sources, including local groundwater, whose future availability could be uncertain. To meet this challenge, water managers are seeking to acquire the knowledge and tools needed to understand the likely effects of future groundwater development in the Santa Rosa Plain and to identify efficient strategies for surface- and groundwater management that will ensure the long-term viability of the water supply. The U.S. Geological Survey, in cooperation with the Sonoma County Water Agency and other stakeholders in the area (cities of Cotati, Rohnert Park, Santa Rosa, and Sebastopol, town of Windsor, Cal-American Water Company, and the County of Sonoma), undertook this study to characterize the hydrology of the Santa Rosa Plain and to develop tools to better understand and manage the groundwater system. The objectives of the study are: (1) to develop an updated assessment of the hydrogeology and geochemistry of the Santa Rosa Plain; (2) to develop a fully coupled surface-water and groundwater-flow model for the Santa Rosa Plain watershed; and (3) to evaluate the potential hydrologic effects of alternative groundwater-management strategies for the basin. The purpose of this report is to describe the surface-water and groundwater hydrology, hydrogeology, and water-quality characteristics of the Santa Rosa Plain watershed and to develop a conceptual model of the hydrologic system in support of the first objective. The results from completing the second and third objectives will be described in a separate report.
Chemical evaluation of three varieties of Roselle ( Hibiscus ...
African Journals Online (AJOL)
Chemical evaluation of three varieties of Roselle ( Hibiscus Sabdariffa L.) seeds. SO Babalola, OC Oworh, KO Alasiri, JA Adetunji. Abstract. No Abstract. Nigerian Journal of Horticultural Science Vol. 11 () 2006: pp.31-35. Full Text: EMAIL FULL TEXT EMAIL FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT.
Haematinic activity of Hibiscus Cannabinus | Agbor | African Journal ...
African Journals Online (AJOL)
The haematinic activity of an orally administered aqueous extract of Hibiscus cannabinus leaves was studied on haemolytic anaemic rats. Anaemia was induced by an oral administration of phenylhydrazine for a period of 8 days. Red blood cell count, haemoglobin concentration, and pack cell volume were analysed as ...
Anthocyanin content of two hibiscus sabdariffa cultivars grown
African Journals Online (AJOL)
Sukwattanasinit T., Burana-osot J., Sotanaphun. U. 2007. Spectrophotometric Method for. Quantitative Determination of Total. Anthocyanins and Quality Characteristics of Roselle (Hibiscus sabdariffa). Planta Med. 73 (14) : 1517 - 1522. Torres-Morán M.I., Escoto-Delgadillo M., Ron-Parra. J., Parra-Tovar G., Mena-Munguía ...
Variety of plant pathogens of ornamental shrubs of the genus Rosa L.
Directory of Open Access Journals (Sweden)
Marchenko Alla Borisovna
2015-12-01
In the Ukraine’s forest-steppe environment, over the years of research, the most common disease among different representatives of the genus Rosa L. is Diplocarpon rosae FA Wolf, about 52.7%. Diseases caused by Sphaerotheca pannosa var. rosae Woron account for 28.3%: Coniothyrium wernsdorffiae Laubert―19.2%; Botrytis cinerea Pers.―16.9%; Phragmidium mucronatum (Pers. Schltdl., Phragmidium tuberculatum Müll. Hal., Nectria cinnabarina (Tode Fr.―from 7.2 to 6.7%. Pathogens Alternaria alternata (Fr. Keissl., Alternaria tenuissima (Kunze Wiltshire, Fusarium oxysporum Schltdl., Fusarium solani (Mart. Sacc., Phytophthora cactorum J. Schröt., Verticillium dahliae Kleb., Verticillium albo-atrum Reinke Berthold are less common―5%.
Worawattananutai, Patsorn; Itharat, Arunporn; Ruangnoo, Srisopa
2014-08-01
Hibiscus sabdariffa (HS) leaves are a vegetable, which is used as a healthy sour soup for protection against chronic diseases in Thai traditional medicine. To investigate antioxidant, anti-inflammatory and cytotoxic activities of Hibiscus sabdariffa leave extracts from diferent extraction methods. Fresh and dry Hibiscus sabdariffa leaves were extracted by various methods such as maceration with 95% and 50% ethanol, squeeze, and boiling with water or decoction. All extracts were testedfor antioxidant activity by using DPPH radical scavenging assay, anti-inflammatory activity by determination on inhibitory effect of nitric oxide production on RAW264. 7 cell. Cytotoxic activity also tested against human prostate cancer cell line (PC-3) by using sulforhodamine B (SRB) assay. Total phenolic content determined by the Folin-Ciocalteu colorimetric method. The results found that the 95% ethanolic extract of Hibiscus sabdariffa dried leaves (HSDE95) showed the highest antioxidant activity with an EC50 of 34.51±2.62 μg/ml and had the highest phenolic content (57.00±3.73 mg GAE/g). HSDE95 also showed potent cytotoxicity against prostate cancer cell line with an IC50 of 8.58±0.68 μg/ml whereas HSDE95 and all of extracts ofHibiscus sabdariffa leaves had no anti-inflammatory activity. The obtained results revealed that HSDE95 extract showedpotent cytotoxic activity against prostate cancer cells but low antioxidant and anti-inflammatory activities. This extract should be further isolated as active compounds against prostate cancer.
Comparative Antioxidant Activity of Hibiscus sabdariffa and Ascorbic ...
African Journals Online (AJOL)
Lipid peroxidation is becoming a popular biological marker of oxidative stress. Hibiscus sabdariffa has been reported to serve as a herbal remedy for various disease conditions, but studies on its antioxidant activity and the extent to which it acts remain scarce. The antioxidant activity of H. sabdariffa aqueous extracts, ...
'USS Arizona' and 'USS California' tropical hibiscus (Hibiscus rosa-sinensis L.)
Both ‘USS Arizona’ and ‘USS California’ were selected for use as accent plants for patios, pools or other outside areas in climates with warm summers or as perennial flowering landscape shrubs in USDA hardiness zones 9 and 10. The cultivars were selected for their exceptional vibrant flowers, well-b...
Hibiscus laevis ‘LUFKIN WHITE’, a new hardy native ornamental hibiscus cultivar is recommended for trial by nurserymen and horticulturists as a summer flowering perennial landscape plant nationwide but is particularly adapted to conditions in the South. ‘LUFKIN WHITE’ was selected for its exception...
The Myth of "Rosa Parks the Tired." Teaching about Rosa Parks and the Montgomery Bus Boycott.
Kohl, Herbert
1993-01-01
Retells the story of Rosa Parks and the Montgomery (Alabama) bus boycott to reflect more accurately the cultural and historical background of the boycott and the conscious decision made by Mrs. Parks. Accurate examination of the story actually enhances a child's ability to identify with the issues and the protagonists. (SLD)
Domestic violence in Chimamanda Ngozi Adichie's Purple Hibiscus ...
African Journals Online (AJOL)
Gender-based violence is an issue that has become a part of modern society, cutting across cultures, race, ethnicity and status. In Adichie's Purple Hibiscus, gender-based violence manifests in the form of domestic violence, projected through the Eugene Achike family around whom the story, set in the eastern part of ...
Sogo, Takayuki; Terahara, Norihiko; Hisanaga, Ayami; Kumamoto, Takuma; Yamashiro, Takaaki; Wu, Shusong; Sakao, Kozue; Hou, De-Xing
2015-01-01
Delphinidin 3-sambubioside (Dp3-Sam), a Hibiscus anthocyanin, was isolated from the dried calices of Hibiscus sabdariffa L, which has been used for folk beverages and herbal medicine although the molecular mechanisms are poorly defined. Based on the properties of Dp3-Sam and the information of inflammatory processes, we investigated the anti-inflammatory activity and molecular mechanisms in both cell and animal models in the present study. In the cell model, Dp3-Sam and Delphinidin (Dp) reduced the levels of inflammatory mediators including iNOS, NO, IL-6, MCP-1, and TNF-α induced by LPS. Cellular signaling analysis revealed that Dp3-Sam and Dp downregulated NF-κB pathway and MEK1/2-ERK1/2 signaling. In animal model, Dp3-Sam and Dp reduced the production of IL-6, MCP-1 and TNF-α and attenuated mouse paw edema induced by LPS. Our in vitro and in vivo data demonstrated that Hibiscus Dp3-Sam possessed potential anti-inflammatory properties. © 2015 International Union of Biochemistry and Molecular Biology.
González Cepero, María C
2014-01-01
Se describen las principales características de la Flor de Jamaica (Hibiscus sabdariffa L.) así como el momento y la forma de evaluación The main characteristics of the Flor de Jamaica (Hibiscus sabdariffa L.) are described as well as the evaluation period and evaluation way
Hibiscus sabdariffa L. - a phytochemical and pharmacological review.
Da-Costa-Rocha, Inês; Bonnlaender, Bernd; Sievers, Hartwig; Pischel, Ivo; Heinrich, Michael
2014-12-15
Hibiscus sabdariffa L. (Hs, roselle; Malvaceae) has been used traditionally as a food, in herbal drinks, in hot and cold beverages, as a flavouring agent in the food industry and as a herbal medicine. In vitro and in vivo studies as well as some clinical trials provide some evidence mostly for phytochemically poorly characterised Hs extracts. Extracts showed antibacterial, anti-oxidant, nephro- and hepato-protective, renal/diuretic effect, effects on lipid metabolism (anti-cholesterol), anti-diabetic and anti-hypertensive effects among others. This might be linked to strong antioxidant activities, inhibition of α-glucosidase and α-amylase, inhibition of angiotensin-converting enzymes (ACE), and direct vaso-relaxant effect or calcium channel modulation. Phenolic acids (esp. protocatechuic acid), organic acid (hydroxycitric acid and hibiscus acid) and anthocyanins (delphinidin-3-sambubioside and cyanidin-3-sambubioside) are likely to contribute to the reported effects. More well designed controlled clinical trials are needed which use phytochemically characterised preparations. Hs has an excellent safety and tolerability record. Copyright © 2014 The Authors. Published by Elsevier Ltd.. All rights reserved.
Heat loss and fluid leakage tests of the ROSA-III facility
International Nuclear Information System (INIS)
Suzuki, Mitsuhiro; Tasaka, Kanji; Shiba, Masayoshi
1981-12-01
The report presents characteristic test results about the steady state heat loss, one of the inherent characteristics of the ROSA-III test facility. The steady state heat loss tests were conducted at five different temperature conditions between 111 0 C and 290 0 C . Net heat loss rates were obtained by estimating the electric power supplied to the core, heat input from the recirculation pumps and steam leakage rate. The heat loss characteristics have important contribution to analyses of the ROSA-III small break tests. A following simple relation was obtained between the net heat loss rate Q*sub(HL) (kJ/s) (*: radical) of the ROSA-III facility and the temperature difference ΔT ( 0 C) between the fluid temperature of the system and the room temperature, Q*sub(HL) = 0.56 x ΔT. (*: radical) And the steam leak flow at normal operating condition of the ROSA-III test, (P = 7.2 MPa) was obtained as 8.9 x 10 -3 kg/s and corresponding steam leakage energy as 10.5 kJ/s. The heat input from the recirculation pumps was indirectly estimated under a constant speed by assuming the heat input was equal to the brake horce power of the pumps. (author)
Photograph-based ergonomic evaluations using the Rapid Office Strain Assessment (ROSA).
Liebregts, J; Sonne, M; Potvin, J R
2016-01-01
The Rapid Office Strain Assessment (ROSA) was developed to assess musculoskeletal disorder (MSD) risk factors for computer workstations. This study examined the validity and reliability of remotely conducted, photo-based assessments using ROSA. Twenty-three office workstations were assessed on-site by an ergonomist, and 5 photos were obtained. Photo-based assessments were conducted by three ergonomists. The sensitivity and specificity of the photo-based assessors' ability to correctly classify workstations was 79% and 55%, respectively. The moderate specificity associated with false positive errors committed by the assessors could lead to unnecessary costs to the employer. Error between on-site and photo-based final scores was a considerable ∼2 points on the 10-point ROSA scale (RMSE = 2.3), with a moderate relationship (ρ = 0.33). Interrater reliability ranged from fairly good to excellent (ICC = 0.667-0.856) and was comparable to previous results. Sources of error include the parallax effect, poor estimations of small joint (e.g. hand/wrist) angles, and boundary errors in postural binning. While this method demonstrated potential validity, further improvements should be made with respect to photo-collection and other protocols for remotely-based ROSA assessments. Copyright © 2015 Elsevier Ltd and The Ergonomics Society. All rights reserved.
Comparative water relation of three varieties of Hibiscus cannabinus ...
African Journals Online (AJOL)
PROMOTING ACCESS TO AFRICAN RESEARCH ... Kenaf (Hibiscus cannabinus L.) is an industrial fiber crop that is being grown ... Throughout a period of 120 days, parameters of gas exchange characteristics were measured within four regular intervals of 30 days. ... EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT
Haematological effects of aqueous extract of Hibiscus Sabdariffa
African Journals Online (AJOL)
The present study was undertaken to investigate the effects of aqueous extract of Hibiscus sabdariffa petals on some haematological parameters. The extract was administered orally in doses of 0.5, 1.0 and 1.5mg/kg body weight to normal Wistar rats for 21 days. The results showed that the extract decreased significantly (p ...
Susanto, Dwi; Ibrahim, Ahmed Mahmood; Mat Hussin, Zeti Ermiena Surya
2013-01-01
Kenaf (Hibiscus cannabinus L.) is one of the important species of Hibiscus for human needs. It is annual upright plant that produces high biomass, has good adaptability to its environment and inexpensive to be grown. Kenaf has been cultivated in many countries since long time ago mainly for fibers. In Malaysia, however, this plant is considered new and cultivated especially in the eastern parts of Peninsular to replace tobacco plantations that have been no longer supported by the government. ...
Effects of Hibiscus sabdariffa L. on serum lipids: a systematic review and meta-analysis.
Aziz, Zoriah; Wong, Su Yuen; Chong, Nyuk Jet
2013-11-25
Prevention of cardiovascular disease by modifying its major risk factors, including serum cholesterol levels, is an important strategy. Hibiscus sabdariffa L. has been promoted for reducing cholesterol levels, but its reported impact on cholesterol levels has been inconsistent. The study aimed to assess systematically the evidence and quality of current research on the effect of Hibiscus sabdariffa L. on blood lipids and its adverse effects. Electronic databases were searched up to June 2013 for relevant randomised controlled trials (RCTs). Journals and conference proceedings were also searched. The quality of the selected trials was assessed using the Cochrane Risk of Bias Assessment Tool. The efficacy results of similar studies were pooled if they used the same comparator. Outcomes examined were levels of total cholesterol, high density lipoprotein cholesterol, low density lipoprotein cholesterol and triglycerides. Six studies involving 474 subjects met our inclusion criteria. These studies varied in terms of the types of interventions, comparators used, and duration of trials. Overall, Hibiscus sabdariffa L. did not produce any significant effect on any of the outcomes examined, when compared with placebo, black tea or diet. With short-term use it is well tolerated. The available evidence from RCTs does not support the efficacy of Hibiscus sabdariffa L. in lowering serum lipids. Further rigorously designed trials with larger sample sizes are warranted to confirm the effects of HS on serum lipids. © 2013 Elsevier Ireland Ltd. All rights reserved.
( Rosa damascena Mill.) by microbial inoculation
African Journals Online (AJOL)
This study was carried out to determine the effects of microbial inoculation in breaking seed dormancy and on the germination of Rosa damascena Mill. Seeds of R. damascena Mill. are the most used scented rose species in rose oil production. The most important production centers around the world are Turkey and ...
Anthocyanin content of two Hibiscus sabdariffa cultivars grown in ...
African Journals Online (AJOL)
Anthocyanin content of Hibiscus sabdariffa calyces was determined to compare two cultivars from Senegal called Koor and Vimto. Results showed a significant difference in terms of total anthocyanin content (TA) and relative abundance (RA) of anthocyanin species. Values of TA for Vimto were 3-fold higher than Koor's.
Protective role of aqueous extract of Hibiscus sabdariffa (calyx ...
African Journals Online (AJOL)
USER
2010-05-24
May 24, 2010 ... of electron on the electron transport chain. There is a dose-dependent relationship between lipid peroxidation induced by potassium bromate and the protection offered by the extract of H. sabdariffa. REFERENCES. Alli MB, Salih M (1991). Investigation of the antispasmodic potential of. Hibiscus sabdariffa ...
The Aqueous Calyx Extract of Hibiscus sabdariffa Lowers Blood ...
African Journals Online (AJOL)
Summary: The antihypertensive effect of Hibiscus sabdariffa (HS) has been validated in animals and man. This study tested the hypothesis that its hypotensive effect may be sympathetically mediated. The cold pressor test (CPT) and handgrip exercise (HGE) were performed in 20 healthy subjects before and after the oral ...
Effect of Hibiscus sabdariffa on Blood Pressure and Electrolyte ...
African Journals Online (AJOL)
Effect of Hibiscus sabdariffa on Blood Pressure and Electrolyte Profile of Mild to Moderate Hypertensive Nigerians: A Comparative Study with Hydrochlorothiazide. ... Aim: The aim of this study is to investigate the effect of HS consumption on blood pressure (BP) and electrolytes of mild to moderate hypertensive Nigerians ...
Fermentation potentials of Citrus limon and Hibiscus sabdariffa juice ...
African Journals Online (AJOL)
This study aimed to determine the fermentation potentials of yeast isolates from Citrus limon and Hibiscus sabdariffa for the fermentation of juice extracts of C. limon and H. sabdariffa. Isolation and morphological studies of yeast cells were carried out by standard protocols. Fourier Transform Infra-red (FT-IR) ...
Lipophilization and MS characterization of the main anthocyanins purified from hibiscus flowers.
Grajeda-Iglesias, Claudia; Salas, Erika; Barouh, Nathalie; Baréa, Bruno; Figueroa-Espinoza, Maria Cruz
2017-09-01
Hibiscus sabdariffa flowers represent an interesting source of anthocyanins, one of the most important plant pigments, which are responsible of the intense red color of the calyces, and have potential as natural colorants for food applications. Nevertheless, anthocyanins are highly hydrosoluble and unstable compounds. On this basis, the aim of this work was to increase the lipophilicity of the hibiscus anthocyanins by lipophilization, in order to obtain amphiphilic colorants, which could be easily incorporated in lipid-rich food matrices. Octanoyl derivatives of delphinidin-3-O-sambubioside and cyanidin-3-O-sambubioside were chemically obtained for the first time, and characterized by means of HPLC-ESI-MS data. Copyright © 2017. Published by Elsevier Ltd.
Fraile, Benito; Alcover, Javier; Royuela, Mar; Rodríguez, David; Chaves, Concepción; Palacios, Ricardo; Piqué, Núria
2017-06-01
To assess the properties of a medical device containing xyloglucan, propolis and hibiscus to create a bioprotective barrier to avoid the contact of uropathogenic Escherichia coli strains on cell walls in models of intestinal (CacoGoblet) and uroepithelial (RWPE-1) cells (derived from normal human prostate epithelium). Two uropathogenic E. coli strains (expressing type 1 fimbriae and P fimbriae) were used to assess, by electronic microscopy and ELISA, the barrier properties of the medical device. The antimicrobial activity was assessed in broth dilution assays. The three components (xyloglucan, propolis and hibiscus) did not alter E. coli cell integrity in intestinal and uroepithelial cell models and were devoid of antibacterial activity. The three components avoided bacterial contact in both cell monolayers. The nonpharmacological barrier properties of xyloglucan, propolis and hibiscus confirm the role of the medical device for the management of urinary tract infections.
Expression of transgenes targeted to the Gt(ROSA26Sor locus is orientation dependent.
Directory of Open Access Journals (Sweden)
Douglas Strathdee
2006-12-01
Full Text Available Targeting transgenes to a chosen location in the genome has a number of advantages. A single copy of the DNA construct can be inserted by targeting into regions of chromatin that allow the desired developmental and tissue-specific expression of the transgene.In order to develop a reliable system for reproducibly expressing transgenes it was decided to insert constructs at the Gt(ROSA26Sor locus. A cytomegalovirus (CMV promoter was used to drive expression of the Tetracycline (tet transcriptional activator, rtTA2(s-M2, and test the effectiveness of using the ROSA26 locus to allow transgene expression. The tet operator construct was inserted into one allele of ROSA26 and a tet responder construct controlling expression of EGFP was inserted into the other allele.Expression of the targeted transgenes was shown to be affected by both the presence of selectable marker cassettes and by the orientation of the transgenes with respect to the endogenous ROSA26 promoter. These results suggest that transcriptional interference from the endogenous gene promoter or from promoters in the selectable marker cassettes may be affecting transgene expression at the locus. Additionally we have been able to determine the optimal orientation for transgene expression at the ROSA26 locus.
El duelo y el tiempo mítico en Rosa Cuchillo y La hora azul
Torres Oyarce, Tania
2017-01-01
In this paper, I propose that the novels Rosa Cuchillo and La hora azulproject individual processes of mourning in a mythical social order thatlimits itself to reproduce the phantom of the enclosed nation (Ubilluz) asa (seudo) proposal to solve the internal conflict that took place in Perubetween 1980-2000. In Rosa Cuchillo the main character, Rosa Cuchillo,goes through a process of mourning due to the loss of his terrorist son,Liborio, whereas in La hora azul the main character, Adrián Ormac...
Study of the hibiscus esculentus mucilage coagulation–flocculation ...
African Journals Online (AJOL)
The flocculent activity of Hibiscus esculentus (gombo) mucilage traditionally used for a local beer (Tchapalo) clarification in Côte d\\'Ivoire was studied using the method of the experimental designs. Of the three factors selected that are the volume of mucilage (X1), the temperature (X2) and the pH (X3), sole X1 and X3 ...
International Nuclear Information System (INIS)
Farooq, A.; Khan, M.; Riaz, A.; Ali, A.
2011-01-01
For the perfume industry, Rosa damascena is the most important species used in the production of rose attar which is made by distilling volatile oils from the petals of flowers. It is also used widely in the production of rose water, a flavoring agent. Other species like R. gallica L., R. centifolia L., R. bourboniana and Gruss an Teplitz also exhibit the fragrance that is sought by perfumeries in the world. Eight land races of Damask rose along with related Rosa species were collected from Punjab province and evaluated to determine the diversity on the basis of morphology and oil yield. The investigated characters were flower weight, flower diameter, peduncle length, number of petals, number of stamens and oil content. Pearson's coefficients showed a negative association of flower weight with peduncle length (r = -0.3348) and a positive and strong correlation was observed for flower weight with the all other morphological characters. Flower diameter showed a positive but weak correlation with peduncle length, number of petals and number of stamens with the values of r = 0.0733, r 0.5302 and r = 0.1241, respectively. Oil content (%) was measured from the Rosa species by using Soxhlet extractor with N-hexane. R. damascena land race from Choha Syedan Shah produced the highest oil content of absolute oil (0.147%) on petal basis while the lowest value for absolute oil content was 0.36% from R. indica. Dendrogram created by cluster analysis for morphological characters, indicated no relationship of genetic variation with their collection sites. This study has revealed that the selection of land races for their specific characteristic could be possible for future breeding program. It also provides practical information for the future collection of Damask rose germplasm and breeding program. (author)
Effect of aqueous extract of Hibiscus sabdariffa Calyces on anaemia ...
African Journals Online (AJOL)
The effect of aqueous extract of Hibiscus sabdariffa Calyces on anaemia-induced and normal wistar albino rats were investigated using standard protocols. The haematological parameters which include haemoglobin concentration, packed cell volume, erythrocyte sedimentation rate, Red Blood Cell count and White Blood ...
Woottisin, Surachet; Hossain, Rayhan Zubair; Yachantha, Chatchai; Sriboonlue, Pote; Ogawa, Yoshihide; Saito, Seiichi
2011-01-01
We evaluated the antilithic effect of Orthosiphon grandiflorus, Hibiscus sabdariffa and Phyllanthus amarus extracts on known risk factors for calcium oxalate stones in rats. We divided 30 male Wistar rats into 5 equal groups. Controls were fed a standard diet and the remaining groups received a 3% glycolate diet for 4 weeks to induce hyperoxaluria. One glycolate fed group served as the untreated group and the others were given oral extracts of Orthosiphon grandiflorus, Hibiscus sabdariffa or Phyllanthus amarus at a dose of 3.5 mg daily. We collected 24-hour urine and blood samples. Kidneys were harvested for histological examination. We measured the renal tissue content of calcium and oxalate. The Hibiscus sabdariffa group showed significantly decreased serum oxalate and glycolate, and higher oxalate urinary excretion. The Phyllanthus amarus group showed significantly increased urinary citrate vs the untreated group. Histological examination revealed less CaOx crystal deposition in the kidneys of Hibiscus sabdariffa and Phyllanthus amarus treated rats than in untreated rats. Those rats also had significantly lower renal tissue calcium content than untreated rats. All parameters in the Orthosiphon grandiflorus treated group were comparable to those in the untreated group. Hibiscus sabdariffa and Phyllanthus amarus decreased calcium crystal deposition in the kidneys. The antilithic effect of Hibiscus sabdariffa may be related to decreased oxalate retention in the kidney and more excretion into urine while that of Phyllanthus amarus may depend on increased urinary citrate. In contrast, administering Orthosiphon grandiflorus had no antilithic effect. Copyright © 2011 American Urological Association Education and Research, Inc. Published by Elsevier Inc. All rights reserved.
Takayama, Koji; Ohi-Toma, Tetsuo; Kudoh, Hiroshi; Kato, Hidetoshi
2005-04-01
Abstract Two woody Hibiscus species co-occur in the Bonin Islands of the northwestern Pacific Ocean: Hibiscus glaber Matsum. is endemic to the islands, and its putative ancestral species, Hibiscus tiliaceus L., is widely distributed in coastal areas of the tropics and subtropics. To infer isolating mechanisms that led to speciation of H. glaber and the processes that resulted in co-occurrence of the two closely related species on the Bonin Islands, we conducted molecular phylogenetic analyses on chloroplast DNA (cpDNA) sequences. Materials collected from a wide area of the Pacific and Indian Oceans were used, and two closely related species, Hibiscus hamabo Siebold Zucc. and Hibiscus macrophyllus Roxb., were also included in the analyses. The constructed tree suggested that H. glaber has been derived from H. tiliaceus, and that most of the modern Bonin populations of H. tiliaceus did not share most recent ancestry with H. glaber. Geographic isolation appears to be the most important mechanism in the speciation of H. glaber. The co-occurrence of the two species can be attributed to multiple migrations of different lineages into the islands. While a wide and overlapping geographical distribution of haplotypes was found in H. tiliaceus, localized geographical distribution of haplotypes was detected in H. glaber. It is hypothesized that a shift to inland habitats may have affected the mode of seed dispersal from ocean currents to gravity and hence resulted in geographical structuring of H. glaber haplotypes.
Hritcu, Lucian; Foyet, Harquin Simplice; Stefan, Marius; Mihasan, Marius; Asongalem, Acha Emmanuel; Kamtchouing, Pierre
2011-09-01
While the Hibiscus asper Hook.f. (Malvaceae) is a traditional herb largely used in tropical region of the Africa as vegetable, potent sedative, tonic and restorative, anti-inflammatory and antidepressive drug, there is very little scientific data concerning the efficacy of this. The antioxidant and antiapoptotic activities of the methanolic extract of Hibiscus asper leaves (50 and 100 mg/kg) were assessed using superoxide dismutase (SOD), glutathione peroxidase (GPX) and catalase (CAT) specific activities, total glutathione (GSH) content, malondialdehyde (MDA) level (lipid peroxidation) and DNA fragmentation assays in male Wistar rats subjected to unilateral 6-hydroxydopamine (6-OHDA)-lesion. In 6-OHDA-lesioned rats, methanolic extract of Hibiscus asper leaves showed potent antioxidant and antiapoptotic activities. Chronic administration of the methanolic extract (50 and 100 mg/kg, i.p., daily, for 7 days) significantly increased antioxidant enzyme activities (SOD, GPX and CAT), total GSH content and reduced lipid peroxidation (MDA level) in rat temporal lobe homogenates, suggesting antioxidant activity. Also, DNA cleavage patterns were absent in the 6-OHDA-lesioned rats treated with methanolic extract of Hibiscus asper leaves, suggesting antiapoptotic activity. Taken together, our results suggest that the methanolic extract of Hibiscus asper leaves possesses neuroprotective activity against 6-OHDA-induced toxicity through antioxidant and antiapoptotic activities in Parkinson's disease model. Copyright © 2011 Elsevier Ireland Ltd. All rights reserved.
Ojeda, Deyanira; Jiménez-Ferrer, Enrique; Zamilpa, Alejandro; Herrera-Arellano, Armando; Tortoriello, Jaime; Alvarez, Laura
2010-01-08
The beverages of Hibiscus sabdariffa calyces are widely used in Mexico as diuretic, for treating gastrointestinal disorders, liver diseases, fever, hypercholesterolemia and hypertension. Different works have demonstrated that Hibiscus sabdariffa extracts reduce blood pressure in humans, and recently, we demonstrated that this effect is due to angiotensin converting enzyme (ACE) inhibitor activity. The aim of the current study was to isolate and characterizer the constituents responsible of the ACE activity of the aqueous extract of Hibiscus sabdariffa. Bioassay-guided fractionation of the aqueous extract of dried calyces of Hibiscus sabdariffa using preparative reversed-phase HPLC, and the in vitro ACE Inhibition assay, as biological monitor model, were used for the isolation. The isolated compounds were characterized by spectroscopic methods. The anthocyanins delphinidin-3-O-sambubioside (1) and cyanidin-3-O-sambubioside (2) were isolated by bioassay-guided purification. These compounds showed IC(50) values (84.5 and 68.4 microg/mL, respectively), which are similar to those obtained by related flavonoid glycosides. Kinetic determinations suggested that these compounds inhibit the enzyme activity by competing with the substrate for the active site. The competitive ACE inhibitor activity of the anthocyanins 1 and 2 is reported for the first time. This activity is in good agreement with the folk medicinal use of Hibiscus sabdariffa calyces as antihypertensive. Copyright 2009 Elsevier Ireland Ltd. All rights reserved.
Effects of aqueous extract of Hibiscus sabdariffa calyces on ...
African Journals Online (AJOL)
The effect of aqueous extract of Hibiscus sabdariffa calyces on the haematological profile of normal male albino rats was investigated for 28 days using standard methods. The rats were divided into five groups comprising of the control group, I; which received equal volume of distilled water and four treatment groups, II, III, ...
El duelo y el tiempo mítico en Rosa Cuchillo y La hora azul
Torres Oyarce, Tania
2017-01-01
En este artículo, sostenemos que las novelas Rosa Cuchillo y La hora azul proyectan procesos individuales de duelo en un orden social mítico que se limita a reproducir el fantasma de la nación cercada (Ubilluz) como (seudo) propuesta de solución al conflicto armado acontecido en el Perú entre 1980-2000. En Rosa Cuchillo, la protagonista Rosa Cuchillo atraviesa un proceso de duelo por haber perdido a su hijo subversivo, Liborio, mientras que, en La hora azul, el protagonista Adrián Ormache suf...
Rasdhari, M; Parekh, T; Dave, N; Patel, V; Subhash, R
2008-09-01
The present investigation was carried out to examine the effect of Hibiscus sabdariffa Calyx extract on the physico-chemical properties, sensory attributes, texture and microbial analysis of L. casei incorporated in probiotic yoghurt after manufacture and during storage. Incorporation of Hibiscus sabdariffa Calyx extract into the probiotic yoghurt resulted into decrease in coagulation time by 25 min. The pH ranged from 4.39 to 4.59, TA 0.81 to 1.14%, moisture 3.05 to 3.37 g%, syneresis 18.85 to 24.90 mL/50 g of sample, % inhibition 12.32 to 59.43, TS 21.27 to 24.90 g% and beta-galactosidase activity 1.041 to 3.277. The protein content ranged between 4.11 and 4.14 g% while the fat content ranged between 3.43 and 3.49 g%. No major changes in sensory evaluation were observed on the day of manufacture and during storage for 7 days. Sabdariffa added yoghurt showed a higher score in almost all sensory attributes. Microbial analysis showed a total plate count ranging from 1.8 x 10(4) to 1.85 x 10(7) cfu mL(-1). Yeast and mold counts were negligible in the Sabdariffa yoghurts. Thus the study concludes that incorporation of Hibiscus sabdariffa extract in yoghurt improved the total antioxidant property, organoleptic qualities and decreased the exudation of whey proteins (Syneresis). Thus, Hibiscus sabdariffa Calyces has beneficial influence on the quality of L. casei incorporated probiotic yoghurt.
Free radical scavenging activities of pigment extract from Hibiscus ...
African Journals Online (AJOL)
The macroporous resin adsorption method was used to purify the pigment from Hibiscus syriacus L. petals. Through the comparison of the adsorption and desorption rates of six types of macroporous resins including AB-8, S-8, NKA-9, DM-130, D101 and 860021 to the pigment, 860021 resin was selected as the most ...
Production of red wine from roselle (Hibiscus sabdariffa) and ...
African Journals Online (AJOL)
Red wine was produced from must formulated by mixing 10% (w/v) roselle calyces (Hibiscus sabdriffa var. sabdariffa) Hot water extract with pawpaw juice at the rate of 3:1. The must was formulated using a pure strain of Sacchromyces cerevisiae isolated from palm wine, propagated and pitched at a rate of 8% (v/v).
estimation of planting dates for roselle (hibiscus sabdariffa l.)
African Journals Online (AJOL)
thinkexploitsint'l
2011-06-11
Jun 11, 2011 ... 2012 to evaluate the effects of planting dates and accessions on the growth and performance of roselle (Hibiscus ... vegetables in soup making, green calyx roselle should be sown in May and harvested not later ... Roselle is native to the region that stretched from India to Malaysia and almost all parts of.
A survey of the microflora of Hibiscus sabdariffa (Roselle) and the ...
African Journals Online (AJOL)
hope&shola
2006-02-02
Feb 2, 2006 ... The dried calyx of Hibiscus sabdariffa (Roselle) is locally processed into a .... determined by perception with the sense organ upon opening a fresh .... Laboratory Zobo. Fresh. 2 wks old. Fresh. 2 wks old. Bacillus subtilis. +. +.
RETHINKING ROMANZO ROSA: THE FIRST PERSON NARRATOR ...
African Journals Online (AJOL)
User
marketing strategy elaborated during the interwar years and now in full ... For a comprehensive analysis of romanzo rosa, see also Pozzato (1982) and ... position of capturing the changing social climate and women's search for ... its name into Annabella in 1938, as a consequence of the campaign against ...... Milan: Net.
Kenaf (Hibiscus cannabinus L.) impact on post-germination seedling growth
The chemical interaction between plants, which is referred to as allelopathy, may result in the inhibition of plant growth and development. The objective of this research was to determine the impact of kenaf (Hibiscus cannabinus L.) plant extracts on the post-germination growth of five plant species...
Tocopherols in rose hips (Rosa spp.) during ripening.
Andersson, Staffan C; Olsson, Marie E; Gustavsson, Karl-Erik; Johansson, Eva; Rumpunen, Kimmo
2012-08-15
Rose hips are used as a food ingredient and in health products. They are rich in various bioactive compounds such as carotenoids and vitamin C, but data on their vitamin E content (tocopherols and tocotrienols) are limited. In this study, four different species of Rosa were analysed for tocopherol and tocotrienol content during ripening in three different years. Only α- and γ-tocopherol were found in the fleshy parts of the rose hips, and the tocopherol content and vitamin E activity varied depending on date of harvesting, species and year. The amount of vitamin E activity differed between species of Rosa and years, whereas the changes during ripening were relatively small. The choice of species must be considered if tocopherol content is to be optimised when rose hips are used as a food ingredient. Copyright © 2012 Society of Chemical Industry.
Grande Sertão: Veredas by João Guimarães Rosa
Directory of Open Access Journals (Sweden)
2013-07-01
Full Text Available "What is a translation that stalls comprehension?" asks Nancy Fumero in her introduction to Felipe W. Martinez' English-language renditions of João Guimarães Rosa's Portuguese poetics. In these translations (presented alongside the Portuguese originals Fumero argues that we encounter "a new form of translation that risks everything in order to encounter the same treacherous knowing Rosa had traversed."
Biologische beheersing wortelvlieg (Psila rosae) in 2009
Broek, van den R.C.F.M.; Gruppen, R.; Kamstra, J.H.
2010-01-01
Since 2007 Applied Plant Research (PPO) investigates whether the carrot root fly (Psila rosae) can be disorientated by applying strong smelling oils. A mature carrot root fly can find a carrot field by smell. The question is whether the smell of carrots may be masked by strong smelling oils so that
Effet de l'incorporation de graines d' Hibiscus Sabdariffa (Oseille de ...
African Journals Online (AJOL)
Effet de l'incorporation de graines d' Hibiscus Sabdariffa (Oseille de Guinée) dans l'alimentation sur quelques paramètres d'ingestion et de croissance du poulet en aviculture traditionnelle améliorée au Burkina Faso.
Qiu, Fen; Tian, Hui; Zhang, Zhi; Yuan, Xian-Ling; Tan, Yuan-Feng; Ning, Xiao-Qing
2013-10-01
To study the effects of hemostasis, analgesic and anti inflammation of the alcohol extract of Hibiscus tiliaceus and offer pharmacological and experimental basis for its safe and effective use in clinic. The effects of hemostasist were observed with tail breaking method, capillary tube method and slide method; Hot board and body distortion induced by acetic acid methods were applied in mice analgesia experiment, the mice model of acute auricle swelling induced by dmi ethylbenzene and capillary permeability induced by acetic acid were applied to observe the anti inflammatory effects. The alcohol extract of Hibiscus tiliaceus could significantly reduce the bleeding time and the clotting time, delay the plant reaction time and reduce the writhing times of the mice, and it also had effect on inhibiting swelling of mice ear and the permeability of the capillary. These results suggest that the alcohol extract of Hibiscus tiliaceus has the effects of hemostasis, analgesic and anti inflammation.
Effect of methanolic extract of Hibiscus sabdariffa in ethanol-induced ...
African Journals Online (AJOL)
The objective of this study was to evaluate the activity of Hibiscus sabdariffa on the liver of rats following repeated administration of ethanol. Hepatotoxicity was induced on the rats using ethanol and the levels of serum enzymes such as serum glutamic pyruvic transaminase (SGPT), serum glutamic oxaloacetic transaminase ...
Micro-element contents of roselle ( Hibiscus sabdariffa L.) at different ...
African Journals Online (AJOL)
In the western Sahel, leaves of Roselle (Hibiscus sabdariffa) have considerable economic importance because of their nutritional and medical uses. These plant organs are used to supplement nutrients provided by cereals such as millet and sorghum. However, there is a lack of information on the nutrient composition of ...
Miki ja Rosa hõivasid Tartu / Ants Juske
Juske, Ants, 1956-2016
2001-01-01
Lühidalt viiest kunstinäitusest - Vaikust lõhestas vali kärgatus (Peeter Allik), Küla, mida on põletanud punased õhtud (Imat Suumann), Rosa Permanente (Ruth Huimerind), Miki-Hiire kirik (Erki Meister, Christer Hägglund), Aledoia (Andrus Joonas)
Salvator Rosa's Democritus and Diogenes in Copenhagen
DEFF Research Database (Denmark)
Pedersen, Eva de la Fuente
2017-01-01
the aesthetic and the ethical in the artist and the work of art, to the melancholic temperament and to the concept of genius as is appeared within the art theoretical context of the day. The article shows that the two philosopher-paintings may have been included amongst what Salvator Rosa himself regarded...
Estimation of Planting Dates for Roselle ( Hibiscus sabdariffa L.) in ...
African Journals Online (AJOL)
In order to fill the gap existing between the production and consumption of roselle in the humid tropical areas of Nigeria, this experiment was carried out in Owerri between May and December, 2012 to evaluate the effects of planting dates and accessions on the growth and performance of roselle (Hibiscus sabdariffa).
Seed trichome variation in Hibiscus section Furcaria in East Africa ...
African Journals Online (AJOL)
The micromorphology of the seed trichomes in Hibiscus section Furcaria in Tropical East Africa was surveyed. The structure of the trichomes was found to be unique for each species examined, where such trichomes are present. Seed trichomes of specimens of H. altissimus Horny from the Kenya and Tanzania coasts were ...
The effect of aqueous extracts of Hibiscus sabdariffa (Sorrel) calyces ...
African Journals Online (AJOL)
The effect of aqueous extracts of Hibiscus sabdariffa (Sorrel) calyces on heamatological profile and organ pathological changes in Trypanasoma congolense – infected ... Consumption of the extract significantly (p<0.01) retarded the rate of weight gain in both healthy and infected rats; even though the feed-intake was not ...
Kobayashi, Toshihiro; Kato-Itoh, Megumi; Yamaguchi, Tomoyuki; Tamura, Chihiro; Sanbo, Makoto; Hirabayashi, Masumi; Nakauchi, Hiromitsu
2012-11-01
Recent discovery of a method for derivation and culture of germline-competent rat pluripotent stem cells (PSCs) enables generation of transgenic rats or knock-out rats via genetic modification of such PSCs. This opens the way to use rats, as is routine in mice, for analyses of gene functions or physiological features. In mouse or human, one widely used technique to express a gene of interest stably and ubiquitously is to insert that gene into the Rosa26 locus via gene targeting of PSCs. Rosa26 knock-in mice conditionally expressing a reporter or a toxin gene have contributed to tracing or ablation of specific cell lineages. We successfully identified a rat orthologue of the mouse Rosa26 locus. Insertion of tdTomato, a variant of red fluorescent protein, into the Rosa26 locus of PSCs of various rat strains allows ubiquitous expression of tdTomato. Through germline transmission of one Rosa26-tdTomato knock-in embryonic stem cell line, we also obtained tdTomato knock-in rats. These expressed tdTomato ubiquitously throughout their bodies, which indicates that the rat Rosa26 locus conserves functions of its orthologues in mouse and human. The new tools described here (targeting vectors, knock-in PSCs, and rats) should be useful for a variety of research using rats.
Effect of aqueous extracts of Hibiscus sabdariffa and Zingiber ...
African Journals Online (AJOL)
Effect of aqueous extracts of Hibiscus sabdariffa and Zingiber Officinale on blood cholesterol and glucose levels of rats. ... Subsequently, group 3 rats were given 0.8 ml/kg body weight of H. sabdarffa extract, while those in group 4 were given 0.2 ml Z. officinale extract/kg body weight. Rats in group 5 were given 1 ml of H.
Poovitha, Sundar; Stalin, Nithaniyal; Balaji, Raju; Parani, Madasamy
2016-12-01
The genus Hibiscus L. includes several taxa of medicinal value and species used for the extraction of natural dyes. These applications require the use of authentic plant materials. DNA barcoding is a molecular method for species identification, which helps in reliable authentication by using one or more DNA barcode marker. In this study, we have collected 44 accessions, representing 16 species of Hibiscus, distributed in the southern peninsular India, to evaluate the discriminatory power of the two core barcodes rbcLa and matK together with the suggested additional regions trnH-psbA and ITS2. No intraspecies divergence was observed among the accessions studied. Interspecies divergence was 0%-9.6% with individual markers, which increased to 0%-12.5% and 0.8%-20.3% when using two- and three-marker combinations, respectively. Differentiation of all the species of Hibiscus was possible with the matK DNA barcode marker. Also, in two-marker combinations, only those combinations with matK differentiated all the species. Though all the three-marker combinations showed 100% species differentiation, species resolution was consistently better when the matK marker formed part of the combination. These results clearly showed that matK is more suitable when compared to rbcLa, trnH-psbA, and ITS2 for species identification in Hibiscus.
El ritmo de intensidad en La rosa escrita de Xavier Abril
Directory of Open Access Journals (Sweden)
Óscar Coello
2011-07-01
Full Text Available Luego de las aventuras rítmicas practicadas por Abril en las más audaces posiciones de vanguardia, se produce una abjuración insólita –explicada luego metatextualmente– en la poiesis del artista, que lo regresa a los cauces de la elaboración versal tradicional. La rosa escrita es el poemario más emblemático de este retorno. La presente ponencia ejemplifica en un texto, a través del ritmo de intensidad, los pormenores de esta redención.Palabras claves: Xavier Abril, La rosa escrita, Vanguardia, ritmo.
Directory of Open Access Journals (Sweden)
Hansen, João Adolfo
2012-01-01
Full Text Available Guimarães Rosa relaciona a sua arte com a tradição literária brasileira e universal como autor de um ato que é simultaneamente estético e social. Essa relação é expressa através de uma forma literária que congrega a representação do sertão, uma referência principal; e a avaliação da mesma a partir de seu ponto de vista particular que é comunicado ao destinatário e ao leitor no estilo dos seus textos. Muitos textos críticos foram produzidos a respeito de Rosa e suas obras, mas uma questão crítica pertinente hoje, depois de muita interpretação de conteúdos, é a do sentido estético e político da intervenção da forma literária de Rosa no cânone
Johnson, Showande Segun; Oyelola, Fakeye Titilayo; Ari, Tolonen; Juho, Hokkanen
2013-01-01
Literature is scanty on the interaction potential of Hibiscus sabdariffa L., plant extract with other drugs and the affected targets. This study was conducted to investigate the cytochrome P450 (CYP) isoforms that are inhibited by the extract of Hibiscus sabdariffa L. in vitro. The inhibition towards the major drug metabolizing CYP isoforms by the plant extract were estimated in human liver microsomal incubations, by monitoring the CYP-specific model reactions through previously validated N-in-one assay method. The ethanolic extract of Hibiscus sabdariffa showed inhibitory activities against nine selected CYP isoforms: CYP1A2, CYP2A6, CYP2B6, CYP2C8, CYP2C9, CYP2C19, CYP2D6, CYP2E1 and CYP3A4. The concentrations of the extract which produced 50% inhibition of the CYP isoforms ranged from 306 µg/ml to 1660 µg/ml, and the degree of inhibition based on the IC50 values for each CYP isoform was in the following order: CYP1A2 > CYP2C8 > CYP2D6 > CYP2B6 > CYP2E1 > CYP2C19 > CYP3A4 > CYP2C9 > CYP2A6. Ethanolic extract of Hibiscus sabdariffa caused inhibition of CYP isoforms in vitro. These observed inhibitions may not cause clinically significant herb-drug interactions; however, caution may need to be taken in co-administering the water extract of Hibiscus sabdariffa with other drugs until clinical studies are available to further clarify these findings.
Data report on spray cooling test by ROSA-III, (1)
International Nuclear Information System (INIS)
Sobajima, Makoto; Murata, Hideo; Shiba, Masayoshi
1980-03-01
A separate effect test on spray cooling was carried out using one core channel of ROSA-III BWR LOCA test facility. This report describes a heating experiment in the series of runs. (1) The cooling from top of the core by spray easily causes countercurrent flow limit due to the vaparization of falling water itself, so it becomes in effective. (2) The cooling by falling water is irregular and unstable. Therefore, the cooling by the falling water is not to be relied on. (3) CCFL at porous plate is hard to occur, compared with single pipe. A quantitative study of this is desired to evaluate reflooding rate. Some suggestions for ROSA-III design are also made. (author)
Mil rosas roubadas, Work of Silviano Santiago a Bakhitinian Analysis
Directory of Open Access Journals (Sweden)
Renata Coelho Marchezan
2017-10-01
Full Text Available This article analyzes Mil rosas roubadas, written by Silviano Santiago in 2014, dealing with the notions of (autobiography, (autobiographical novel, metafiction and autofiction. Although the creation of this last word may indicate the existence of a new genre – it is even adopted by the writer himself to name his work –, the article shows the pertinence of placing Mil rosas roubadas in the route of the transformations and stylisations of the (autobiographical novel, such as examined by M. Bakhtin. The novel is, for Bakhtin, a genre without rigid forms, an unfinished genre, as it always follows the inflections of social life. In this way the ressemantization of the self, proposed by Silviano Santiago, is analyzed.
Aqueous Extracts of Hibiscus sabdariffa Calyces to Control Aichi Virus.
D'Souza, Doris H; Dice, Lezlee; Davidson, P Michael
2016-06-01
Aqueous Hibiscus sabdariffa extracts possess antimicrobial properties with limited information available on their antiviral effects. Aichi virus (AiV) is an emerging foodborne pathogen that causes gastroenteritis. Vaccines are currently unavailable to prevent their disease transmission. The objective of this study was to determine the antiviral effects of aqueous H. sabdariffa extracts against AiV. AiV at ~5 log PFU/ml was incubated with undiluted (200 mg/ml), 1:1 (100 mg/ml) or 1:5 (40 mg/ml) diluted aqueous hibiscus extract (pH 3.6), phosphate-buffered saline (pH 7.2 as control), or malic acid (pH 3.0, acid control) at 37 °C over 24 h. Treatments were stopped by serially diluting in cell-culture media containing fetal bovine serum and titers were determined using plaque assays on confluent Vero cells. Each treatment was replicated thrice and assayed in duplicate. AiV did not show any significant reduction with 1:1 (100 mg/ml) or 1:5 (40 mg/ml) diluted aqueous hibiscus extracts or malic acid after 0.5, 1, or 2 h at 37 °C. However, AiV titers were reduced to non-detectable levels after 24 h with all the three tested concentrations, while malic acid showed only 0.93 log PFU/ml reduction after 24 h. AiV was reduced by 0.5 and 0.9 log PFU/ml with undiluted extracts (200 mg/ml) after 2 and 6 h, respectively. AiV treated with 1:1 (100 mg/ml) and 1:5 (40 mg/ml) diluted extracts showed a minimal ~0.3 log PFU/ml reduction after 6 h. These extracts show promise to reduce AiV titers mainly through alteration of virus structure, though higher concentrations may have improved effects.
Genetic relationships among Rosa species based on random ...
African Journals Online (AJOL)
To investigate the genetic diversity of Rosa accessions, random amplified polymorphism DNA (RAPD) approach was employed. Nine of ten primers amplified 138 scorable RAPD loci with 111 polymorphic bands (80%). Percentages of polymorphic bands ranged from 75 to 100%. Sizes of amplified DNA fragments ranged ...
Adichie's Purple Hibiscus and issues of ideology in the constitution ...
African Journals Online (AJOL)
... as subjects, with the eventual emergence of Kambili to self-knowledge and condition of social responsibility. The aim of this is to examine how Adichie's Purple Hibiscus is typical of how the Nigerian novel engages itself in issues of ideology and how these issues, in turn, crystallize the challenges of nation-ness in Nigeria.
Ain, Quratul; Naveed, Muhammad Na; Mumtaz, Abdul Samad; Farman, Muhammad; Ahmed, Iftikhar; Khalid, Nauman
2015-09-01
Various species in genus Hibiscus are traditionally known for their therapeutic attributes. The present study focused on the phytochemical analysis of a rather unexplored species Hibiscus caesius (H. caesius), using high-pressure liquid chromatography coupled with mass spectrometry (HPLC-MS). The analysis revealed five major compounds in the aqueous extract, viz. vanillic acid, protocatechoic acid, quercetin, quercetin glucoside and apigenin, being reported for the first time in H. caesius. Literature suggests that these compounds have important pharmacological traits such as anti-cancer, anti-inflammatory, anti-bacterial and hepatoprotective etc. however, this requires further pharmacological investigations at in vitro and in vivo scale. The above study concluded the medicinal potential of H. caesius.
Deciduous shrubs for ozone bioindication: Hibiscus syriacus as an example
Energy Technology Data Exchange (ETDEWEB)
Paoletti, Elena [Institut Plant Protection (IPP), National Council Research (CNR), Via Madonna del Piano 10, 50019 Sesto Fiorentino, Florence (Italy)], E-mail: e.paoletti@ipp.cnr.it; Ferrara, Anna Maria [Istituto per le Piante da Legno e l' Ambiente (IPLA), Corso Casale 476, 10132 Turin (Italy); Calatayud, Vicent; Cervero, Julia [Fundacion C.E.A.M., Charles R. Darwin 14, Parc Tecnologic, 46980 Paterna, Valencia (Spain); Giannetti, Fabio [Istituto per le Piante da Legno e l' Ambiente (IPLA), Corso Casale 476, 10132 Turin (Italy); Sanz, Maria Jose [Fundacion C.E.A.M., Charles R. Darwin 14, Parc Tecnologic, 46980 Paterna, Valencia (Spain); Manning, William J. [Department of Plant, Soil and Insect Sciences, University of Massachusetts, Amherst, MA 01003-9320 (United States)
2009-03-15
Ozone-like visible injury was detected on Hibiscus syriacus plants used as ornamental hedges. Weekly spray of the antiozonant ethylenediurea (EDU, 300 ppm) confirmed that the injury was induced by ambient ozone. EDU induced a 75% reduction in visible injury. Injury was more severe on the western than on the eastern exposure of the hedge. This factor of variability should be considered in ozone biomonitoring programmes. Seeds were collected and seedlings were artificially exposed to ozone in filtered vs. not-filtered (+30 ppb) Open-Top Chambers. The level of exposure inducing visible injury in the OTC seedlings was lower than that in the ambient-grown hedge. The occurrence of visible injury in the OTC confirmed that the ozone sensitivity was heritable and suggested that symptomatic plants of this deciduous shrub population can be successfully used as ozone bioindicators. EDU is recommended as a simple tool for diagnosing ambient ozone visible injury on field vegetation. - An Italian population of the deciduous shrub Hibiscus syriacus, a common ornamental species in temperate zones, is recommended as ozone bioindicator.
Deciduous shrubs for ozone bioindication: Hibiscus syriacus as an example
International Nuclear Information System (INIS)
Paoletti, Elena; Ferrara, Anna Maria; Calatayud, Vicent; Cervero, Julia; Giannetti, Fabio; Sanz, Maria Jose; Manning, William J.
2009-01-01
Ozone-like visible injury was detected on Hibiscus syriacus plants used as ornamental hedges. Weekly spray of the antiozonant ethylenediurea (EDU, 300 ppm) confirmed that the injury was induced by ambient ozone. EDU induced a 75% reduction in visible injury. Injury was more severe on the western than on the eastern exposure of the hedge. This factor of variability should be considered in ozone biomonitoring programmes. Seeds were collected and seedlings were artificially exposed to ozone in filtered vs. not-filtered (+30 ppb) Open-Top Chambers. The level of exposure inducing visible injury in the OTC seedlings was lower than that in the ambient-grown hedge. The occurrence of visible injury in the OTC confirmed that the ozone sensitivity was heritable and suggested that symptomatic plants of this deciduous shrub population can be successfully used as ozone bioindicators. EDU is recommended as a simple tool for diagnosing ambient ozone visible injury on field vegetation. - An Italian population of the deciduous shrub Hibiscus syriacus, a common ornamental species in temperate zones, is recommended as ozone bioindicator
Effect of rosella ( Hibiscus sabdariffa L ) extract on glutathione-S ...
African Journals Online (AJOL)
Purpose: To determine the effect of rosella (Hibiscus sabdariffa L) extract on glutathione-S-trasferase (GST) activity and its hepatoprotective effect. Methods: A total of 25 rats were divided randomly into 5 groups (5 rats per group). Group I served as the baseline, group II was the negative control group, while groups III, IV and ...
Changes in the quality of zobo beverages produced from Hibiscus ...
African Journals Online (AJOL)
Quality changes in zobo beverage produced from Hibiscus sabdarifa during storage and the effects of extracts of ginger (Zingiber officinale) alone or in combination with refrigeration at 6C were evaluated for six (6) weeks duration. Results shows that the total viable bacterial count increased from 0.9 ± 0.01 log10 cfu/ml to ...
Therapeutic Applications of Rose Hips from Different Rosa Species.
Mármol, Inés; Sánchez-de-Diego, Cristina; Jiménez-Moreno, Nerea; Ancín-Azpilicueta, Carmen; Rodríguez-Yoldi, María Jesús
2017-05-25
Rosa species, rose hips, are widespread wild plants that have been traditionally used as medicinal compounds for the treatment of a wide variety of diseases. The therapeutic potential of these plants is based on its antioxidant effects caused by or associated with its phytochemical composition, which includes ascorbic acid, phenolic compounds and healthy fatty acids among others. Over the last few years, medicinal interest in rose hips has increased as a consequence of recent research that has studied its potential application as a treatment for several diseases including skin disorders, hepatotoxicity, renal disturbances, diarrhoea, inflammatory disorders, arthritis, diabetes, hyperlipidaemia, obesity and cancer. In this review, the role of different species of Rosa in the prevention of treatment of various disorders related to oxidative stress, is examined, focusing on new therapeutic approaches from a molecular point of view.
An overview of the HIBISCUS campaign
Pommereau, J.-P.; Garnier, A.; Held, G.; Gomes, A. M.; Goutail, F.; Durry, G.; Borchi, F.; Hauchecorne, A.; Montoux, N.; Cocquerez, P.; Letrenne, G.; Vial, F.; Hertzog, A.; Legras, B.; Pisso, I.; Pyle, J. A.; Harris, N. R. P.; Jones, R. L.; Robinson, A. D.; Hansford, G.; Eden, L.; Gardiner, T.; Swann, N.; Knudsen, B.; Larsen, N.; Nielsen, J. K.; Christensen, T.; Cairo, F.; Fierli, F.; Pirre, M.; Marécal, V.; Huret, N.; Rivière, E. D.; Coe, H.; Grosvenor, D.; Edvarsen, K.; di Donfrancesco, G.; Ricaud, P.; Berthelier, J.-J.; Godefroy, M.; Seran, E.; Longo, K.; Freitas, S.
2011-03-01
The EU HIBISCUS project consisted of a series of field campaigns during the intense convective summers in 2001, 2003 and 2004 in the State of São Paulo in Brazil. Its objective was to investigate the impact of deep convection on the Tropical Tropopause Layer (TTL) and the lower stratosphere by providing a new set of observational data on meteorology, tracers of horizontal and vertical transport, water vapour, clouds, and chemistry in the tropical Upper Troposphere/Lower Stratosphere (UT/LS). This was achieved using short duration research balloons to study local phenomena associated with convection over land, and long-duration balloons circumnavigating the globe to study the contrast between land and oceans. Analyses of observations of short-lived tracers, ozone and ice particles show strong episodic local updraughts of cold air across the lapse rate tropopause up to 18 or 19 km (420-440 K) in the lower stratosphere by overshooting towers. The long duration balloon and satellite measurements reveal a contrast between the composition of the lower stratosphere over land and oceanic areas, suggesting significant global impact of such events. The overshoots are shown to be well captured by non-hydrostatic meso-scale Cloud Resolving Models indicating vertical velocities of 50-60 m s-1 at the top of the Neutral Buoyancy Level (NBL) at around 14 km, but, in contrast, are poorly represented by global Chemistry-Transport Models (CTM) forced by Numerical Weather Forecast Models (NWP) underestimating the overshooting process. Finally, the data collected by the HIBISCUS balloons have allowed a thorough evaluation of temperature NWP analyses and reanalyses, as well as satellite ozone, nitrogen oxide, water vapour and bromine oxide measurements in the tropics.
Adeyemi, David O; Ukwenya, Victor O; Obuotor, Efere M; Adewole, Stephen O
2014-07-30
Flavonoid-rich aqueous fraction of methanolic extract of Hibiscus sabdariffa calyx was evaluated for its anti-hepatotoxic activities in streptozotocin-induced diabetic Wistar rats. Diabetes Mellitus was induced in Wistar rats by a single i.p injection of 80 mg/kg b.w. streptozotocin (STZ) dissolved in 0.1 M citrate buffer (pH 6.3). The ameliorative effects of the extract on STZ-diabetes induced liver damage was evident from the histopathological analysis and the biochemical parameters evaluated in the serum and liver homogenates. Reduced levels of glutathione (GSH), catalase (CAT), superoxide dismutase (SOD), and glutathione peroxidase (GPx) (3.76 ± 0.38 μM, 0.42 ± 0.04 U/L, 41.08 ± 3.04 U/ml, 0.82 ± 0.04 U/L respectively) in the liver of diabetic rats were restored to a near normal level in the Hibiscus sabdariffa-treated rats (6.87 ± 0.51 μM, 0.72 ± 0.06 U/L, 87.92 ± 5.26 U/ml, 1.37 ± 0.06 U/L respectively). Elevated levels of aspartate amino transferase (AST), alanine amino transferase (ALT) and alkaline phosphatase (ALP) in the serum of diabetic rats were also restored in Hibiscus sabdariffa -treated rats. Examination of stained liver sections revealed hepatic fibrosis and excessive glycogen deposition in the diabetic rats. These pathological changes were ameliorated in the extract-treated rats. The anti-hepatotoxic activity of Hibiscus sabdariffa extract in STZ diabetic rats could be partly related to its antioxidant activity and the presence of flavonnoids.
Directory of Open Access Journals (Sweden)
Kim Dong-soo
2009-12-01
Full Text Available Objective & Methods : The purpose of this study was to observe the effects of herbal-acupuncture with Rosae Laevigatae Fructus extact(RLF-HA at KI10(Umgok on osteoporosis in ovariectomized(OVX ddy mice. We carried out several experimental items to analyze the changes in body weight, uterine weight, uterus index, tibial length, the ash bone weight, tibial BMD, serum ALP, serum osteocalcin, serum Ca, and the levels of Ca, P, Ca/P ratio in tibia, and we performed histological and histomorphological analysis as well. Results : 1. Herbal-acupuncture with Rosae Laevigatae Fructus at KI10(Umgok and saline injection at KI10(Umgok significantly inhibited the reduction of tibial calcium level in ovariectomized mice. 2. Herbal-acupuncture with Rosae Laevigatae Fructus at KI10(Umgok significantly inhibited the increase of tibial osteoclast cells in ovariectomized mice. 3. Herbal-acupuncture with Rosae Laevigatae Fructus at KI10(Umgok significantly inhibited the reduction of tibial trabecular bone thickness(TBT in ovariectomized mice. 4. Herbal-acupuncture with Rosae Laevigatae Fructus at KI10(Umgok significantly inhibited the overgrowth of tibial growth plate length(GPL in ovariectomized mice. Conclusion : These results suggested that herbal-acupuncture with Rosae Laevigatae Fructus at KI10(Umgok has a therapeutic effect on osteoporosis, and to be put to practical use in the future osteoporosis clinic.
Recirculation pump suction line 2.8% break integral test at ROSA-III with HPCS failure, RUN 984
International Nuclear Information System (INIS)
Suzuki, Mitsuhiro; Anoda, Yoshinari; Tasaka, Kanji; Kumamaru, Hiroshige; Nakamura, Hideo; Yonomoto, Taisuke; Murata, Hideo; Shiba, Masayoshi
1984-06-01
This report presents the experimental data of 2.8% suction line break test RUN 984 at ROSA-III, which was conducted as one of counterpart tests to FIST program sponsored by GE, EPRI and USNRC. The similarity study between the ROSA-III and FIST tests is on the way. The report also presents the information on the ROSA-III test facility, experiment results and the effects of the ADS flow rate and the MSIV trip level comparing with the previously conducted ROSA-III small break tests, RUNs 920 and 922. Major conclusions obtained are as follows. (1) Change of the MSIV trip level from L2 to L1 gives delay of MSIV closure and longer actuation of pressure control system in a small break LOCA. (2) Larger ADS flow gives faster depressurization rate and earlier ECCS actuation, which results in shorter fuel rod dryout period and lower PCT. (author)
Kombucha Rosella (Hibiscus Sabdariffa Linn) dan Kemampuannya sebagai Antihiperkolesterolemia
Suhartatik, Nanik; Karyantina, Merkuria; Purwanti, Indrias Tri
2009-01-01
Kita mengenal adanya teh yang diekstrak dari kelopak bunga rosella (Hibiscus sabdariffa Linn). Teh jenis ini dapat dibuat menjadi kombucha dengan cara memfermentasikan ekstrak rosella menggunakan peran mikrobia dalam fer mentasi kombucha. Mikrobia dalam fermentasi kombucha ini ditumbuhkan dalam ekstrak rosella sebagai medium per tumbuhan dengan variasi konsentrasi rosella (30, 40, 50 gram rosella kering/L). Selama proses fermentasi, kombucha rosella dianalisis pH, total asam, dan aktivitas ...
Frank, Thomas; Janssen, Marlies; Netzel, Michael; Strass, Gabriele; Kler, Adolf; Kriesl, Erwin; Bitsch, Irmgard
2005-02-01
Pharmacokinetic parameters of several dietary anthocyanins following consumption of Hibiscus sabdariffa L. extract were determined in 6 healthy volunteers. Subjects were given a single oral dose of 150 mL of Hibiscus sabdariffa L. extract yielding 62.6 mg of cyanidin-3-sambubioside, 81.6 mg of delphindin-3-sambubioside, and 147.4 mg of total anthocyanins (calculated as cyanidin equivalents). Within 7 hours, the urinary excretion of cyanidin-3-sambubioside, delphinidin-3-sambubioside, and total anthocyanins (ie, the sum of all quantifiable anthocyanidin glycosides) was 0.016%, 0.021%, and 0.018% of the administered doses, respectively. Maximum excretion rates were determined at 1.5 to 2.0 hours after intake. The dose-normalized plasma area under the curve estimates were 0.076, 0.032, and 0.050 ng x h/mL/mg for cyanidin-3-sambubioside, delphinidin-3-sambubioside, and total anthocyanins, respectively. The dose-normalized C(max) estimates were 0.036, 0.015, and 0.023 ng/mL/mg in the same sequence. They were reached each at 1.5 hours (median) after intake. The geometric means of t1/2 were 2.18, 3.34, and 2.63 hours for cyanidin-3-sambubioside, delphinidin-3-sambubioside, and total anthocyanins, respectively. The urinary excretion of intact anthocyanins was fast and appeared to be monoexponential. To evaluate the contribution of anthocyanins to the health-protecting effects of Hibiscus sabdariffa L. extract, it will be necessary to perform further studies on both the intact glycosides and their in vivo metabolites or conjugates in human plasma and urine.
MORPHOLOGICAL AND MICROMORPHOLOGICAL INVESTIGATIONS REGARDING THE LEAVES OF SEVERAL ROSA L. SPECIES
Directory of Open Access Journals (Sweden)
Lidia ADUMITRESEI
2016-12-01
Full Text Available Multicellular secretory glands are present on Rosa L. species, at least on the stipellae edge; some of them have a larger number and different particularities. The researches have been made on leaves of the following species: Rosa agrestis, R. x damascena, R. multibracteata, R. pimpinellifolia and R. rubiginosa. Micromorphological studies emphasized a large number of cells which forming both terminal secretory part and foot, even though their dimensions are small. These researches highlight the micromorphological aspect of these glands, tector hairs and epicuticular wax. All of them were examined through scanning electron microscopy method.
FORMULATION AND EVALUATION OF A HERBAL SHAMPOO
Gouri Kumar Dash* and Noor Husna Nazirah Binti A. Razak
2017-01-01
The study was aimed at formulating and evaluating a complete herbal shampoo containing only traditionally used plant materials. The shampoo contained extracts of Hibiscus rosa-sinensis, Azadirachta indica, Trigonella foenumgraecum, Phyllanthus emblica, Sapindus mukorossi, Acacia concinna and fresh juice of Aloe vera. The physicochemical parameters such as colour, clarity, pH, skin irritation, percentage of solid contents, dirt dispersion, foaming ability and foam stability, wetting time and c...
Verification of a TRACE EPRTM model on the basis of a scaling calculation of an SBLOCA ROSA test
International Nuclear Information System (INIS)
Freixa, J.; Manera, A.
2011-01-01
Research highlights: → Verification of a TRACE input deck for the EPR TM generation III PWR. → Scaling simulation of an SBLOCA experiment of the integral test facility ROSA/LSTF. → The EPR TM model was compared with the TRACE results of the ROSA/LSTF model. - Abstract: In cooperation with the Finnish Radiation and Nuclear Safety Authority (STUK), a project has been launched at the Paul Scherrer Institute (PSI) aimed at performing safety evaluations of the Olkiluoto-3 nuclear power plant (NPP), the first EPR TM , a generation III pressurizer water reactor (PWR); with particular emphasis on small-and large-break loss-of-coolant-accidents (SB/LB-LOCAs) and main steam-line breaks. As a first step of this work, the best estimate system code TRACE has been used to develop a model of Olkiluoto-3. In order to test the nodalization, a scaling calculation from the rig of safety assessment (ROSA) test facility has been performed. The ROSA large scale test facility (LSTF) was built to simulate Westinghouse design pressurized water reactors (PWR) with a four-loop configuration. Even though there are differences between the EPR TM and the Westinghouse designs, the number of similarities is large enough to carry out scaling calculations on SBLOCA and LOCA cases from the ROSA facility; as a matter of fact, the main differences are located in the secondary side. Test 6-1 of the ROSA 1 programme, an SBLOCA with the break situated in the upper head of the reactor pressure vessel (RPV), was of special interest since a very good agreement with the experiment was obtained with a TRACE input deck. In order to perform such scaling calculation, the set-points of the secondary relief and safety valves in the EPR TM nodalization had to be changed to those used in the ROSA facility, the break size and the core power had to be scaled by a factor of 60 (according to the core power and core volume) and the pumps coast down had to be adapted to the ones of the test. The calculation showed
Directory of Open Access Journals (Sweden)
Rodrigo Castañeda
2015-11-01
Full Text Available a elevación de los lípidos sanguíneos se ha convertido en un riesgo común de enfermedades cardiovasculares,en especial en el caso del colesterol y triglicéridos, también a problemas pancreáticos, de la córnea, bazo e hígado.Hibiscus sabdariffa L., es una especie medicinal de la familia Malvaceae, su efecto sobre la reducción de los lípidos séricos se ha mencionado en varios estudios. El objetivo del presente estudio consistió en evaluar la actividad de un extracto acuoso de los cálices de H. sabdariffa, para reducir los lípidos séricos en dos grupos de individuos, con valores de triglicéridos mayores de 150 mg/dL, al recibir una dosis de 15 mg de antocianinas totales al día, dividida en tres veces, por un periodo de dos meses para establecer su influencia, dependiendo del momento de su administración, un grupo recibiéndola antes de la comida y otro durante la misma. El extracto de H. sabdariffa mostró un efecto hipotrigliceridémico significativo (p = 0.034, al finalizar el tratamiento, únicamente al administrar el extracto antes de las comidas. Al mismo tiempo, no se observó alteración en los niveles de colesterol total, colesterol contenido en las lipoproteínas de baja densidad y colesterol contenido en las proteínas de alta densidad en ninguno de los dos grupos evaluados. Los resultados sugieren que los extractos acuosos de H. sabdariffa podrían ser utilizados para ejercer una acción en los triglicéridos plasmáticos, dependiente del consumo de alimentos, y del momento de administración.
The fungal pathogen, Diplocarpon rosae Wolf, infects only roses (Rosa spp.) and leads to rose black spot disease. Rose black spot is the most problematic disease of outdoor grown roses worldwide, due to the potential for rapid leaf yellowing and defoliation. Plants repeatedly defoliated from black ...
The far East in the Poetry of Rosa Romojaro
Directory of Open Access Journals (Sweden)
Yanghongyi Ou
2016-05-01
Full Text Available The present article pays attention, in the first place, to the new conditions which provide a wide reception of the East Asian literature in the western area. Coming up next, in this context, a study of the poetries of Rosa Romojaro has been carried out, from the key points and compared motives, especially with the Chinese lyrical poetries and its tradition. After presenting the creative work of Rosa Romojaro, one of the most outstanding Spanish poets nowadays, standing on the point of view of a Chinese original critic, fundamental motives are given in advance in the chosen texts, and constantly linking with the Asian canon: so as the nature, and the degree of the symbolic subtlety in the writing of the poet according to the eastern point of view; the feeling of “Hen”, which contains the emotion of bittersweet and also associates with the passage of time; the essence of the poems and every word of hers, which is fulfilled with sentiments; the symbolism of the moon and its metaphorical reflections of the nocturne; the great motive of voyage and motions, and attached to them, the hope and the seasons, the fall; the adventure of discovery within the heart of the known places and the purity driven by her glance; the synesthetic evocations; and, lastly, the relationship of her poems with the vital prolongation, making up every poem of Rosa Romojaro in a center of expressivity shared with universal motives which look up to the tradition and the modernity.
ROSA-III 200% double-ended break integral test RUN 901
International Nuclear Information System (INIS)
Nakamura, Hideo; Tasaka, Kanji; Koizumi, Yasuo; Anoda, Yoshinari; Kumamaru, Hiroshige; Murata, Hideo; Suzuki, Mitsuhiro; Shiba, Masayoshi
1984-02-01
This report presents the experimental data of RUN 901, a 200% double-ended break test at the recirculation pump suction line with the ROSA-III test facility. The ROSA-III test facility is a volumetrically scaled (1/424) system of the BWR/6. The facility has the electrically heated core, the break simulator and the scaled ECCS (Emergency Core Cooling System). The MSIV closure and the ECCS actuation were tripped by the liquid level in the upper downcomer. The channel inlet flows were measured by differential pressure transducers installed at the channel inlet orifices of the fuel assembly No.4. The PCT (Peak Cladding Temperature) was 780 K occured during the blowdown phase in RUN 901. The whole core was quenched after the ECCS actuation and the effectiveness of ECCS has been confirmed. (author)
Directory of Open Access Journals (Sweden)
Kim Jungeun
2012-11-01
Full Text Available Abstract Background Roses (Rosa sp., which belong to the family Rosaceae, are the most economically important ornamental plants—making up 30% of the floriculture market. However, given high demand for roses, rose breeding programs are limited in molecular resources which can greatly enhance and speed breeding efforts. A better understanding of important genes that contribute to important floral development and desired phenotypes will lead to improved rose cultivars. For this study, we analyzed rose miRNAs and the rose flower transcriptome in order to generate a database to expound upon current knowledge regarding regulation of important floral characteristics. A rose genetic database will enable comprehensive analysis of gene expression and regulation via miRNA among different Rosa cultivars. Results We produced more than 0.5 million reads from expressed sequences, totalling more than 110 million bp. From these, we generated 35,657, 31,434, 34,725, and 39,722 flower unigenes from Rosa hybrid: ‘Vital’, ‘Maroussia’, and ‘Sympathy’ and Rosa rugosa Thunb. , respectively. The unigenes were assigned functional annotations, domains, metabolic pathways, Gene Ontology (GO terms, Plant Ontology (PO terms, and MIPS Functional Catalogue (FunCat terms. Rose flower transcripts were compared with genes from whole genome sequences of Rosaceae members (apple, strawberry, and peach and grape. We also produced approximately 40 million small RNA reads from flower tissue for Rosa, representing 267 unique miRNA tags. Among identified miRNAs, 25 of them were novel and 242 of them were conserved miRNAs. Statistical analyses of miRNA profiles revealed both shared and species-specific miRNAs, which presumably effect flower development and phenotypes. Conclusions In this study, we constructed a Rose miRNA and transcriptome database, and we analyzed the miRNAs and transcriptome generated from the flower tissues of four Rosa cultivars. The database provides a
Toxicity studies of the water extract from the calyces of Hibiscus ...
African Journals Online (AJOL)
Acute and chronic toxicities of the water extract from calyces of Hibiscus sabdariffa were studied in male and female rats. After 14 days of a single oral administration of test substance 5,000 mg/kg body weight, measurement of the body and organ weights, necropsy and health monitoring were performed. No signs and ...
Ajiboye, Taofeek O; Raji, Hikmat O; Adeleye, Abdulwasiu O; Adigun, Nurudeen S; Giwa, Oluwayemisi B; Ojewuyi, Oluwayemisi B; Oladiji, Adenike T
2016-03-30
The effect of Hibiscus sabdariffa calyx extract was evaluated in high-fructose-induced metabolic syndrome rats. Insulin resistance, hyperglycemia, dyslipidemia and oxidative rout were induced in rats using high-fructose diet. High-fructose diet-fed rats were administered 100 and 200 mg kg(-1) body weight of H. sabdariffa extract for 3 weeks, starting from week 7 of high-fructose diet treatment. High-fructose diet significantly (P Hibiscus extract. Overall, aqueous extract of H. sabdariffa palliates insulin resistance, hyperglycemia, dyslipidemia and oxidative rout in high-fructose-induced metabolic syndrome rats. © 2015 Society of Chemical Industry.
2012-06-21
...-AA00 Eighth Coast Guard District Annual Safety Zones; Sound of Independence; Santa Rosa Sound; Fort... Coast Guard will enforce a Safety Zone for the Sound of Independence event in the Santa Rosa Sound, Fort... during the Sound of Independence. During the enforcement period, entry into, transiting or anchoring in...
Spatial neutron kinetic module of ROSA code
International Nuclear Information System (INIS)
Cherezov, A.L.; Shchukin, N.V.
2009-01-01
A spatial neutron kinetic module was developed for computer code ROSA. The paper describes a numerical scheme used in the module for resolving neutron kinetic equations. Analytical integration for delayed neutrons emitters method and direct numerical integration method (Gear's method) were analyzed. The two methods were compared on their efficiency and accuracy. Both methods were verified with test problems. The results obtained in the verification studies were presented [ru
Directory of Open Access Journals (Sweden)
P. J. Weisser
1982-10-01
Full Text Available The destruction of the Phoenix!Hibiscus and Barringtonia racemosa Communities described by Venter in 1972 on the southern shores of Richards Bay is reported. The cause was the artificial openingof a new mouth about 5,5 km south of the original mouth, which increased tidal range and salinity. These swamp communities occupied a narrow band about 6 ha in area behind the Bruguiera gymnorrhiza Community. An estimated 95 % of the communities was affected and only on the landward border were some isolated remnants of species such as Acrostichum aureum, Hibiscus tiliaceus and Phoenix reclinata detected .Young stands of Phragmites australis, seedlings of Bruguiera gymnorrhiza and Avicennia marina and epipelic algae are recoIonizing the affected area.
ANALISIS POSTUR KERJA PADA PT. XYZ MENGGUNAKAN METODE ROSA (RAPID OFFICE STRAIN ASSESSMENT
Directory of Open Access Journals (Sweden)
Rosma Hani Damayanti
2014-06-01
Full Text Available Penggunaan teknologi informasi, dimana komputer sebagai medianya kini semakin meningkat. Frekuensi yang tinggi akan penggunaan komputer yang tidak memperhatikan sisi ergonomi dalam bekerja mengakibatkan adanya resiko yang dirasakan oleh pengguna. PT. XYZ merupakan salah satu perusahaan yang menggunakan komputer sebagai salah satu alat utama dalam bekerja. Pada penggunaannya karyawan pada Departemen Publishing merasakan keluhan pada punggung, pinggang, nyeri bahu, leher dan tangan. Keluhan yang dirasakan oleh pekerja pada Departemen publishing dapat diminimalkan dengan cara mengetahui dan mengidentifikasi postur kerja pada pekerja dalam menggunakan komputer. Identifikasi tersebut digunakan untuk mengetahui kondisi pekerja dan mengetahui penyebab keluhan yang dirasakan oleh pekerja untuk dilakukan perbaikan. Pada penelitian ini dilakukan analisis dengan menggunakan metode ROSA untuk mengurangi adanya keluhan yang dirasakan oleh pekerja pada Departemen publishing. ROSA merupakan salah satu metode pada office ergonomics, dimana penilaiannnya dirancang untuk mengukur resiko yang terkait dengan penggunaan komputer serta untuk menetapkan tingkat tindakan perubahan berdasarkan laporan dari ketidaknyamanan pekerja. Dengan menggunakan metode ROSA, dapat diketahui apakah postur kerja karyawan pada Departemen Publishing pada saat bekerja aman atau berbahaya. Hasil analisis postur kerja menggunakan metode ROSA pada Departemen Publishing menunjukkan bahwa seluruh pekerja yang menjadi sampel memiliki level resiko yang tinggi dan perlu dilakukan perbaikan segera. Perbaikan yang dapat dilakukan untuk mengurangi tingkat resiko yang dirasakan oleh pekerja yaitu dengan perbaikan fasilitas yang digunakan oleh pekerja yang sesuai dengan standar ergonomi, melakukan sosialisasi kepada pekerja tentang pentingnya ergonomi pada dunia kerja, dan sebaiknya pekerja melakukan istirahat atau peregangan otot minimal setiap tiga jam sekali.
ANALISIS POSTUR KERJA PADA PT. XYZ MENGGUNAKAN METODE ROSA (RAPID OFFICE STRAIN ASSESSMENT
Directory of Open Access Journals (Sweden)
Rosma Hani Damayanti
2014-06-01
Full Text Available Penggunaan teknologi informasi, dimana komputer sebagai medianya kini semakin meningkat. Frekuensi yang tinggi akan penggunaan komputer yang tidak memperhatikan sisi ergonomi dalam bekerja mengakibatkan adanya resiko yang dirasakan oleh pengguna. PT. XYZ merupakan salah satu perusahaan yang menggunakan komputer sebagai salah satu alat utama dalam bekerja. Pada penggunaannya karyawan pada Departemen Publishing merasakan keluhan pada punggung, pinggang, nyeri bahu, leher dan tangan. Keluhan yang dirasakan oleh pekerja pada Departemen publishing dapat diminimalkan dengan cara mengetahui dan mengidentifikasi postur kerja pada pekerja dalam menggunakan komputer. Identifikasi tersebut digunakan untuk mengetahui kondisi pekerja dan mengetahui penyebab keluhan yang dirasakan oleh pekerja untuk dilakukan perbaikan. Pada penelitian ini dilakukan analisis dengan menggunakan metode ROSA untuk mengurangi adanya keluhan yang dirasakan oleh pekerja pada Departemen publishing. ROSA merupakan salah satu metode pada office ergonomics, dimana penilaiannnya dirancang untuk mengukur resiko yang terkait dengan penggunaan komputer serta untuk menetapkan tingkat tindakan perubahan berdasarkan laporan dari ketidaknyamanan pekerja. Dengan menggunakan metode ROSA, dapat diketahui apakah postur kerja karyawan pada Departemen Publishing pada saat bekerja aman atau berbahaya. Hasil analisis postur kerja menggunakan metode ROSA pada Departemen Publishing menunjukkan bahwa seluruh pekerja yang menjadi sampel memiliki level resiko yang tinggi dan perlu dilakukan perbaikan segera. Perbaikan yang dapat dilakukan untuk mengurangi tingkat resiko yang dirasakan oleh pekerja yaitu dengan perbaikan fasilitas yang digunakan oleh pekerja yang sesuai dengan standar ergonomi, melakukan sosialisasi kepada pekerja tentang pentingnya ergonomi pada dunia kerja, dan sebaiknya pekerja melakukan istirahat atau peregangan otot minimal setiap tiga jam sekali.
Molecular characterization of ferulate 5-hydroxylase gene from kenaf (Hibiscus cannabinus L.)
The purpose of this research was to clone and characterize the expression pattern of a kenaf (Hibiscus cannabinus L.) F5H gene that encodes ferulate 5-hydroxylase in the phenylpropanoid pathway. Kenaf is well known as a fast growing dicotyledonous plant, which makes it a valuable biomass plant. The ...
Baliraine, F N; Bonizzoni, M; Guglielmino, C R; Osir, E O; Lux, S A; Mulaa, F J; Gomulski, L M; Zheng, L; Quilici, S; Gasperi, G; Malacrida, A R
2004-03-01
A set of 10 microsatellite markers was used to survey the levels of genetic variability and to analyse the genetic aspects of the population dynamics of two potentially invasive pest fruit fly species, Ceratitis rosa and C. fasciventris, in Africa. The loci were derived from the closely related species, C. capitata. The degree of microsatellite polymorphism in C. rosa and C. fasciventris was extensive and comparable to that of C. capitata. In C. rosa, the evolution of microsatellite polymorphism in its distribution area reflects the colonization history of this species. The mainland populations are more polymorphic than the island populations. Low levels of differentiation were found within the Africa mainland area, while greater levels of differentiation affect the islands. Ceratitis fasciventris is a central-east African species. The microsatellite data over the Uganda/Kenya spatial scale suggest a recent expansion and possibly continuing gene flow within this area. The microsatellite variability data from C. rosa and C. fasciventris, together with those of C. capitata, support the hypothesis of an east African origin of the Ceratitis spp.
Setenta anos depois: direitos autorais em Noel Rosa Seventy years later: Noel Rosa's copyrights
Directory of Open Access Journals (Sweden)
Daniel do Amaral Arbix
2008-06-01
Full Text Available Um regime ótimo de direitos autorais, ao tomar fundamento no estímulo ao desenvolvimento de novos bens intelectuais, depende de limites bem traçados. Este artigo procura aferir a funcionalidade desses direitos no que diz respeito a composições musicais, de sorte a avaliar, nesse campo específico, a maleabilidade da proteção aos direitos autorais e sua adequação à criação de novas obras. Para tanto, remete-se à experiência criativa de e sobre noel rosa, expoente do samba brasileiro. A marcada assunção de riscos por autores de obras derivadas, a formalização irregular das relações jurídicas entre titulares de direitos autorais e a profissionalização de determinados autores são constatadas como respostas diretas aos incentivos legais pertinentes. A incerteza decorrente dessas respostas expõe a dessintonia entre alguns dos objetivos das normas analisadas e seus efeitos práticos.An optimal copyright regime, based on fostering the development of new intellectual works, depends on well designed limitations. This article aims to analyze such rights' functionality with respect to musical works, in order to evaluate, in this field specifically, the flexibility of copyright protection and its adequacy for the creation of new works. To perform such task, the creative process of brazilian samba expert, noel rosa, is examined. A remarkable assumption of risks by derivative works' authors, the irregular formalization of legal relations between copyright owners and the profissionalization of certain authors are seen as direct answers to the legal incentives currently in force. The uncertainty derived from such answers exposes the tension between some of the analyzed norms' objectives and their actual effects.
Farag, Mohamed A; Rasheed, Dalia M; Kamal, Islam M
2015-12-01
Hibiscus sabdariffa (roselle) is a plant of considerable commercial importance worldwide as functional food due to its organic acids, mucilage, anthocyanins, macro and micro-nutrients content. Although Hibiscus flowers are emerging as very competitive targets for phytochemical studies, very little is known about their volatile composition and or aroma, such knowledge can be suspected to be relevant for understanding its olfactory and taste properties. To provide insight into Hibiscus flower aroma composition and for its future use in food and or pharmaceutical industry, volatile constituents from 2 cultivars grown in Egypt, viz. Aswan and Sudan-1 were profiled using solid-phase microextraction (SPME) coupled to GCMS. A total of 104 volatiles were identified with sugar and fatty acid derived volatiles amounting for the major volatile classes. To reveal for cultivar effect on volatile composition in an untargeted manner, multivariate data analysis was applied. Orthogonal projection to latent structures-discriminant analysis (OPLS-DA) revealed for 1-octen-3-ol versus furfural/acetic acid enrichment in Aswan and Sudan-1 cvs., respectively. Primary metabolites contributing to roselle taste and nutritional value viz. sugars and organic acids were profiled using GC-MS after silylation. The impact of probiotic bacteria on roselle infusion aroma profile was further assessed and revealed for the increase in furfural production with Lactobacillus plantarum inoculation and without affecting its anthocyanin content. This study provides the most complete map for volatiles, sugars and organic acids distribution in two Hibiscus flower cultivars and its fermented product. Copyright © 2015 Elsevier Ltd. All rights reserved.
Marsaro Júnior, A L; Peronti, A L B G; Penteado-Dias, A M; Morais, E G F; Pereira, P R V S
2013-05-01
The pink hibiscus mealybug (PHM), Maconellicoccus hirsutus (Green) (Hemiptera: Pseudococcidae) and the associated hymenopterous parasitoid, Anagyrus kamali Moursi, 1948 (Hymenoptera: Encyrtidae), are reported for the first time in Brazil. Specimens of the PHM were collected on nine hosts plants, Annona muricata L. (Anonnaceae), Glycine max (L.) Merr. (Fabaceae), Centrolobium paraensis Tul. (Fabaceae), Inga edulis Mart. (Fabaceae), Hibiscus rosa-sinensis L. (Malvaceae), Psidium guajava L. (Myrtaceae), Averrhoa carambola L. (Oxalidaceae), Citrus sinensis (L.) Osbeck (Rutaceae) and Solanum lycopersicum L. (Solanaceae), in four municipalities in the north-northeast of the state of Roraima. The plants C. paraensis, I. edulis and C. sinensis are recorded for the first time as a hosts for PHM. Characteristic injuries observed on the host plants infested by PHM and suggestions for its management are presented.
‘Hapa White’, 'Hapa Pink', and 'Hapa Red' interspecific hybrid hibiscus cultivars
Hibiscus mutabilis, also known as confederate rose, is native to southeastern China, but it is also grown as an ornamental throughout the southeastern United States and is hardy in USDA zone 7 to 9. It is popular for its large, soft, gray-green foliage during the summer, and large, showy flowers pro...
Post-test analysis of the ROSA/LSTF and PKL counterpart test
Energy Technology Data Exchange (ETDEWEB)
Carlos, S., E-mail: scarlos@iqn.upv.es [Departament d’Enginyeria Química i Nuclear, Universitat Politècnica de València, Camí de Vera, 14, València Spain (Spain); Querol, A., E-mail: anquevi@iqn.upv.es [Departament d’Enginyeria Química i Nuclear, Universitat Politècnica de València, Camí de Vera, 14, València Spain (Spain); Instituto de Seguridad Industrial, Radiofísica y Medioambiental, Universitat Politècnica de València, Camí de Vera, 14, València (Spain); Gallardo, S., E-mail: sergalbe@iqn.upv.es [Departament d’Enginyeria Química i Nuclear, Universitat Politècnica de València, Camí de Vera, 14, València Spain (Spain); Instituto de Seguridad Industrial, Radiofísica y Medioambiental, Universitat Politècnica de València, Camí de Vera, 14, València (Spain); Sanchez-Saez, F., E-mail: frasansa@etsii.upv.es [Departament d’Enginyeria Química i Nuclear, Universitat Politècnica de València, Camí de Vera, 14, València Spain (Spain); and others
2016-02-15
Highlights: • TRACE modelization for PKL and ROSA/LSTF installations. • Secondary-side depressurization as accident management action. • CET vs PCT relation. • Analysis of differences in the vessel models. - Abstract: Experimental facilities are scaled models of commercial nuclear power plants, and are of great importance to improve nuclear power plants safety. Thus, the results obtained in the experiments undertaken in such facilities are essential to develop and improve the models implemented in the thermal-hydraulic codes, which are used in safety analysis. The experiments and inter-comparisons of the simulated results are usually performed in the frame of international programmes in which different groups of several countries simulate the behaviour of the plant under the accidental conditions established, using different codes and models. The results obtained are compared and studied to improve the knowledge on codes performance and nuclear safety. Thus, the Nuclear Energy Agency (NEA), in the nuclear safety work area, auspices several programmes which involve experiments in different experimental facilities. Among the experiments proposed in NEA programmes, one on them consisted of performing a counterpart test between ROSA/LSTF and PKL facilities, with the main objective of determining the effectiveness of late accident management actions in a small break loss of coolant accident (SBLOCA). This study was proposed as a result of the conclusion obtained by the NEA Working Group on the Analysis and Management of Accidents, which analyzed different installations and observed differences in the measurements of core exit temperature (CET) and maximum peak cladding temperature (PCT). In particular, the transient consists of a small break loss of coolant accident (SBLOCA) in a hot leg with additional failure of safety systems but with accident management measures (AM), consisting of a fast secondary-side depressurization, activated by the CET. The paper
Post-test analysis of the ROSA/LSTF and PKL counterpart test
International Nuclear Information System (INIS)
Carlos, S.; Querol, A.; Gallardo, S.; Sanchez-Saez, F.
2016-01-01
Highlights: • TRACE modelization for PKL and ROSA/LSTF installations. • Secondary-side depressurization as accident management action. • CET vs PCT relation. • Analysis of differences in the vessel models. - Abstract: Experimental facilities are scaled models of commercial nuclear power plants, and are of great importance to improve nuclear power plants safety. Thus, the results obtained in the experiments undertaken in such facilities are essential to develop and improve the models implemented in the thermal-hydraulic codes, which are used in safety analysis. The experiments and inter-comparisons of the simulated results are usually performed in the frame of international programmes in which different groups of several countries simulate the behaviour of the plant under the accidental conditions established, using different codes and models. The results obtained are compared and studied to improve the knowledge on codes performance and nuclear safety. Thus, the Nuclear Energy Agency (NEA), in the nuclear safety work area, auspices several programmes which involve experiments in different experimental facilities. Among the experiments proposed in NEA programmes, one on them consisted of performing a counterpart test between ROSA/LSTF and PKL facilities, with the main objective of determining the effectiveness of late accident management actions in a small break loss of coolant accident (SBLOCA). This study was proposed as a result of the conclusion obtained by the NEA Working Group on the Analysis and Management of Accidents, which analyzed different installations and observed differences in the measurements of core exit temperature (CET) and maximum peak cladding temperature (PCT). In particular, the transient consists of a small break loss of coolant accident (SBLOCA) in a hot leg with additional failure of safety systems but with accident management measures (AM), consisting of a fast secondary-side depressurization, activated by the CET. The paper
Composition of the seed oil of Hibiscus abelmoschus L. (Malvaceae) growing in Vietnam
Dung, N.X.; Khien, P.V.; Nhuan, D.D.; Hoi, T.M.; Ban, N.K.; Leclercq, P.A.; Muselli, A.; Bighelli, A.; Casanova, J.
1999-01-01
The essential oils of ambrette (Hibiscus abelmoschus 1., syn. Abelmoschus moschatus) were produced from seeds collected in the different provinces of Vietnam. Five samples were investigated and 35 components were identified by a combination of high resolution GC, GC/MS and 13C-NMR spectrometry. The
Ifie, Idolo; Marshall, Lisa J; Ho, Peter; Williamson, Gary
2016-06-22
Three varieties of Hibiscus sabdariffa were analyzed for their phytochemical content and inhibitory potential on carbohydrate-digesting enzymes as a basis for selecting a variety for wine production. The dark red variety was chosen as it was highest in phenolic content and an aqueous extract partially inhibited α-glucosidase (maltase), with delphinidin 3-O-sambubioside, cyanidin 3-O-sambubioside, and 3-O-caffeoylquinic acid accounting for 65% of this activity. None of the varieties significantly inhibited α-amylase. Regarding Hibiscus sabdariffa wine, the effect of fermentation temperature (20 and 30 °C) on the physicochemical, phytochemical, and aroma composition was monitored over 40 days. The main change in phytochemical composition observed was the hydrolysis of 3-O-caffeolquinic acid and the concomitant increase of caffeic acid irrespective of fermentation temperature. Wine fermented at 20 °C was slightly more active for α-glucosidase inhibition with more fruity aromas (ethyl octanoate), but there were more flowery notes (2-phenylethanol) at 30 °C.
INHIBITION OF HUMAN LOW-DENSITY LIPOPROTEINS OXIDATION BY Hibiscus radiatus CUV. CALYCES EXTRACT
Directory of Open Access Journals (Sweden)
Hernawan Hernawan
2010-06-01
Full Text Available Hibiscus radiatus Cuv calyces extracts rich in polyphenols was screened for their potential to inhibit oxidation of human low-density lipoproteins-cholesterol (LDL-C in vitro. The inhibition of LDL-C oxidation (antioxidant activity was determined by measuring the formation of conjugated dienes and thiobarbituric acid reagent substances (TBARS. LDL-C oxidation was carried out in the presence of H. radiatus Cuv calyces extract (20 and 50 μM. CuSO4 (10 μM was used as the oxidation initiator and butylated hydroxytoluene (BHT at 50 μM was used as standard antioxidant. The protective effect of H. radiatus Cuv. calyces extract toward human low-density lipoproteins, complex lipid system was demonstrated by significant increase lag time (> 103 min, diminished of the propagation rate (44 %, and diminution of conjugated dienes formation 59.42 % (50 μM compared to control. Keywords: antioxidant, conjugated dienes, Hibiscus radiatus Cuv, low-density lipoproteins-cholesterol
Directory of Open Access Journals (Sweden)
Maria Kowalik
2015-08-01
Full Text Available Micromycetes inhabiting the leaves of 20 cultivars of climbing roses (Rosa L., grown in Botanic Garden of the Jagiellonian University in Cracow was investigated in the three successive years of research. Sixty-five taxa of of micromycetes was recorded with a few species dominating: Alternaria alternata, Epicoccum nigrum, Pestalotia rosae, Penicillium brevicompactum and Sordaria fimicola, accompanied by various other microfungi. A high abundance of rose black spot caused by Diplocarpon rosae was also observed. The affected leaves revealed advancing necrosis, substantially enhancing at the end of the growing season. Defoliation took place from June to October. Micromycetes inhabiting the leaves of climbing roses in Botanic Garden of the Jagiellonian University in Cracow considerably deteriorated the decorative aspect of the plants.
Antidepressant-like effects of methanol extract of Hibiscus tiliaceus flowers in mice
2012-01-01
Background Hibiscus tiliaceus L. (Malvaceae) is used in postpartum disorders. Our purpose was to examine the antidepressant, anxiolytic and sedative actions of the methanol extract of H. tiliaceus flowers using animal models. Methods Adult male Swiss albino mice were treated with saline, standard drugs or methanol extract of H. tiliaceus and then subjected to behavioral tests. The forced swimming and tail suspension tests were used as predictive animal models of antidepressant activity, where the time of immobility was considered. The animals were submitted to the elevated plus-maze and ketamine-induced sleeping time to assess anxiolytic and sedative activities, respectively. Results Methanol extract of H. tiliaceus significantly decreased the duration of immobility in both animal models of antidepressant activity, forced swimming and tail suspension tests. This extract did not potentiate the effect of ketamine-induced hypnosis, as determined by the time to onset and duration of sleeping time. Conclusion Our results indicate an antidepressant-like profile of action for the extract of Hibiscus tiliaceus without sedative side effect. PMID:22494845
Antidepressant-like effects of methanol extract of Hibiscus tiliaceus flowers in mice
Directory of Open Access Journals (Sweden)
Vanzella Cláudia
2012-04-01
Full Text Available Abstract Background Hibiscus tiliaceus L. (Malvaceae is used in postpartum disorders. Our purpose was to examine the antidepressant, anxiolytic and sedative actions of the methanol extract of H. tiliaceus flowers using animal models. Methods Adult male Swiss albino mice were treated with saline, standard drugs or methanol extract of H. tiliaceus and then subjected to behavioral tests. The forced swimming and tail suspension tests were used as predictive animal models of antidepressant activity, where the time of immobility was considered. The animals were submitted to the elevated plus-maze and ketamine-induced sleeping time to assess anxiolytic and sedative activities, respectively. Results Methanol extract of H. tiliaceus significantly decreased the duration of immobility in both animal models of antidepressant activity, forced swimming and tail suspension tests. This extract did not potentiate the effect of ketamine-induced hypnosis, as determined by the time to onset and duration of sleeping time. Conclusion Our results indicate an antidepressant-like profile of action for the extract of Hibiscus tiliaceus without sedative side effect.
CRED REA Algal Assessment, Santa Rosa Bank 2003 (NODC Accession 0010352)
National Oceanic and Atmospheric Administration, Department of Commerce — Twelve quadrats were sampled along 2 consecutively-placed, 25m transect lines as part of Rapid Ecological Assessments conducted at 2 sites at Santa Rosa Bank (off...
International Nuclear Information System (INIS)
Namatame, Ken; Kobayashi, Kensuke
1975-12-01
In the ROSA (Rig of Safety Assessment) program, the digital computer code DEPCO-SINGLE and DEPCO-MULTI (Subcooled Decompression Process in Loss-of-Coolant Accident - Single Pipe and - Multiple Pipe Network) were prepared to study thermo-hydraulic behavior of the primary coolant in subcooled decompression of the PWR LOCA. The analytical results with DEPCO-MULTI on the subcooled decompression phenomena are presented for ROSA-I, ROSA-II and LOFT 500, 600, 700 and 800 series experiments. The effects of space mesh length, elasticity of pressure boundary materials and simplification for computational piping system on the computed result are described. This will be the final work on the study of the subcooled decompression analysis as for the ROSA program, and the authors wish that the present code shall further be examined with the data of much advanced experiments. (auth.)
High-Performance Elastically Self-Deployed Roll-Out Solar Array (ROSA), Phase II
National Aeronautics and Space Administration — Deployable Space Systems (DSS) has developed an ultra-lightweight elastically self-deployable roll-out solar array (ROSA) structural platform that when combined with...
Experiment data of ROSA-III integral test Run 7341
International Nuclear Information System (INIS)
Anoda, Yoshinari; Soda, Kunihisa; Tasaka, Kanji
1983-02-01
This report presents the test data of Run 7341 in the single failure test series of the ROSA-III program to conduct the system effect test concerning the response of a BWR during a LOCA with the ECC injection. The ROSA-III test facility is a volumetrically scaled (1/424) system of the BWR/6 with an electrically heated core and the scaled ECCS. Run 7341 is a double-ended break test at the recirculation pump inlet with the assumption that all ECCS function as designed. The test is initiated with the steam dome pressure of 7.28 MPa, the lower plenum subcooling of 11.0 K, the core inlet flow rate of 15.3 kg/s, and the core heat generation rate of 3.55 MW and proceeded as planned. The whole core is quenched after the ECCS actuation and the maximum fuel cladding temperature is 810 K. The effectiveness of ECC injection has been clarified from the comparison of the test results with those of the other test in the series without ECCS. (author)
Borrás-Linares, Isabel; Herranz-López, María; Barrajón-Catalán, Enrique; Arráez-Román, David; González-Álvarez, Isabel; Bermejo, Marival; Gutiérrez, Alberto Fernández; Micol, Vicente; Segura-Carretero, Antonio
2015-01-01
Previous findings on the capacity of Hibiscus sabdariffa (HS) polyphenols to ameliorate metabolic disturbances justify the necessity of studies oriented to find the potential metabolites responsible for such an effect. The present study examined the intestinal epithelial membrane permeability of polyphenols present in a phenolic-enriched Hibiscus sabdariffa extract (PEHS), free and encapsulated, using the Caco-2 cell line. Additionally, selected polyphenols (quercetin, quercetin-3-glucoside, quercetin-3-glucuronide, and N-feruloyltyramine) were also studied in the same absorption model. The powerful analytical platform used ultra-high-performance liquid chromatography coupled with ultra-high-resolution quadrupole time-of-flight mass spectrometry (UHPLC-ESI-UHR-Qq-TOF-MS), and enabled the characterization of seven new compounds in PEHS. In the permeation study, only a few compounds were able to cross the cell monolayer and the permeability was lower when the extract was in an encapsulated form. Pure compounds showed a moderate absorption in all cases. Nevertheless, these preliminary results may need further research to understand the complete absorption mechanism of Hibiscus polyphenols. PMID:26262611
Directory of Open Access Journals (Sweden)
Isabel Borrás-Linares
2015-08-01
Full Text Available Previous findings on the capacity of Hibiscus sabdariffa (HS polyphenols to ameliorate metabolic disturbances justify the necessity of studies oriented to find the potential metabolites responsible for such an effect. The present study examined the intestinal epithelial membrane permeability of polyphenols present in a phenolic-enriched Hibiscus sabdariffa extract (PEHS, free and encapsulated, using the Caco-2 cell line. Additionally, selected polyphenols (quercetin, quercetin-3-glucoside, quercetin-3-glucuronide, and N-feruloyltyramine were also studied in the same absorption model. The powerful analytical platform used ultra-high-performance liquid chromatography coupled with ultra-high-resolution quadrupole time-of-flight mass spectrometry (UHPLC-ESI-UHR-Qq-TOF-MS, and enabled the characterization of seven new compounds in PEHS. In the permeation study, only a few compounds were able to cross the cell monolayer and the permeability was lower when the extract was in an encapsulated form. Pure compounds showed a moderate absorption in all cases. Nevertheless, these preliminary results may need further research to understand the complete absorption mechanism of Hibiscus polyphenols.
Borrás-Linares, Isabel; Herranz-López, María; Barrajón-Catalán, Enrique; Arráez-Román, David; González-Álvarez, Isabel; Bermejo, Marival; Fernández Gutiérrez, Alberto; Micol, Vicente; Segura-Carretero, Antonio
2015-08-07
Previous findings on the capacity of Hibiscus sabdariffa (HS) polyphenols to ameliorate metabolic disturbances justify the necessity of studies oriented to find the potential metabolites responsible for such an effect. The present study examined the intestinal epithelial membrane permeability of polyphenols present in a phenolic-enriched Hibiscus sabdariffa extract (PEHS), free and encapsulated, using the Caco-2 cell line. Additionally, selected polyphenols (quercetin, quercetin-3-glucoside, quercetin-3-glucuronide, and N-feruloyltyramine) were also studied in the same absorption model. The powerful analytical platform used ultra-high-performance liquid chromatography coupled with ultra-high-resolution quadrupole time-of-flight mass spectrometry (UHPLC-ESI-UHR-Qq-TOF-MS), and enabled the characterization of seven new compounds in PEHS. In the permeation study, only a few compounds were able to cross the cell monolayer and the permeability was lower when the extract was in an encapsulated form. Pure compounds showed a moderate absorption in all cases. Nevertheless, these preliminary results may need further research to understand the complete absorption mechanism of Hibiscus polyphenols.
Rosa canina Extracts Have Antiproliferative and Antioxidant Effects on Caco-2 Human Colon Cancer.
Directory of Open Access Journals (Sweden)
Sandra Jiménez
Full Text Available The in vitro antiproliferative and antioxidant effects of different fractions of Rosa canina hips on human colon cancer cell lines (Caco-2 was studied. The compounds tested were total extract (fraction 1, vitamin C (fraction 2, neutral polyphenols (fraction 3 and acidic polyphenols (fraction 4. All the extracts showed high cytotoxicity after 72 h, both low and high concentrations. The flow cytometric analysis revealed that all the fractions produce disturbances in the cell cycle resulting in a concomitant cell death by an apoptotic pathway. Changes in the redox status of Caco-2 cells in response to Rosa canina hips were determined. Cells were exposed to hydrogen peroxide in presence of plant fractions and the production of Reactive Oxygen Species (ROS was significantly decreased. Therefore, our data demonstrate that rosehip extracts are a powerful antioxidant that produces an antiproliferative effect in Caco-2 cells. Therefore, these results predict a promising future for Rosa canina as a therapeutic agent. Thus, this natural plant could be an effective component of functional foods addressed towards colorectal carcinoma.
The effect of aromatherapy with Rosa damascena essential oil on sleep quality in children
Directory of Open Access Journals (Sweden)
A.S. Keyhanmehr
2018-01-01
Full Text Available Background and objectives: Sleep disorder is one of the main problems in children. Poor sleep quality can lead to adverse effects on their growth and development. Aromatherapy is a kind of method for improving sleep. In Iranian traditional medicine, inhaling Rosa damascena has been recommended for treating sleep disorder. Due to the side effects of chemical drugs and trend to alternative medicine due to less complication, the aim of this study was to investigate the effect of aromatherapy with Rosa damascena essential oil on sleep quality in children. Methods: This study was an experimental before and after study that conducted in 30 children with sleep disorder. Children inhaled 5 drops of Rosa damascena essential oil on a cotton ball before sleep for 20 min (2 weeks. Before and after intervention, BEARS questionnaire was asked. Wilcoxon signed-rank test was used for comparisons by SPSS software. Results: The results of this study showed that resistance to sleep, difficulty waking in the morning, nightmare and waking up during the night in children decreased (p
Energy Technology Data Exchange (ETDEWEB)
Holser, Ronald A.; King, J. W. (Jerry W.); Bost, G.
2002-01-01
The genus Hibiscus exhibits great diversity in the production of natural materials with edible and industrial applications. The seeds of twelve varieties of Hibiscus were investigated as a source for triglycerides and phospholipids that could be used in functional foods. Lipid components were extracted from seed samples ground to a nominal particle diameter of 0.1 mm. Extractions were performed with an ISCO model 3560 supercritical fluid extractor using carbon dioxide and a mixture of carbon dioxide modified with ethanol. The neutral lipids were extracted with carbon dioxide at 80 C and 5370 MPa for 45 min. Polar lipids were subsequently extracted with a mixture of carbon dioxide and 15% ethanol at the same temperature and pressure. High performance liquid chromatography (HPLC) was used to analyze extracts for major neutral and polar lipid classes. A silica column was used with a solvent gradient of hexane/isopropanol/ water and ultraviolet (UV) and evaporative light scattering detectors (ELSD). An aliquot of each triglyceride fraction was trans-methylated with sodium methoxide and analyzed by gas chromatography to obtain the corresponding fatty acid methyl esters. The total lipids extracted ranged from 8.5% for a variety indigenous to Madagascar (H. calyphyllus) to 20% for a hybrid species (Georgia Rose). The average oil yield was 11.4% for the other varieties tested. The fatty acid methyl ester analysis displayed a high degree of unsaturation for all varieties tested, e. g., 75 ' 83%. Oleic, linoleic, and linolenic fatty acids were the predominate unsaturated fatty acids with only minor amounts of C14, C18, and C20 saturated fatty acids measured. Palmitic acid was identified as the predominate saturated fatty acid. The distribution of the major phospholipids, i. e., phosphatidylethanolamine, phosphatidic acid, phosphatidylserine, phosphatidylcholine, and lysophosphatidylcholine, was found to vary significantly among the hibiscus species examined
Hajibagheri, Ali; Babaii, Atye; Adib-Hajbaghery, Mohsen
2014-08-01
Sleep disorders are common among patients hospitalized in coronary care unit (CCU). This study aimed to investigate the effect of Rosa damascene aromatherapy on sleep quality of patients hospitalized in CCU. In this randomized controlled trial, 60 patients who met the inclusion criteria were conveniently sampled and randomly allocated to the experimental and control groups. Patients in the control group received routine care. In the experimental group, patients received routine care and Rosa damascene aromatherapy for three subsequent nights. In the both groups the sleep quality was assessed using the Pittsburgh Sleep Quality Index. After the study, the mean scores of five domains of Pittsburg Sleep Quality Index as well as the mean of total score of the index in the experimental group were significantly lower than the control group. Rosa damascene aromatherapy can significantly improve the sleep quality of patients hospitalized in CCUs. Copyright © 2014 Elsevier Ltd. All rights reserved.
CORÍN TELLADO Y LA NOVELA ROSA
Directory of Open Access Journals (Sweden)
Encarna Alonso Valero
2012-07-01
Full Text Available Resumen: Las novelas de Corín Tellado marcaron la vida de varias generaciones de mujeres y también de muchos hombres. Sufrió los reproches habituales a la novela comercial y de éxito, además del desprecio dedicado a la llamada novela rosa al ser considerada un género menor y fundamentalmente para mujeres. En este artículo nos proponemos analizar cómo con frecuencia ese tipo de juicios no son literarios sino sociales, juicios sociales denegados. Además, estudiaremos las novelas de Corín Tellado, que influyeron enormemente en la “educación sentimental” de las mujeres durante el franquismo, y analizaremos el modelo de mujer que presentan. Abstract: The novels of Corín Tellado marked the life of several generations of women, as well as of many men. She suffered the criticisms habitually levelled at commercially successful novels, especially the so-called novela rosa, or popular romance novel, because of its reputation as a minor genre aimed primarily at women. This paper aims to show that these judgments are often not literary but social. The paper will also examine Corín Tellado's novels, which greatly influenced the 'sentimental education' of women during the Franco regime, and we will analyze the models of woman that theses romances present.
The complete chloroplast genome sequence of Hibiscus syriacus.
Kwon, Hae-Yun; Kim, Joon-Hyeok; Kim, Sea-Hyun; Park, Ji-Min; Lee, Hyoshin
2016-09-01
The complete chloroplast genome sequence of Hibiscus syriacus L. is presented in this study. The genome is composed of 161 019 bp in length, with a typical circular structure containing a pair of inverted repeats of 25 745 bp of length separated by a large single-copy region and a small single-copy region of 89 698 bp and 19 831 bp of length, respectively. The overall GC content is 36.8%. One hundred and fourteen genes were annotated, including 81 protein-coding genes, 4 ribosomal RNA genes and 29 transfer RNA genes.
Santa Rosa Geysers Recharge Project: GEO-98-001. Final Report
Energy Technology Data Exchange (ETDEWEB)
Brauner, Edwin Jr.; Carlson, Daniel C.
2002-10-01
The Geysers steamfields in northern Sonoma County have produced reliable ''green'' power for many years. An impediment to long-term continued production has been the ability to provide a reliable source of injection water to replace water extracted and lost in the form of steam. The steamfield operators have historcially used cooling towers to recycle a small portion of the steam and have collected water during the winter months using stream extraction. These two sources, however, could not by themselves sustain the steamfield in the long term. The Lake County Reclaimed Water Project (SEGEP) was inititated in 1997 and provides another source of steamfield replenishment water. The Santa Rosa Geysers Recharge Project provides another significant step in replenishing the steamfield. In addition, the Santa Rosa Geysers Recharge Project has been built with capacity to potentially meet virtually all injection water requirements, when combined with these other sources. Figure 2.1 graphically depicts the combination of injection sources.
Pengaruh Periode Panen Terhadap Viabilitas Benih Rosela (Hibiscus sabdariffa L.)
Pulungan, Dedes Mayang Sari
2016-01-01
Rosella has a harvest period that does not simultaneously or concurrently so that harvesting done gradually. This research aimed to determine the effect of harvest on seed viability period of roselle (Hibiscus sabdariffa L.).Conducted in the experimental field of the Faculty of Agriculture, University of North Sumatra which were ± 25 meters above sea level and continued in Seed Technology Laboratory of the Faculty of Agriculture, University of North Sumatra from February to June 2013, using r...
Directory of Open Access Journals (Sweden)
abdolreza raisi sarbijan
2017-02-01
Full Text Available Introduction: Nitrogen is an essential element forplants and in combination withelements such as carbon, oxygen, hydrogen and sulfur results ineven more valuable materials such as amino acids, nucleic acids, alkaloids. Hibiscus tea (Hibiscus sabdariffa from Malvaceaefamily is known by different names in different parts of the world. In Iran it is calledthe Maki tea, tea Meccaorred tea.As an important plant,it is decided to investigate its growth and development in Jiroft. Materials and Methods The experiment was conducted as factorial based on randomized complete block design with three replications in farm research of Islamic Azad University of Jiroft during 2010. The first factor was nitrogen foliar application in four levels (0, 1, 2 and 3 percent and second factor was foliar application of zinc at twolevels (0 and 1 percent. The measured quantitative characteristics were stem diameter, plant height, calycle fresh weight,calycle dry weight, plant fresh weight,plant dry weight, leaf fresh weight,leaf dry weight, mucilage percentage and mucilage yield. Results and Discussion:The results of ANOVA showed that nitrogen foliar application on leaf dry weight, calycle fresh and dry weight was effective. Plant fresh weight, dry weight, stem diameter, plant height, mucilage percentageandmucilage yield showedsignificanteffects. Zinc foliar application significantly affected leaf fresh weight,leafdry weight, calycle fresh weight, plant fresh weight,plant dry weight, mucilage percentage andmucilage yield.The interaction effect of nitrogen and zinc on leaf dry weight, plant freshweight and plant dry weight was also significant. The mean comparison of studied characteristics revealed that byincreasing the amount of nitrogen up to N2 level, the stem diameter, plant height, leaf dry weight, calycle dry weight, mucilage percentage and yield increased but there was no significant difference between N2 and N3 levels. Plant fresh weight and plantdry weight
Erzincan ve Çevresinde Yayılış Gösteren Doğal Gül ( Rosa L. Taksonları
Directory of Open Access Journals (Sweden)
Mustafa KORKMAZ
2014-07-01
Full Text Available Roses (Rosa L. is known as the genus of fragrant, nice-looking plants of Rosaceae family. Rosa which has a history older than the history of humanity, due to the alluring beauty and nice- smell were cultivated and used throughout the ages
Kombucha Rosella (Hibiscus sabdariffa Linn) dan Kemampuannya sebagai Antihiperkolesterolemia
Suhartatik, Nanik; Karyantina, Merkuria; Purwanti, Indrias Tri
2012-01-01
We know that there is another tea extract, e.i from calyx of roselle flower (Hibiscus sabdariffa Linn). This kind of tea could be made became kombucha by ferment roselle extract using microbe in the fermentation of kombucha. This mi crobe grown in roselle extract as a medium with variety of roselle concentration (30; 40; 50 grams of dried roselle/L). During the fermentation process, roselle kombucha was analyzed for pH value, total acid, antioxidant activity at 0, 1, 3, 5, 7, 10 days of ferm...
Directory of Open Access Journals (Sweden)
Aloisio Xavier
2003-06-01
Full Text Available No presente trabalho objetivou-se avaliar o enraizamento de cinco diferentes tipos de miniestaca (caulinar, caulinar apical, caulinar intermediária, caulinar apical desfolhada e foliar, na propagação vegetativa de cedro-rosa (Cedrela fissilis por miniestaquia, a partir de material seminal. Os resultados obtidos quanto ao enraizamento indicaram o melhor desempenho da miniestaca caulinar, com 84% de sobrevivência das mudas aos 90 dias de idade, demonstrando o potencial da miniestaquia como alternativa na produção de mudas de cedro-rosa.This work aimed to evaluate the rooting of five different types of minicuttings (stem, apical stem, intermediate stem, apical stem with removed leaves and leaf, in the vegetative propagation of cedro-rosa (Cedrela fissilis, by applying the minicutting technique, using seedlings material. The results showed that stem cutting was the most efficient technique for the vegetative propagation of this species, with up to 84% survival at 90 days of age. Thus, this technique can be used as an alternative in the production of minicuttings of this species, throughout the year.
Disruption of Angiogenesis by Anthocyanin-Rich Extracts of Hibiscus sabdariffa
Joshua, Madu; Okere, Christiana; Sylvester, O’Donnell; Yahaya, Muhammad; Precious, Omale; Dluya, Thagriki; Um, Ji-Yeon; Neksumi, Musa; Boyd, Jessica; Vincent-Tyndall, Jennifer; Choo, Dong-Won; Gutsaeva, Diana R.; Jahng, Wan Jin
2017-01-01
Abnormal vessel formations contribute to the progression of specific angiogenic diseases including age-related macular degeneration. Adequate vessel growth and maintenance represent the coordinated process of endothelial cell proliferation, matrix remodeling, and differentiation. However, the molecular mechanism of the proper balance between angiogenic activators and inhibitors remains elusive. In addition, quantitative analysis of vessel formation has been challenging due to complex angiogenic morphology. We hypothesized that conjugated double bond containing-natural products, including anthocyanin extracts from Hibiscus sabdariffa, may control the proper angiogenesis. The current study was designed to determine whether natural molecules from African plant library modulate angiogenesis. Further, we questioned how the proper balance of anti- or pro-angiogenic signaling can be obtained in the vascular microenvironment by treating anthocyanin or fatty acids using chick chorioallantoic membrane angiogenesis model in ovo. The angiogenic morphology was analyzed systematically by measuring twenty one angiogenic indexes using Angiogenic Analyzer software. Chick chorioallantoic model demonstrated that anthocyanin-rich extracts inhibited angiogenesis in time- and concentration-dependent manner. Molecular modeling analysis proposed that hibiscetin as a component in Hibiscus may bind to the active site of vascular endothelial growth factor receptor 2 (VEGFR2) with ΔG= −8.42 kcal/mol of binding energy. Our results provided the evidence that anthocyanin is an angiogenic modulator that can be used to treat uncontrolled neovascular-related diseases, including age-related macular degeneration. PMID:28459020
Sáyago-Ayerdi, Sonia G; Arranz, Sara; Serrano, José; Goñi, Isabel
2007-09-19
The beverage of Hibiscus sabdariffa flowers is widely consumed in Mexico. Polyphenols contained in plant foods are frequently associated with dietary fiber. The aim of this work is to quantify the dietary fiber, associated polyphenols, and antioxidant capacity of the Roselle flower and the beverage traditionally prepared from it and its contribution to the Mexican diet. Roselle flower contained dietary fiber as the largest component (33.9%) and was rich in phenolic compounds (6.13%). Soluble dietary fiber was 0.66 g/L in beverage, and 66% of total extractable polyphenols contained in Roselle flower passed to the beverage and showed an antioxidant capacity of 335 micromoL trolox equivalents/100 mL beverage measured by ABTS. These data suggest that Roselle flower beverage intake in the Mexican diet may contribute around 166 and 165 mg/per serving to the intake of dietary fiber and polyphenols, respectively. The health benefits from consumption of Hibiscus beverage could be of considerable benefit to the whole population.
Flora vascular y vegetación del humedal de Santa Rosa (Chancay, Lima
Directory of Open Access Journals (Sweden)
Dámaso W. Ramirez
2011-05-01
Full Text Available El presente trabajo muestra los resultados de un estudio de la flora y vegetación del humedal de Santa Rosa (Chancay, Lima realizado entre los años 2007 y 2009. La flora vascular estuvo conformada por 66 especies agrupadas en 57 géneros y 26 familias. Las Poaceae (16, Cyperaceae (6 y Asteraceae (6 fueron las familias más diversas y constituyeron el 42% de la flora total. En comparación con los principales humedales de Lima, Santa Rosa presenta un mayor número de especies (Pantanos de Villa (65, Paraíso (26 y Medio Mundo (16. El análisis de similitud florística muestra que Santa Rosa es más semejante a Los Pantanos de Villa (Lima. El Análisis de Correspondencia (AC determinó tres comunidades vegetales predominantes: a Comunidad de acuáticas flotantes, b Totoral y asociadas y c Vega Mixta. Se considera que los cambios en la estructura de las comunidades vegetales y el número de especies introducidas son indicadores del impacto antrópico al que está sometido este ecosistema. Se identifican las fuentes de impacto humano y se considera a la agricultura como la principal amenaza del humedal.
Rosa micrantha as a powerfull source of antioxidants
Guimarães, Rafaela; Barros, Lillian; Carvalho, Ana Maria; Ferreira, Isabel C.F.R.
2010-01-01
Reactive oxygen (ROS) and nitrogen (RNS) species production inevitably occurs during normal cell metabolism both in animals and plants. An excess of those species lead to oxidative and nitrosative stresses, resulting in damage for some cellular molecules such as DNA, proteins and lipids. Natural antioxidants have become a safety option to avoid biological oxidations involved in cellular damage and deterioration of food quality. Rosa micrantha is one of the rose species that gro...
Analisis Kualitas Layanan Hotel New Sany Rosa Bandung
Elisabeth, Elisabeth
2013-01-01
In this decade, hospitality is an industry that grows rapidly in Indonesia, notably inBandung. New Sany Rosa Hotel Bandung is among the most popular hotels. Fac-ing tough industry, transformation at this hotel was enforced. The new managementdelivered a change in customer satisfaction valuation, from suggestions or criticsto service quality. The objective is to identify if five dimensions of service qualityimpact the customer satisfaction and which dimension has most influence on cus-tomer sa...
Compostos bioativos em polpas de mangas 'rosa' e 'espada' submetidas ao branqueamento e congelamento
Directory of Open Access Journals (Sweden)
Lucimara Piauí Soares
2013-06-01
Full Text Available A manga (Mangifera indica L. constitui uma importante fonte de compostos bioativos, dentre os quais se destacam os carotenoides e a vitamina C, que contribuem para a promoção da saúde. Vários métodos podem ser utilizados para conservação de alimentos a fim de aproveitar melhor os frutos durante a safra e permitir seu armazenamento fora de época de produção. No entanto, podem alterar a qualidade nutricional do alimento. Dessa forma, sendo o branqueamento e o congelamento métodos que são utilizados no processamento industrial para conservação de polpas de frutas, objetivou-se, neste trabalho, analisar a influência do branqueamento e do congelamento sobre os teores de carotenoides totais e ácido ascórbico em mangas 'Rosa' e 'Espada' em relação ao tempo de armazenamento. As mangas no estádio maduro, após serem colhidas, lavadas, cortadas e despolpadas, foram submetidas ao congelamento (-18ºC ou branqueamento por imersão em água (75ºC, por 3 minutos ou branqueamento por vapor em água fervente, por 3 minutos. Em seguida, foram realizadas as determinações bioquímicas dos teores de carotenoides totais e ácido ascórbico no tempo zero e após 20; 40 e 60 dias de armazenamento sob congelamento. Após análise dos resultados obtidos, conclui-se que, na forma in natura (tempo zero, as variedades Rosa e Espada apresentam os máximos teores de ácido ascórbico, porém o uso do branqueamento com vapor e o congelamento após 60 dias de armazenamento provocam perdas de, respectivamente, 53% ('Rosa' e 35% ('Espada'; 72% ('Rosa' e 60% ('Espada' destes compostos. No branqueamento por imersão em água, há perda completa do ácido ascórbico nas polpas das variedades Rosa e Espada. Em relação aos carotenoides totais, os valores foram semelhantes em polpas branqueadas a vapor e sem branqueamento no tempo zero,com tendência de redução durante o longo da armazenagem.
Directory of Open Access Journals (Sweden)
Terrence Timothy Evan Lusida
2017-04-01
Full Text Available Infection of Staphylococcus epidermidis is still a common problem in many hospitals. Factor determining biofilm formation makes it harder for atibiotics to cure the infection. Roselle (Hibiscus sabdariffa, a well known traditional medicine plant, is a potential candidate as a drug againts infectious disease. The purpose of this research is to investigate the antibacterial effect of ethanol extract from Roselle (Hibiscus sabdariffa calyx againts the growth of Staphylococcus epidermidis. Assessment for antibacterial effect is performed using broth diffusion method. The extract is made by maceration of the calyx of Roselle in 96% ethanol. Extracts with concentration of 125, 62.5, 31.25, 15.63, 7.81, 3.90, 1.95, 0.97, 0.48, 0.24 mg/mL are added into separated Mueller-Hinton broths (MHB, which have already been inoculated by Staphylococcus epidermidis. As for bacterial growth control, we used MHB with bacterial inoculation, while sterility control we used mixture of extract and MHB. Then from each broth, the solutions are added into separated nutrition agar plates. Replications are done three times. Clarity and bacterial growth are observed after 24 hours of incubation. However, clarity cannot be observed in 36 broth, but bacterial growth is observed on the plate for concentration 0.97, 0.48, and 0.24 mg/mL. Therefore Minimum inhibitory concentration (MIC cannot be determined because the extract’s color interfere the observation. While minimum bactericidal concentration (MBC, the last concentration before the concentration where the bacteria are still viable, is 1.95 mg/mL. Based on the result of the research, the Roselle calyx ethanol extract (Hibiscus sabdariffa through dilution method with a concentration of 1.95 mg / mL can kill Staphylococcus epidermidis and in order to find MIC in collored and turbid solution (before being incubated in incubator, we can consider using agar dilution methode or microdilution methode.
Anabolic effect of Hibiscus rosasinensis Linn. leaf extracts in immature albino male rats.
Olagbende-Dada, S O; Ezeobika, E N; Duru, F I
2007-01-01
Many plants remedies have been employed in solving man's health needs especially the nutritive value which enhances health living. Aphrodisiac plants are plants with anabolic properties i.e. they help in protein synthesis and enhances sexual abilities in males. They are also known as androgenic plants because their properties are similar to that of androgen a male hormone. Cold aqueous extract of Hibiscus rosasinensis leaves is reported by local traditional practioners in Western Nigeria to be aphrodisiac. To investigate the anabolic properties of Hibiscus rosasinensis. Three groups (8/group) of immature male rats of known weights were administered equal doses of aqueous (cold and hot) and alcoholic extracts of Hibiscus rosasinensis leaves for 8 weeks. The gain in body and isolated sexual organs (testis, epididymis, seminal vesicle and prostate) weights were determined after treatment and compared to the value obtained from a fourth untreated group which served as the control. Section through the testes of both the treated and untreated rats were also examined microscopically and displayed as a photomicrograph for comparism. All data were statistically analysed and displaced in graphic form. Over the 8 weeks of treatment, the control, the cold aqueous extract dosed, hot aqueous extract dosed and alcoholic extract dosed rats gained 8%, 15%, 18% and 22% in body weights respectively. The increase in the weight of testis, epididymis, seminal vesicle and prostate of the alcoholic extract dosed rats was 19%, 30%, 31% and 40% respectively. The anabolic effect of the leaf extracts of H. rosasinensis is hereby established. More work needs to be done on these leaf extracts to know their effect on the gonadotrophin hormones which regulate the activity of the androgens in relation to spermatogenesis.
E uma rosa se abre: a guerra e a flor na poesia de Drummond
Directory of Open Access Journals (Sweden)
Valéria Daiane Soares Rodrigues
2013-08-01
Full Text Available Carlos Drummond de Andrade, em A Rosa do Povo (1945 articula, por meio da palavra e da criação de um “eu” lírico habitante de um mundo em guerra, a construção de uma imagem, imbuída de teor histórico, do Brasil dos anos finais da 2ª guerra mundial. Os versos traduzem a experiência do Drummond gauche, angustiado pelos problemas do seu tempo, em que a individualidade advinda da fragmentação do homem moderno é marca do conflito entre o “eu” lírico e o mundo. O poeta descreve de forma melancólica a degeneração das coisas e dos homens, em meio à consciência paralisante e a falta de perspectivas. A força que emerge do símbolo da rosa respalda o acento poético do Itabirano: a destruição dos valores provocados pela morte e pelo derramar de sangue contrasta com o brotar da flor no asfalto. Do chão forrado de cadáveres, emerge uma rosa, numa representação da resistência humana.
[Therapeutic potential of Hibiscus sabdariffa: a review of the scientific evidence].
Guardiola, Soledad; Mach, Núria
2014-05-01
Infusion of Hibiscus sabdariffa (H. sabdariffa) is a very popular drink in many parts of the world. Its phytochemical composition is associated to antioxidant, hypotensive, and antiatherosclerotic effects. However, the molecular mechanisms involved in these processes are not well known. The aim of this review was to report the scientific evidence supporting that regular use of H. sabdariffa decreases oxidative stress, atherosclerosis, lipid profile, and blood pressure. A search of recent publications was made in the following specialized electronic databases: Elsevier Journal, SciELO, FSTA, Science Direct, Springer Link, and NCBI. Results of research conducted in clinical trials in humans and in animal models and cell cultures were recorded. Keywords used included Hibiscus sabdariffa, oxidative stress, polyphenols, hypertension, atherosclerosis, and lipid profile. Results of the different articles suggested a possible therapeutic effect of H. sabdariffa extracts on oxidative stress, lipid profile, hypertension, and atherosclerosis thanks to its composition rich in phenolic compounds. Anthocyanins significantly decrease LDL oxidation, inhibit adipogenesis by regulating adipogenic signaling pathways and transcription factors, and modulate gene expression of certain microRNAs. No adverse events or side effects were reported. Further more homogeneous, placebo-controlled studies in humans are needed to state that H. sabdariffa has therapeutic efficacy in humans. Copyright © 2013 SEEN. Published by Elsevier Espana. All rights reserved.
Directory of Open Access Journals (Sweden)
Colinas-León MT
2011-01-01
Full Text Available Durante el crecimiento y desarro- llo de las flores, la nutrición fosforada es un factor que puede influir en la vida en flore- ro. El objetivo de este trabajo fue evaluar el efecto de cinco niveles de fósforo (P: 0, 0.5, 1.0, 1.5 y 2.0 me·L-1 de P aplicados en precosecha, mediante un sistema hidropóni- co abierto, en el comportamiento fisiológico postcosecha de tallos florales de rosa (Rosa hybrida L. ‘Classy’ y ‘Vega’. Las variables evaluadas durante la vida de florero de los tallos florales fueron: transpiración foliar y floral, potencial de turgencia foliar y de pétalos. Además, se evaluó la concentración de antocianinas en pétalos al momento de la cosecha. Las aplicaciones de P en precose- cha tuvieron efecto significativo únicamente en la transpiración foliar; sin embargo, se demostró que la mayor vida en florero (15.8 días de ‘Classy’ en comparación con ‘Vega’ (11.7 días estuvo directamente asociada con mayores potenciales de turgencia foliar y de pétalos, mayor tasa transpiratoria floral y menor tasa transpiratoria foliar en ‘Classy’.
Post-test analysis of ROSA-III experiment Run 702
International Nuclear Information System (INIS)
Koizumi, Yasuo; Kikuchi, Osamu; Soda, Kunihisa
1980-01-01
The purpose of the ROSA-III experiment with a scaled BWR test facility is to examine primary coolant thermal-hydraulic behavior and performance of ECCS during a posturated loss-of-coolant accident of BWR. The results provide information for verification and improvement of reactor safety analysis codes. Run 702 assumed a 200% split break at the recirculation pump suction line under an average core power without ECCS activation. Post - test analysis of the Run 702 experiment was made with computer code RELAP4J. Agreement of the calculated system pressure and the experiment one was good. However, the calculated heater surface temperatures were higher than the measured ones. Also, the axial temperature distribution was different in tendency from the experimental one. From these results, the necessity was indicated of improving the analytical model of void distribution in the core and the nodalization in the pressure vassel, in order to make the analysis more realistic. And also, the need of characteristic test was indicated for ROSA-III test facility components, such as jet pump and piping form loss coefficient; likewise, flow rate measurements must be increased and refined. (author)
Sabzghabaee, Ali Mohammad; Ataei, Ehsan; Kelishadi, Roya; Ghannadi, Alireza; Soltani, Rasool; Badri, Shirinsadat; Shirani, Shahin
2013-01-01
Conflict of interest: none declared. Objective We aimed to evaluate the effects of Hibiscus sabdariffa (HS) calices on controlling dyslipidemia in obese adolescents. Methodology In this triple blind randomized placebo-controlled clinical trial which was registered in the Iranian registry for clinical trials (IRCT201109122306N2), 90 obese adolescents aged 12-18 years with documented dyslipidemia were randomly assigned in two groups of cases who received 2 grams of fine powdered calices of Hibiscus sabdariffa per day for one month and controls who received placebo powder with the same dietary and physical activity recommendations and duration of exposure. Full lipid profile and fasting blood sugar measured before and after the trial. Data were analyzed using multivariate general linear model. Findings Overall, 72 participants (mean age of 14.21±1.6, 35 boys) completed the trial. The two arms of the study (cases and controls) were not statistically different in terms of age, gender, weight, body mass index (BMI) and lipid profile before the trial. Serum total cholesterol, low density lipoprotein cholesterol and serum triglyceride showed a significant decrease in cases group but high density lipoprotein cholesterol level was not changed significantly. Conclusion It is concluded that Hibiscus sabdariffa calyces powder may have significant positive effects on lipid profile of adolescents which maybe attributed to its polyphenolic and antioxidant content. Further studies are needed on dose-response and formulation optimization. PMID:24082826
Fakeye, T O; Adegoke, A O; Omoyeni, O C; Famakinde, A A
2007-01-01
The effect of beverages prepared from the dried calyx of the flowers of Hibiscus sabdariffa on the excretion of diclofenac was investigated using a controlled study in healthy human volunteers. A high pressure liquid chromatographic method was used to analyse the 8 h urine samples collected after the administration of diclofenac with 300 mL (equivalent to 8.18 mg anthocyanins) of the beverage administered daily for 3 days. An unpaired two-tailed t-test was used to analyse for significant difference observed in the amount of diclofenac excreted before and after administration of the beverage. There was a reduction in the amount of diclofenac excreted and the wide variability observed in the control with the water beverage of Hibiscus sabdariffa (p < 0.05). There is an increasing need to counsel patients against the use of plant beverages with drugs.
Comparisons of ROSA-III and FIST BWR loss of coolant accident simulation tests
International Nuclear Information System (INIS)
Tasaka, Kanji; Suzuki, Mitsuhiro; Koizumi, Yasuo
1985-10-01
A common understanding and interpretation of BWR system response and the controlling phenomena in LOCA transients has been achieved through the evaluation and comparison of counterpart tests performed in the ROSA-III and FIST test facilities. These facilities, which are designed to simulate the thermal-hydraulic response of BWR systems, are operated respectively by the Japan Atomic Energy Research Institute (JAERI) and the General Electric Company. Comparison is made between three types of counterpart tests, each performed under similar tests conditions in the two facilities. They are large break, small break, and steamline break LOCA's. The system responses to these tests in each facility are quite similar. The sequence of events are similar, and the timing of these events are similar. Differences that do occur are due to minor differences in modeling objectives, facility scaling, and test conditions. Parallel channel flow interactions effects in the ROSA-III four channel (half length) core, although noticeable in the large break test, do not result in major differences with the single channel response in FIST. In the small break tests the timing of events is offset by the earlier ADS actuation in FIST. The steamline test responses are similar except there is no heatup in FIST, resulting from a different ECCS trip modeling. Overall comparisons between ROSA-III and FIST system responses in LOCA tests is very good. (author)
The South American species of Hibiscus sect. Furcaria DC. (Malvaceae-Hibisceae
Directory of Open Access Journals (Sweden)
Antonio Krapovickas
2004-01-01
Full Text Available The Hibiscus section Furcaria from South America is revised. Ten new species from Brasil are described: H. Andersonii, H. capitalensis, H. chapadensis, H. Gregoryi, H. Hochreutineri, H. itirapinensis, H. matogrossensis, H. Nanuzae, H. Saddii, H. Windischii, and a new one from Perú: H. Chancoae. Two new names are proposed: H. Hilarianus from Brasil and H. amambayensis from Paraguay. A key is provided to distinguish the 40 species of section Furcaria known from South America
Directory of Open Access Journals (Sweden)
Joyce Silva dos Santos
2009-06-01
Full Text Available Trata-se de uma revisão de literatura sobre os principais trabalhos científicos publicados nas últimas duas décadas acerca das propriedades medicinais da Rosa Mosqueta, especialmente no tratamento de feridas abertas. O objetivo é reunir informações que demonstrem, mediante evidências científicas e empíricas, a importância da medicina tradicional quanto ao uso da Rosa Mosqueta em diversas aplicações clínicas. Este estudo caracteriza-se como uma compilação de informações significativas sobre a composição, indicações e usos empíricos do extrato de Rosa Mosqueta, a fim de facilitar pesquisas posteriores, visto que a produção sobre o assunto é escassa. A pesquisa bibliográfica foi realizada através dos bancos de dados Bireme, SciELO, Capes e sites relacionados ao tema na internet.Este articulo es sobre una revisión de la literatura en los principales trabajos científicos publicados en las últimas dos décadas referentes a las características medicinales de Rosa Mosqueta, especialmente en el tratamiento de heridas abiertas. El objetivo es juntar la información que demuestran, con las evidencias científicas y empíricas, la importancia de la medicina tradicional cuánto al uso de Rosa Mosqueta en aplicaciones clínicas diversas. Este estudio se caracteriza como una compilación de la información significativa sobre la composición, las indicaciones y las aplicaciones empíricas del extracto de Rosa Mosqueta, para facilitar la investigación posterior, puesto que la producción en el tema es escasa. La investigación bibliográfica fue llevada a través de las bases de datos Bireme, SciELO, Capes y sitios relacionados con el tema en el Internet.This article is about a literature revision concerning to the main published scientific works in the last two decades about the medicinal properties of the Mosqueta Rose, especially in the treatment of open wounds. The objective is to congregate information demonstrating, by
International Nuclear Information System (INIS)
1978-07-01
Results of the ROSA-II test simulating a loss-of-coolant accident (LOCA) in a PWR are presented, including test conditions and interpretations of phenomena observed in test runs 502, 505, 506 and 507. Development tests were performed to find a more effective ECCS injection method than the existing one based on cold leg injection. A combined injection of hot water into upper plenum in early stage of blowdown and subsequent cold water into lower plenum is the most effective method for a cold leg break. A hot leg injection of a low pressure injection system is effective for direct core cooling and early reflooding. The generalization for actual reactors will require analyses with a reliable code. (auth.)
Monteiro, Maria João P; Costa, Ana Isabel A; Fliedel, Geneviève; Cissé, Mady; Bechoff, Aurélie; Pallet, Dominique; Tomlins, Keith; Pintado, Maria Manuela E
2017-06-15
The need to increase sustainability and add value to traditional foods claiming health benefits led to the introduction of key improvements in the production of hibiscus beverages in Senegal. The physicochemical and sensory properties of three resulting products (an under-vacuum concentrate, a dilute-to-taste syrup and a ready-to-drink infusion) were assessed, vis-à-vis those of conventionally manufactured beverages, and their impact on local consumer preference determined (n=146). New beverages had more intense, redder colour and higher monomeric anthocyanin content, total phenolic content and antioxidant capacity. Moreover, their colour evaluations by trained panellists were mainly linked to colour density and anthocyanin/polyphenol content, while flavour assessments were associated to titratable acidity and sugar-to-acid ratio. Consumer evaluations, in turn, were driven by the beverages' red colour intensity, aroma strength and balance between sweetness and acidity. This explained why they overwhelmingly preferred the under-vacuum concentrate, regardless of their age, gender or frequency of hibiscus beverage consumption. Copyright © 2016 Elsevier Ltd. All rights reserved.
Chiu, Chun-Tang; Hsuan, Shu-Wen; Lin, Hui-Hsuan; Hsu, Cheng-Chin; Chou, Fen-Pi; Chen, Jing-Hsien
2015-03-01
Melanoma is the least common but most fatal form of skin cancer. Previous studies have indicated that an aqueous extract of Hibiscus sabdariffa leaves possess hypoglycemic, hypolipidemic, and antioxidant effects. In this study, we want to investigate the anticancer activity of Hibiscus leaf polyphenolic (HLP) extract in melanoma cells. First, HLP was exhibited to be rich in epicatechin gallate (ECG) and other polyphenols. Apoptotic and autophagic activities of HLP and ECG were further evaluated by DAPI stain, cell-cycle analysis, and acidic vascular organelle (AVO) stain. Our results revealed that both HLP and ECG induced the caspases cleavages, Bcl-2 family proteins regulation, and Fas/FasL activation in A375 cells. In addition, we also revealed that the cells presented AVO-positive after HLP treatments. HLP could increase the expressions of autophagy-related proteins autophagy-related gene 5 (ATG5), Beclin1, and light chain 3-II (LC3-II), and induce autophagic cell death in A375 cells. These data indicated that the anticancer effect of HLP, partly contributed by ECG, in A375 cells. HLP potentially could be developed as an antimelanoma agent. © 2015 Institute of Food Technologists®
Wei, Qiang; Ji, Xiao-ying; Xu, Fei; Li, Qian-rong; Yin, Hao
2015-05-01
To study the chemical constituents from Hibiscus syriacus leaves and their α-glucosidase inhibitory activities. Column chromatography including macroporous resins, silica gel and Sephadex LH-20 were used for the isolation and purification of all compounds. Spectroscopic methods including physical and chemical properties, 1H-NMR and 13C-NMR were used for the identification of structures. Their α-glucosidase inhibitory activities were detected by a 96-well microplate. 15 compounds were isolated and identified as β-sitosterol(1), β-daucostero (2), β-amyrin (3), oleanolic acid (4), stigmast-4-en-3-one (5), friedelin (6), syriacusin A (7), kaempferol (8), isovitexin (9), vitexin (10), apigenin (11), apigenin-7-O-β-D-glucopyranoside (12), luteolin-7-O-β-D-glucopyranoside (13), vitexin-7-O-β-D-glucopyranoside (14) and rutin (15). All the compounds are isolated from the leaves of Hibiscus syriacus for the first time. Taking acarbose as positive control, the α-glucosidase inhibitory activities of 15 compounds were evaluated. Compounds 7 and 9 have shown strong α-glucosidase inhibitory activities with IC50 of 39.03 ± 0.38 and 32.12 ± 0.62 mg/L, inhibition ratio of 94.95% and 97.15%, respectively.
Hibiscus syriacus Extract from an Established Cell Culture Stimulates Skin Wound Healing.
di Martino, O; Tito, A; De Lucia, A; Cimmino, A; Cicotti, F; Apone, F; Colucci, G; Calabrò, V
2017-01-01
Higher plants are the source of a wide array of bioactive compounds that support skin integrity and health. Hibiscus syriacus , family Malvaceae, is a plant of Chinese origin known for its antipyretic, anthelmintic, and antifungal properties. The aim of this study was to assess the healing and hydration properties of H. syriacus ethanolic extract (HSEE). We established a cell culture from Hibiscus syriacus leaves and obtained an ethanol soluble extract from cultured cells. The properties of the extract were tested by gene expression and functional analyses on human fibroblast, keratinocytes, and skin explants. HSEE treatment increased the healing potential of fibroblasts and keratinocytes. Specifically, HSEE significantly stimulated fibronectin and collagen synthesis by 16 and 60%, respectively, while fibroblasts contractility was enhanced by 30%. These results were confirmed on skin explants, where HSEE accelerated the wound healing activity in terms of epithelium formation and fibronectin production. Moreover, HSEE increased the expression of genes involved in skin hydration and homeostasis. Specifically, aquaporin 3 and filaggrin genes were enhanced by 20 and 58%, respectively. Our data show that HSEE contains compounds capable of stimulating expression of biomarkers relevant to skin regeneration and hydration thereby counteracting molecular pathways leading to skin damage and aging.
Hibiscus syriacus Extract from an Established Cell Culture Stimulates Skin Wound Healing
Directory of Open Access Journals (Sweden)
O. di Martino
2017-01-01
Full Text Available Higher plants are the source of a wide array of bioactive compounds that support skin integrity and health. Hibiscus syriacus, family Malvaceae, is a plant of Chinese origin known for its antipyretic, anthelmintic, and antifungal properties. The aim of this study was to assess the healing and hydration properties of H. syriacus ethanolic extract (HSEE. We established a cell culture from Hibiscus syriacus leaves and obtained an ethanol soluble extract from cultured cells. The properties of the extract were tested by gene expression and functional analyses on human fibroblast, keratinocytes, and skin explants. HSEE treatment increased the healing potential of fibroblasts and keratinocytes. Specifically, HSEE significantly stimulated fibronectin and collagen synthesis by 16 and 60%, respectively, while fibroblasts contractility was enhanced by 30%. These results were confirmed on skin explants, where HSEE accelerated the wound healing activity in terms of epithelium formation and fibronectin production. Moreover, HSEE increased the expression of genes involved in skin hydration and homeostasis. Specifically, aquaporin 3 and filaggrin genes were enhanced by 20 and 58%, respectively. Our data show that HSEE contains compounds capable of stimulating expression of biomarkers relevant to skin regeneration and hydration thereby counteracting molecular pathways leading to skin damage and aging.
Anti-Escherichia coli effect of Hibiscus sabdariffa L. in a meat model
Directory of Open Access Journals (Sweden)
Marcelo Pinto PAIM
Full Text Available Abstract Hibiscus sabdariffa L. is used in traditional medicine because of its bioactive properties, such as antioxidant and antibacterial. Escherichia coli is a Gram-negative bacteria and as an indicator of contamination in food. The aim of this work was to evaluate the anti-Escherichia coli effect and the change in pH on the control of aerobic mesophilic microorganisms, using hydroethanolic extract of H. sabdariffa L. in different concentrations in a meat model, verifying its potential as food additive for microbiological stability on ground beef during cooling storage. For the preparation of the treatments, the meat experimental units were elaborated with different concentrations of the vegetal extract (5, 10, 15 and 20%, ground beef and contaminated with E. coli. For pH evaluation, the meat experimental units were added different percentages of hydroethanolic extract. The H. sabdariffa L. antibacterial action reduced two logarithmic levels in practically all treatments. The best pH result was obtained in the meat containing 30% of the extract. The hydroethanolic extracts of Hibiscus sabdariffa L. showed anti-Escherichia coli activity in the presence of refrigerated ground beef. Analyzing the pH results and the count of aerobic mesophilic bacteria, it is possible this extract to be used as a natural food additive.
Introduction of ROL genes in Rosa hybrida L. for improved rootstock performance
Salm, van der T.P.M.
1996-01-01
In contrast to many other cut flowers, which are harvested completely at the time of flowering, rose plants ( Rosahybrida L.) continuously produce flowering shoots, which are harvested on a regular basis. For the release of axillary buds and
Pomegranate (Punica granatum) fruit and roselle (Hibiscus sabdariffa) leaves have been used in traditional medicine, including as anthelmintics. Methanolic extracts from these plants were investigated for activity against the southern root-knot nematode (RKN) Meloidogyne incognita. Dried, ground p...
Directory of Open Access Journals (Sweden)
Bernardino Candelaria-Martínez
2017-01-01
Full Text Available Se evaluó el efecto del pastoreo a los 50, 60 y 70 días en época de lluvias y seca con nortes que son los frentes fríos, que corresponden de octubre a enero junto con la disponibilidad, calidad de biomasa y hábitos alimenticios de ovinos en un sistema silvopastoril de pasto estrella (Cynodon nlemfuensis, tulipán (Hibiscus rosasinensis y leucaena (Leucaena leucocephala. Para cada tratamiento se utilizaron 2 parcelas de 8x24 m y 6 ovejas adultas raza pelibuey. La disponibilidad de biomasa en leucaena y tulipán se evaluó mediante cosecha total de 20 a 40 plantas por tratamiento. El pasto estrella se midió antes y después del pastoreo. Las 3 especies se separaron en componentes morfológicos, y se determinó proteína cruda y fibra detergente neutra en las hojas. Los hábitos de los ovinos se determinaron mediante observación directa. La disponibilidad de biomasa total, consumo por grupo y utilización del pasto estrella fueron mayores a los 70 días y en la época de lluvias. La proporción de hoja de las 3 especies fue mayor a los 50 días; por efecto de la época, fue más abundante en lluvias, nortes y seca para estrella, leucaena y tulipán, respectivamente. La disponibilidad de PC no varió (p>0,05 por efecto de frecuencia ni época de pastoreo. El mayor tiempo de consumo estuvo destinado a pasto estrella, tulipán y leucaena. Los diseños favorecieron los sistemas silvopastoriles multiasociados pues potenciaron los efectos positivos de sus relaciones. Las frecuencias de pastoreo se ajustaron a la época del año, bajo un modelo de manejo mixto de pastoreo y podas, para mejor utilización de la biomasa.
ROSA P : The National Transportation Library’s Repository and Open Science Access Portal
2018-01-01
The National Transportation Library (NTL) was founded as an all-digital repository of US DOT research reports, technical publications and data products. NTLs primary public offering is ROSA P, the Repository and Open Science Access Portal. An open...
Importancia y propiedades físico química de la Rosa mosqueta (R. canina, R. rubiginosa: una revisión
Directory of Open Access Journals (Sweden)
T. Espinoza
2016-01-01
Full Text Available Los consumidores cada día exigen productos en sus dietas que no solo aporten los nutrientes requeridos para una vida sana, sino que además son de preferencia aquellos que puedan complementar con propiedades benéficas para la salud. En las últimas décadas se ha reconocido a la Rosa mosqueta, la Rosa canina y a la Rosa rubiginosa, como frutos que contienen muchas propiedades nutracéuticas. El presente trabajo hace una revisión de los artículos de investigación realizados a la Rosa mosqueta desde un punto de vista de su importancia de su consumo y sus beneficios para la salud; describiendo las características químicas, físicas y bioquímicas tales como el contenido de componentes fenólicos, ácidos grasos, ácido linoleico, minerales; y de otros compuestos importantes también desde el punto de vista industrial, tales como el contenido de antioxidantes, pigmentos, entre otros. De acuerdo a los antecedentes recopilados, la Rosa mosqueta es una fuente de micronutrientes incluyendo la vitamina c y el licopeno, entregando además un buen aporte nutricional; por lo anterior debe ser considerado como un alimento funcional. Aun siendo una especie que crece en estado salvaje, sobre suelos forestales; siendo un frutal menor y una planta medicinal su importancia en el consumo masivo debe ser considerada.
Geophysics report of Santa Rosa place Canelones province
International Nuclear Information System (INIS)
Cicalese, H.
1984-01-01
The Hydrogeology Section required to Geophysics Department of the DINAMIGE to carry out this report for Education and Culture Ministery, to study the feasibility of the exploration and exploitation of underground waters located in three properties zones in Santa Rosa's town, Canelones province. By means of the geoeletric methods it was possible to estimate the alluviums thickness ,sedimentary deposits or alteration mantels. The purpose of the present work has been to establish geologic and structural features through vertical electric well by means of which is been able to study the vertical variations of the resistivity .
Wong, Yu Hua; Tan, Wai Yan; Tan, Chin Ping; Long, Kamariah; Nyam, Kar Lin
2014-01-01
Objective To examine the cytotoxic properties of both the kenaf (Hibiscus cannabinus L.) seed extract and kenaf seed oil on human cervical cancer, human breast cancer, human colon cancer and human lung cancer cell lines. Methods The in vitro cytotoxic activity of the kenaf (Hibiscus cannabinus L.) seed extract and kenaf seed oil on human cancer cell lines was evaluated by using 3-(4,5-dimethylthiazol-2-yl)-2,5-diphenyltetrazolium bromide and sulforhodamine B assays. Cell morphological changes were observed by using an inverted light microscope. Results The kenaf seed extract (KSE) exhibited a lower IC50 than kenaf seed oil (KSO) in all of the cancer cell lines. Morphological alterations in the cell lines after KSE and KSO treatment were observed. KSE and KSO possessed effective cytotoxic activities against all the cell lines been selected. Conclusions KSE and KSO could be potential sources of natural anti-cancer agents. Further investigations on using kenaf seeds for anti-proliferative properties are warranted. PMID:25183141
Directory of Open Access Journals (Sweden)
Gloria Lapeña-Gallego
2017-01-01
Full Text Available A través de la Memoria Histórica, la Historia con mayúsculas se ha convertido en una fuente inagotable para narrar grandes historias con minúscula. De manera paralela, el paso de una cultura eminentemente letrada a otra más visual con predominio de la imagen ha favorecido la progresiva incorporación en el ámbito educativo de fuentes procedentes de la cultura popular, cuyos autores se aproximan al hecho histórico desde una perspectiva más íntima y reflexiva. En el presente artículo se fundamenta el potencial del álbum ilustrado como fórmula narrativa complementaria al manual escolar o libro de texto de Historia, especialmente en el tratamiento de temas complejos y delicados, como el holocausto nazi. Además, se propone un modelo de análisis que tiene en cuenta las particularidades de este género artístico en la construcción de la historiografía por medio de la incorporación de imágenes que van más allá de ser una redundancia o aclaración del texto. Para el cumplimiento de ambos objetivos, una vez analizado la concepción actual de la narración histórica, se estudia en detalle el álbum Rosa Blanca, contextualizado en la ocupación nazi durante la Segunda Guerra Mundial.
Energy Technology Data Exchange (ETDEWEB)
Legros, E.
2002-12-01
New developments are expected on the prolific bloc 17 of the Angola offshore. Among the tenth of discoveries that followed the discovery of the Girassol giant field, TotalFinaElf initially selected the Dalia field, for which engineering studies started in December 2000. However, it is still not excluded that the development of the Rosa-Lirio field will start first. This article describes the specific characteristics of this field and the solutions proposed for its exploitation. (J.S.)
Ifie, Idolo; Ifie, Beatrice E; Ibitoye, Dorcas O; Marshall, Lisa J; Williamson, Gary
2018-09-30
Seasonal variations in crops can alter the profile and amount of constituent compounds and consequentially any biological activity. Differences in phytochemical profile, total phenolic content and inhibitory activity on α-glucosidase (maltase) of Hibiscus sabdariffa calyces grown in South Western Nigeria were determined over wet and dry seasons. The phenolic profile, organic acids and sugars were analysed using HPLC, while inhibition of rat intestinal maltase was measured enzymically. There was a significant increase (1.4-fold; p ≤ 0.05) in total anthocyanin content in the dry compared to wet planting seasons, and maltase inhibition from the dry season was slightly more potent (1.15-fold, p ≤ 0.05). Fructose (1.8-fold), glucose (1.8-fold) and malic acid (3.7-fold) were significantly higher (p ≤ 0.05) but citric acid was lower (62-fold, p ≤ 0.008) in the dry season. Environmental conditions provoke metabolic responses in Hibiscus sabdariffa affecting constituent phytochemicals and nutritional value. Copyright © 2018 Elsevier Ltd. All rights reserved.
Kao, Erl-Shyh; Yang, Mon-Yuan; Hung, Chia-Hung; Huang, Chien-Ning; Wang, Chau-Jong
2016-01-01
Diets high in fat lead to excess lipid accumulation in adipose tissue, which is a crucial factor in the development of obesity, hepatitis, and hyperlipidemia. In this study, we investigated the anti-obesity effect of Hibiscus sabdariffa extract (HSE) in vivo. Hamsters fed a high-fat diet (HFD) develop symptoms of obesity, which were determined based on body weight changes and changes in plasma and serum triglycerides, free fatty acid concentrations, total cholesterol levels, LDL-C levels, HDL-C levels, and adipocyte tissue weight. HFD-fed hamsters were used to investigate the effects of HSE on symptoms of obesity such as adipogenesis and fatty liver, loss of blood glucose regulation, and serum ion imbalance. Interestingly, HSE treatment effectively reduced the effects of the HFD in hamsters in a dose-dependent manner. Further, after inducing maturation of preadipocytes, Hibiscus sabdariffa polyphenolic extract (HPE) was shown to suppress the adipogenesis of adipocytes. However, HPE does not affect the viability of preadipocytes. Therefore, both HSE and HPE are effective and viable treatment strategies for preventing the development and treating the symptoms of obesity.
Atividade fungitóxica de extratos vegetais e produtos comerciais contra Diplocarpon rosae
Directory of Open Access Journals (Sweden)
Janaina Miyashiro Simon
Full Text Available RESUMO O objetivo deste trabalho foi verificar o potencial de extratos oriundos de plantas medicinais (Rosmarinus officinalis L., Equisetum arvense L. e Moringa oleifera Lam. e produtos comerciais (a base de extratos vegetais, óleos vegetais e fosfito de potássio no controle in vitro de Diplocarpon rosae. Avaliou-se o efeito dos tratamentos sobre o fitopatógeno pelo índice de velocidade de crescimento micelial, inibição do crescimento micelial, inibição da esporulação, índice de esporulação, síntese de proteínas, a atividade específica de peroxidase e catalase no micélio do fitopatógeno, utilizando extrato bruto aquoso (EBA de folhas de R. officinalis (1%; EBA de caules de E. arvense (1%; EBA de sementes de M. oleifera (1%; produto comercial a base de extratos vegetais fermentados (0,01%; produto comercial a base de fosfito de potássio (0,01%; produto comercial a base de óleos vegetais (0,01%; produto a base de massa cítrica (0,01%; fungicida a base de Tiofanato metílico (0,007%; adjuvante (0,0025% BDA e BD. Pelos resultados observou-se maior redução do crescimento de D. rosae quando na presença do produto comercial a base de óleos vegetais. O EBA de E. arvense e o produto comercial a base de extratos vegetais fermentados apresentaram efeito anti-esporulante. Os tratamentos com EBA de R. officinalis, EBA de E. arvense, EBA de M. oleifera, produto comercial a base de óleos vegetais e produto a base de massa cítrica aumentaram a síntese de proteínas no micélio D.rosae. Houve aumento da atividade específica das enzimas peroxidase e catalase no micélio quando na presença do EBA de R. officinalis e produto comercial a base de fosfito de potássio, respectivamente. O EBA de E. arvense, e os produtos comerciais a base de óleos vegetais e a base de extratos vegetais fermentados, apresentaram resultados promissores no controle do fitopatógeno D. rosae.
Ma, Yuanwu; Yu, Lei; Pan, Shuo; Gao, Shan; Chen, Wei; Zhang, Xu; Dong, Wei; Li, Jing; Zhou, Rui; Huang, Lan; Han, Yunlin; Bai, Lin; Zhang, Li; Zhang, Lianfeng
2017-10-01
The rat is an important laboratory animal for physiological, toxicological and pharmacological studies. Clustered regularly interspaced short palindromic repeats (CRISPR)/CRISPR-associated 9 (Cas9) is a simple and efficient tool to generate precise genetic modifications in rats, which will promote the accumulation of genetic resources and enable more precise studies of gene function. To monitor Cre-loxP-mediated excision in vivo, we generated a Cre reporter rat strain (Rosa26-imCherry) by knockin of a Cre reporter cassette at the Rosa26 locus using CRISPR/Cas9. Rosa26-imCherry rats exhibited inducible expression of the mCherry cassette (imCherry) using the Cre-loxP system, whereas normal rats exhibited ubiquitous expression of eGFP but not mCherry in the whole body. Injection of adeno-associated virus serotype 9-Cre into the hippocampus and skeletal muscle resulted in mCherry expression in virus-infected cells. Cre-loxP-mediated mCherry expression was then evaluated by crossing Rosa26-imCherry rats with transgenic rats ubiquitously expressing CAG-Cre, heart-specific α-MHC-Cre transgenic rats and liver-specific Alb-Cre knockin rats. Finally, using the established system the expression pattern of Cre driven by two endogenous gene promoters (Wfs1-Cre knockin rat, FabP2-Cre knockin rat) was traced. In summary, we demonstrated excision of the loxP-flanked allele in Rosa26-imCherry rats via activation of mCherry expression in the presence of Cre recombinase. This newly established Rosa26-imCherry rat strain represents a useful tool to facilitate Cre-expression pattern determination and tracing experiments. © 2017 Federation of European Biochemical Societies.
The metabolism of sorbitol and fructose in isolated chloroplasts of Santa Rosa plum leaves
International Nuclear Information System (INIS)
De Villiers, O.T.
1979-01-01
Aqueously as well as non-aqueously isolated chloroplasts from Santa Rosa plum leaves readily metabolised sorbitol- 14 C to fructose, glucose and sucrose. Likewise, fructose- 14 C was converted to sorbitol, glucose and sucrose [af
COMPORTAMIENTO DEL CRECIMIENTO EN ALTURA DE Hibiscus elatus Sw CULTIVADA EN CONTENEDORES
Directory of Open Access Journals (Sweden)
M. Cobas-López
2003-01-01
Full Text Available Hibiscus elatus Sw. (majagua es una especie nativa de Cuba, incluida en los planes de reforestación del país por su importancia económica, ecológica y su condición de ser una madera preciosa. En el trabajo se describe el comportamiento en vivero del crecimiento en altura de la especie, cultivada en contenedores. Se utilizaron cuatro tipos de sustratos, que fueron los siguientes: S1- Turba (40 %, humus de lombriz (40 % y corteza de pino compostada (20 %; S2- Estiércol de caballo (45 %, composta (40 %, y humus de lombriz (15 %; S3- Humus de lombriz (30 %, composta (25 %, turba (25 %, y estiércol de caballo (20 %; S4- Testigo, consistente en suelo proveniente de una plantación de la especie. A través del análisis de regresión se probaron nueve modelos matemáticos del tipo y = f (x, polinómicos, exponenciales y logarítmicos. De acuerdo con el coeficiente de determinación obtenido, del análisis de residuos y la validación de los modelos, se comprobó que la función que mejor representa el crecimiento en altura de Hibiscus elatus Sw., para los sustratos estudiados fue b t y b e 1 = 0 + .
The chemical interaction between plants, which is referred to as allelopathy, may result in the inhibition of plant growth and development. The objective of this research was to determine the impact of kenaf (Hibiscus cannabinus L.) plant extracts on the germination and post-germination development ...
We cloned the full-length of the gene putatively encoding caffeic acid O-methyltransferase (COMT) from kenaf (Hibiscus cannabinus L.) using degenerate primers and the RACE (rapid amplification of cDNA ends) method. Kenaf is an herbaceous and rapidly growing dicotyledonous plant with great potential ...
Wilt, crown, and root rot of common rose mallow (Hibiscus moscheutos) caused by a novel Fusarium sp
A new crown and root rot disease of landscape plantings of the malvaceous ornamental common rose mallow (Hibiscus moscheutos) was first detected in Washington State in 2012. The main objectives of this study were to complete Koch's postulates, document the disease sypmtoms photographically, and iden...
Effect of Chronic Gamma Irradiation on Kenaf (Hibiscus cannabinus. L) Variety V36
International Nuclear Information System (INIS)
Mohd Zulmadi Sani; Faiz Ahmad; Mustapha Akil; Zaiton Ahmad; Affrida Abu Hassan; Abdul Rahim Harun
2016-01-01
Kenaf (Hibiscus cannabinus) is originated from Africa and used in making various products such as animal food pallet, clothes, particle board, bio-plastics, paper and many other fibre related products. Due to its commercial value in various industries, research has been carried out to obtain kenaf with improved traits. Mutation breeding using ionizing radiation has been used widely and proven to be effective as an alternative method in plant improvement. In this study, chronic gamma irradiation on kenaf (Hibiscus cannabinus. L) Variety V36 was carried out at Gamma Greenhouse (GGH) facility at Malaysia Nuclear Agency. Kenaf seeds were planted in pots at the shade house and transferred to GGH after 7 days. These seedlings were subjected to various dose rates of 0.3 Gy/ hour, 0.17 Gy/ hour, 0.11 Gy /hour, 0.05 Gy/ hour, 0.03 Gy/ hour, 0.02 Gy/ hour, and 0 Gy/ hour (control). Plant survival and morphological data such as plant height and stem girth, were observed. From the result obtain, at accumulated dose of 230 Gy (Ring 4), plant showed the highest average plant height, stem girth and highest morphological changes. The finding of this study is useful in determining the most suitable dose rate for chronic gamma irradiation in the future. (author)
Hecker, Suzanne; Langenheim, Victoria; Williams, Robert; Hitchcock, Christopher S.; DeLong, Stephen B.
2016-01-01
Airborne light detection and ranging (lidar) topography reveals for the first time the trace of the Rodgers Creek fault (RCF) through the center of Santa Rosa, the largest city in the northern San Francisco Bay area. Vertical deformation of the Santa Rosa Creek floodplain expresses a composite pull‐apart basin beneath the urban cover that is part of a broader 1‐km‐wide right‐releasing bend in the fault. High‐resolution geophysical data illuminate subsurface conditions that may be responsible for the complex pattern of surface faulting, as well as for the distribution of seismicity and possibly for creep behavior. We identify a dense, magnetic basement body bounded by the RCF beneath Santa Rosa that we interpret as a strong asperity, likely part of a larger locked patch of the fault to the south. A local increase in frictional resistance associated with the basement body appears to explain (1) distributed fault‐normal extension above where the RCF intersects the body; (2) earthquake activity around the northern end of the body, notably the 1969 ML 5.6 and 5.7 events and aftershocks; and (3) creep rates on the RCF that are higher to the north of Santa Rosa than to the south. There is a significant probability of a major earthquake on the RCF in the coming decades, and earthquakes associated with the proposed asperity have the potential to release seismic energy into the Cotati basin beneath Santa Rosa, already known from damaging historical earthquakes to produce amplified ground shaking.
Still the same after all these years: Santa Rosa`s curbside recycling model
Energy Technology Data Exchange (ETDEWEB)
Egan, K.
1997-10-01
When Santa Rosa, located north of San Francisco, first began its recycling program in 1977, it was no different from the other fledgling curbside recycling programs in the state. Back then, residents collected recyclables in their homes and put them out on the curb each week next to the garbage cans in whatever container they could find, whether it was a paper grocery bag or a cardboard box. The city`s pre-bin recycling program had a participation rate of about 25%. Then in 1978, with the firm`s help, Empire officials came up with the idea of providing recycling bins to residents. The program planners asked residents to source-separate their recyclables and then put the metals (including steel, tin, and aluminum); all three glass colors (brown, green, and clear); and newspaper in three individual bins. A few weeks after city officials distributed the bins to residents, the program showed a participation rate of 77%, indicating to Clark that the bins were necessary to significantly increase public awareness of the program.
Taxonomic status of the roses (Rosa) described by S.G. Dimitrov from Bulgaria
DEFF Research Database (Denmark)
Zielinski, J.; Petrova, A; Tan, Kit
2004-01-01
The original herbarium vouchers for six species of Rosa (Rosaceae) described by S. G. Dimitrov from Bulgaria are taxonomically evaluated. Two species (R. balcanica, R. orphei) are considered hybrids, four other names (R. bulgarica, R. parilica, R. pontica and R. rhodopaea) are taxonomic synonyms...
Anwar Ibrahim, Doa'a; Noman Albadani, Rowida
2014-01-01
Green tea and hibiscus are widely consumed as traditional beverages in Yemen and some regional countries. They are relatively cheap and the belief is that they improve health state and cure many diseases. The aim of this study was to evaluate the potential protective and antibacterial activity of these two famous plants in vitro through measuring their antibacterial activity and in vivo through measuring nonenzymatic kidney markers dysfunction after induction of nephrotoxicity by gentamicin. Gram positive bacteria like MRSA (methicillin resistant Staphylococcus aureus) were isolated from hospitalized patients' different sources (pus and wound) and Gram negative bacteria including E. coli and P. aeruginosa were used in vitro study. In addition, the efficacy of these plants was assessed in vivo through measuring nonenzymatic kidney markers including S. creatinine and S. urea. Green tea was shown antimicrobial activity against MRSA with inhibition zone 19.67 ± 0.33 mm and MIC 1.25 ± 0.00 mg/mL compared with standard reference (vancomycin) 18.00 ± 0.00 mg/mL. Hibiscus did not exhibit a similar effect. Both Hibiscus- and green tea-treated groups had nephroprotective effects as they reduced the elevation in nonenzymatic kidney markers. We conclude that green tea has dual effects: antimicrobial and nephroprotective.
Directory of Open Access Journals (Sweden)
Doa’a Anwar Ibrahim
2014-01-01
Full Text Available Green tea and hibiscus are widely consumed as traditional beverages in Yemen and some regional countries. They are relatively cheap and the belief is that they improve health state and cure many diseases. The aim of this study was to evaluate the potential protective and antibacterial activity of these two famous plants in vitro through measuring their antibacterial activity and in vivo through measuring nonenzymatic kidney markers dysfunction after induction of nephrotoxicity by gentamicin. Gram positive bacteria like MRSA (methicillin resistant Staphylococcus aureus were isolated from hospitalized patients’ different sources (pus and wound and Gram negative bacteria including E. coli and P. aeruginosa were used in vitro study. In addition, the efficacy of these plants was assessed in vivo through measuring nonenzymatic kidney markers including S. creatinine and S. urea. Green tea was shown antimicrobial activity against MRSA with inhibition zone 19.67 ± 0.33 mm and MIC 1.25 ± 0.00 mg/mL compared with standard reference (vancomycin 18.00 ± 0.00 mg/mL. Hibiscus did not exhibit a similar effect. Both Hibiscus- and green tea-treated groups had nephroprotective effects as they reduced the elevation in nonenzymatic kidney markers. We conclude that green tea has dual effects: antimicrobial and nephroprotective.
Anwar Ibrahim, Doa'a; Noman Albadani, Rowida
2014-01-01
Green tea and hibiscus are widely consumed as traditional beverages in Yemen and some regional countries. They are relatively cheap and the belief is that they improve health state and cure many diseases. The aim of this study was to evaluate the potential protective and antibacterial activity of these two famous plants in vitro through measuring their antibacterial activity and in vivo through measuring nonenzymatic kidney markers dysfunction after induction of nephrotoxicity by gentamicin. Gram positive bacteria like MRSA (methicillin resistant Staphylococcus aureus) were isolated from hospitalized patients' different sources (pus and wound) and Gram negative bacteria including E. coli and P. aeruginosa were used in vitro study. In addition, the efficacy of these plants was assessed in vivo through measuring nonenzymatic kidney markers including S. creatinine and S. urea. Green tea was shown antimicrobial activity against MRSA with inhibition zone 19.67 ± 0.33 mm and MIC 1.25 ± 0.00 mg/mL compared with standard reference (vancomycin) 18.00 ± 0.00 mg/mL. Hibiscus did not exhibit a similar effect. Both Hibiscus- and green tea-treated groups had nephroprotective effects as they reduced the elevation in nonenzymatic kidney markers. We conclude that green tea has dual effects: antimicrobial and nephroprotective. PMID:24949007
EFFECTS OF ALKALINE PRE-IMPREGNATION AND PULPING ON MALAYSIA CULTIVATED KENAF (HIBISCUS CANNABINUS
Lin Suan Ang; Cheu Peng Leh; Chong Chat Lee
2010-01-01
This study was carried out to identify an appropriate alkaline pulping condition for Malaysia cultivated kenaf (Hibiscus cannabinus L.). The chemical composition of the kenaf bast and core fibers, and also whole stalk with different growing time were examined prior to pulping attempts. The results of various soda-AQ pulping showed that the degree of carbohydrate degradation and delignification increased with the increase of active alkali and cooking temperature, but decreased with the increas...
Potencial uso de la leonardita para el cultivo de rosa en condiciones de invernadero
Directory of Open Access Journals (Sweden)
Marilú González
2018-01-01
Full Text Available La leonardita es un fertilizante orgánico que está teniendo cada vez mayor aceptación entre los agricultores, debido a que contiene altas cantidades de ácidos húmicos que favorecen la producción de los cultivos. Se evaluó el efecto de la aplicación de leonardita sobre parámetros vegetativos y productivos de rosa (Rosa sinensis cv. Freedom bajo condiciones de invernadero. Se evaluaron 3 dosis del ácidos orgánicos derivados del mineral leonardita: baja (10 g.cama-1, media (15 g.cama-1 y alta (20 g.cama-1 lo cual fue comparado con el efecto de un ácido orgánico comúnmente usado en el invernadero (control positivo y con la fertilización inorgánica (control negativo. Las aplicaciones fueron realizadas al inicio del ensayo sobre un área de 18 m2 por tratamiento y las plantas fueron evaluadas semanalmente durante 5 semanas. Los resultados obtenidos mostraron que las plantas tratadas con 15 g de leonardita.cama-1 presentaron mayor longitud de brotes, número de brotes basales y productividad de tallos en comparación con el resto de los tratamientos. Sin embargo, se sugiere realizar estudios similares donde se evalúe durante un periodo más prolongado para determinar el tiempo que se mantiene el efecto sobre la productividad en el cultivo de rosas en condiciones de invernadero.
BWR 2 % main recirculation line break LOCA tests RUNs 915 and 920 without HPCS in ROSA-III program
International Nuclear Information System (INIS)
Suzuki, Mitsuhiro; Nakamura, Hideo; Anoda, Yoshinari; Kumamaru, Hiroshige; Yonomoto, Taisuke; Koizumi, Yasuo; Tasaka, Kanji
1987-03-01
This report presents the experimental results of BWR LOCA integral tests, RUNs 915 and 920, which are performed in the ROSA-III program simulating 2 % main recirculation line break LOCA tests with and without pressure control system operation. The ROSA-III test facility simulates a BWR system with volume scale of 1/424 and has four half-length electrically heated fuel bundles, two active recirculation loops, four types of ECCS's, and steam and feedwater systems. The report presents (1) the experimental results of 2 % small break LOCA phanomena in the ROSA-III system and (2) the effects of the pressure control system on the LOCA phenomena. The pressure control system contributed to (A) prevent bulk flashing in the early blowdown phase, (B) early closure of MSIV by L2 level trip, (C) early actuation of ADS by L1 level trip. However, the core thermal responses of the two tests were similar because of the similar mass inventory in PV after the ADS actuation in both tests. (author)
Efficient generation of Rosa26 knock-in mice using CRISPR/Cas9 in C57BL/6 zygotes.
Chu, Van Trung; Weber, Timm; Graf, Robin; Sommermann, Thomas; Petsch, Kerstin; Sack, Ulrike; Volchkov, Pavel; Rajewsky, Klaus; Kühn, Ralf
2016-01-16
The CRISPR/Cas9 system is increasingly used for gene inactivation in mouse zygotes, but homology-directed mutagenesis and use of inbred embryos are less established. In particular, Rosa26 knock-in alleles for the insertion of transgenes in a genomic 'safe harbor' site, have not been produced. Here we applied CRISPR/Cas9 for the knock-in of 8-11 kb inserts into Rosa26 of C57BL/6 zygotes. We found that 10-20 % of live pups derived from microinjected zygotes were founder mutants, without apparent off-target effects, and up to 50 % knock-in embryos were recovered upon coinjection of Cas9 mRNA and protein. Using this approach, we established a new mouse line for the Cre/loxP-dependent expression of Cas9. Altogether, our protocols and resources support the fast and direct generation of new Rosa26 knock-in alleles and of Cas9-mediated in vivo gene editing in the widely used C57BL/6 inbred strain.
Baatartsogt, Tugsbaatar; Bui, Vuong N; Trinh, Dai Q; Yamaguchi, Emi; Gronsang, Dulyatad; Thampaisarn, Rapeewan; Ogawa, Haruko; Imai, Kunitoshi
2016-10-01
Viral neuraminidase inhibitors are widely used as synthetic anti-influenza drugs for the prevention and treatment of influenza. However, drug-resistant influenza A virus variants, including H5N1 highly pathogenic avian influenza viruses (HPAIVs), have been reported. Therefore, the discovery of novel and effective antiviral agents is warranted. We screened the antiviral effects of 11 herbal tea extracts (hibiscus, black tea, tencha, rosehip tea, burdock tea, green tea, jasmine tea, ginger tea, lavender tea, rose tea and oak tea) against the H5N1 HPAIV in vitro. Among the tested extracts, only the hibiscus extract and its fractionated extract (frHibis) highly and rapidly reduced the titers of all H5 HPAIVs and low pathogenic AIVs (LPAIVs) used in the pre-treatment tests of Madin-Darby canine kidney (MDCK) cells that were inoculated with a mixture of the virus and the extract. Immunogold electron microscopy showed that anti-H5 monoclonal antibodies could not bind to the deformed H5 virus particles pretreated with frHibis. In post-treatment tests of MDCK cells cultured in the presence of frHibis after infection with H5N1 HPAIV, the frHibis inhibited viral replication and the expression of viral antigens and genes. Among the plants tested, hibiscus showed the most prominent antiviral effects against both H5 HPAIV and LPAIV.
Flavonols including quercetin, kaempferol, myricetin, and fatty acids in plants have many useful health attributes including antioxidants, cholesterol lowering, and cancer prevention. Six accessions of roselle, Hibiscus sabdariffa calyces were evaluated for quercetin, kaempferol, and myricetin conte...
The use of the natural fibers requires the development of cost-efficient processing of fibers with consistent, uniform properties. The microbial communities associated with kenaf (Hibiscus cannabinus) plant fibers during retting were determined in an effort to identify possible means of accelerating...
Directory of Open Access Journals (Sweden)
Moretti Massimo
2016-06-01
Full Text Available Beach sands from the Rosa Marina locality (Adriatic coast, southern Italy were analysed mainly microscopically in order to trace the source areas of their lithoclastic and bioclastic components. The main cropping out sedimentary units were also studied with the objective to identify the potential source areas of lithoclasts. This allowed to establish how the various rock units contribute to the formation of beach sands. The analysis of the bioclastic components allows to estimate the actual role of organisms regarding the supply of this material to the beach. Identification of taxa that are present in the beach sands as shell fragments or other remains was carried out at the genus or family level. Ecological investigation of the same beach and the recognition of sub-environments (mainly distinguished on the basis of the nature of the substrate and of the water depth was the key topic that allowed to establish the actual source areas of bioclasts in the Rosa Marina beach sands. The sedimentological analysis (including a physical study of the beach and the calculation of some statistical parameters concerning the grain-size curves shows that the Rosa Marina beach is nowadays subject to erosion.
LaGreca, Nancy
2012-01-01
This study explores the intertextuality between Aurora Caceres's "La rosa muerta" (1914) and the novel "Del amor, del dolor y del vicio" (1898) by her ex-husband, Enrique Gomez Carrillo. Caceres strategically mentions Gomez Carrillo's novel in "La rosa muerta" to invite a reading of her work in dialogue with his. Both narratives follow the sexual…
Isolation and identification of an allelopathic substance from Hibiscus sabdariffa.
Suwitchayanon, Prapaipit; Pukclai, Piyatida; Ohno, Osamu; Suenaga, Kiyotake; Kato-Noguchi, Hisashi
2015-05-01
In this study, an allelopathic substance was isolated from an aqueous methanol extract of Hibiscus sabdariffa L. by column chromatography and reverse phase HPLC. The chemical structure of the substance was determined by 1H NMR spectroscopy and mass spectrometry as trimethyl allo-hydroxycitrate. Trimethyl allo-hydroxycitrate inhibited the growth of cress hypocotyls and roots at concentrations greater than 10 mM. The concentrations required for 50% growth inhibition of the hypocotyls and roots of cress were 20.3 and 14.4 mM, respectively. The inhibitory activity of trimethyl allo-hydroxycitrate suggests that the substance may act as an allelopathic substance of H. sabdariffa.
Beltrán-Debón, Raúl; Rodríguez-Gallego, Esther; Fernández-Arroyo, Salvador; Senan-Campos, Oriol; Massucci, Francesco A; Hernández-Aguilera, Anna; Sales-Pardo, Marta; Guimerà, Roger; Camps, Jordi; Menendez, Javier A; Joven, Jorge
2015-09-01
We explored the acute multifunctional effects of polyphenols from Hibiscus sabdariffa in humans to assess possible consequences on the host's health. The expected dynamic response was studied using a combination of transcriptomics and metabolomics to integrate specific functional pathways through network-based methods and to generate hypotheses established by acute metabolic effects and/or modifications in the expression of relevant genes. Data were obtained from healthy male volunteers after 3 hours of ingestion of an aqueous Hibiscus sabdariffa extract. The data were compared with data obtained prior to the ingestion, and the overall findings suggest that these particular polyphenols had a simultaneous role in mitochondrial function, energy homeostasis and protection of the cardiovascular system. These findings suggest beneficial actions in inflammation, endothelial dysfunction, and oxidation, which are interrelated mechanisms. Among other effects, the activation of the heme oxygenase-biliverdin reductase axis, the systemic inhibition of the renin-angiotensin system, the inhibition of the angiotensin-converting enzyme, and several actions mirroring those of the peroxisome proliferator-activated receptor agonists further support this notion. We also found concordant findings in the serum of the participants, which include a decrease in cortisol levels and a significant increase in the active vasodilator metabolite of bradykinin (des-Arg(9)-bradykinin). Therefore, our data support the view that polyphenols from Hibiscus sabdariffa play a regulatory role in metabolic health and in the maintenance of blood pressure, thus implying a multi-faceted impact in metabolic and cardiovascular diseases.
Directory of Open Access Journals (Sweden)
Lílian Estrela Borges Baldotto
2015-06-01
Full Text Available The vegetative propagation of ornamental plants can be accelerated by applying plant growth regulators. Amongst them, the use of auxins, plant hormones with physiological effects on cell elongation and rooting have stood out. Alternatively, the application of humic acids, bioactive fraction of soil organic matter, also results in increases in rooting cuttings of ornamental plants. The objective of this work was to study the growth characteristics and the nutritional contents of croton and hibiscus plants during acclimation of seedlings in response to different concentrations of indolebutyric acid (IBA and humic acid (HA applied to cuttings for rooting. The experiment was conducted in greenhouse, and the apical stem cuttings were treated with solutions with concentrations of 0, 250, 500, 1000 and 2000 mg L-1of IBA and 0, 10, 20, 30 and 40 mg L-1 of C from HA. At 45 days of rooting in carbonized rice husk, they were individually transferred to plastic bags of 2.0 dm3 containing a mixture of soil: sand: manure (2: 1: 1 as substrate. At 90 days of acclimation, the plants were collected for measurement of growth and nutritional variables. The results showed that the application of the IBA stimulates the absorption of nutrients and growth of croton cuttings and transplanted hibiscus, contributing to formation of vigorous seedlings. A similar response occurred with the application of HA in hibiscus cuttings
Infestations of the pink hibiscus mealybug, Maconellicoccus hirsutus (Green), in ornamental trees were already in an advanced state at the time of its discovery in the Imperial Valley of California (USA) in August 1999. Concern about the spread of M. hirsutus beyond the Imperial Valley led to the p...
Effect of Absolute From Hibiscus syriacus L. Flower on Wound Healing in Keratinocytes
Yoon, Seok Won; Lee, Kang Pa; Kim, Do-Yoon; Hwang, Dae Il; Won, Kyung-Jong; Lee, Dae Won; Lee, Hwan Myung
2017-01-01
Background: Proliferation and migration of keratinocytes are essential for the repair of cutaneous wounds. Hibiscus syriacus L. has been used in Asian medicine; however, research on keratinocytes is inadequate. Objective: To establish the dermatological properties of absolute from Hibiscus syriacus L. flower (HSF) and to provide fundamental research for alternative medicine. Materials and Methods: We identified the composition of HSF absolute using gas chromatography-mass spectrometry analysis. We also examined the effect of HSF absolute in HaCaT cells using the XTT assay, Boyden chamber assay, sprout-out growth assay, and western blotting. We conducted an in-vivo wound healing assay in rat tail-skin. Results: Ten major active compounds were identified from HSF absolute. As determined by the XTT assay, Boyden chamber assay, and sprout-out growth assay results, HSF absolute exhibited similar effects as that of epidermal growth factor on the proliferation and migration patterns of keratinocytes (HaCaT cells), which were significantly increased after HSF absolute treatment. The expression levels of the phosphorylated signaling proteins relevant to proliferation, including extracellular signal-regulated kinase 1/2 (Erk 1/2) and Akt, were also determined by western blot analysis. Conclusion: These results of our in-vitro and ex-vivo studies indicate that HSF absolute induced cell growth and migration of HaCaT cells by phosphorylating both Erk 1/2 and Akt. Moreover, we confirmed the wound-healing effect of HSF on injury of the rat tail-skin. Therefore, our results suggest that HSF absolute is promising for use in cosmetics and alternative medicine. SUMMARY Hisbiscus syriacus L. flower absolute increases HaCaT cell migration and proliferation.Hisbiscus syriacus L. flower absolute regulates phosphorylation of ERK 1/2 and Akt in HaCaT cell.Treatment with Hisbiscus syriacus L. flower induced sprout outgrowth.The wound in the tail-skin of rat was reduced by Hisbiscus syriacus
Directory of Open Access Journals (Sweden)
Marzieh Mirshekari
2017-08-01
Salicylic acid (SA is one of the important signal molecules, which modulates plant responses to environmental stress. In the present work, impact of exogenous SA on some physiological and biochemical traits of Hibiscus sabdariffa in response to drought stress was studied. Hibiscus sabdariffa seedlings were exposed to six drought levels (0, -0.05, -0.1, -0.5, -0.75, and 1 MPa with two SA concentrations (0 and 500 µM in 5 days intervals up to 20 days in a factorial design. During drought stress period, the root and shoot growth, relative water content, pigments content, non-reducing sugar and starch content was significantly decreased. SA treatment cause prevention of the growth reduction and improvement of relative water content. Protein concentration was roughly unchanged during drought stress with SA, while, reducing sugars accumulates and non-reducing sugars and starch significantly decreases. The results show that exogenous SA application on leaves during drought stress can ameliorate detrimental effects of stress through reducing water loss and accumulating reducing sugars, which cause preserving turgor pressure of the cells.
De Villiers, Marelize; Manrakhan, Aruna; Addison, Pia; Hattingh, Vaughan
2013-10-01
Ceratitis capitata (Wiedemann), Ceratitis rosa Karsch, and Ceratitis cosyra (Walker) are fruit fly species (Diptera: Tephritidae) of economic importance in South Africa. These pests cause direct damage to a number of commercially produced fruit and are of phytosanitary concern. A study was conducted to determine the distribution, relative abundance, and seasonal occurrence of the three species in different climatic regions of South Africa. The relative abundance and seasonal phenology of C. capitata and C. rosa were also compared between production areas and home gardens in Stellenbosch, Western Cape. Yellow bucket traps baited with Biolure were used to trap the flies over a 2-yr period in the different sampling areas. Different fruit types were sampled in Stellenbosch to determine fruit fly infestation. C. capitata was found to have a widespread distribution in South Africa, whereas C. rosa were absent from or only present in low numbers in the drier regions. C. cosyra was restricted to the North East and East coast, following a similar pattern to the distribution of marula, Sclerocarrya birrea, an important wild host. Fruit in home gardens provided a breeding ground for C. capitata and C. rosa and a source for infestation of orchards when fruit started to mature, highlighting the need for an area-wide strategy for the control of fruit flies.
Ahsan, Muhammad; Younis, Adnan; Jaskani, Muhammad Jafar; Tufail, Aasma; Riaz, Atif; Schwinghamer, Timothy; Tariq, Usman; Nawaz, Fahim
2018-09-15
Wastewater is an alternative to traditional sources of renewable irrigation water in agriculture, particularly in water-scarce regions. However, the possible risks due to heavy metals accumulation in plant tissues are often overlooked by producers. The present study aimed to identify heavy metals-induced structural modifications to roots of scented Rosa species that were irrigated with water of marginal quality. The chemical and mineral contents from the experimental irrigation canal water (control) and treated wastewater were below the limits recommended by the Pakistan Environmental Protection Agency (Pak-EPA) for medicinal plants. The experimentally untreated wastewater contained electrical conductivity (EC), chemical oxygen demand (COD), biological oxygen demand (BOD), and heavy metals (Co, Cu, Cd, Pb) that were above the recommended limits. The responses by wastewater-treated Rosa species (Rosa damascena, R. bourboniana, R. Gruss-an-Teplitz, and R. centifolia) were evaluated. The experimental data revealed that treated wastewater significantly increased the thickness of collenchyma (cortex and pith) and parenchyma tissues (vascular bundle, xylem, and phloem) of R. Gruss-an-Teplitz. Root dermal tissues (epidermis) of R. bourboniana also responded to treated wastewater. R. damascena and R. centifolia were the least affected species, under the experimental irrigation conditions. Collenchyma and dermal tissues were thicker in R. damascena and R. Gruss-an-Teplitz under untreated wastewater conditions. In parenchyma tissues, vascular bundles were thicker in R. damascena in untreated wastewater conditions, while the xylem and phloem of R. Gruss-an-Teplitz were thicker where treated wastewater was applied. In tissues other than the vascular bundle, the differences in anatomical metrics due to the experimental irrigation treatments were greater during the second year of the experiment than in the first year. The contents of metals other than chromium in the roots and
Preliminary X-ray data analysis of crystalline hibiscus chlorotic ringspot virus
International Nuclear Information System (INIS)
Cheng, Ao; Speir, Jeffrey A.; Yuan, Y. Adam; Johnson, John E.; Wong, Sek-Man
2009-01-01
Hibiscus chlorotic ringspot virus is a positive-sense monopartite single-stranded RNA virus that belongs to the Carmovirus genus of the Tombusviridae family. Authentic virus harvested from infected host kenaf leaves was purified and virus crystals were grown in multiple conditions. One of the crystals diffracted to 3.2 Å resolution and allowed the collection of a partial data set. Hibiscus chlorotic ringspot virus (HCRSV) is a positive-sense monopartite single-stranded RNA virus that belongs to the Carmovirus genus of the Tombusviridae family, which includes carnation mottle virus (CarMV). The HCRSV virion has a 30 nm diameter icosahedral capsid with T = 3 quasi-symmetry containing 180 copies of a 38 kDa coat protein (CP) and encapsidates a full-length 3.9 kb genomic RNA. Authentic virus was harvested from infected host kenaf leaves and was purified by saturated ammonium sulfate precipitation, sucrose density-gradient centrifugation and anion-exchange chromatography. Virus crystals were grown in multiple conditions; one of the crystals diffracted to 3.2 Å resolution and allowed the collection of a partial data set. The crystal belonged to space group R32, with unit-cell parameters a = b = 336.4, c = 798.5 Å. Packing considerations and rotation-function analysis determined that there were three particles per unit cell, all of which have the same orientation and fixed positions, and resulted in tenfold noncrystallography symmetry for real-space averaging. The crystals used for the structure determination of southern bean mosaic virus (SBMV) have nearly identical characteristics. Together, these findings will greatly aid the high-resolution structure determination of HCRSV
Ohtani, Masato; Tani, Naoki; Yoshimaru, Hiroshi
2008-11-01
Polymorphic microsatellite markers were developed for Hibiscus glaber, an endemic tree of the Bonin Islands. Eighty-seven of the 208 sequences from an enriched library were unique and containing microsatellites. Ten loci were proved to be highly polymorphic among 78 individuals from the Nishi-jima Island. Total exclusionary powers for the first and the second parents were 99.989% and 99.999%, respectively. Nine loci also amplified single fragment from genomic DNA of H. tiliaceus, a related and widespread congener. Our markers can be reliably used for the estimation of current gene flow within/among populations of the two woody Hibiscus species. © 2008 The Authors. Journal compilation © 2008 Blackwell Publishing Ltd.
Directory of Open Access Journals (Sweden)
Seyedeh Farzaneh Moniri
2018-01-01
Full Text Available Ischemic stroke is an important cause of death and disability in the world. Brain ischemia causes damage to brain cell, and among brain neurons, pyramidal neurons of the hippocampal CA1 region are more susceptive to ischemic injury. Recent findings suggest that neurotrophic factors protect against ischemic cell death. A dietary component of Rosa damascene extract possibly is associated with expression of neurotrophic factors mRNA following ischemia, so it can have therapeutic effect on cerebral ischemia. The present study attempts to evaluate the neuroprotective effect of Rosa damascene extract on adult rat hippocampal neurons following ischemic brain injury. Forty-eight adult male Wistar rats (weighing 250±20 gr and ages 10-12 weeks used in this study, animals randomly were divided into 6 groups including Control, ischemia/ reperfusion (IR, vehicle and three treated groups (IR+0.5, 1, 2 mg/ml extract. Global ischemia was induced by bilateral common carotid arteries occlusion for 20 minutes. The treatment was done by different doses of Rosa damascena extract for 30 days. After 30 days cell death and gene expression in neurons of the CA1 region of the hippocampus were evaluated by Nissl staining and real time PCR assay. We found a significant decrease in NGF, BDNF and NT3 mRNA expression in neurons of CA1 region of the hippocampus in ischemia group compared to control group (P<0.0001. Our results also revealed that the number of dark neurons significantly increases in ischemia group compared to control group (P<0.0001. Following treatment with Rosa damascene extract reduced the number of dark neurons that was associated with NGF, NT3, and BDNF mRNA expression. All doses level had positive effects, but the most effective dose of Rosa damascena extract was 1 mg/ml. Our results suggest that neuroprotective activity of Rosa damascena can enhance hippocampal CA1 neuronal survival after global ischemia.
Directory of Open Access Journals (Sweden)
F. Douglas Wilson
2006-01-01
Full Text Available Hibiscus section Furcaria is a natural group of plants that presently includes 109 recognized taxa. Taxa are found in subsaharan Africa, India, southeastern Asia, Malesia, Australia, islands of the Pacific basin, the Caribbean, North, Central, and South America. The basic chromosome number is x = 18. In nature, ploidy levels range from diploid to decaploid. The taxa exhibit a remarkable amount of genome diversity. At least 13 genomes have been identified, some distributed widely and others with more restricted distributions. No modern taxonomic monograph ofHibiscus section Furcaria exists, but a number of regional studies have appeared that are essentially global in extent. Also, a number of studies of chromosome numbers and genome relationships have been published. The present paper includes a census of all the presently accepted taxa, the geographical distribution of each taxon, and chromosome numbers and genome designations of the 49 taxa for which the information is available. Important mechanisms of speciation include genome divergence at the diploid level, followed by hybridization and allopolyploidy, significant species radiation at the tetraploid and hexaploid levels, and the development of even higher levels of allopolyploids.
International Nuclear Information System (INIS)
1977-12-01
Results of the ROSA-II test simulating a loss-of coolant accident (LOCA) in a light water reactor (LWR) are presented, including the test conditions and interpretation of the phenomena for test runs 415, 417, 421 and 422. Even in small break at the cold leg, the core is exposed to void and the temperature rises. In small break of the hot leg, however, core cooling keeps without temperature rise, because there still remains much residual water and upward core flow exists. Direct effect of the HPCI on the depressurization rate is small, but it increases the accumulator injection rate, leading to early core reflooding and early core cooling from upward. Effects of the secondary system depressurization are increase of depressurization and discharge rates of the primary loop, which results in early initiation of the accumulator injection and core reflooding. (auth.)
Directory of Open Access Journals (Sweden)
Samman Fatima
2016-01-01
Full Text Available Hibiscus mealybug, Maconellicoccus hirsutus (Hemiptera: Pseudococcidae, is the major pest of many vegetables, fruits, crops, and ornamental plants causing losses to the farmers and its control has been an issue of significance in the pest management. This study was aimed at evaluating different concentrations (0.06%, 0.1%, and 0.14% of Telsta, Advantage, Talstar, Imidacloprid, and their mixtures against hibiscus mealybug in the Laboratory of Systematics and Pest Management at University of Gujrat, Pakistan. The toxic effect was evaluated in the laboratory bioassay after 24 and 48 h of the application of insecticides. The highest mortality (95.83% was shown by Talstar and Talstar + Imidacloprid at the concentration of 0.14% after 48 h followed by Advantage + Talstar with 87.50% mortality at 0.14% concentration after 48 h of application. The study also showed that the least effective treatment observed was Advantage + Telsta with no mortality after 24 h and 25% mortality after 48 h at 0.14% concentration. The study revealed that the concentration 0.14% was highly effective in lowering the mealybug population and insecticide mixtures were effective in reducing mealybug density. The study emphasizes the use of such insecticide mixtures to develop better management strategy for mealybug populations attacking ornamental plants. However effects of such insecticide mixtures on other organisms and biological control agents should be checked under field conditions.
Western Imperialism Against Primitive Communism. A New Reading of Rosa Luxemburg’s Economic Writings
Directory of Open Access Journals (Sweden)
Michael Löwy
2012-01-01
Full Text Available The discussion on Rosa Luxemburg’s theories of imperialism hasmainly focused on the economic argument - the schemes of reproduction, theprocess of circulation, the need for “external” markets, etc. There is howeveranother dimension, at least as important : the struggle of imperialism againstpre-capitalist economies, the ruthless destruction of “natural” and peasant economies,many of them being forms of primitive communism. Luxemburg’sinterest for primitive communist societies is documented by her Introductionto Political Economy and the imperialist war against them is discussed both inthis work and in the last chapters of The Accumulation of Capital. A whollyoriginal approach to the evolution of social formations, running counter tolinear “progressive” views of bourgeois ideology, is outlined in these reflections. Present indigenous struggles e.g. in Latin America, against multinational oil or mining companies, illustrate the topicality of Rosa Luxemburg’s argument in the 21th century.
OPTIMISATION OF HIBISCUS SABDARIFFA AS A NATURAL COAGULANT TO TREAT CONGO RED IN WASTEWATER
Directory of Open Access Journals (Sweden)
MUN Y. YONG
2016-02-01
Full Text Available The process of coagulation is commonly practiced in water and wastewater treatment to reduce level of dissolved chemical, turbidity and so on with the usage of coagulant. Aluminium sulphate (alum is the most commonly used coagulant, however, recent studies show that residual aluminium in drinking water and sludge may induce Alzheimer’s disease and environmental issues. Natural coagulant which is environmental friendly and non-toxic is developed as an alternative to overcome these issues. In this work, Hibiscus Sabdariffa was studied as natural coagulant to treat dye wastewater containing Congo red. The seeds were extracted with different solvent such as distilled water, 0.5 M NaCl and 0.05 M NaOH to extract the coagulation agent. The working parameters were optimised using Response Surface Methodology (RSM. 0.5 M NaCl was found to have highest colour removal of 95.1 % among the solvents. In addition, Hibiscus Sabdariffa seed was found to be an effective coagulant that has 91.2 % colour removal at the optimal working condition of pH 2, 190 mg/L coagulant dosage at 400 ppm of dye concentration. It was also been identified that the performance of natural coagulant is comparable with conventional coagulant, aluminium sulphate with colour removal of 91.2 % and 92.3 % respectively.
Seung, Tae Wan; Park, Seon Kyeong; Kang, Jin Yong; Kim, Jong Min; Park, Sang Hyun; Kwon, Bong Seok; Lee, Chang Jun; Kang, Jeong Eun; Kim, Dae Ok; Lee, Uk; Heo, Ho Jin
2018-03-01
The ameliorating effects of the ethyl acetate fraction from Hibiscus sabdariffa L. (EFHS) 2 against diabetes mellitus (DM) 3 and DM-induced cognitive impairment were investigated on streptozotocin (STZ) 4 -induced DM mice. The EFHS groups showed improved hyperglycemia and glucose tolerance compared to the STZ group. Furthermore, their liver and kidney function and lipid metabolic imbalance in the blood serum were effectively recovered. The EFHS groups significantly ameliorated STZ-induced cognitive impairment in Y-maze, passive avoidance, and Morris water maze (MWM) 5 tests. The EFHS groups showed significant improvement in the antioxidant and cholinergic systems of the brain tissue. In addition, EFHS had an excellent ameliorating effect on protein expression levels from the tau hyperphosphorylation pathways, such as phospho-c-Jun N-terminal kinases (p-JNK), 6 phospho-tau (p-tau), 7 and cleaved poly (ADP-ribose) polymerase (c-PARP). 8 The main compounds of EFHS were identified as various phenolic compounds, including hibiscus acid, caffeoylquinic acid (CQA) 9 isomers, and quercetin derivates. Therefore, EFHS containing various physiologically active materials can potentially be used for improving DM-induced cognitive impairment via its antioxidant activity, improvement of the cholinergic system, and hyperphosphorylation tau signaling. Copyright © 2017 Elsevier Ltd. All rights reserved.
Vitiquinolone--a quinolone alkaloid from Hibiscus vitifolius Linn.
Ramasamy, D; Saraswathy, A
2014-02-15
Phytochemical investigations of the powdered root of Hibiscus vitifolius Linn. (Malvaceae) was extracted successively with n-hexane and chloroform. Analysis of the n-hexane extract by GC-MS led to the identification of twenty-six components by comparison of their mass spectra with GC-MS library data. A novel quinolone alkaloid, vitiquinolone (5) together with eight known compounds viz. β-Amyrin acetate (1), n-octacosanol (2), β-Amyrin (3), stigmasterol (4), xanthyletin (6), alloxanthoxyletin (7), xanthoxyletin (8) and betulinic acid (9) were isolated from chloroform extract by column chromatography over silica gel. The structure of vitiquinolone was established on the basis of spectroscopic methods including UV, IR, 1D, 2D NMR and ESI-MS. The known compounds were identified on the basis of their physical and spectroscopic data as reported in the literature. Copyright © 2013 Elsevier Ltd. All rights reserved.
Hassan, Sherif T S; Berchová, Kateřina; Šudomová, Miroslava
In the last few decades, Hibiscus sabdariffa L. (Malvaceae; H. sabdariffa) has gained much attention in research field because of its potentially useful bioactivity as well as a great safety and tolerability. For decades, microbial, parasitic and cancer diseases remain a serious threat to human health and animals as well. To treat such diseases, a search for new sources such as plants that provide various bioactive compounds useful in the treatment of several physiological conditions is urgently needed, since most of the drugs currently used in the therapy have several undesirable side effects, toxicity, and drug resistance. In this paper, we aim to present an updated overview of in vitro and in vivo studies that show the significant therapeutic properties of the crude extracts and phytochemicals derived from H. sabdariffa as antimicrobial, antiparasitic, and anticancer agents. The future directions of the use of H. sabdariffa in clinical trials will be discussed. Hibiscus sabdariffa L. antimicrobial agents cancer preventive agents antiparasitic drugs natural products.
Comparison report for CSNI International Standard Problem 12 (ROSA-III Run 912)
International Nuclear Information System (INIS)
Tasaka, Kanji; Anoda, Yoshinari; Kumamaru, Hiroshige; Nakamura, Hideo; Iriko, Masanori; Yonomoto, Taisuke; Shiba, Masayoshi
1982-09-01
ROSA-III Run 912 was identified as International Standard Problem 12 by the Committee on the Safety of Nuclear Installations. Run 912 simulated a 5% split break LOCA condition in a BWR at the pump suction in the recirculation line with the HPCS failure. Comparisons between the test data and the calculations by eight international participants were made and discussed. (author)
José Rosa y La guaracha del Macho Camacho de Luis Rafael Sánchez: texto, iconotexto y palimpsesto
Directory of Open Access Journals (Sweden)
Rita De Maeseneer
2014-06-01
Full Text Available La edición de Cátedra de La guaracha del Macho Camacho (2000 de Luis R. Sánchez lleva en su portada una reproducción incompleta de un llamativo cartel del artista puertorriqueño José Rosa. Esta obra, un iconotexto que estudiamos y reproducimos íntegramente, incorpora una rica serie de citas –falsas y verdaderas– de La guaracha. Proponemos un recorrido interpretativo de la configuración visual y textual de esta imagen, creada con otro fin que el de servir de pórtico a la novela. Con ella Rosa condensaba ya en 1977 de manera sorprendente muchos de los enfoques que los críticos literarios de Sánchez sólo desarrollarían mucho más tarde: la desacralización, el enmascaramiento racial, sexual y social, la dictadura del ocio y del consumo, el barroquismo... Como copista infiel y retozón, Rosa reinterpreta La guaracha insertando su autobiografía en ella y sobre todo insistiendo en que oigamos su trasfondo sonoro más profundo hecho de violencia, de racismo, de explotación y de exclusión.
The complete nucleotide sequence of a recently discovered Florida (FL) isolate of Hibiscus infecting Cilevirus (HiCV) was determined by Sanger sequencing. The movement- and coat- protein gene sequences of the HiCV-FL isolate are more divergent than other genes of the previously sequenced HiCV-HA (Ha...
Cinnamoyl-CoA reductase (CCR) is an important enzyme for lignin biosynthesis as it catalyzes the first specific committed step in monolignol biosynthesis. We have cloned a full length coding sequence of CCR from kenaf (Hibiscus cannabinus L.), which contains a 1,020-bp open reading frame (ORF), enco...
AFLP Markers as a tool to reconstruct complex relationships: a case study in Rosa (Rosaceae)
Koopman, W.J.M.; Wissemann, V.; Cock, de K.; Huylenbroeck, van J.; Riek, de J.; Sabatino, G.J.H.; Visser, D.L.; Vosman, B.; Ritz, K.; Maes, B.; Werlemark, G.; Nybom, H.; Debener, T.; Linde, M.; Smulders, M.J.M.
2008-01-01
The genus Rosa has a complex evolutionary history caused by several factors, often in conjunction: extensive hybridization, recent radiation, incomplete lineage sorting, and multiple events of polyploidy. We examined the applicability of AFLP markers for reconstructing (species) relationships in
DIVERSIDAD GENÉTICA DE Peronospora sparsa (PERONOSPORACEAE EN CULTIVOS DE ROSA DE COLOMBIA
Directory of Open Access Journals (Sweden)
MARILUZ AYALA-VÁSQUEZ
2008-01-01
Full Text Available El mildeo velloso de la rosa es la enfermedad más limitante de este cultivo en Colombia. Aunque algunos trabajos de investigación se han adelantado recientemente sobre la epidemiología de esta enfermedad, uno de los campos menos estudiados es el nivel de variabilidad de su agente causal. El conocimiento de este aspecto es fundamental para definir las estrategias de manejo, especialmente aquellas relacionadas con la resistencia genética y el control químico. Los objetivos de esta investigación fueron confirmar la identidad taxonómica del agente causal del mildeo velloso de la rosa y profundizar en el conocimiento de su estructura poblacional en Colombia. Para esto se colectaron 34 aislamientos del pseudohongo en cultivos de rosas ubicados en Antioquia y la sabana de Bogotá y se extrajo su ADN, para proceder a la amplificación mediante PCR de la región ITS del ADNr utilizando los primers especieespecíficos PS3 y PS1. Dichos productos se emplearon tanto para su secuenciación directa como para la evaluación de variabilidad genética mediante la técnica PCRRFLP, resultados que se complementaron con la utilización de los marcadores RAPD y RAMS. La presencia de un amplicón de aproximadamente 700 pb que compartió un porcentaje de identidad del 100% con secuencias depositadas en el GenBank, permitió confirmar a los aislamientos como pertenecientes a Peronospora sparsa, mientras que el análisis de RFLP, RAPD y RAMS indicó un muy bajo nivel de variabilidad entre todos los aislamientos, concluyéndose que la población de P. sparsa en Colombia es predominantemente clonal
Uso eficiente del agua para el cultivo de rosa cv. Freedom bajo invernadero
Directory of Open Access Journals (Sweden)
John J. Arévalo-H
2013-08-01
Full Text Available Determinar el requerimiento de agua y el momento adecuado de distribución, es un factor fundamental para el cultivo de flores. El objetivo del presente trabajo fue determinar el efecto de la aplicación de tres láminas de riego sobre el desarrollo y producción del cultivo de la Rosa cv. Freedom, bajo invernadero. El experimento se realizó con tres láminas de riego en un cultivo de rosa (Rosa spp. cv. Freedom. Se analizó el crecimiento de los tallos florales, la vida en florero, la producción y la eficiencia en el uso del agua. Los tratamientos se basaron en tres niveles de evapotranspiración de cultivo (ETc (70, 80 y 100%. Durante el estudio, el cultivo se mantuvo en producción constante. Se aplicaron 384,87, 254,25 y 218,97 m³ correspondiente a 100, 80 e 70% de ETc respectivamente, significando un ahorro de agua de 14,0 y 21,8% en el 80 e 70% de ETc respectivamente. El coeficiente de cultivo (Kc vario entre 0,58 y 1,65, con una media de 1,13. No se encontraron diferencias en la producción. Las curvas de crecimiento presentaron incremento continuo, con ajuste al modelo logístico. El 70% de ETc presentó la mayor eficiencia en el uso del agua, con 185 tallos m-3. La conservación media de los tallos florales fue de 12 a 15 días. La mayor causa de pérdida fue la deshidratación, que inició en el día 11, comportamiento normal del tallo floral.
Amadou, L; Baoua, I B; Baributsa, D; Williams, S B; Murdock, L L
2016-10-01
We assessed the performance of hermetic triple layer Purdue Improved Crop Storage (PICS) bags for protecting Hibiscus sabdariffa grain against storage insects. The major storage pest in the grain was a bruchid, Spermophagus sp.. When we stored infested H. sabdariffa grain for six months in the woven polypropylene bags typically used by farmers, the Spermophagus population increased 33-fold over that initially present. The mean number of emergence holes per 100 seeds increased from 3.3 holes to 35.4 holes during this time period, while grain held for the same length of time in PICS bags experienced no increase in the numbers of holes. Grain weight loss in the woven control bags was 8.6% while no weight loss was observed in the PICS bags. Seed germination rates of grain held in woven bags for six months dropped significantly while germination of grain held in PICS bags did not change from the initial value. PICS bags can be used to safely store Hibiscus grain after harvest to protect against a major insect pest.
Danalatos, N.G.; Archontoulis, S.V.
2010-01-01
The growth and biomass productivity of kenaf (Hibiscus cannabinus, L.) cultivars Tainung 2 and Everglades 41 were determined under three irrigation applications (low: 25%, moderate: 50% and fully: 100% of maximum evapotranspiration; ETm), four nitrogen dressings (0, 50, 100 and 150 kg hat), two
Czech Academy of Sciences Publication Activity Database
Frankova, A.; Malik, J.; Drabek, O.; Szakova, J.; Sperlingova, I.; Kloucek, P.; Novy, P.; Tejnecky, V.; Landa, Přemysl; Leuner, O.; Kokoska, L.
2016-01-01
Roč. 174, č. 2 (2016), s. 267-273 ISSN 0163-4984 Institutional support: RVO:61389030 Keywords : dialysis dementia * tea * bioavailability * speciation * toxicity * Aluminum * In vitro digestion * Hot watery infusion * Urine * Hibiscus sabdariffa L Subject RIV: EF - Botanics Impact factor: 2.399, year: 2016
Experiment on performance of upper head injection system with ROSA-II
International Nuclear Information System (INIS)
1978-05-01
Of the total 10 ROSA-II/UHI performance tests, 6 were reported previously. The rest are presented and discussion is made on the effects of heat generation in the core and UHI injection and repeatability of experiments. In addition, the following are described: (1) Pressure spikes observed in the upper head after sudden stoppage of UHI injection, and (2) discharge flow oscillation possibly due to UHI water injection into the upper plenum. (auth.)
Background: In vitro studies have shown Hibiscus sabdariffa L., an ingredient found in many herbal tea blends and other beverages, has antioxidant properties, and, in animal models, extracts of its calyces have demonstrated hypocholesterolemic and anti-hypertensive properties. Objective: To exa...
ANILÚ MIRANDA-MEDINA; PATRICIA M. HAYWARD-JONES; OCTAVIO CARVAJAL-ZARRABAL; LUZ DEL ALBA LADRÓN DE GUEVARA-VELA; YERIKC DAVID RAMÍREZ-VILLAGÓMEZ; DULCE M. BARRADAS-DERMITZ; GEORGINA LUNA-CARRILLO; MARÍA G. AGUILAR-USCANGA
2018-01-01
Anthocyanins along with protocatechuic acid and quercetin have been recognized as bioactive compounds in Hibiscus sabdariffa L. aqueous extracts. Characteristic anthocyanin absorption in the visible region makes their quantification possible without the interference of the other two compounds, and also can favor its potential application as an alternative to organic-based dye sensitized solar cell, in various forms. In order to optimize measurable factors linked to the extraction of these fla...
Seed oil and fatty acids in plants have human health implications. Oil from roselle (Hibiscus sabdariffa L.) seeds are used in Taiwan as a diuretic, laxative, and tonic. The objectives of this study were to evaluate seeds from 17 roselle accessions for oil and fatty acid variation in a greenhouse. S...
Natural cross-pollination in roselle, Hibiscus sabdariffa L. (Malvaceae
Directory of Open Access Journals (Sweden)
Vaidya K.R.
2000-01-01
Full Text Available Two local varieties of roselle (Hibiscus sabdariffa L., Jamaican Green and Jamaican Red, were grown to determine the amount of natural cross-pollination. Two planting arrangements (alternating rows; alternating individuals in a row and two planting dates, a month apart, were used for the outcrossing experiments. Stem pigmentation, red (R- vs. green (rr, was used as a genetic marker in the estimation of outcrossing. Homozygous dominant and recessive genotypes of Jamaican Red and Jamaican Green, respectively, were grown in both of the planting arrangements and dates. Seeds from open-pollinated capsules of randomly selected Jamaican Green plants were planted to score the frequency of cross-pollination. Estimates of natural cross-pollination ranged from 0.20 ± 0.09% to 0.68 ± 0.34%. Roselle outcrosses at a low rate in Jamaica.
Directory of Open Access Journals (Sweden)
B. S. Kaith
2008-01-01
Full Text Available Different reaction parameters for the graft copolymerization of butyl acrylate onto Hibiscus sabdariffa fiber were optimized. Graft copolymers thus obtained were subjected to characterization using XRD, TGA, DTA, SEM and FTIR techniques and were evaluated for physio-chemical changes in the behavior. The percentage crystallinity and crystallinity index were found to decrease with increase in grafting while there was reduction in moisture absorption and increase in chemical, thermal resistance of the graft copolymers.
CARACTERIZACIÓN QUÍMICA Y COLORIMÉTRICA DE CULTIVARES DE JAMAICA (Hibiscus sabdariffa L.)
Camelo Méndez, Gustavo Adolfo
2013-01-01
La jamaica (Hibiscus sabdariffa L.) se destaca por su alto contenido en antocianinas y potencial actividad antioxidante. En la medicina tradicional se usa como: bactericida, diurético, cicatrizante y laxante entre otros. Actualmente, en México existen programas de mejoramiento genético tradicional de materiales, que han generado materiales de esta planta con diversos grados de pigmentación y tolerancia a plagas y enfermedades. El objetivo de este trabajo fue caracterizar químic...
Golizadeh, A; Jafari-Behi, V; Razmjou, J; Naseri, B; Hassanpour, M
2017-02-01
The rose aphid, Macrosiphum rosae (L.), is one of the most important pests on rose plants (Rosa spp.) with a worldwide distribution. As resistance indices, the development, survivorship, and reproduction of this aphid were evaluated on 10 rose cultivars, including Bella Vita, Cool Water, Dolce Vita, Maroussia, Orange Juice, Pinkpromise, Roulette, Tea, Valentine, and Persian Yellow in laboratory at 25 ± 1°C, 65 ± 5% relative humidity, and photoperiod of 16:8 (L/D) h. Rose aphid successfully survived on all 10 rose cultivars, although mortality rate was higher on Tea and Bella Vita. The number of offspring per female differed significantly among the tested rose cultivars, and ranged from 9.2 on Tea to 38.7 nymphs on Orange Juice. Population growth parameters were significantly affected by rose cultivars. The longest mean generation time (T) was observed on Bella Vita (14.8 days) and Tea (14.7 days) and the shortest on Orange Juice (10.0 days). The net reproductive rate (R 0 ) ranged from 6.9 on Tea to 33.2 nymphs on Orange Juice cultivar. Correspondingly, the highest value of intrinsic rate of increase (r m ) was observed on Orange Juice (0.348 day -1 ) and lower values on Tea (0.131 day -1 ) followed by Bella Vita (0.154 day -1 ). Cluster analysis of all the measured parameters of rose aphid on different rose cultivars revealed that Tea and Bella Vita were relatively resistant to M. rosae. These findings could be useful in developing an integrated pest management (IPM) program for this aphid in urbanized areas and commercial rose potting.
Solar drying of rose (Rosa sp.) petals
Energy Technology Data Exchange (ETDEWEB)
Balladin, D.A.; Headley, Oliver [University of the West Indies, Center for Resource Management and Environmental Studies, St. Michael (Barbados)
1999-10-01
The rose (Rosa sp.) petals can be dried after 2 days at about 30degC reaching an equilibrium moisture content after 16 h using the solar wire basket dryer. The initial moisture content (wet wt basis) and final moisture content (dry wt basis), determined by the Dean-Stark toluene were 65.7 and 25.2% respectively. The intensity of the rose red coloured pigment (pelargonidin) decreased by a factor of 2.5 after drying. The pelargonidin ethanoic extract as an acid-base indicator, has a K{sub 4} value of 1 x 10{sup -4} mol 1{sup -1} and pH of end point 4 and imbibed on filter paper and allowed to air dry for 5 min showed excellent properties as acid-based test tapes. (Author)
Prediction of ROSA-III experiment Run 702
International Nuclear Information System (INIS)
Koizumi, Yasuo; Soda, Kunihisa; Kikuchi, Osamu.
1978-11-01
The purpose of the ROSA-III experiment with a scaled BWR test facility is to examine primary coolant thermalhydraulic behavior and performance during a postulated loss-of-coolant accident of BWR. The results provide information for verification and improvement of reactor safety analysis codes. Run 702 assumes a recirculation line double ended break at the pump suction with average core power and no ECCS. Prediction of the Run 702 experiment was made with computer code RELAP-4J. What determine the coolant behavior are mixture level in the downcomer and flowrates and flow directions at jet pump drive flow nozzle, jet pump suction and discharge. There is thus the need for these measurements to compare predicted results with experimental ones. The liquid level formation model also needs improvement. (author)
Entrevista com Mathieu Dosse, Gian Luigi de Rosa e Michael Kegler
Directory of Open Access Journals (Sweden)
Andréia Guerini
2017-09-01
Full Text Available O conjunto das três entrevistas que seguem aborda a mesma temática, isto é, aspectos de tradução/adaptação em geral e da tradução do romance Estive em Lisboa e lembrei de você de Luiz Ruffato em particular. O romance de Ruffato foi escrito em 2009, editado em Portugal (Quetzal, 2010 e traduzido para diferentes línguas, como italiano (La Nuova Frontiera, 2011, espanhol (Eterna Cadencia, 2011, francês (Chandeigne, 2015, alemão (Assoziation A, 2016 e, nos próximos meses será publicado em finlandês (Into. O livro foi adaptado para o cinema em 2015, pelo cineasta português José Barahona, sendo exibido em festivais nacionais e internacionais. As entrevistas abaixo foram feitas com os tradutores Gian Luigi De Rosa, Mathieu Dosse e Michael Kegler em 2016. Gian Luigi De Rosa (Itália/1969-- possui doutorado em “Culture e Istituzioni dei paesi di lingue iberiche in età moderna e contemporanea” e é professor de português na Universidade do Salento, em Lecce. É autor de livros e ensaios sobre língua e linguística portuguesa, literatura portuguesa e brasileira e tradução audiovisual e intersemiótica. É também responsável pela elaboração das legendas em italiano do filme Estive em Lisboa e lembrei de você. Mathieu Dosse (Brasil/1978-- é formado pela Université Paris 8, onde estudou Teoria da Tradução. Traduziu para o francês Graciliano Ramos, Luiz Ruffato e João Guimarães Rosa. Michael Kegler (Alemanha/1967-- estudou literatura brasileira e portuguesa na universidade de Frankfurt, sem concluir o curso. Trabalhou como livreiro no Centro do Livro de Língua Portuguesa, antes de se tornar tradutor literário. Traduziu para o alemão José Eduardo Agualusa, Moacyr Scliar, Luiz Ruffato, entre outros autores. Em julho de 2016, junto com Ruffato, recebeu o prêmio literário Hermann Hesse na Alemanha, pela qualidade da obra publicada em conjunto com a sua tradução.
Ibrahim, Ahmed Mahmood; Kayat, Fatimah Binti; Hussin, Zeti Ermiena Surya Mat; Susanto, Dwi; Ariffulah, Mohammed
2014-01-01
Kenaf (Hibiscus cannabinus L.) is one of the important species of Hibiscus cultivated for fiber. Availability of homozygous parent lines is prerequisite to the use of the heterosis effect reproducible in hybrid breeding. The production of haploid plants by anther culture followed by chromosome doubling can be achieved in short period compared with inbred lines by conventional method that requires self pollination of parent material. In this research, the effects of the microspore developmental stage, time of flower collection, various pretreatments, different combinations of hormones, and culture condition on anther culture of KB6 variety of Kenaf were studied. Young flower buds with immature anthers at the appropriate stage of microspore development were sterilized and the anthers were carefully dissected from the flower buds and subjected to various pretreatments and different combinations of hormones like NAA, 2,4-D, Kinetin, BAP, and TDZ to induce callus. The best microspore development stage of the flower buds was about 6-8 mm long collected 1-2 weeks after flower initiation. At that stage, the microspores were at the uninucleate stage which was suitable for culture. The best callus induction frequency was 90% in the optimized semisolid MS medium fortified with 3.0 mg/L BAP + 3.0 mg/L NAA.
Directory of Open Access Journals (Sweden)
Ahmed Mahmood Ibrahim
2014-01-01
Full Text Available Kenaf (Hibiscus cannabinus L. is one of the important species of Hibiscus cultivated for fiber. Availability of homozygous parent lines is prerequisite to the use of the heterosis effect reproducible in hybrid breeding. The production of haploid plants by anther culture followed by chromosome doubling can be achieved in short period compared with inbred lines by conventional method that requires self pollination of parent material. In this research, the effects of the microspore developmental stage, time of flower collection, various pretreatments, different combinations of hormones, and culture condition on anther culture of KB6 variety of Kenaf were studied. Young flower buds with immature anthers at the appropriate stage of microspore development were sterilized and the anthers were carefully dissected from the flower buds and subjected to various pretreatments and different combinations of hormones like NAA, 2,4-D, Kinetin, BAP, and TDZ to induce callus. The best microspore development stage of the flower buds was about 6–8 mm long collected 1-2 weeks after flower initiation. At that stage, the microspores were at the uninucleate stage which was suitable for culture. The best callus induction frequency was 90% in the optimized semisolid MS medium fortified with 3.0 mg/L BAP + 3.0 mg/L NAA.
Binti Kayat, Fatimah; Ermiena Surya Mat Hussin, Zeti; Susanto, Dwi; Ariffulah, Mohammed
2014-01-01
Kenaf (Hibiscus cannabinus L.) is one of the important species of Hibiscus cultivated for fiber. Availability of homozygous parent lines is prerequisite to the use of the heterosis effect reproducible in hybrid breeding. The production of haploid plants by anther culture followed by chromosome doubling can be achieved in short period compared with inbred lines by conventional method that requires self pollination of parent material. In this research, the effects of the microspore developmental stage, time of flower collection, various pretreatments, different combinations of hormones, and culture condition on anther culture of KB6 variety of Kenaf were studied. Young flower buds with immature anthers at the appropriate stage of microspore development were sterilized and the anthers were carefully dissected from the flower buds and subjected to various pretreatments and different combinations of hormones like NAA, 2,4-D, Kinetin, BAP, and TDZ to induce callus. The best microspore development stage of the flower buds was about 6–8 mm long collected 1-2 weeks after flower initiation. At that stage, the microspores were at the uninucleate stage which was suitable for culture. The best callus induction frequency was 90% in the optimized semisolid MS medium fortified with 3.0 mg/L BAP + 3.0 mg/L NAA. PMID:24757416
Anthocyanin-rich extract from Hibiscus sabdariffa calyx counteracts UVC-caused impairments in rats.
Ozkol, Hatice Uce; Koyuncu, Ismail; Tuluce, Yasin; Dilsiz, Nihat; Soral, Sinan; Ozkol, Halil
2015-01-01
Ultraviolet radiation (UV) was reported to cause oxidative stress. Hibiscus sabdariffa L. (Malvaceae) calyx is commonly used in traditional Asian and African medicines and possesses strong antioxidant capacity due to its anthocyanin (ANTH) content. This study researched the possible protective role of Hibiscus sabdariffa calyx extract (HSCE) in UVC exposure of rats. Levels of serum enzymes, renal function tests, and some oxidant/antioxidant biomarkers of skin, lens, and retina tissues were monitored. Rats were exposed to UVC 4 h daily for 40 d and simultaneously received HSCE containing 2.5, 5, and 10 mg doses of ANTH in drinking water. Significant (p < 0.05) increases in the levels of serum aminotransferases, lactate dehydrogenase, urea, creatinine, and uric acid were noted after UVC exposure. In skin, lens, and retina tissues, total oxidant status, oxidative stress index, lipid peroxidation, and protein oxidation escalated markedly (p < 0.05) whereas total antioxidant status, reduced glutathione, and superoxide dismutase decreased dramatically (p < 0.05) related to UVC. Co-administration of HSCE with each ANTH dose significantly (p < 0.05) reversed aforementioned parameters (except total oxidant status) almost in all tissues. The LD50 of HSCE in rats was determined to be above 5000 mg/kg. Our data revealed that HSCE has a remarkable potential to counteract UVC-caused impairments, probably through its antioxidant and free radical-defusing effects. Therefore, HSCE could be useful against some cutaneous and ocular diseases in which UV and oxidative stress have a role in the etiopathogenesis.
Energy Technology Data Exchange (ETDEWEB)
Wood, I.M.; Stewart, G.A. (eds.)
1981-01-01
Papers by different authors are presented in 8 sections on kenaf (Hibiscus cannabinus), a possible substitute for wood pulp. Agronomy and physiology; Selection and breeding; Pests and diseases; By-products; Harvesting; Farming systems; Pulping techniques; and Economics and marketing.
Rocha, Joecildo Francisco; Pimentel, Rafael Ribeiro; Machado, Silvia Rodrigues [UNESP
2011-01-01
No presente trabalho foram estudadas as estruturas secretoras de mucilagem de Hibiscus pernambucensis aos microscópios de luz e de varredura. Conhecida como guaxima-do-mangue e algodão-do-brejo, é espécie nativa encontrada no litoral brasileiro, vegetando áreas de manguezal e restinga, tendo grande importância ecológica nestes ecossistemas. É importante produtora de fibras têxteis e celulose, fornece abundante mucilagem suscetível das mesmas aplicações medicinais de outras malváceas, além da ...
Sreedevi, Gudapati; Prasad, Yenumula Gerard; Prabhakar, Mathyam; Rao, Gubbala Ramachandra; Vennila, Sengottaiyan; Venkateswarlu, Bandi
2013-01-01
Temperature-driven development and survival rates of the mealybug, Phenacoccussolenopsis Tinsley (Hemiptera: Pseudococcidae) were examined at nine constant temperatures (15, 20, 25, 27, 30, 32, 35 and 40°C) on hibiscus (Hibiscusrosa -sinensis L.). Crawlers successfully completed development to adult stage between 15 and 35°C, although their survival was affected at low temperatures. Two linear and four nonlinear models were fitted to describe developmental rates of P. solenopsis as a function of temperature, and for estimating thermal constants and bioclimatic thresholds (lower, optimum and upper temperature thresholds for development: Tmin, Topt and Tmax, respectively). Estimated thresholds between the two linear models were statistically similar. Ikemoto and Takai's linear model permitted testing the equivalence of lower developmental thresholds for life stages of P. solenopsis reared on two hosts, hibiscus and cotton. Thermal constants required for completion of cumulative development of female and male nymphs and for the whole generation were significantly lower on hibiscus (222.2, 237.0, 308.6 degree-days, respectively) compared to cotton. Three nonlinear models performed better in describing the developmental rate for immature instars and cumulative life stages of female and male and for generation based on goodness-of-fit criteria. The simplified β type distribution function estimated Topt values closer to the observed maximum rates. Thermodynamic SSI model indicated no significant differences in the intrinsic optimum temperature estimates for different geographical populations of P. solenopsis. The estimated bioclimatic thresholds and the observed survival rates of P. solenopsis indicate the species to be high-temperature adaptive, and explained the field abundance of P. solenopsis on its host plants.
Functional properties of roselle (Hibiscus sabdariffa L.) seed and its application as bakery product
Nyam, Kar-Lin; Leao, Sod-Ying; Tan, Chin-Ping; Long, Kamariah
2012-01-01
Roselle (Hibiscus sabdariffa L.) seed is a valuable food resource as it has an excellent source of dietary fibre. Therefore, this study examined the functional properties of roselle seeds. Replacement of cookie flour with roselle seed powder at levels of 0–30 % was investigated for its effect on functional and nutritional properties of cookies. Among the four formulations cookies, the most preferred by panelists was 20 % roselle seed powder cookie (F3), followed by 10 % roselle seed powder co...
International Nuclear Information System (INIS)
Gonzalez Cepero, Maria C; Trujillo Gil, Delfina; Teran Vidaly, Zoilo; Altane Valentin, Sonia
2011-01-01
At the National Institute of Agricultural Sciences was obtained a mutant of Hibiscus sabdariffa variety that differs from the donor (Yersy) in the cycle, color of leaves,stems, flowers and fruits in the form of leaves and yield per plant
Okra (Hibiscus esculentus) seed oil for biodiesel production
Energy Technology Data Exchange (ETDEWEB)
Anwar, Farooq; Nadeem, Muhammad [Department of Chemistry and Biochemistry, University of Agriculture, Faisalabad 38040 (Pakistan); Rashid, Umer [Department of Chemistry and Biochemistry, University of Agriculture, Faisalabad 38040 (Pakistan); Department of Industrial Chemistry, Government College University, Faisalabad 38000 (Pakistan); Ashraf, Muhammad [Department of Botany, University of Agriculture, Faisalabad 38040 (Pakistan)
2010-03-15
Biodiesel was derived from okra (Hibiscus esculentus) seed oil by methanol-induced transesterification using an alkali catalyst. Transesterification of the tested okra seed oil under optimum conditions: 7:1 methanol to oil molar ratio, 1.00% (w/w) NaOCH{sub 3} catalyst, temperature 65 C and 600 rpm agitation intensity exhibited 96.8% of okra oil methyl esters (OOMEs) yield. The OOMEs/biodiesel produced was analyzed by GC/MS, which showed that it mainly consisted of four fatty acids: linoleic (30.31%), palmitic (30.23%), oleic (29.09%) and stearic (4.93%). A small amount of 2-octyl cyclopropaneoctanoic acid with contribution 1.92% was also established. Fuel properties of OOMEs such as density, kinematic viscosity, cetane number, oxidative stability, lubricity, flash point, cold flow properties, sulfur contents and acid value were comparable with those of ASTM D 6751 and EN 14214, where applicable. It was concluded that okra seed oil is an acceptable feedstock for biodiesel production. (author)
Fatty Acid Composition of Hibiscus trionum L. (Malvaceae
Directory of Open Access Journals (Sweden)
Ceyda Sibel Kılıç
2011-01-01
Full Text Available The genus Hibiscus plants have different uses, some are used as foods (H. esculenta L., and some species as remedy in traditional medicine (H. sabdariffa L. as well as a colorant for herbal teas. The only species that grows naturally in Turkey is H. trionum L. The plant especially infests soy and corn fields, and therefore it is considered to be a noxious weed. The plant is also found to be a host for Potato Virus Y (PVY and Tomato Spotted Wilt Virus (TSWV. Infestation of the crop fields by this plant shows that it germinates easily. Since it produces many seeds, distribution of the plant is also quiet easy. Though, seed oil yield is low (4.7% since linoleic acid composition of the seed oil is quiet high (67,5%, it can still be used as a source of unsaturated fatty acids. The other major fatty acids are palmitic, oleic and stearic acids in the studied seed oil .
Experimental analysis of the power curve sensitivity test series at ROSA-III
International Nuclear Information System (INIS)
Koizumi, Y.; Iriko, M.; Yonomoto, T.; Tasaka, K.
1985-01-01
The rig of safety assessment (ROSA)-III facility is a volumetrically scaled (1/424) boiling water reactor (BWR/6) system with an electrically heated core designed for integral LOCA and ECCS tests. Seven recirculation pump suction line break LOCA experiments were conducted at the ROSA-III facility in order to examine the effect of the initial stored heat of a fuel rod on the peak cladding temperature (PCT). The break size was changed from 200% to 5% in the test series and a failure of a high pressure core spray (HPCS) diesel generator was assumed. Three power curves which represented conservative, realistic and zero initial stored heat, respectively, were used. In a large break LOCA such as 200% or 50% breaks, the initial stored heat in a fuel rod has a large effect on the cladding surface temperature because core uncovery occurs before all the initial stored heat is released, whereas in a small break LOCA such as a 5% break little effect is observed because core uncovery occurs after the initial stored heat is released. The maximum PCTs for the conservative initial stored heat case was 925 K, obtained in the 50% break experiment, and that for the realistic initial stored heat case was 835 K, obtained in the 5% break experiment. (orig./HP)
Directory of Open Access Journals (Sweden)
Roncari, Luiz
2012-01-01
Full Text Available Estudo da obra Corpo de baile, de Guimarães Rosa buscando perceber como a dispersão das personagens da primeira estória, seus reagrupamentos nas novelas intermediárias e a reintegração final, formam as ranhuras que amarravam o conjunto. Além de analisar como esses elementos de composição, que sustentam a unidade do livro, têm também um fundo ideológico, ou seja, apresentam uma visão da história e uma concepção da vida e do mundo
Hassan, Sherif T S; Švajdlenka, Emil; Berchová-Bímová, Kateřina
2017-04-30
For decades, Hibiscus sabdariffa L. and its phytochemicals have been shown to possess a wide range of pharmacologic properties. In this study, aqueous extract of Hibiscus sabdariffa (AEHS) and its bioactive constituent protocatechuic acid (PCA), have been evaluated in vitro for their antiviral activity against HSV-2 clinical isolates and anti-enzymatic activity against urease. Antiherpetic activity was evaluated by the titer reduction assay in infected Vero cells, and cytotoxicity was evaluated by the neutral red dye-uptake method. Anti-urease activity was determined by a developed Electrospray Ionization-Mass Spectrometry (ESI-MS)-based assay. PCA showed potent anti-HSV-2 activity compared with that of acyclovir, with EC 50 values of 0.92 and 1.43 µg∙mL -1 , respectively, and selectivity indices > 217 and > 140, respectively. For the first time, AEHS was shown to exert anti-urease inhibition activity, with an IC 50 value of 82.4 µg∙mL -1 . This, combined with its safety, could facilitate its use in practical applications as a natural urease inhibitor. Our results present Hibiscus sabdariffa L. and its bioactive compound PCA as potential therapeutic agents in the treatment of HSV-2 infection and the treatment of diseases caused by urease-producing bacteria.
Directory of Open Access Journals (Sweden)
Sherif T. S. Hassan
2017-04-01
Full Text Available For decades, Hibiscus sabdariffa L. and its phytochemicals have been shown to possess a wide range of pharmacologic properties. In this study, aqueous extract of Hibiscus sabdariffa (AEHS and its bioactive constituent protocatechuic acid (PCA, have been evaluated in vitro for their antiviral activity against HSV-2 clinical isolates and anti-enzymatic activity against urease. Antiherpetic activity was evaluated by the titer reduction assay in infected Vero cells, and cytotoxicity was evaluated by the neutral red dye-uptake method. Anti-urease activity was determined by a developed Electrospray Ionization-Mass Spectrometry (ESI-MS-based assay. PCA showed potent anti-HSV-2 activity compared with that of acyclovir, with EC50 values of 0.92 and 1.43 µg∙mL−1, respectively, and selectivity indices > 217 and > 140, respectively. For the first time, AEHS was shown to exert anti-urease inhibition activity, with an IC50 value of 82.4 µg∙mL−1. This, combined with its safety, could facilitate its use in practical applications as a natural urease inhibitor. Our results present Hibiscus sabdariffa L. and its bioactive compound PCA as potential therapeutic agents in the treatment of HSV-2 infection and the treatment of diseases caused by urease-producing bacteria.
Isolation of immunomodulatory triterpene acids from a standardized rose hip powder (Rosa canina L.)
DEFF Research Database (Denmark)
Saaby, Lasse; Jäger, Anna Katharina; Moesby, Lise
2011-01-01
A previously published systematic review and a metaanalysis have concluded that the consumption of standardized rose hip powder (Rosa canina L.) can reduce pain in osteoarthritis patients. Synovial inflammation has been suggested to play an important role in the pathogenesis of osteoarthritis and...
Czech Academy of Sciences Publication Activity Database
Vaníčková, Lucie; Břízová, Radka; Pompeiano, A.; Ekesi, S.; De Meyer, M.
-, č. 540 (2015), s. 507-524 ISSN 1313-2989 Institutional support: RVO:61388963 Keywords : Ceratitis rosa * cryptic species * chemotaxonomy * GCxGC/MS * integrative taxonomy Subject RIV: EG - Zoology Impact factor: 0.938, year: 2015 http://zookeys.pensoft.net/articles.php?id=6222
Physiological responses and tolerance of kenaf (Hibiscus cannabinus L.) exposed to chromium.
Ding, Han; Wang, Guodong; Lou, Lili; Lv, Jinyin
2016-11-01
Selection of kenaf species with chromium (Cr) tolerance and exploring the physiological mechanisms involved in Cr tolerance are crucial for application of these species to phyto-remediation. In the present study, a hydroponic experiment was conducted to investigate the variation in two kenaf cultivars, K39-2 and Zhe50-3 under Cr stress. At the same Cr concentration, the tolerance index (TI) of K39-2 was higher than that of Zhe50-3, indicating that K39-2 may be more tolerant to Cr than Zhe50-3. It was also observed that high concentration of chromium was accumulated both in the shoots and the roots of Hibiscus cannabinus L. The leaves of K39-2 accumulated 4760.28mgkg(-1) of dry weight under 1.50mM Cr stress, and the roots accumulated 11,958.33mgkg(-1). Physiological response shows that the antioxidant enzymes' superoxide dismutase (SOD), catalase activity (CAT) and peroxidase (POD) activities increased in the leaves and decreased in roots of the Cr-stressed plants nearly compared to the control. Moreover, the variation of antioxidant enzymes activities indicated Zhe50-3 was more vulnerable than K39-2, and the contents of the non-protein thiol pool (GSH, NPT and PCs) were higher in K39-2 than Zhe50-3 with the increased Cr concentration. Based on the observations above, it can be concluded that the well-coordinated physiological changes confer a greater Cr tolerance to K39-2 than Zhe50-3 under Cr exposure, and Hibiscus cannabinus L. has a great accumulation capacity for chromium. Copyright © 2016 Elsevier Inc. All rights reserved.
JOÃO GUIMARÃES ROSA, TRADUTOR DE O ÚLTIMO DOS MAÇARICOS, DE FRED BODSWORTH
Directory of Open Access Journals (Sweden)
Pedro Guilherme Bastos Menezes
2016-12-01
Full Text Available This article concerns João Guimarães Rosa’s translation of the condensed novel Last of the Curlews (1954, from Canadian writer Fred Bodsworth, entitled O Último dos Maçaricos (1958. In the first place, we describe the context in which the translation was made as well as certain aspects of the process itself, such as the motivation behind it and the use of ornithological books by the translator. Then, some passages of the novel are analyzed in order to corroborate the conceivable effort undertaken by Rosa to write a poetically relevant text, even though the style of the novel does not match that of Rosa’s own oeuvre. Other texts besides the novel are used to achieve these objectives, such as documents, statements from close friends and the correspondence between Rosa and his Italian and German translators.
"Ishica, de quien sos tu?": Nostalgia for a Mother Tongue in Rosa Nissan's Novels
Linhard, Tabea Alex
2009-01-01
This paper explores the use of Judeo-Spanish in the Rosa Nissan's novels "Novia que te vea" (1992) and "Hisho que te nazca" (1996) and reveals the ways in which the presence of this language interrupts the otherwise linear coming-of-age narrative. An analysis of the main character's relationship with Judeo-Spanish establishes a critical dialogue…
Sobre a obscenidade inocente: o caderno Rosa de Lori Lamby, de Hilda Hilst
Directory of Open Access Journals (Sweden)
Luciana Borges
2006-01-01
Full Text Available From this text gender construction and pornography on female literature may be discussed. By reading O caderno rosa de Lori Lamby, not only the ancient prejudice over the erotic literature (what transforms written pornography into outraging political act but the way society assemble the idea that eroticism and sexual army may raise once it’s associated with the contrasts between male and female conceptions.
International Nuclear Information System (INIS)
FARAG, M.F.S.; OSMAN, N.N.
2009-01-01
Monosodium glutamate (MSG) continues to function as a flavour enhancer in diets. Aqueous extract of dried flowers of irradiated Hibiscus sabdariffa L. (HS), (Karkade), was investigated for its antioxidant action in MSG treated rats. MSG was injected intraperitoneally at a dose of 4 mg/g body weight for 15 days to male Wistar rats. Lipid peroxidation as thiobarbituric acid reactive substances (TBARS) and the antioxidants superoxide dismutase (SOD), catalase (CAT) and reduced glutathione (GSH) were examined in brain, heart, kidney and testes. MSG markedly increases the TBARS formation in rat organs. Meanwhile, it decreased significantly the activities of SOD and CAT in the same examined organs. The GSH level was also reduced due to MSG. In MSG treated rats, simultaneous oral administration of HS water extract (HSAE; 540 mg /kg/day) significantly reduced the MSG mediated increase in TBARS. Moreover, the administered HSAE was effective in ameliorating the changes in the activities of SOD and CAT in the examined organs. It also restored the decrease in GSH content. Overall, these findings are suggestive of the protective and the possible anti oxidative role played by dried flowers of Hibiscus sabdariffa L. against the oxidative damage due to MSG administration to rats.
Directory of Open Access Journals (Sweden)
Napoleon N. A. Tjou-Tam-Sin
2017-11-01
Full Text Available Ralstonia pseudosolanacearum (Ralstonia solanacearum phylotype I isolates found in stunted, yellowing, and wilted ornamental rose (Rosa spp. were assessed for their pathogenic ability in two rose cultivars (cv. “Armando” and cv. “Red Naomi” and in four solanaceous crops: tomato (Solanum lycopersicum cv. “Money Maker”, tobacco (Nicotiana tabacum cv. “White Burley”, eggplant (Solanum melongena cv. “Black Beauty” and sweet pepper (Capsicum annum cv. “Yolo Wonder”. Significant differences were observed in susceptibility between the two rose cultivars as well as between the two modes of inoculation performed. The cultivar “Armando” was significantly more susceptible than cultivar “Red Naomi,” exhibiting higher disease severity and incidence. Similarly, stem inoculation after wounding was found to be significantly more effective than soil drenching, resulting in higher disease severity. Additionally, a temperature dependency in susceptibility was observed for both cultivars irrespective of the mode of inoculation, however, this was significantly more pronounced upon soil drenching. The solanaceous crops all showed to be susceptible to the R. pseudosolanacearum isolates originated from the Rosa spp. plants. Furthermore, both rose cultivars were able to harbor symptomless infections with other R. pseudosolanacearum and R. solanacearum isolates than those isolated from rose. Our results clearly demonstrated that latent infections in a rose cultivar such as cv. “Red Naomi” do occur even at temperatures as low as 20°C. This latency poses high risks for the entire floricultural industry as latently infected Rosa spp. plants are propagated and distributed over various continents, including areas where climatic conditions are optimal for the pathogen.
International Nuclear Information System (INIS)
Chang, Y.-C.; Huang, H.-P.; Hsu, J.-D.; Yang, S.-F.; Wang, C.-J.
2005-01-01
Hibiscus sabdariffa Linne (Malvaceae), an attractive plant believed to be native to Africa, is cultivated in the Sudan and Eastern Taiwan. Anthocyanins exist widely in many vegetables and fruits. Some reports demonstrated that anthocyanins extracted from H. sabdariffa L., Hibiscus anthocyanins (HAs) (which are a group of natural pigments existing in the dried calyx of H. sabdariffa L.) exhibited antioxidant activity and liver protection. Therefore, in this study, we explored the effect of HAs on human cancer cells. The result showed that HAs could cause cancer cell apoptosis, especially in HL-60 cells. Using flow cytometry, we found that HAs treatment (0-4 mg/ml) markedly induced apoptosis in HL-60 cells in a dose- and time-dependent manner. The result also revealed increased phosphorylation in p38 and c-Jun, cytochrome c release, and expression of tBid, Fas, and FasL in the HAs-treated HL-60 cells. We further used SB203580 (p38 inhibitor), PD98059 (MEK inhibitor), SP600125 (JNK inhibitor), and wortmannin (phosphatidylinositol 3-kinase; PI-3K inhibitor) to evaluate their effect on the HAs-induced HL-60 death. The data showed that only SB203580 had strong potential in inhibiting HL-60 cell apoptosis and related protein expression and phosphorylation. Therefore, we suggested that HAs mediated HL-60 apoptosis via the p38-FasL and Bid pathway. According to these results, HAs could be developed as chemopreventive agents. However, further investigations into the specificity and mechanism(s) of HAs are needed
The Politics of Children's Literature: The Story of Rosa Parks and the Montgomery Bus Boycott.
Kohl, Herbert
1991-01-01
As commonly told to and read by children, the story of Rosa Parks and the Montgomery bus boycott fails to indicate Mrs. Parks' activist role or the degree of community organization and participation in the boycott. Telling what actually occurred allows children identify with people who make justice happen. (SLD)
Energy Technology Data Exchange (ETDEWEB)
Sinn, Ruediger
2010-07-01
The new Monte Rosa Lodge in the Swiss Canton Wallis was established not only as a passive house, but also achieves a degree of self-reliance of 90 % due to a thought-out energy management. This is how the future of the alpine construction might look.
Occurrence of Root Rot and Vascular Wilt Diseases in Roselle (Hibiscus sabdariffa L.) in Upper Egypt
Hassan, Naglaa; Shimizu, Masafumi; Hyakumachi, Mitsuro
2014-01-01
Roselle (Hibiscus sabdariffa L.) family Malvaceae is an important crop used in food, cosmetics and pharmaceutics industries. Roselle is cultivated mainly in Upper Egypt (Qena and Aswan governorates) producing 94% of total production. Root rot disease of roselle is one of the most important diseases that attack both seedlings and adult plants causing serious losses in crop productivity and quality. The main objective of the present study is to identify and characterize pathogens associated wit...
THE ROLE OF EMPLOYEE PERFORMANCE APPRAISAL AT CASA DE LA ROSA TIMISOARA
Directory of Open Access Journals (Sweden)
SILVIA VLAD
2015-04-01
Full Text Available The purpose of this research is to analyze the most important aspects of employee performance appraisal role in a hotel. The research is based on highlighting the major aspects of employee performance appraisal at Casa de la Rosa Hotel and aims the aspects related to the hotel performance. The aim of this evaluation is to observe and to analyze the employee time evolution and the way they complete their tasks and their job requirements.
Sombras da Escuta - Guimarães Rosa criador de livros e textos
Directory of Open Access Journals (Sweden)
Mônica Gama
2008-10-01
Full Text Available Nous essayerons ici une lecture de l'historicité de la pratique de lecture proposée par Guimarães Rosa, qui même en étant un auteur connu pour sa capacité fabulation, il est aussi remarquable par laisser apparaître dans sa fiction la préoccupation par l'importance de la matérialité du livre et avec les processus d’appréhension de la lecture.
THE DEVELOPMENT OF TECHNOLOGY CUPCAKES USING ADDITIVES ROSEHIP MAY (ROSA MAJALIS
Directory of Open Access Journals (Sweden)
E. V. Belokurova
2014-01-01
Full Text Available Summary. This article contains information about newly developed technologies cupcakes with making fine powder (product recycling and water extract of the fruit of the wild rose may (Rosa majalis. Given the chemical composition of the deposited product of the processing of the fine powder hips may. The aim of this study is to develop and scientific substantiation of technologies of production of flour confectionery products, in particular cupcakes, with superior quality with the use of additives rosehip may. The results of experimental studies on changes of physico-chemical properties of the dough during fermentation, depending on the amounts of applied additives and modifying complex indicators of the quality of finished products. Based on the data produced optimal ratios make product recycling and extract from the fruits of medicinal plants in Central Russia hips may (Rosa majalis recipe cake products. See recipe cake products with optimal ratios introduced, enriching the product components. Based on the results of organoleptic and physico-chemical evaluation of the quality of finished products obtained from the samples of the test, the values obtained comprehensive quality indicators. The conclusion is that the best physico-chemical and organoleptic quality, has been studied in a laboratory study, are the samples with the introduction of the product refining of fine powder rosehip 3.6 % from the total amount of wheat flour and rosehip extract 5.7 % instead of the water in the recipe.
National Oceanic and Atmospheric Administration, Department of Commerce — This image represents an 8 meter resolution backscatter of the seafloor south of Santa Rosa Island in Channel Islands National Marine Sanctuary. It was acquired...
National Oceanic and Atmospheric Administration, Department of Commerce — This image represents an 8 meter resolution backscatter of the seafloor south of Santa Rosa Island in Channel Islands National Marine Sanctuary. It was acquired...
National Oceanic and Atmospheric Administration, Department of Commerce — This image represents an 8 meter resolution bathymetry of the seafloor south of Santa Rosa Island in Channel Islands National Marine Sanctuary. It was acquired using...
National Oceanic and Atmospheric Administration, Department of Commerce — This image represents an 8 meter resolution bathymetry of the seafloor north of Santa Rosa Island in Channel Islands National Marine Sanctuary. It was acquired using...
Estrutura e significado em "Uma rosa para Emily", de William Faulkner
Daghlian,Carlos
2004-01-01
Trata-se de uma análise do consagrado conto "Uma Rosa para Emily", de William Faulkner, voltada para alguns dos principais aspectos de sua estrutura. Após considerarmos o enredo, discutimos a construção das personagens, com destaque para a protagonista, fazendo um levantamento e comentários sobre possíveis fontes de inspiração, destacando, entre outras, aspectos da biografia da poeta Emily Dickinson, a ficção e a poesia de E. A. Poe, romances de Charles Dickens e Henry James, o conto de Sherw...
A feeling for Systems Development Work - Design of the ROSA project
DEFF Research Database (Denmark)
Bødker, Susanne; Greenbaum, Joan
1988-01-01
This article is based on the design of a research project that will look at intuition, learning processes, language and roles in the development of computer systems. The research project, called ROSA (a Danish acronym for Roles and Cooperation in Systems Development) grew out of our interest...... in the informal working practices among systems developers, because it is these informal working relationships that are most often overlooked in research about computer science methods and tools. The project applies a gender perspective to look at the informal work relations of systems developers. The concept...
Effect of zinc on nectar secretion of Hibiscus rosa -sinensis L.
Sawidis, Thomas; Papadopoulou, Alexandra; Voulgaropoulou, Maria
2014-05-01
Zinc toxicity in secretory cells caused a range of effects, mainly depending on metal concentration. Low concentrations activated nectary function increasing nectar secretion but secretion was greatly inhibited or stopped entirely by ongoing concentration. Water loss rate of zinc treated flower parts was significantly reduced whereas green sepals were dehydrated more rapidly in comparison to colored petals. The content of zinc, calcium, magnesium and manganese increased mainly in sepals under excess of zinc, but in the secreted nectar this metal was not evident. Morphological changes were observed in mucilage cells concerning the mucilage structure and appearance. The parenchymatic, subglandular cells displayed an early vacuolarization and cytoplasm condensation. Secretory hairs appeared to be thinner, the apical cell folded inwards and plasmolytic shrinkage became severe in all cells. The waxy cuticula showed an increased electron density. A plasmalemma detachment from the external cell walls was observed creating a gap between cell wall and plasmalemma. ER cisterns of all treated nectary hairs dominated the cytoplasm and electron dense deposits were seen within its profiles. A great number of other organelles were also present, showing electron dense deposits in their membranes as well. The vacuome was drastically reduced in all cells, except in the subglandular ones and electron dense membrane remnants were observed.
Directory of Open Access Journals (Sweden)
Ignacio Zubizarreta
2015-03-01
Full Text Available This article analyzes the trajectory of two secret organizations that were formed between 1835 and 1840. The first appeared in Uruguay and the second in Buenos Aires, and both were created for the purpose of overthrowing the regime of Juan Manuel de Rosas in Argentina. Despite the fact that neither was completely successful in achieving said objective, the article aims to reveal their strategies, their communication systems, their plans and the internal relations among their members. The conclusion is that these lodges played a determining role in the complex machinery of opposition since they constituted an important component in the persistent drive to oust Rosas, which would not be completely successful until the battle that finally liquidated him in Caseros (1852.
Bastos, Fernanda Espíndola Assumpção
2014-01-01
O objetivo deste trabalho foi avaliar a produtividade das cultivares de rosa Avalanche‟ e Carola‟, de coloração branca e vermelha, respectivamente, em três densidades de plantio bem como a qualidade e conservação pós-colheita da cultivar Carola‟, no município de Lages-SC. O experimento referente à densidade de plantio foi implantado em janeiro de 2013, no campus da Universidade do Estado de Santa Catarina (UDESC), com espaçamento de 1,0 m entre fileiras e de 30, 40 e 50 c...
Antifungal activity of methanolic extracts of some indigenous plants against common soil-borne fungi
International Nuclear Information System (INIS)
Tuba, T.; Abid, M.; Shaukat, S. S.; Shaikh, A.
2016-01-01
Present study was conducted to evaluate the fungicidal property of methanolic extracts of some indigenous plants of Karachi such as Hibiscus rosa-sinensis (leaves), The spesia populnea (leaves, stem and fruit), Withania somnifera (leaves and stem), Solanum surattense (shoot) and Melia azedarach (fruit) against common soil-borne phytopathogens viz., Macrophomina phaseolina, Rhizoctonia solani and Fusarium oxysporum by using food poison technique. Among the eight methanolic extracts of tested parts of plants, seven showed antifungal activity, of which T. populnea leaves and S. surattense shoots inhibited growth of all three test pathogens. Leaves of H. rosa-sinensis did not exhibit antifungal activity. T. populnea (leaves and stem), W. somnifera (stem) and M. azedarach (fruit) suppressed growth of Rhizoctonia solani by 100 percent. T. populnea leaves and M. azedarach fruit inhibited growth of M. phaseolina by 100 percent and 82 percent, respectively T. populnea leaves inhibited 99 percent mycelial growth of F. oxysporum. It is concluded that the methanolic extracts of the tested indigenous plants contain natural fungicidal compounds, which can be used for the control of common soil-borne pathogens. (author)
Review Hepatoprotektor Rosela (Hibiscus sabdariffa: Aktivitas, Mekanisme Aksi dan Toksisitas
Directory of Open Access Journals (Sweden)
Steffi Liem
2017-12-01
Full Text Available Liver cirrhosis has become the international health problem that causes significant mortality. Handling using herbs from various countries has been done, one of them by consuming roselle (Hibiscus sabdariffa calyx extract. H. sabdariffa contains anthocyanins, flavonoids, tannins, and ascorbic acid that function as hepatoprotector. H. sabdariffacalyx extract may inhibit the increasing of various clinical parameters, such as ALT, AST, ALP, and LDH in various inducer types, ie acetaminophen, CCl4, CdCl2, DNPH, and TAA. The mechanism of action of H. sabdariffacalyx extract are as an antioxidant, inhibition of cytochrome enzyme, induction of phase II metabolism enzymes, increase cell viability percentage, increase CAT, GSH and decrease protein expression of pJNK, tBid and Bax. However, the consumption of H. sabdariffacalyx extract may also cause acute, subchronic, and chronic toxicity depending on the given dose.
Hibiscus sabdariffa extract lowers blood pressure and improves endothelial function.
Joven, Jorge; March, Isabel; Espinel, Eugenia; Fernández-Arroyo, Salvador; Rodríguez-Gallego, Esther; Aragonès, Gerard; Beltrán-Debón, Raúl; Alonso-Villaverde, Carlos; Rios, Lidia; Martin-Paredero, Vicente; Menendez, Javier A; Micol, Vicente; Segura-Carretero, Antonio; Camps, Jordi
2014-06-01
Polyphenols from Hibiscus sabdariffa calices were administered to patients with metabolic syndrome (125 mg/kg/day for 4 wk, n = 31) and spontaneously hypertensive rats (125 or 60 mg/kg in a single dose or daily for 1 wk, n = 8 for each experimental group). The H. sabdariffa extract improved metabolism, displayed potent anti-inflammatory and antioxidant activities, and significantly reduced blood pressure in both humans and rats. Diuresis and inhibition of the angiotensin I-converting enzyme were found to be less important mechanisms than those related to the antioxidant, anti-inflammatory, and endothelium-dependent effects to explain the beneficial actions. Notably, polyphenols induced a favorable endothelial response that should be considered in the management of metabolic cardiovascular risks. © 2014 The Authors. Molecular Nutrition & Food Research published by Wiley-VCH Verlag GmbH & Co. KGaA, Weinheim.
Factors influencing extract of Hibiscus sabdariffa staining of rat testes.
Bassey, R B; Bakare, A A; Peter, A I; Oremosu, A A; Osinubi, A A
2012-08-01
Some plant extracts can be used in biology and medicine to reveal or identify cellular components and tissues. We investigated the effects of time and concentration on staining of histological sections of rat testes by an acidified extract of Hibiscus sabdariffa. An ethanolic extract of H. sabdariffa was diluted using 1% acetic acid in 70% ethanol to stain histological sections of testes at concentrations of 0.2, 0.1 and 0.05 g/ml for 5, 10, 15, 30, 45 and 60 min. The sections of testes were stained deep red. The staining efficiency of H. sabdariffa was greater at a high concentration and required less time to achieve optimal staining. H. sabdariffa is a strongly basic dye that can be used for various diagnostic purposes. Staining time and concentration must be considered to achieve optimal results.
Hibiscus fiber carbon for fuel cell device material
International Nuclear Information System (INIS)
Nanik Indayaningsih; Anne Zulfia; Dedi Priadi; Suprapedi
2010-01-01
The objective of this research is carbon of hibiscus fibers for the application as basic material of fuel cell device. The carbon is made using a pyrolysis process in inert gas (nitrogen) for 1 hour at temperature of 500 °C, 700 °C and 900 °C. The X-Ray Diffractometer (XRD), Scanning Electron Microscope (SEM) and Impedance-Capacitance-Resistance-meter are used to find out the microstructure, morphology and electrical properties respectively. The results of the experiment showed that the carbon had a structure of amorphous, and as the semiconductor material the electrical conductivity was 5 x 10"-"5 S.cm"-"1 to 4.9 x 10"-"5 S.cm"-"1 increasing in accordance with the pyrolysis temperature. The morphology resembled to plaited mats constructed by porous fibers having width of 50 µm to 300 µm, thickness of 25 µm to 35 µm, and the porous size of 0.5 µm to 5 µm. This morphology enables carbon to be applied as a candidate for a basic material of the Proton Exchange Membrane Fuel Cell. (author)
Directory of Open Access Journals (Sweden)
T. Andzi Barhé
2016-01-01
Full Text Available The present study is part of the evaluation of extracts of Glycine max L. Merr and Hibiscus L. Sabdariffa as antioxidants. A comparative study was performed with extracts of yellow tea and commercial red wine, two foods known for their antioxidant activity. The method applied is free radical scavenging using the 1,1-diphenyl-2-picrylhydrazyl (DPPH°. The antioxidant properties were identified and measured by the determining the anti-radical activity reducing index, expressed in percentage % RSA (Radical Scavenger Activity, and by the determination of the colouring intensity (IC50. All results are compared to those of ascorbic acid as reference antioxidant. The results indicate the following order for the antioxidant power of the extracts tested. % RSA (tea > % RSA (Glycine max % > RSA (red wine % > RSA (Sabdariffa Hibiscus, and colouring intensities (IC50 ranging from 4.62 μM (ascorbic acid to 1.10 μM (Hibiscus sabdariffa correlated with their chemical structure and the content of phenolic compounds.
International Nuclear Information System (INIS)
Mahama, Adamou.
1980-10-01
This work on textile hibiscus was undertaken for two reasons: to contribute by physical mutagenesis methods to the genetic improvement of these species and especially to obtain the genetic diversity which is seriously lacking in the species sabdariffa var. altissima; to add to research on the effects of mutagenic seed treatments and thus to help towards a better definition of optimum seed irradiation conditions. These two purposes have been fulfilled. The main results may be summed up as follows. - Concerning the improvement of textile hibiscus. Many strains with various new features were selected at the second generation and may lead either to new varieties or at least to interesting precursors for selection programmes. In the second generation derived from Hibiscus saddariffa var. THS 22 some plants were observed with one or more of the following characteristics specific to the edible form: ramified bearing - fleshy calix - smooth leaf. - Concerning the study of mutagenic seed treatment effects. Our experiments showed up the importance of the seed water content and its effect on the response of first-generation plantlets to cobalt 60 γ-ray treatments [fr
Multiplicação in vitro da ameixeira 'Santa Rosa': efeito da citocinina BAP
Directory of Open Access Journals (Sweden)
Rogalski Marcelo
2003-01-01
Full Text Available A ameixeira 'Santa Rosa' apresenta alta produtividade, ótimo sabor e aparência dos frutos para a comercialização. No entanto, por ser altamente suscetível à escaldadura das folhas (Xylella fastidiosa Wells, esta variedade apresenta problemas de cultivo no sul do Brasil. As técnicas de cultura in vitro permitem propagar e rapidamente espécies de interesse, além de permitir a limpeza de patógenos e a produção de matrizes com qualidade genética e sanitária comprovada. Porém, o uso prático da propagação in vitro requer a otimização das condições de cultura para cada espécie e/ou variedade. Dentre os fatores que mais influenciam a micropropagação, estão as citocininas, com destaque para o BAP. O objetivo principal deste trabalho foi avaliar o potencial de multiplicação in vitro da ameixeira 'Santa Rosa' sob diferentes concentrações de BAP. Após três subculturas em meio MA1, segmentos nodais com 0,5-1,0 cm foram submetidos a diferentes concentrações de BAP (0,5; 1,0; 2,0 e 3,0 mg.L-1. Os resultados mostraram que não ocorreram diferenças significativas no número de brotos para as diferentes concentrações de BAP testadas. No entanto, o maior número de brotos por explante (3,6 obteve-se na concentração de 2,0 mg.L-1 e a maior altura média dos brotos foi obtido na concentração de 0,5 mg.L-1 de BAP. Concentrações maiores que a 0,5 mg.L-1 de BAP inibiram o crescimento dos brotos. A micropropagação da ameixeira 'Santa Rosa' a partir de ápices caulinares e gemas laterais em meio de cultura MA1 mostrou-se eficaz.
International Nuclear Information System (INIS)
Bhattacharyya, A.; Prasad, R.; Buhroo, A. A.; Yousuf, I.; Khanday, A. L.; Duraisamy, P.; Umadevi, M.; Bindhu, M. R.; Govindarajan, M.
2016-01-01
The espousal of nano technology is a current come-up of the present revolution. As we know that the rose aphid, Macrosiphum rosae (Hemiptera: Aphididae), is a key pest on rose plant in Kashmir Valley, India, it exhibits a worldwide distribution. In the present study, we have synthesized biologically silver nanoparticles (Ag NPs) from Solanum lycopersicum and characterized them by UV-vis spectroscopy, TEM, and X-RD analysis. The experiment was performed by leaf dip method. Insecticidal solutions of different Ag NPs concentrations, namely, 200, 300, 400, and 500 ppm, were tested on M. rosae. For assessment purposes, leaves were treated with distilled water (used as control). Aphid mortality data revealed that the Ag NPs were effective at 500 ppm concentration. As the concentration and day’s treatment increased, the aphid mortality rate also increased. There were statistically significant differences in M. rosae mortality between concentrations by LSD at 5%. In wrapping up, the use of Ag NPs in pest control processes will be the most novel eco-friendly approach in the Kashmir Valley, India, in future.
Directory of Open Access Journals (Sweden)
Zuraida ,
2015-09-01
Full Text Available Abstrak Pemberian rosella (Hibiscus sabdariffa Linn diharapkan melindung hepar tikus dari kerusakkan akibat stres oksidatif pada keracunan karbon tetraklorida (CCl 4. Senyawa yang sering dijadikan petunjuk adanya kerusakan tersebut adalah malondialdehid (MDA. Rosella mengandung vitamin C, flavonoid, polifenol dan beta karoten. Tujuanpenelitian ini adalah menentukan pengaruh pemberian ekstrak rosella (Hibiscus sabdariffa Linn terhadap MDA dan aktivitas katalase tikus yang terpapar CCl 4. Ini adalah penelitian eksperimental dengan desain Post test Only Control Group Design. Sampel 24 ekor tikus Strain Wistar berumur 2-3 bulan, berat 150-200 gr. Sampel diambil secara acakdan dibagi 4 kelompok terdiri dari kelompok kontrol negatif, kontrol positif (CCl 4, perlakuan 1 (CCl 4 dan ekstrak rosella 250 mg/kg bb dan perlakuan 2 (CCl4 dan ekstrak rosella 500 mg/kg bb. Pemberian CCl 4secara oral dosis tunggal, setelah 24 jam kemudian diberi ekstrak rosella secara oral selama 14 hari. Data dianalisis dengan uji Anova, tingkatkepercayaan 95%.Pemberian ekstrak rosella secara statistik didapatkan perbedaan yang signifikan rerata kadar MDA dan katalase antar kelompok (p < 0,05. Disimpulkan bahwa ekstrak rosella dapat menurunkan kadar MDA dan meningkatkan aktivitas katalase tikus yang terpapar CCl 4. Kata kunci: karbon tetraklorida, MDA, katalase, rosella Abstract Administering roselle (Hibiscus sabdariffa Linn is expected to protect rat liver from damage caused by oxidative stress in CCl4 poisoning. Rosella contains vitamin C, flavonoids, polyphenol and beta carotene. Compounds which was often used as marker of the damage caused by free radicals wa MDA. The objective of this study was to determine the effect of extracts of roselle (Hibiscus sabdariffa Linn on MDA and catalase activity of rats exposed to CCl4. Experimental research design with Post test Only Control Group Design. Samples of 24 male Wistar Strain rats were 2-3 months old. weighing 150-200 gr
Tsai, Tsung-Chang; Huang, Hui-Pei; Chang, Yun-Ching; Wang, Chau-Jong
2014-02-19
A previous study reported that anthocyanins from roselle (Hibiscus sabdariffa L.) showed significant anticancer activity in human promyelocytic leukemia cells. To explore the antitumor effect of anthocyanin, a roselle bioactive polyphenol in a rat model of chemical-induced leukemia was assayed. Anthocyanin extract of roselle (Hibiscus anthocyanins, HAs) was supplemented in the diet (0.1 and 0.2%). This study was carried out to evaluate the protective effect of HAs on N-nitrosomethylurea (NMU)-induced leukemia of rats. The study employed male Sprague-Dawley rats (n = 48), and leukemia was induced by intravenous injection of 35 mg kg(-1) body weight of NMU dissolved in physiologic saline solution. The rats were divided into four groups (n = 12): control, NMU only, and HAs groups that received different doses of HAs (0.1 and 0.2%) daily, orally, after NMU injection. After 220 days, the animals were killed, and the following parameters were assessed: morphological observation, hematology examination, histopathological assessment, and biochemical assay. When compared with the NMU-only group, HAs significantly prevented loss of organ weight and ameliorated the impairment of morphology, hematology, and histopathology. Treatment with HAs caused reduction in the levels of AST, ALT, uric acid, and MPO. Also, the results showed that oral administration of HAs (0.2%) remarkably inhibited progression of NMU-induced leukemia by approximately 33.3% in rats. This is the first report to demonstrate that the sequential administration of HAs followed by NMU resulted in an antileukemic activity in vivo.
Sarr, Mamadou; Ngom, Saliou; Kane, Modou O; Wele, Alassane; Diop, Doudou; Sarr, Bocar; Gueye, Lamine; Andriantsitohaina, Ramaroson; Diallo, Aminata S
2009-01-01
Background In this study, we suggested characterizing the vasodilator effects and the phytochemical characteristics of a plant with food usage also used in traditional treatment of arterial high blood pressure in Senegal. Methods Vascular effects of crude extract of dried and powdered calyces of Hibiscus sabdariffa were evaluated on isolated thoracic aorta of male Wistar rats on organ chambers. The crude extract was also enriched by liquid-liquid extraction. The various cyclohexane, dichloromethane, ethyl acetate, butanol extracts obtained as well as the residual marc were subjected to Sephadex LH-20 column chromatography. The different methanolic eluate fractions were then analyzed by Thin Layer (TLC) and High Performance Liquid Chromatography (HPLC) and their vascular effects also evaluated. Results The H. Sabdariffa crude extract induced mainly endothelium-dependent relaxant effects. The endothelium-dependent relaxations result from NOS activation and those who not dependent to endothelium from activation of smooth muscle potassium channels. The phytochemical analysis revealed the presence of phenolic acids in the ethyl acetate extract and anthocyans in the butanolic extract. The biological efficiency of the various studied extracts, in term of vasorelaxant capacity, showed that: Butanol extract > Crude extract > Residual marc > Ethyl acetate extract. These results suggest that the strong activity of the butanolic extract is essentially due to the presence of anthocyans found in its fractions 43-67. Conclusion These results demonstrate the vasodilator potential of hibiscus sabdariffa and contribute to his valuation as therapeutic alternative. PMID:19883513
Experiment data of ROSA-III integral test RUN 710
International Nuclear Information System (INIS)
Koizumi, Yasuo; Tasaka, Kanji; Adachi, Hiromichi; Anoda, Yoshinari; Soda, Kunihisa
1981-01-01
The report presents data of RUN 710 at ROSA-III test facility. RUN 710 simulates a 200% double-ended break at the inlest side of a recirculation pump of a BWR. All ECCS are activated and electric power to simulated fuel rods in one core channel among four is not supplied in RUN 710. The primary initial conditions are steam dome pressure 7.35 MPa, lower plenum subcooling 10.8 K, core inlet flow rate 31.3 kg/s and core heat generation 2.42 MW. Peak cladding temperature is 609 K at Position 3, 352.5 mm above the mid plane of the core. All heater rods are quenched after ECCS actuation and the effectiveness of ECCS is confirmed. (author)
Labadie, Cécile; Ginies, Christian; Guinebretiere, Marie-Hélène; Renard, Catherine M G C; Cerutti, Céline; Carlin, Frédéric
2015-10-01
Hydrosols are hydrodistillation products of aromatic plants. They contain less than 1g/L of dispersed essential oils giving organoleptic properties. Hydrosols are subjected to microbial proliferation. Reasons for spoilage have to be found in the nature of substrates supporting growth and of microbiological contaminants. The composition in essential oils and the microbiota of 22 hydrosol samples of Citrus aurantium L. ssp. amara L. (orange blossom), Rosa damascena Miller (rose D.), and Rosa centifolia L. (rose C.) flowers were analyzed to determine the factors responsible for decay. The median concentrations in essential oils were 677mg/L for orange blossom hydrosols, 205mg/L for rose D. hydrosols, and 116mg/L for rose C. hydrosols. The dry matter content of these hydrosols varied between 4.0mg/L and 702mg/L, and the carbohydrate content varied between 0.21mg/L and 0.38mg/L. These non-volatile compounds were likely carried over during distillation by a priming and foaming effect, and could be used as nutrients by microorganisms. A microbial proliferation at ambient temperature and also at 5°C has been observed in all studied hydrosols when stored in a non-sterile container. In contaminated hydrosols, maximal counts were about 7log 10 CFU/mL, while the French pharmacopeia recommends a maximal total bacterial count of 2log 10 CFU/mL. Neither yeast nor mold was detected. The isolated microbial population was composed of environmental Gram-negative bacteria, arranged in four major genera: Pseudomonas sp., Burkholderia cepacia complex, and presumably two new genera belonging to Acetobacteraceae and Rhodospirillaceae. Among those bacteria, Burkholderia vietnamiensis and Novosphingobium capsulatum were able to metabolize volatile compounds, such as geraniol to produce 6-methyl-5-hepten-2-one or geranic acid, or phenylethyl acetate to produce 2-phenylethanol. EO concentrations in hydrosols or cold storage are not sufficient to insure microbiological stability. Additional
Directory of Open Access Journals (Sweden)
D.G. MOREIRA
2016-01-01
Full Text Available RESUMO O uso de adubos verdes e/ou de plantas de cobertura é uma técnica que vem sendo difundida para o cultivo de espécies medicinais, por garantir a sustentabilidade do solo agrícola, ser flexível em seu uso e por melhorar a atividade biológica do solo. O objetivo do trabalho foi avaliar o uso de culturas de cobertura para incrementar a produção de massa de plantas de vinagreira, pimenta rosa e carobinha. Foram avaliadas duas espécies de leguminosas tropicais (mucuna preta e feijão de porco como cobertura do solo e uma testemunha (sem cultura de cobertura e três espécies medicinais (vinagreira, pimenta rosa e carobinha. O experimento foi arranjado em esquema de parcelas subdivididas, tendo nas parcelas as coberturas vegetais e nas subparcelas, as plantas medicinais. As plantas para a cobertura vegetal foram propagadas por semeadura direta no local de cultivo, enquanto as medicinais foram transplantadas diretamente entre a palhada da cobertura vegetal. A produção da mucuna preta foi de 8,37 t ha-1 de massa seca e do feijão de porco, de 14,37 t ha-1 de massa seca. O uso das culturas de cobertura contribuiu para uma maior biomassa microbiana do solo. As produções de massas frescas de folhas, caules e frutos de vinagreira e de frutos da pimenta rosa foram maiores quando cultivadas em sucessão às coberturas vegetais do solo, independente da espécie. As produções da carobinha foram semelhantes quando cultivadas em áreas com ou sem a cobertura. Visando à maior produtividade da vinagreira e pimenta rosa, são indicadas as culturas antecessoras feijão de porco e mucuna preta.
Yoshida, Tetsuya; Kitazawa, Yugo; Komatsu, Ken; Neriya, Yutaro; Ishikawa, Kazuya; Fujita, Naoko; Hashimoto, Masayoshi; Maejima, Kensaku; Yamaji, Yasuyuki; Namba, Shigetou
2014-11-01
In this study, we detected a Japanese isolate of hibiscus latent Fort Pierce virus (HLFPV-J), a member of the genus Tobamovirus, in a hibiscus plant in Japan and determined the complete sequence and organization of its genome. HLFPV-J has four open reading frames (ORFs), each of which shares more than 98 % nucleotide sequence identity with those of other HLFPV isolates. Moreover, HLFPV-J contains a unique internal poly(A) region of variable length, ranging from 44 to 78 nucleotides, in its 3'-untranslated region (UTR), as is the case with hibiscus latent Singapore virus (HLSV), another hibiscus-infecting tobamovirus. The length of the HLFPV-J genome was 6431 nucleotides, including the shortest internal poly(A) region. The sequence identities of ORFs 1, 2, 3 and 4 of HLFPV-J to other tobamoviruses were 46.6-68.7, 49.9-70.8, 31.0-70.8 and 39.4-70.1 %, respectively, at the nucleotide level and 39.8-75.0, 43.6-77.8, 19.2-70.4 and 31.2-74.2 %, respectively, at the amino acid level. The 5'- and 3'-UTRs of HLFPV-J showed 24.3-58.6 and 13.0-79.8 % identity, respectively, to other tobamoviruses. In particular, when compared to other tobamoviruses, each ORF and UTR of HLFPV-J showed the highest sequence identity to those of HLSV. Phylogenetic analysis showed that HLFPV-J, other HLFPV isolates and HLSV constitute a malvaceous-plant-infecting tobamovirus cluster. These results indicate that the genomic structure of HLFPV-J has unique features similar to those of HLSV. To our knowledge, this is the first report of the complete genome sequence of HLFPV.
Directory of Open Access Journals (Sweden)
Cybelle Weinberg
2005-04-01
Full Text Available A literatura especializada tem nos mostrado que é grande a semelhança entre o comportamento alimentar das santas jejuadoras medievais e o das anoréxicas atuais. No entanto, há poucas referências sobre a existência de santas jejuadoras na América Latina. No presente trabalho, os autores salientam aspectos da vida de Santa Rosa de Lima, Patrona da América e Filipinas, que poderiam ser descritos como comportamentos anoréxicos. Comparando os aspectos psicopatológicos da vida de Santa Rosa com o comportamento das anoréxicas atuais, pareceu confirmar-se um padrão uniforme de comportamento, especialmente quanto ao aspecto imitativo, fator que poderia levar as jovens da atualidade a desenvolverem um transtorno alimentar após terem algum tipo de informação sobre o transtorno.La literatura especializada nos muestra gran similitud entre el comportamiento alimentar de las santas de la edad media que ayunaban y el de las anoréxicas de la actualidad. Hay pocas informaciones sobre santas que practicaban ayuno en Latinoamérica. En este artículo, los autores resaltan aspectos de la vida de santa Rosa de Lima, Patrona de América y Filipinas, que pueden ser considerados como comportamientos anoréxicos. Al comparar aspectos psicopatológicos de la vida de santa Rosa con el comportamiento de anoréxicas de la actualidad, parece que se confirma un modelo uniforme de comportamiento, especialmente respecto al aspecto de imitación, hecho que podría llevar a las jóvenes de hoy a desarrollar un trastorno de la alimentación luego de recibir informaciones sobre el tema.The specialized literature has shown us the great similarity between the eating habits of medieval fasting women saints and today's anorexic women. Nonetheless, there are few references to the existence of such fasting women saints in Latin America. The authors of this paper present some aspects of the life of Saint Rose of Lima, the patroness of the Americas and the Philippines, that
Cytotoxic and genotoxic studies of essential oil from Rosa damascene Mill., Kashan, Iran.
Shokrzadeh, Mohammad; Habibi, Emran; Modanloo, Mona
2017-08-01
Aim Rosa damascene Mill. belongs to the family of Roseaceae and its essential oil is produced in large amounts in Iran. The wide application of rose oil has raised questions about potential adverse health effects. We have investigated cytotoxic activity and genotoxic effects of Rosa oil from Kashan, Iran. Methods The cytotoxic effect and IC50 of the essential oil on the cell lines was studied followed by MTT assay. In this assay mitochondrial oxidoreductase enzymes with reducing the tetrazolium dye MTT (3-(4, 5-dimethylthiazol-2-yl)-2, 5-diphenyltetrazolium bromide) reflect the number of viable cells. Genotoxic effect of the oil was evaluated by micronucleus assay by evaluating produced micronuclei due to cytogenetic damage in binucleated lymphocytes. Results The results showed that essential oil significantly had cytotoxic and genotoxic effects at doses over 10µg/mL (pessential oil of Rose showed lower IC50 in cancer cell line (A549) in comparison with the normal cell line (NIH3T3). Conclusion Cytotoxic and genotoxic properties of essential oil of Rose in Kashan, Iran, are safe at a dose of 10µg/mL. Also, a good cytotoxic effect was shown and could be introduced as an anticancer compound. Further studies are needed with regard to anti-cancer effects of Rose essential oil. Copyright© by the Medical Assotiation of Zenica-Doboj Canton.
The objective of this study was to investigate the antimicrobial effects of carvacrol and cinnamaldehyde incorporated into apple, carrot and hibiscus based edible films against Salmonella Newport in contaminated organic leafy greens. The leafy greens tested included romaine and iceberg lettuce, and ...
Guimarães Rosa e Monteiro Lobato: uma aproximação insólita
Directory of Open Access Journals (Sweden)
Maria Aparecida Santilli
2002-03-01
Full Text Available Poderá ser surpreendente fazer pendant de escritores, com Guimarães Rosa e Monteiro Lobato. Mas haverá, no mínimo, a procedência de ser ilustrativo do trabalho que aqui se apresenta. Ficou, em nossa memória mais remota de leituras, que as figuras encantadoras do imaginário infanto-juvenil europeu, em sua coorte de significados, desembarcaram, com Lobato, para nacionalizarem-se em terreiro do Brasil. Mas ficou, também, em nossa memória mais recente de leituras, que o pensamento dos antigos ou “clássicos” da Grécia, em seus sedutores achados, pousou no sertão grande de Guimarães Rosa, transfundindose à passagem pelas veredas da metabolização cultural brasileira. Este trabalho tem, então, o objetivo de refletir sobre tal operação, realizada no processo da alquimia literária rosiana, através de recorte estabelecido à volta do conto “A hora e a vez de Augusto Matraga”, de Primeiras estórias.
Morphological and chemical characteristics of fruits of selected Rosa sp.
Directory of Open Access Journals (Sweden)
Agnieszka Najda
2013-04-01
Full Text Available The aim of this study was to evaluate the morphological and chemical parameters, antioxidant activity (DPPH of five rose species (Rosa rugosa, R. villosa, R. californica, R. spinosissima, and R. × damascene and grouping them according to the harvest date. On the basis of the study, rose species grown in eastern Poland were grouped according to their harvest time, and three dates of cumulative ripeness of pseudofruits were distinguished. Rosehips of studied species varied referring to their harvest date and morphological properties and were characterized by diverse contents of primary metabolites analyzed. In addition, obtained extracts showed high antioxidant activity, which has a significant impact on their value for processing.
Isolation of immunomodulatory triterpene acids from a standardized rose hip powder (Rosa canina L.).
Saaby, Lasse; Jäger, Anna Katharina; Moesby, Lise; Hansen, Erik Wind; Christensen, Søren Brøgger
2011-02-01
A previously published systematic review and a metaanalysis have concluded that the consumption of standardized rose hip powder (Rosa canina L.) can reduce pain in osteoarthritis patients. Synovial inflammation has been suggested to play an important role in the pathogenesis of osteoarthritis and mainly to involve infiltration of the synovial membrane by macrophages. Therefore, the immunomodulatory effect of standardized rose hip powder of Rosa canina L. was investigated and active principles isolated using the Mono Mac 6 cell line as a model for human macrophages. Treatment of Mono Mac 6 cells with the residue of a crude dichloromethane extract of rose hip powder significantly and concentration dependently inhibited the lipopolysaccharide induced interleukin-6 release. Through bioassay-guided fractionation the immunomodulatory effect of the dichloromethane extract was correlated to a mixture of three triterpene acids; oleanolic acid, betulinic acid and ursolic acid (IC(50) 21 ± 6 µm). Further studies revealed that only oleanolic acid and ursolic acid, but not betulinic acid, could inhibit the lipopolysaccharide induced interleukin-6 release from Mono Mac 6 cells when tested separately. Combination of either oleanolic acid or ursolic acid with betulinic acid enhanced the immunomodulatory effect of the two triterpene acids. Copyright © 2010 John Wiley & Sons, Ltd.
Energy Technology Data Exchange (ETDEWEB)
Grund, A.; Schwikowski, M.; Bruetsch, S.; Gaeggeler, H.W. [Paul Scherrer Inst. (PSI), Villigen (Switzerland)
1997-09-01
In order to determine trace concentrations of acetate, formate and methanesulfonate in ice samples by ion chromatography precautions have to be taken to avoid contaminations. We investigated sources of contamination and analysed first samples from Grenzgletscher (Monte Rosa massif). (author) 1 fig., 3 refs.
International Nuclear Information System (INIS)
Grund, A.; Schwikowski, M.; Bruetsch, S.; Gaeggeler, H.W.
1997-01-01
In order to determine trace concentrations of acetate, formate and methanesulfonate in ice samples by ion chromatography precautions have to be taken to avoid contaminations. We investigated sources of contamination and analysed first samples from Grenzgletscher (Monte Rosa massif). (author) 1 fig., 3 refs
Moya Cuito, María Gabriela; Almeida Pazmiño, Andrea Carolina
2016-01-01
Beautyflor inició sus actividades hace aproximadamente 4 años, con la distribución y venta de rosas naturales preservadas, las mismas que tienen un tiempo de duración de 3 años. El producto se dirigirá a un segmento objetivo en el mercado nacional, el cual comprende, hombres y mujeres que se encuentran entre los 26 a 35 años de edad, quienes, al momento de adquirir rosas preservadas buscan que sus atributos: color, aroma, tamaño y calidad cumplan sus expectativas. Beautyflor, al ser innovador...
Energy Technology Data Exchange (ETDEWEB)
Tabares, J; Orozco, J
1992-07-01
In 1987 the Regional Autonomous Corporation of Risaralda, CARDER and the Risaralda Government, they signed a cooperation agreement, in order to endowing from sanitary landfill to the municipalities of the department. In the mark of this agreement it was carried out the design of Santa Rosa's sanitary landfill, that with near 50.000 inhabitants it is constituted in the third city of the department. This city generates some 25 tons/day of garbage that at the present time are heady directly to the waters of San Eugenio River. The present work contains the most important methodological aspects in the design of the sanitary landfill and some comments about the approaches ideal Vs real approaches of selection of places.
Rocha, Joecildo Francisco; Machado, Silvia Rodrigues [UNESP
2009-01-01
This paper reports on the extrafloral nectary (EFN) of Hibiscus pernambucensis, a native shrub species occurring in mangrove and restinga along Brazil's coastline. EFNs occur as furrows with a protuberant border on the abaxial surface veins of the leaf blade. Each nectary consists of numerous secretory multicellular trichomes, epidermal cells in palisade-like arrangements and non-vascularized parenchyma tissue. Nectar secretion is prolonged, since secretion starts in very young leaves and rem...
Frank, Thomas; Netzel, Gabriele; Kammerer, Dietmar R; Carle, Reinhold; Kler, Adolf; Kriesl, Erwin; Bitsch, Irmgard; Bitsch, Roland; Netzel, Michael
2012-08-15
To evaluate health benefits attributed to Hibiscus sabdariffa L. a randomized, open-label, two-way crossover study was undertaken to compare the impact of an aqueous H. sabdariffa L. extract (HSE) on the systemic antioxidant potential (AOP; assayed by ferric reducing antioxidant power (FRAP)) with a reference treatment (water) in eight healthy volunteers. The biokinetic variables were the areas under the curve (AUC) of plasma FRAP, ascorbic acid and urate that are above the pre-dose concentration, and the amounts excreted into urine within 24 h (Ae(0-24) ) of antioxidants as assayed by FRAP, ascorbic acid, uric acid, malondialdehyde (biomarker for oxidative stress), and hippuric acid (metabolite and potential biomarker for total polyphenol intake). HSE caused significantly higher plasma AUC of FRAP, an increase in Ae(0-24) of FRAP, ascorbic acid and hippuric acid, whereas malondialdehyde excretion was reduced. Furthermore, the main hibiscus anthocyanins as well as one glucuronide conjugate could be quantified in the volunteers' urine (0.02% of the administered dose). The aqueous HSE investigated in this study enhanced the systemic AOP and reduced the oxidative stress in humans. Furthermore, the increased urinary hippuric acid excretion after HSE consumption indicates a high biotransformation of the ingested HSE polyphenols, most likely caused by the colonic microbiota. Copyright © 2012 Society of Chemical Industry.
Directory of Open Access Journals (Sweden)
Gláucia Marques Freitas-Ribeiro
2005-11-01
Full Text Available Engorged and partially engorged females of Boophilus microplus were exposed to 600; 3,000; 6,000 and 30,000 infective juveniles of Steinernema carpocapsae Weiser, 1955 Santa Rosa and All strains per dish, under lab conditions. Eggs weight, pre-laying period, laying period, survival period, reproductive efficiency rate, percentage of larval eclosion and lethal concentrations of 50% and 90% (CL50 and CL90 were calculated for engorged females. In the case of partially engorged females, only egg weight, survival period and CL50 and CL90 were calculated. All biological parameters of engorged or partially engorged females were altered by exposition of S. carpocapsae infective juveniles (IJs, Santa Rosa and All strains (pFêmeas ingurgitadas e parcialmente ingurgitadas de B. microplus foram expostas a 600, 3000, 6000 e 30000 juvenis infectivos de Steinernema carpocapsae Weiser, 1955 linhagens Santa Rosa e ALL por placa, sob condições de laboratório. Foram investigados para fêmeas ingurgitadas: peso da massa de ovos, período pré-postura, período de postura, tempo de sobrevivência, índice de eficiência reprodutiva, percentual de aclosão de larvas e concentrações letais 50% e 90% (CL50 e CL90. Para fêmeas parcialmente ingurgitadas somente foram observados peso da massa de ovos, tempo de sobrevivência, CL50 e CL90. Todos os parâmetros biológicos de fêmeas ingurgitadas foram e parcialmente ingurgitadas foram alterados pela exposição a juvenis infectivos de S. carpocapsae linhagens Santa Rosa e ALL (P<0,05. O aumento das resposta foi diretamente proporcional ao aumento das concentrações de juvenis infectivos por placa (P<0,05. Os resultados sugerem que nematóides entomopatogênicos podem ter papel primissor no controle de carrapatos dos bovinos.
Henari, F. Z.; Al-Saie, A.
2006-12-01
We report the observation of self-action phenomena, such as self-focusing, self-defocusing, self-phase modulation and beam fanning in Roselle-Hibiscus Sabdariffa solutions. This material is found to be a new type of natural nonlinear media, and the nonlinear reflective index coefficient has been determined using a Z-scan technique and by measuring the critical power for the self-trapping effect. Z-scan measurements show that this material has a large negative nonlinear refractive index, n 2 = 1 × 10-4 esu. A comparison between the experimental n 2 values and the calculated thermal value for n 2 suggests that the major contribution to nonlinear response is of thermal origin.
CARACTERIZAÇÃO FÍSICA, QUÍMICA E NUTRICIONAL DA PITAIA-ROSA DE POLPA VERMELHA
Directory of Open Access Journals (Sweden)
MARIA HELENA MENEZES CORDEIRO
2015-03-01
Full Text Available RESUMO A pitaia-rosa de polpa vermelha é uma cactácea com potencial para exploração econômica, devido aos seus componentes nutricionais e ao alto valor comercial; no entanto, poucas são as pesquisas quanto a suas características pós-colheita. O objetivo do trabalho foi caracterizar física, química e nutricionalmente pitaias-rosas de polpa vermelha. Frutos colhidos totalmente maduros foram sanitizados, selecionados e divididos em grupos de quatro frutos por repetição, constituindo um total de 30 amostras. Em seguida, as amostras foram submetidas às seguintes avaliações: comprimento, diâmetro, espessura de casca, massa fresca, massa de casca e polpa, teor de umidade, firmeza da casca, sólidos solúveis, pH, acidez titulável, açúcares e fibra bruta, cromaticidade, ângulo hue e luminosidade da casca e da polpa, e o teor de nutrientes. Para os dados obtidos, foram determinados a média, o valor mínimo e máximo, desvio-padrão e o coeficiente de variação. A fruta apresentou valores elevados de conteúdo de água, teor de fibras e dos nutrientes nitrogênio, potássio, cálcio, ferro, manganês e zinco. Quanto ao teor de sólidos solúveis, a média observada foi de 13,14° Brix, e para acidez titulável,0,29 mg de ác. málico 100-1 mL de suco. Verificaram-se para os açúcares valores de 5,56; 8,79 e 3,07 %, respectivamente, para os açúcares redutores, totais e não redutores. Quanto à coloração, os frutos apresentaram valores maiores para luminosidade e cromaticidade da casca e ângulo Hue da polpa. A pitaia-rosa de polpa vermelha (Hylocereus polyrhizus apresenta características físicas, químicas e nutricionais interessantes para o consumo in natura.
DEFF Research Database (Denmark)
Agbobatinkpo, Pélagie B.; Thorsen, Line; Nielsen, Dennis Sandris
2013-01-01
Yanyanku and Ikpiru made by the fermentation of Malcavene bean (Hibiscus sabdariffa) are used as functional additives for Parkia biglobosa seed fermentations in Benin. A total of 355 aerobic endospore-forming bacteria (AEFB) isolated from Yanyanku and Ikpiru produced in northern and southern Benin...
Fernández-Arroyo, Salvador; Herranz-López, María; Beltrán-Debón, Raúl; Borrás-Linares, Isabel; Barrajón-Catalán, Enrique; Joven, Jorge; Fernández-Gutiérrez, Alberto; Segura-Carretero, Antonio; Micol, Vicente
2012-10-01
The aqueous extracts of Hibiscus sabdariffa have been commonly used in folk medicine. Nevertheless, the compounds or metabolites responsible for its healthy effects have not yet been identified. The major metabolites present in rat plasma after acute ingestion of a polyphenol-enriched Hibiscus sabdariffa extract were characterized and quantified in order to study their bioavailability. The antioxidant status of the plasma samples was also measured through several complementary antioxidant techniques. High-performance liquid chromatography coupled to time-of-flight mass spectrometry (HPLC-ESI-TOF-MS) was used for the bioavailability study. The antioxidant status was measured by ferric reducing ability of plasma method, thiobarbituric acid reactive substances assay, and superoxide dismutase activity assay. Seventeen polyphenols and metabolites have been detected and quantified. Eleven of these compounds were metabolites. Although phenolic acids were found in plasma without any modification in their structures, most flavonols were found as quercetin or kaempferol glucuronide conjugates. Flavonol glucuronide conjugates, which show longer half-life elimination values, are proposed to contribute to the observed lipid peroxidation inhibitory activity in the cellular membranes. By contrast, phenolic acids appear to exert their antioxidant activity through ferric ion reduction and superoxide scavenging at shorter times. We propose that flavonol-conjugated forms (quercetin and kaempferol) may be the compounds responsible for the observed antioxidant effects and contribute to the healthy effects of H. sabdariffa polyphenolic extract. © 2012 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.
Gao, Ruimin; Wan, Zi Yi; Wong, Sek-Man
2013-01-01
Virus infection may cause a multiplicity of symptoms in their host including discoloration, distortion and growth retardation. Hibiscus chlorotic ringspot virus (HCRSV) infection was studied using kenaf (Hibiscus cannabinus L.), a non-wood fiber-producing crop in this study. Infection by HCRSV reduced the fiber yield and concomitant economic value of kenaf. We investigated kenaf growth retardation and fluctuations of four selected miRNAs after HCRSV infection. Vegetative growth (including plant height, leaf size and root development) was severely retarded. From the transverse and radial sections of the mock and HCRSV-infected kenaf stem, the vascular bundles of HCRSV-infected plants were severely disrupted. In addition, four conserved plant developmental and defence related microRNAs (miRNAs) (miR165, miR167, miR168 and miR171) and their respective target genes phabulosa (PHB), auxin response factor 8 (ARF8), argonaute 1 (AGO1) and scarecrow-like protein 1 (SCL1) displayed variation in expression levels after HCRSV infection. Compared with the mock inoculated kenaf plants, miR171 and miR168 and their targets SCL1 and AGO1 showed greater fluctuations after HCRSV infection. As HCRSV upregulates plant SO transcript in kenaf and upregulated AGO1 in HCRSV-infected plants, the expression level of AGO1 transcript was further investigated under sulfite oxidase (SO) overexpression or silencing condition. Interestingly, the four selected miRNAs were also up- or down-regulated upon overexpression or silencing of SO. Plant growth retardation and fluctuation of four conserved miRNAs are correlated to HCRSV infection.
Directory of Open Access Journals (Sweden)
Carlos Alberto Márquez
2008-06-01
Full Text Available En este trabajo, se determinaron experimentalmente y modelaron los cambios de volumen y porosidad de lecho fijo durante la deshidratación de cerezas, guindas y frutos de la rosa mosqueta. Se utilizaron un equipo de secado experimental y frutas frescas. La altura de lecho variaba entre 0,04 y 0,12 m, la temperatura del aire entre 50 y 70 ºC, su velocidad entre 1 y 4 m/s, y su humedad relativa fue de 5 y 50%. Al inicio y durante la deshidratación se medía la altura del lecho como promedio de 8 escalas graduadas colocadas simétricamente en la cámara de secado y el peso de las muestras correspondientes. Con los valores obtenidos se calculaba el volumen de lecho y su porosidad en función del contenido de agua de la muestra. Mediante regresión, se obtuvieron correlaciones para estimar el volumen y la porosidad de lecho. Los errores porcentuales obtenidos fueron: para cambios en el volumen de lecho, entre -16,4 y 23,3 para cerezas y guindas, y entre -4,9 y 4,4 para frutos de la rosa mosqueta; y para los cambios de porosidad, entre -15,2 y 21,1 para cerezas y guindas, y entre -2,6 y 6,1 para frutos de la rosa mosqueta.Neste trabalho foram determinadas e modeladas as mudanças de volume e porosidade de cerejas doces e ácidas, bem como de frutas de rosa mosqueta em leitos fixos durante a secagem. Foi usado um equipamento de secagem experimental e frutas frescas. A espessura dos leitos variou entre 0,04 e 0,12 m, a temperatura do ar entre 50 e 70 ºC, a velocidade entre 1 e 4 m/s e a umidade relativa de 5 a 50%. Para o começo e durante a secagem foram medidos a altura do leito por meio de 8 escalas graduadas colocadas simetricamente na câmara de secagem e o peso das amostras correspondentes. Com os valores obtidos foi calculado o volume de leito e a porosidade em função do conteúdo de água da amostra. Por meio de correlações de regressão foram obtidos o volume e a porosidade de leito. Os erros porcentuais obtidos foram: para mudanças no
Plant regeneration from petiole segments of some species in tissue culture
Directory of Open Access Journals (Sweden)
Krystyna Klimaszewska
2013-12-01
Full Text Available The regeneration ability of 21 plant species belonging to 14 families was tested. The method of tissue culture in vitro was applied, on basic MS medium with an addition of growth regulators from the auxin and cytokinin groups. From among the investigated plant groups Peperomia scandens and Caladium × hortulanum were capable of plant regeneration, Passiilora coerulea regenerated shoots, Hedera helix, Begonia glabra, Coleus blumei, Fuchsia hybrida, Passiflora suberosa and Peperomia eburnea formed callus and roots, Kalanchoe blossfeldiana, Pelargonium grandiflorum, P. peltatum, P. radula, Coleus shirensis and Magnolia soulangeana produced callus, Philodendron scandens, Rhododendron smirnovii, Hibiscus rosa-sinensis, Coprosma baueri, Cestrum purpureum and Solanum rantonnetii did not exhibit any regeneration reactions.
PORTUGUESE LITERATURE FOR CHILDREN: AQUILINO RIBEIRO AND MATILDE ROSA ARAÚJO
Directory of Open Access Journals (Sweden)
Luci Ruas
2014-11-01
Full Text Available This work shows that, in the twentieth century, specifically in its second half, many of the texts produced for children already showed clear concern in separating itself from the receiver, so that value is given to how they are built, that is, so that from the writing scripture is made, and from text, literature. For this purpose, we start by presenting the concerns of Antero de Quental and Eça de Queiroz, and then approaching the literary work of Aquilino Ribeiro, specifically O romance da raposa, following with the approach present in the literary work of Matilde Rosa Araújo.
Ai, Chau Tran Diem; Linh, Vo Thi Hong; Yen, Tran Thi Ngoc; Nguyen, Nguyen Thi; Hoa, Phan Ngoc
2017-09-01
This study focused on the comparison among the usage of immobilized porcine pancreas lipase (PPL) on different hydrotalcite carriers (uncalcined and calcined hydrotalcite - like compound Mg /Al) and free lipase as the catalysts to hydrolyze of roselle (Hibiscus sabdariffa L.) seed oil. The reaction conditions were investigated including the ratio of oil to buffer, ratio of enzyme to substrate, the temperature of the hydrolysis, pH. The calcined hydrotalcite showed a higher lipase immobilization yield and a better reusability than the uncalcined hydrotalcite (87.15% and 86.78%, respectively).
Comparative chemical and biochemical analysis of extracts of Hibiscus sabdariffa.
Sindi, Heba A; Marshall, Lisa J; Morgan, Michael R A
2014-12-01
Hibiscus sabdariffa extracts have attracted attention because of potentially useful bioactivity. However, there have been no systematic studies of extraction efficiencies of H. sabdariffa. The nature of extracts used in different studies has varied considerably, making comparisons difficult. Therefore, a systematic study of extracts of H. sabdariffa made with different solvents was carried out using water, methanol, ethyl acetate and hexane in the presence/absence of formic acid, using different extraction times and temperatures. The extracts were analysed for total polyphenol content, antioxidant capacity using DPPH, FRAP and TEAC assays, and specific anthocyanins were determined using HPLC and LC-MS. The results showed the highest antioxidant capacities were obtained by extracting using water, with or without formic acid, for 10 min at 100°C. These extracts provided the highest concentrations of cyanidin 3-sambubioside and delphinidin 3-sambubioside. It will be important to use extraction conditions giving optimal extraction efficiencies for subsequent bioactivity experiments. Copyright © 2014 Elsevier Ltd. All rights reserved.
Wound Healing Potential of Formulated Extract from Hibiscus Sabdariffa Calyx
Builders, P. F.; Kabele-Toge, B.; Builders, M.; Chindo, B. A.; Anwunobi, Patricia A.; Isimi, Yetunde C.
2013-01-01
Wound healing agents support the natural healing process, reduce trauma and likelihood of secondary infections and hasten wound closure. The wound healing activities of water in oil cream of the methanol extract of Hibiscus sabdariffa L. (Malvaceae) was evaluated in rats with superficial skin excision wounds. Antibacterial activities against Pseudomonas aeroginosa, Staphylococcus aureus and Echerichia coli were determined. The total flavonoid content, antioxidant properties and thin layer chromatographic fingerprints of the extract were also evaluated. The extract demonstrated antioxidant properties with a total flavonoid content of 12.30±0.09 mg/g. Six reproducible spots were obtained using methanol:water (95:5) as the mobile phase. The extract showed no antimicrobial activity on the selected microorganisms, which are known to infect and retard wound healing. Creams containing H. sabdariffa extract showed significant (Psabdariffa extract. This study, thus, provides evidence of the wound healing potentials of the formulated extract of the calyces of H. sabdariffa and synergism when co-formulated with gentamicin. PMID:23901160
DIVERSIDAD GENÉTICA DE Peronospora sparsa (PERONOSPORACEAE) EN CULTIVOS DE ROSA DE COLOMBIA
MARILUZ AYALA-VÁSQUEZ; LUZ EDITH ARGEL-ROLDAN; MAURICIO MARÍN-MONTOYA
2008-01-01
El mildeo velloso de la rosa es la enfermedad más limitante de este cultivo en Colombia. Aunque algunos trabajos de investigación se han adelantado recientemente sobre la epidemiología de esta enfermedad, uno de los campos menos estudiados es el nivel de variabilidad de su agente causal. El conocimiento de este aspecto es fundamental para definir las estrategias de manejo, especialmente aquellas relacionadas con la resistencia genética y el control químico. Los objetivos de esta investigación...
DIVERSIDAD GENÉTICA DE Peronospora sparsa (PERONOSPORACEAE) EN CULTIVOS DE ROSA DE COLOMBIA
MARILUZ AYALA-VÁSQUEZ; LUZ EDITH ARGEL-ROLDAN; SONIA JARAMILLO-VILLEGAS; MAURICIO MARÍN-MONTOYA
2008-01-01
El mildeo velloso de la rosa es la enfermedad más limitante de este cultivo en Co- lombia. Aunque algunos trabajos de investigación se han adelantado recientemente sobre la epidemiología de esta enfermedad, uno de los campos menos estudiados es el nivel de variabilidad de su agente causal. El conocimiento de este aspecto es fun- damental para definir las estrategias de manejo, especialmente aquellas relacionadas con la resistencia genética y el control químico. Los objetivos de esta investiga...
GUIMARÃES ROSA: UMA REFLEXÃO SOBRE A QUESTÃO DA IDENTIDADE NACIONAL
Directory of Open Access Journals (Sweden)
Maria de Lourdes Viana Lyra
2016-01-01
Full Text Available A partir da discussão levantada por Guimarães Rosa no texto Pé-Duro, Chapéu-de-Couro, sobre a busca dos fundamentos da nacionalidade, o artigo enfoca a reflexão desenvolvida sobre os fundamentos da identidade nacional, analisando o tempo histórico correspondente e ressaltando o empenho do autor pela valorização das raízes sertanejas na constituição da nacionalidade brasileira. Palavras-chave: Nacionalidade, Raízes sertanejas, Identidade nacional
2010-01-01
Background Hibiscus sabdariffa is used regularly in folk medicine to treat various conditions. Methods The study was a double blind, placebo controlled, randomized trial. Sixty subjects with serum LDL values in the range of 130-190 mg/dl and with no history of coronary heart disease were randomized into experimental and placebo groups. The experimental group received 1 gm of the extract for 90 days while the placebo received a similar amount of maltodextrin in addition to dietary and physical activity advice for the control of their blood lipids. Anthropometry, blood biochemistry, dietary and physical activity were assessed at baseline, day 45 and day 90. Results While body weight, serum LDL cholesterol and triglyceride levels decreased in both groups, there were no significant differences between the experimental and placebo group. Conclusions It is likely that the observed effects were as a result of the patients following the standard dietary and physical activity advice. At a dose of 1 gm/day, hibiscus sabdariffa leaf extract did not appear to have a blood lipid lowering effect. Trial Registration REFCTRI2009000472 PMID:20553629
Directory of Open Access Journals (Sweden)
R Rajendran
2010-06-01
Full Text Available Abstract Background Hibiscus sabdariffa is used regularly in folk medicine to treat various conditions. Methods The study was a double blind, placebo controlled, randomized trial. Sixty subjects with serum LDL values in the range of 130-190 mg/dl and with no history of coronary heart disease were randomized into experimental and placebo groups. The experimental group received 1 gm of the extract for 90 days while the placebo received a similar amount of maltodextrin in addition to dietary and physical activity advice for the control of their blood lipids. Anthropometry, blood biochemistry, dietary and physical activity were assessed at baseline, day 45 and day 90. Results While body weight, serum LDL cholesterol and triglyceride levels decreased in both groups, there were no significant differences between the experimental and placebo group. Conclusions It is likely that the observed effects were as a result of the patients following the standard dietary and physical activity advice. At a dose of 1 gm/day, hibiscus sabdariffa leaf extract did not appear to have a blood lipid lowering effect. Trial Registration REFCTRI2009000472
ROSELLE FLOWER (HIBISCUS SABDARIFFA IN THE TREATMENT OF HYPERTENSION IN POSTPARTUM MOTHERS
Directory of Open Access Journals (Sweden)
Nikmah Jalilah Ritonga
2017-07-01
Full Text Available Background: Roselle flower (Hibiscus sabdariffa has been used as a food and herbal drinks, in hot and cold beverages, as a herbal medicine. Objective: To examine the effect of consuming roselle dried flower petals on changes in maternal hypertensive blood pressure during postpartum period. Methods: This was a quasi-experimental study with non-equivalent control group design conducted in 2016. There were 30 samples recruited using consecutive sampling with 15 samples in the intervention group and control group. Data were analyzed using paired t-test to know the difference of blood pressure value before and after intervention in the intervention and control group, and Independent t-test to determine the difference of blood pressure decrease between intervention and control group. Mann-whitney and Wilcoxon test were also performed for data analysis. Results: Findings showed that there were statistically significant differences in systolic and diastolic blood pressure values before and after intervention in the intervention and control group with p-value 0.000 <0.05 with systolic blood pressure decrease was 5 mmHg and diastolic was 5.33 mmHg. Additionally, there was a significant effect in the duration of healing in the intervention group with p-value 0.000 <0.05, with the average duration of healing was 2 days. Conclusion: There was significant effects of dried petals of rosella flowers (Hibiscus sabdariffa brewed with 200 ml of hot water with temperature 90oC in lowering blood pressure, and there was significant differences in systolic and diastolic blood pressure and duration of healing between the intervention and control group of mothers who consumed antihypertensive drugs. The results of this study can be applied by midwives in postpartum care with the cases of hypertension. It is expected that this intervention can help the healing process more quickly through a combination of antihypertensive medicines and sedated petals of rosella flowers.
ROSELLE FLOWER (HIBISCUS SABDARIFFA IN THE TREATMENT OF HYPERTENSION IN POSTPARTUM MOTHERS
Directory of Open Access Journals (Sweden)
Nikmah Jalilah Ritonga
2017-07-01
Full Text Available Background: Roselle flower (Hibiscus sabdariffa has been used as a food and herbal drinks, in hot and cold beverages, as a herbal medicine. Objective: To examine the effect of consuming roselle dried flower petals on changes in maternal hypertensive blood pressure during postpartum period. Methods: This was a Quasi experimental study with non-equivalent control group design conducted in 2016. There were 30 samples recruited by consecutive sampling with 15 samples in the intervention and control group. Data were analyzed using paired t-test to know the difference of blood pressure value before and after intervention in the intervention and control group, and Independent t-test to determine the difference of blood pressure decrease between intervention and control group. Mann-whitney and Wilcoxon test were also performed for non-normal data distribution. Results: Findings showed that there were statistically significant differences in systolic and diastolic blood pressure values before and after intervention in the intervention group with p-value 0.000 <0.05 with mean of systolic blood pressure decrease was 39.67 mmHg and diastolic was 22.33 mmHg. Additionally, there was a significant difference in the duration of healing between both groups with p-value 0.000 <0.05, with the average duration of healing in the intervention group was 2 days while in the control group was 3-4 days. Conclusion: There was significant effects of dried petals of rosella flowers (Hibiscus sabdariffa in lowering blood pressure, and there was significant differences in systolic and diastolic blood pressure and duration of healing between the intervention and control group of mothers who consumed antihypertensive drugs. The results of this study can be applied by midwives or health services in postpartum care with the cases of hypertension. It is expected that this intervention can help the healing process more quickly through a combination of antihypertensive medicines and
Directory of Open Access Journals (Sweden)
Saeideh Aghagoli
2016-06-01
Full Text Available Background Apnea is one of the most common problems in preterm neonates. This study aimed to evaluate the effectiveness of aromatherapy on the reduction of apnea, bradycardia, and Pulse Oximetry (SPO2 in premature infants. Materials and Methods In a clinical trial study, 60 preterm neonates randomly divided in two groups and exposed to aromatherapy with Rosa damascenes distillate or distilled water beside the routine treatment. In experimental group, two drops of 10% Rosa damascenes distillate was dropped on the pad eye in second day of birth at 6 Am. The intervention was repeated in 9 AM, 12 Am, 15 PM and 18 PM hours. A same condition applied for control group and distilled water was dropped on the pad eye. The number of apnea attacks, bradycardia and decrease in SpO2 compared between two groups using chi-square test, independent t-test and repeated measure test. Results The overall apnea attacks, bradycardia, and SPO2 in tree studied days were lower in intervention group than control group (0.47±0.13 vs. 2.6±0.41, 0.47±0.13 vs. 2.56±0.41 and 0.70±0.17 vs. 2.77±0.21, respectively. In addition, the repeated measurement test showed that the mean number of apnea attacks, decrease in heart pulse rate, and decrease in SpO2 was statistically lower in intervention group with aromatherapy than controls in first, second, third and sum of three days (P< 0.05. Conclusion Aromatherapy with Rosa damascenes distillate can reduce more and speedy the occurrence of apnea attacks, bradycardia and SPO2 in premature infants, along with other routine treatment.
The effect of aromatherapy with Rosa damascena essential oil on sleep quality in children
A.S. Keyhanmehr; M. Movahhed; S. Sahranavard; L. Gachkar; M. Hamdieh; Sh. Afsharpaiman*; H. Nikfarjad
2018-01-01
Background and objectives: Sleep disorder is one of the main problems in children. Poor sleep quality can lead to adverse effects on their growth and development. Aromatherapy is a kind of method for improving sleep. In Iranian traditional medicine, inhaling Rosa damascena has been recommended for treating sleep disorder. Due to the side effects of chemical drugs and trend to alternative medicine due to less complication, the aim of this study was to investigate the effect of aromatherapy wit...
Antihypoxic and antioxidant activity of Hibiscus esculentus seeds
Directory of Open Access Journals (Sweden)
Eslami, Bahman
2010-03-01
Full Text Available The antihypoxic and antioxidant activities of Hibiscus esculentus seeds were investigated employing eight in vitro assay systems. Antihypoxic activity was investigated in two models, haemic and circulatory. The effects were pronounced in both models of hypoxia. The antihypoxic effects were dose-dependent. The results indicated that the extracts have a protective effect against hypoxia induced lethality in mice. The extracts showed antioxidant activity in some models. IC50 for DPPH radical-scavenging activity was 234 ± 8.9 μg ml-1. The extracts showed weak nitric oxide-scavenging activity between 0.1 and 1.6 mg ml-1. The extracts showed weak Fe2+ chelating ability. IC50 were 150 ± 13 μg ml-1. The extracts also exhibited low antioxidant activity in the linoleic acid model but were capable of scavenging hydrogen peroxide in a concentration dependent manner. The total amount of phenolic compounds in each extract was determined as gallic acid equivalents and total flavonoid contents were calculated as quercetin equivalents from a calibration curve. Pharmacological effects may be attributed, at least in part, to the presence of phenols and flavonoids in the extracts.La actividad antihipóxica y antioxidante de semillas de Hibiscus esculentus fue investigada empleando ocho ensayos in vitro. La actividad antihipóxica fue investigada en dos modelos, uno de caracter hemínico y otro circulatorio. Los efectos fueron pronunciados en ambos modelos de hipoxia. Los efectos antihipóxicos fueron dependientes de la dosis. Los resultados indican que los extractos tienen un efecto protector contra la letabilidad inducida por hipoxia en ratones. Los extractos mostraron actividad antioxidante en algunos modelos. El IC50 para la actividad captadora de radicales fue 234 ± 8.9 μg ml-1. Los extractos muestran una débil actividad captadora de óxido nítrico comprendida entre 0.1 y 1.6 mg ml-1. Los extractos muestran una débil capacidad quelatante de Fe2+. El IC
Rose hip (Rosa canina L: A functional food perspective
Directory of Open Access Journals (Sweden)
Cui Fan
2014-12-01
Full Text Available Rose hip (Rosa canina L. is the pseudo-fruit of the rose plant, which is widely known as a valuable source of polyphenols and vitamin C. Both in vivo and in vitro studies have demonstrated that this fruit exhibits anti-inflammatory, antioxidant, and antiobesogenic activities. The health benefits of Rose hip (RH have been attributed to its wide range of bioactive compounds including the anti-inflammatory galactolipid: (2S-1,2-di-O-[(9Z,12Z,15Z-octadeca-9,12,15-trienoyl]-3-O-β-D galactopyranosyl glycerol (GOPO, vitamin C, phenolics, lycopene, lutein, zeaxanthin, and other carotenoids. As cyclooxygenase inhibitors, RH compounds may reduce the risk of cancer, heart disease, and various inflammatory conditions. The aim of this review is to present an overview of the functional, medical, and physiological properties of RH.
Lifescience Database Archive (English)
Full Text Available KYEEWFIERAATGPNSLDTDIYIFR*nixqifnl*sinesi iswfxl*k*ymafrr*xsiks*kix Translated Amino Acid sequence (All Fram...es) Frame A: ---isikxnisnitcdgfd*ECEIQGNSTXFTVDYTAVYHVNSNPISKYYNRKVCIKSVP YGTYLSNNNGVIEMSEKLRKYEEWFIERAATGPNSLDTDIYIFR*nixqifnl*sines
Helsper, J.P.F.G.; Vos, de C.H.; Maas, F.M.; Jonker, H.H.; Broeck, van den H.C.; Jordi, W.; Pot, C.S.; Keizer, L.C.P.; Schapendonk, A.H.C.M.
2003-01-01
The effect of supplemental UV-A (320-400 nm) radiation on tissue absorption at 355 nm, levels of various antioxidants (ascorbate, glutathione, carotenoids and flavonoids) and of antioxidant scavenging capacity were investigated with leaves and petals of Rosa hybrida, cv. Honesty and with leaves,
Low-cost and miniaturized 100-Gb/s (2 × 50 Gb/s) PAM-4 TO-packaged ROSA for data center networks.
Kang, Sae-Kyoung; Huh, Joon Young; Lee, Jie Hyun; Lee, Joon Ki
2018-03-05
We design and implement a cost-effective and compact 100-Gb/s (2 × 50 Gb/s) PAM-4 receiver optical sub-assembly (ROSA) by using a TO-can package instead of an expensive box-type package. It consists of an optical demultiplexer, two PIN-PDs and a 2-channel linear transimpedance amplifier. The components are passively aligned and assembled using alignment marks engraved on each part. With a real-time PAM-4 DSP chip, we measured the back-to-back receiver sensitivities of the 100-Gb/s ROSA based on TO-56 to be less than -13.2 dBm for both channels at a bit error rate of 2.4e-4. The crosstalk penalty due to the adjacent channel interference was observed around 0.1 dB.
International Nuclear Information System (INIS)
1978-02-01
Results of the ROSA-II tests simulating a loss-of-coolant accident (LOCA) and effects of an emergency core cooling system (ECCS) in a pressurized water reactor (PWR) are presented including the test conditions and interpretations of the data in test runs 327,328,329 and 330. Each test was performed with large double-ended hot leg break and effect of the break area distribution (break diameter are 25.0 mm at one end and 37.5 mm at the other end of break) and of pump circulation upon coolant flow in the core were studied. The following are the results: In the case of a smaller break on the steam generator side, core cooling was achieved due to upward coolant flow in the core and early reflooding by ACC water injected into the cold leg. In the case of a smaller break area on the vessel side, on the other hand, coolant flow in the core was stagnant and the heater rods were mostly exposed to steam, so that core cooling was not as good. Effect of the coolant circulation by acting pump on the core cooling during a blowdown was not significant except that in a steam generator side small break the core cooling was improved. (auth.)
Cogni, R; Freitas, AVL
2002-01-01
Ant species visiting extrafloral nectaries (EFNs) of Hibiscus pernambucensis were studied in a daily flooded mangrove forest in Picinguaba, Southeast Brazil. Nineteen ant species in five subfamilies were observed visiting the EFNs. The most common species (in order of abundance) were Camponotus sp.2, Brachymyrmex sp. and Pseudomyrmex gracilis during the warm season and Brachymyrmex sp., Camponotus crassus and Camponotus sp.2 during the cold season. A twenty-four hour census showed that ant ac...