
Sample records for hhh hhh iii

  1. 40 CFR Appendix: Table 1 to... - List of Hazardous Air Pollutants (HAP) for Subpart HHH (United States)


    ... 40 Protection of Environment 11 2010-07-01 2010-07-01 true List of Hazardous Air Pollutants (HAP) for Subpart HHH Table Appendix: Table 1 to Subpart HHH of Part 63 Protection of Environment... HHH of Part 63—List of Hazardous Air Pollutants (HAP) for Subpart HHH CAS Number a Chemical name 75070...

  2. Diagnosis and high incidence of hyperornithinemia-hyperammonemia-homocitrullinemia (HHH) syndrome in northern Saskatchewan. (United States)

    Sokoro, AbdulRazaq A H; Lepage, Joyce; Antonishyn, Nick; McDonald, Ryan; Rockman-Greenberg, Cheryl; Irvine, James; Lehotay, Denis C


    Mutations in the SLC25A15 gene, encoding the human inner mitochondrial membrane ornithine transporter, are thought to be responsible for hyperornithinemia-hyperammonemia-homocitrullinemia (HHH) syndrome, a rare autosomal recessive condition. HHH syndrome has been detected in several small, isolated communities in northern Saskatchewan (SK). To determine the incidence of HHH syndrome in these communities, a PCR method was set up to detect F188Δ, the common French-Canadian mutation. Neonatal blood spots collected from all newborns from the high risk area were genotyped for the F188Δ mutation for seven consecutive years. Using DNA analysis, we estimated that the heterozygote frequency for the mutant allele for HHH syndrome to be about 1 in 19 individuals, predicting one affected child with HHH syndrome for approximately every 1,500 individuals (1 in 1,550 live births; 1 child every 12 years) in this isolated population. The frequency for the mutant allele for HHH syndrome in this isolated community is probably the highest in the world for this rare disorder. We determined that ornithine levels, by tandem mass spectrometry, were not abnormal in newborns with F188Δ mutation, carriers and normals. Ornithine rises to abnormally high levels at some time after birth well past the time that the newborn screening blood spot is collected. The timing or the reasons for the delayed rise of ornithine in affected children with HHH syndrome have not been determined. Newborn screening for HHH Syndrome in this high risk population is only possible by detection of the mutant allele using DNA analysis.

  3. Insights into the mutation-induced HHH syndrome from modeling human mitochondrial ornithine transporter-1.

    Directory of Open Access Journals (Sweden)

    Jing-Fang Wang

    Full Text Available Human mitochondrial ornithine transporter-1 is reported in coupling with the hyperornithinemia-hyperammonemia-homocitrullinuria (HHH syndrome, which is a rare autosomal recessive disorder. For in-depth understanding of the molecular mechanism of the disease, it is crucially important to acquire the 3D structure of human mitochondrial ornithine transporter-1. Since no such structure is available in the current protein structure database, we have developed it via computational approaches based on the recent NMR structure of human mitochondrial uncoupling protein (Berardi MJ, Chou JJ, et al. Nature 2011, 476:109-113. Subsequently, we docked the ligand L-ornithine into the computational structure to search for the favorable binding mode. It was observed that the binding interaction for the most favorable binding mode is featured by six remarkable hydrogen bonds between the receptor and ligand, and that the most favorable binding mode shared the same ligand-binding site with most of the homologous mitochondrial carriers from different organisms, implying that the ligand-binding sites are quite conservative in the mitochondrial carriers family although their sequences similarity is very low with 20% or so. Moreover, according to our structural analysis, the relationship between the disease-causing mutations of human mitochondrial ornithine transporter-1 and the HHH syndrome can be classified into the following three categories: (i the mutation occurs in the pseudo-repeat regions so as to change the region of the protein closer to the mitochondrial matrix; (ii the mutation is directly affecting the substrate binding pocket so as to reduce the substrate binding affinity; (iii the mutation is located in the structural region closer to the intermembrane space that can significantly break the salt bridge networks of the protein. These findings may provide useful insights for in-depth understanding of the molecular mechanism of the HHH syndrome and

  4. Structure-guided mutational analysis of the OB, HhH, and BRCT domains of Escherichia coli DNA ligase. (United States)

    Wang, Li Kai; Nair, Pravin A; Shuman, Stewart


    NAD(+)-dependent DNA ligases (LigAs) are ubiquitous in bacteria and essential for growth. LigA enzymes have a modular structure in which a central catalytic core composed of nucleotidyltransferase and oligonucleotide-binding (OB) domains is linked via a tetracysteine zinc finger to distal helix-hairpin-helix (HhH) and BRCT (BRCA1-like C-terminal) domains. The OB and HhH domains contribute prominently to the protein clamp formed by LigA around nicked duplex DNA. Here we conducted a structure-function analysis of the OB and HhH domains of Escherichia coli LigA by alanine scanning and conservative substitutions, entailing 43 mutations at 22 amino acids. We thereby identified essential functional groups in the OB domain that engage the DNA phosphodiester backbone flanking the nick (Arg(333)); penetrate the minor grove and distort the nick (Val(383) and Ile(384)); or stabilize the OB fold (Arg(379)). The essential constituents of the HhH domain include: four glycines (Gly(455), Gly(489), Gly(521), Gly(553)), which bind the phosphate backbone across the minor groove at the outer margins of the LigA-DNA interface; Arg(487), which penetrates the minor groove at the outer margin on the 3 (R)-OH side of the nick; and Arg(446), which promotes protein clamp formation via contacts to the nucleotidyltransferase domain. We find that the BRCT domain is required in its entirety for effective nick sealing and AMP-dependent supercoil relaxation.

  5. Summary of CARE-HHH Mini-Workshop on LHC Crab Cavity Validation, 21 August 2008

    CERN Document Server

    Calaga, R; Garoby, R; Linnecar, T; Tomás, R; Zimmermann, F; CERN. Geneva. BE Department


    A global LHC crab-cavity collaboration is rapidly advancing the R&D of a complete crab cavity cryomodule and performing the associated beam dynamics simulations compatible with a prototype test in the phase 0/I upgrade with the aim of establishing a full crab crossing scheme for the phase II upgrade of the LHC. A one day CARE-HHH mini-workshop was held on August 21, 2008 at CERN to discuss crab crossing in the LHC phase 0/I & II upgrades and this reports summarizes the activities of the four sessions that took place during the workshop. The goals of this crab-cavity workshop were fourfold: (1) to discuss prospects of crab cavities in LHC upgrades (2) to review the status of the cryomodule development and beam dynamics, (3) to establish validity requirements for LHC crab cavities which need to be demonstrated prior to their installation into the LHC, and (4) to provide guidance & coordination for the global collaborators.

  6. CARE-HHH-APD Workshop on Finalizing the Roadmap for the Upgrade of the CERN and GSI Accelerator Complex

    CERN Document Server

    Zimmermann, Frank; BEAM'07; BEAM 2007; Finalizing the Roadmap for the Upgrade of the LHC and GSI Accelerator Complex


    This report contains the Proceedings of the CARE-HHH-APD Event BEAM’07, “Finalizing the Roadmap for the Upgrade of the CERN & GSI Accelerator Complex,” which was held at CERN in Geneva, Switzerland, from 1 to 5 October 2007. BEAM’07 was primarily devoted to beam dynamics limitations for the two, or three, alternative baseline scenarios of the LHC luminosity upgrade and to critical design choices for the upgrade of the LHC injector complex at CERN and for the FAIR complex at GSI. It comprised five parts: (1) a Mini-Workshop on LHC+ Beam Performance, (2) a CERN-GSI Meeting on Collective Effects, (3) the Francesco Ruggiero Memorial Symposium, (4) a Mini-Workshop on the LHC Injectors Upgrade, and (5) the BEAM’07 Summaries. Topics addressed in the first mini-workshop of BEAM’07 ranged from the luminosity performance reach of the upgraded LHC in different scenarios, over the generation and stability of the future LHC beams, the turnaround time, beam–beam effects, luminosity levelling methods, and ...

  7. Joint CARE-ELAN, CARE-HHH-APD, and EUROTEV-WP3 Workshop on Electron Cloud Clearing

    CERN Document Server

    Scandale, Walter; Schulte, D; Zimmermann, F; Electron Cloud Effects and Technological Consequences; ECL2


    This report contains the Proceedings of the joint CARE-HHH-APD, CARE-ELAN, and EUROTEV-WP3 Mini-Workshop on 'Electron Cloud Clearing - Electron Cloud and Technical Consequences', "ECL2", held at CERN in Geneva, Switzerland, 1-2 March 2007). The ECL2 workshop explored novel technological remedies against electron-cloud formation in an accelerator beam pipe. A primary motivation for the workshop was the expected harmful electron-cloud effects in the upgraded LHC injectors and in future linear colliders, as well as recent beam observations in operating facilities like ANKA, CESR, KEKB, RHIC, and SPS. The solutions discussed at ECL2 included enamel-based clearing electrodes, slotted vacuum chambers, NEG coating, and grooves. Several of the proposed cures were assessed in terms of their clearing efficiency and the associated beam impedance. The workshop also reviewed new simulation tools like the 3D electron-ion build-up 'Faktor', modeling assumptions, analytical calculations, beam experiments, and laboratory meas...

  8. Evidence of CP violation in B -> hhh charmless decays

    CERN Multimedia

    CERN. Geneva


    We present the first evidence of CP violation in the B+→ pi+pi-pi+,  B+→ K+pi+pi-, B+→ K+K-pi+ and B+→K+K-K+ decays using the 1.0 fb-1 of data collected by the LHCb experiment during 2011. The results show that the 3pi and Kpipi channels present a positive asymmetry while the KKpi and KKK modes present a negative asymmetry. We also study the variation of the CP violation effects in the phase space of each three-body decay.  We find significant inhomogeneities that reveal regions with particularly large asymmetries in the pipi and KK low mass regions in B+→pi+pi-pi+ and B+→K+K-pi+ respectively.

  9. Improved measurements of the two-body decays B → hh(h = K, π)

    International Nuclear Information System (INIS)

    Mohanty, Gagan


    We report improved measurements of the branching fractions and CP violation asymmetries for B → Kπ,ππ and K K decays based on the final data sample 772 million BB pairs collected with the Belle detector. We set a 90% confidence-level upper limit for B 0 →K + K; all other decays are observed with branching fraction ranging from 10 6 to 10 5

  10. Summy of the working groupI of the care HHH LUMI-2005 workshop

    CERN Document Server

    Brüning, Oliver Sim


    The working group I of the LUMI-2005 workshop was asked to put together a catalogue of basic design options for the IR solutions for an LHC-upgrade. The goal of the working group was to discuss the different solutions with respect to the maximum beta-functions inside the first focusing quadrupole magnets and the resulting required quadrupole apertures the chromatic aberrations on the one hand and the implications for the magnet technology on the other hand. Such a comparison requires a wide range of input data ranging from the expected loss patterns at the magnetic elements and the resulting peak and average heat deposition to the obtainable peak magnetic field and quench limits for different magnet design options and the correct ability of the chromatic aberrations for a given optics design. Given the wide spectrum of relevant input data the working group could not yet prepare a final ranking of the various design options. Rather the working group succeeded in fixing some of the key boundary conditions in or...

  11. Study of CP violation in the B0 → h+h-(h = π, K) decay by the BaBar detector at SLAC

    International Nuclear Information System (INIS)

    Pivk, Muriel


    The absence of antimatter in the universe imposes the study of the CP symmetry violation. This phenomenon first uncovered in the K meson systems has been recently evidenced in the B meson systems. The B factories PEP-II and KEK-B produce e + e - in the Υ(4S) resonance, which undergoes a decay into charged or neutral BB-bar pairs. Evidencing the CP violation requires a measurement of the difference between the B meson decays towards a precise final state and the B-bar meson decay, i.e. of the CP conjugate antiparticle of B. The work described in this thesis has been carried out since January 2001 with the detector BABAR. Namely, the subject matter of the thesis was the study of the neutral B meson decay into two charmless bodies in the final state B 0 /B 0 -bar → h + h - (h = π, K). Since events in these channels are extremely rare a major task of the analysis is to lower the background as much as possible. The decays allow studying the CP violation namely, through the α angle of the unitarity triangle describing the CP violation in the Standard Model. This new information added to the β angle and to other CKM matrix parameters, already measured, permits strengthening the constraints on the Standard Model parameters. This thesis is structured in three parts. The first one deals with the theory. First it presents a general description of the weak interaction within in the frame of the Standard Model, as well as a description of the B 0 /B 0 -bar system. The second chapter presents the B 0 → π + π - decay which is indeed the core of this thesis. Four theoretical models studied for the interpretation of the results are also described. The second part is devoted to the experimental setup. The PEP-II collider and the BABAR detector are described thoroughly to comprehend the key points of the analysis. The third part presents details of the analysis of experimental results from the data acquisition up to extraction of measurement magnitudes. The chapter four gives a general outlook of the analysis particularly of the event selection. The fundamental variables are here defined and exposed is the principle of the likelihood method used for extraction of the information in the last stage of the analysis. The chapter five is devoted to the fight against the background. The following chapter presents the adjustment made to shape the final stage of analysis which allows extraction of the branching ratios and parameters which measure the CP violation. Finally, the last chapter deals with the interpretation of the results in terms of constraints on parameters of CKM matrix of the Standard Model. Also, the results of Belle experiment are discussed. In conclusion, the following values were obtained for the branching ratios: B(B 0 → π + π - ) = 4.7 ± 0.6 ± 0.2 10 -6 ; B(B 0 → K + π - ) = 17.9 ± 0.9 ± 0.7 10 -6 ; B(B 0 → K + K - ) -6 (90%). These values are in good agreement with the data previously published but they have a higher precision. In the last case only an upper limit is given because the signal is as expected very low. The results for the parameters measuring the CP violation are: A Kπ = - 0.10 ± 0.05 ± 0.02; S ππ = 0.02 ± 0.34 ± 0.05; C ππ = - 0.30 ± 0.25 ± 0.04. These three values are compatible with the absence of CP violation. The interpretation of these results show that is still difficult to constrain significantly the alpha angle with the current statistics and isospin symmetry which is the only solid theoretical frame. Hopefully, the statistics of BABAR will increase till 2006 by a factor of five and the B 0 → π 0 π 0 ) decay branching will be measured sufficiently accurately to allow reaching the α angle. To get stronger constraints the theoretical models should be further elaborated and experimentally checked

  12. Deconstructing the mammal species richness pattern in Europe - towards and understanding of the relative importance of climate, biogeographic history, habitat heterogeneity and humans

    DEFF Research Database (Denmark)

    Fløjgaard, Camilla; Normand, Signe; Skov, Flemming


    partitioning to assess the importance of macroclimate and HHH variables. The HHH variables included two historical factors, estimated by novel methodologies: (1) ice-age-driven dynamics, represented by accessibility to recolonization from hindcasting-estimated glacial refugia, and (2) biogeographic peninsular...

  13. Data of evolutionary structure change: 1A5CB-2QUUC [Confc[Archive

    Lifescience Database Archive (English)


  14. Data of evolutionary structure change: 1ACLA-1LPOA [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available entryIDChain>1ACLA DEQFP-GFSGS > - HHH...O A 1LPOA PEGTYEENLPK ...> HHH> ATOM 474 CA PRO A 65 69.013 60.208 -6.968 1...Chain>A 1LPOA GSASD--KLACL re> --HHHHH...CLA NLNSDEELIHCL > HHHHHHHH

  15. Data of evolutionary structure change: 1EP8B-1FAAA [Confc[Archive

    Lifescience Database Archive (English)


  16. Dicty_cDB: AFH258 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 6. 2 Translated Amino Acid sequence gllxskinikqi*k*kcqvvemvvii*kilaiilkkllfnhqkkqlql*ynkilmilk...vrqfqs*wvlinckl*iqsmvgfhqrcnkqimilkscllvf ywvplmhl*fgkvqerpq*fvdslkihfgvnkiisssirhqaqvmnisplsil*nlvipm vqyws...*nkkkl* Frame B: gllxskinikqi*k*kcqvvemvvii*kilaiilkkllfnhqkkqlql*ynkilmilkq* hhh*SQNPLVAVLVKINHHHHHHVVVVVIK

  17. The Use of Dexamethasone in Support of High-Altitude Ground Operations and Physical Performance: Review of the Literature (United States)


    rates vary dramatically, the physiological effect of hypobaric high-altitude hypoxia (HHH) is ubiquitous.1,2 Symptoms of less severe cases of HHH...staff member on a quarterly basis at the UHM Fellowship Program and Multiplace Hyperbaric Chamber Wilford Hall San Anto- nio MHS, Texas. Initially...oc- cupational, and undersea hyperbaric medicine. Lt Col (Ret) Wright, PhD, CAsP, is a full-time faculty member at the USAF School of Aerospace

  18. Higgs boson pair production at the photon linear collider in the two Higgs doublet model

    International Nuclear Information System (INIS)

    Asakawa, Eri; Harada, Daisuke; Okada, Yasuhiro; Kanemura, Shinya; Tsumura, Koji


    We calculate the cross section of the lightest Higgs boson pair production at the Photon Linear Collider in the two Higgs doublet model. We focus on the scenario in which the lightest Higgs boson has the standard model like couplings to gauge bosons. We take into account the one-loop correction to the hhh coupling as well as additional one-loop diagrams due to charged bosons to the γγ → hh helicity amplitudes. We discuss the impact of these corrections on the hhh coupling measurement at the Photon Linear Collider. (author)

  19. Richard III

    DEFF Research Database (Denmark)

    Lauridsen, Palle Schantz


    Kort analyse af Shakespeares Richard III med fokus på, hvordan denne skurk fremstilles, så tilskuere (og læsere) langt henad vejen kan føle sympati med ham. Med paralleller til Netflix-serien "House of Cards"......Kort analyse af Shakespeares Richard III med fokus på, hvordan denne skurk fremstilles, så tilskuere (og læsere) langt henad vejen kan føle sympati med ham. Med paralleller til Netflix-serien "House of Cards"...


    International Nuclear Information System (INIS)

    Jordan, H.; Sack, C.


    This report gives a detailed description of the latest version of the PARDISEKO code, PARDISEKO III, with particular emphasis on the numerical and programming methods employed. The physical model and its relation to nuclear safety as well as a description and the results of confirming experiments are treated in detail in the Karlsruhe Nuclear Research Centre report KFK-1989. (orig.) [de

  1. Fermilab III

    International Nuclear Information System (INIS)



    The total ongoing plans for Fermilab are wrapped up in the Fermilab III scheme, centrepiece of which is the proposal for a new Main Injector. The Laboratory has been awarded a $200,000 Illinois grant which will be used to initiate environmental assessment and engineering design of the Main Injector, while a state review panel recommended that the project should also benefit from $2 million of funding

  2. Fermilab III

    Energy Technology Data Exchange (ETDEWEB)



    The total ongoing plans for Fermilab are wrapped up in the Fermilab III scheme, centrepiece of which is the proposal for a new Main Injector. The Laboratory has been awarded a $200,000 Illinois grant which will be used to initiate environmental assessment and engineering design of the Main Injector, while a state review panel recommended that the project should also benefit from $2 million of funding.

  3. The Fanconi anemia associated protein FAAP24 uses two substrate specific binding surfaces for DNA recognition

    NARCIS (Netherlands)

    Wienk, H.L.J.; Slootweg, J.C.; Speerstra, S.; Kaptein, R.; Boelens, R.; Folkers, G.E.


    To maintain the integrity of the genome, multiple DNA repair systems exist to repair damaged DNA. Recognition of altered DNA, including bulky adducts, pyrimidine dimers and interstrand crosslinks (ICL), partially depends on proteins containing helix-hairpin-helix (HhH) domains. To understand how ICL

  4. Accelerator Physics Code Web Repository

    CERN Document Server

    Zimmermann, Frank; Bellodi, G; Benedetto, E; Dorda, U; Giovannozzi, Massimo; Papaphilippou, Y; Pieloni, T; Ruggiero, F; Rumolo, G; Schmidt, F; Todesco, E; Zotter, Bruno W; Payet, J; Bartolini, R; Farvacque, L; Sen, T; Chin, Y H; Ohmi, K; Oide, K; Furman, M; Qiang, J; Sabbi, G L; Seidl, P A; Vay, J L; Friedman, A; Grote, D P; Cousineau, S M; Danilov, V; Holmes, J A; Shishlo, A; Kim, E S; Cai, Y; Pivi, M; Kaltchev, D I; Abell, D T; Katsouleas, Thomas C; Boine-Frankenheim, O; Franchetti, G; Hofmann, I; Machida, S; Wei, J


    In the framework of the CARE HHH European Network, we have developed a web-based dynamic acceleratorphysics code repository. We describe the design, structure and contents of this repository, illustrate its usage, and discuss our future plans, with emphasis on code benchmarking.

  5. Solution structure and DNA-binding properties of the C-terminal domain of UvrC from E.coli

    NARCIS (Netherlands)

    Singh, S.; Folkers, G.E.; Bonvin, A.M.J.J.; Boelens, R.; Wechselberger, R.W.; Niztayev, A.; Kaptein, R.


    The C-terminal domain of the UvrC protein (UvrC CTD) is essential for 5' incision in the prokaryotic nucleotide excision repair process. We have determined the three-dimensional structure of the UvrC CTD using heteronuclear NMR techniques. The structure shows two helix±hairpin±helix (HhH) motifs

  6. Data of evolutionary structure change: 1VL8A-2UVDE [Confc[Archive

    Lifescience Database Archive (English)


  7. Data of evolutionary structure change: 1A5CB-2QUTC [Confc[Archive

    Lifescience Database Archive (English)


  8. Data of evolutionary structure change: 1CG5A-2QU0C [Confc[Archive

    Lifescience Database Archive (English)


  9. Data of evolutionary structure change: 1CG8A-2QU0A [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available /pdbChain> 2QU0A ence>YFPHF-DLSHGence> G - 0 A A VLSSQNKKAIEELGNLIKANAEAWGADALARLFELHPQT...hain> 1CG8 A 1CG8A ence>VNLQA-FTPVT...ine>THR CA 278 2QU0 A 2QU...0A ence>CHLPNDFTPAV HH HHHH HHH

  10. Data of evolutionary structure change: 1A5CB-2QUVA [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available n14> 2QUV A 2QUVA ...V A 2QUVA ... 2QUVA LKIGE--HTPSAence> E -- H...1A5CB-2QUVA 1A5C 2QUV B A ------LPADVAEELATTAQKLVQAGKGILAADESTQTI... 1A5CB ence>LFGTK-GLGKFence> HHH -

  11. Data of evolutionary structure change: 2QU0A-2DXMB [Confc[Archive

    Lifescience Database Archive (English)


  12. Data of evolutionary structure change: 1A5CB-2QUTA [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 4> 2QUT A 2QUTA ...yChain> 2QUT A 2QUTA ...hain>A 2QUTA ence>LKIGE--HTPSAence> ...1A5CB-2QUTA 1A5C 2QUT B A ------LPADVAEELATTAQKLVQAGKGILAADESTQTI...entryIDChain>1A5CB ence>LFGTK-GLGKFence> HHH -

  13. Data of evolutionary structure change: 1BYPA-1FA4A [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available dbChain>A 1BYPA SVTLT---EKGTY cture...>EEEE --- EEE> ATOM 522 CA SER A ...n> STTFPADAPAGEY ucture>EE ture...ucture> -- cture> ATOM 860 CA LYS A 57 7.87...yIDChain> TKISMPEEDLLN >HHH >

  14. Safety of Mixed Model Access Control in a Multilevel System (United States)


    42  H.  FIREWALL AND IPS LANGUAGES...Research Laboratory AIS automated information system ANOA advance notice of arrival APT advanced persistent threat BFM boundary flow modeling...of Investigation FW firewall GENSER general service xvi GUI graphical user interface HAG high-assurance guard HGS high-grade service H-H-H High

  15. Data of evolutionary structure change: 1PVDA-2VBIA [Confc[Archive

    Lifescience Database Archive (English)


  16. Data of evolutionary structure change: 1PVDA-2VBIG [Confc[Archive

    Lifescience Database Archive (English)



    Energy Technology Data Exchange (ETDEWEB)

    WEI, J.


    In the framework of the CARE HHH European Network, we have developed a web-based dynamic accelerator-physics code repository. We describe the design, structure and contents of this repository, illustrate its usage, and discuss our future plans, with emphasis on code benchmarking.

  18. Data of evolutionary structure change: 1EWOA-5PADA [Confc[Archive

    Lifescience Database Archive (English)


  19. Antithrombin III blood test (United States)

    ... Antithrombin III blood test To use the sharing features on this page, ... a protein that helps control blood clotting. A blood test can determine the amount of AT III present ...

  20. A CSMP Commutation Model for Design Study of a Brushless DC Motor Power Conditioner for a Cruise Missile Fin Control Actuator. (United States)


    miU PICJ 4- 00 OH ~0HH tiiI~ H L10 iP. iiiiUiiIIL’ Of 04 c HHHHHH go) 0000 MM3M M M HHII 1:0P 000000 01011 k-4 -4 000 ..44muWNWmu-4MU HHHHH H...14343(. HL4OH Qu).. "-(UI ) 06-40 k-iHU2(./24HUHw HHHHHHQ 71 H NO %0 00HNN 004H Hw* *4 HAQ* -4- 04W34 0104 c FIH EM *Ln2M N rz + 8 -14 Im HHHHHH ...HHH U) * * 02TC4 r4 A 4r1my (𔃾(N1 01010 wM1 ; -0w= .4 mm W004r rzl p HHHHHH P 110 pw Mm22 01 + + 0193 CDJ~ D CD 04 C00000 Q HHH -H" 0 00+0 Z: 010’ )CaM

  1. A Comparison between the Rhesus Monkey and the Human on the Effect of Atropine on the Electroencephalogram. Volume 2. Preliminary Statistical Analysis of Spectral EEG Waveforms in Rhesus Monkeys Exposed to Atropine. (United States)


    000000 000000 000000 000000 000000 C) H rHI HHHH HHHHH - rIr- - rIr H HHHHH 1 1 l H HHHHH- rIr- -I ri - HHHHHH H E-1~~ o~o ~ N H W~r ~ ~ W~MqU) co ýH H aiI...NMlCMMH’DHOO I-NNNMNIr- I- NNNNOnMH U) toH H H z. 000000000 000000000 Cl) H HHHHHH HHHHHHqHHH H- E-4 N MWr-N H Mr- N wMn0~r-oMMN Wl MNHOMM0O’ ro m olq~w H...ý C4k 44 4 ýL 4C 00000 HHH.-4 1- HH H HHHH HHHH U) /u) co* o nvr r-IO NOHM H0(-if0 m i c4 HooD- 00 Z 0000 000000000 00000 VI) H HHHHHH HHHHH HHHH 1

  2. Higgs Pair Production in the $H(\\rightarrow \\tau\\tau)H(\\rightarrow b\\bar{b})$ channel at the High-Luminosity LHC

    CERN Document Server

    The ATLAS collaboration


    Prospects studies are presented for the observation of double Higgs production in the channel $H(\\rightarrow b \\overline{b})H(\\rightarrow \\tau \\tau)$ for a total integrated luminosity of 3000~fb$ ^{-1}$ of $\\sqrt{s}=$14~TeV proton-proton collisions at the HL-LHC. A cut-based analysis strategy using MC data and a parametrisation of the ATLAS detector provide assessment to the measurement prospects performed under different assumptions for the trilinear Higgs couplings values. Assuming SM background and SM signal, we expect to set an upper limit of the cross section for the di-Higgs production of $4.3 \\times \\sigma(HH \\rightarrow b\\bar{b}\\tau^+\\tau^-)$ at 95\\% Confidence Level. Using an effective Lagrangian for the Higgs potential, and allowing its trilinear coupling to vary, we can project an exclusion of $\\lambda_{HHH}/\\lambda_{SM} \\leq -4$ and $\\lambda_{HHH}/\\lambda_{SM} \\geq 12$.

  3. Coronary Arteries Segmentation Based on the 3D Discrete Wavelet Transform and 3D Neutrosophic Transform


    Shuo-Tsung Chen; Tzung-Dau Wang; Wen-Jeng Lee; Tsai-Wei Huang; Pei-Kai Hung; Cheng-Yu Wei; Chung-Ming Chen; Woon-Man Kung


    Purpose. Most applications in the field of medical image processing require precise estimation. To improve the accuracy of segmentation, this study aimed to propose a novel segmentation method for coronary arteries to allow for the automatic and accurate detection of coronary pathologies. Methods. The proposed segmentation method included 2 parts. First, 3D region growing was applied to give the initial segmentation of coronary arteries. Next, the location of vessel information, HHH subband c...

  4. Development of a Distributed Breach for the Conical Shock Tube. (United States)


    Ti - «<M’»<Mosm —vocvicocviosm —VO(VI cr»—vo •*— ro cvi ro • * m m is. vo N OO CO OS <c<c<c<c<r<c<coc<c<E<c«<c<c<coc<coi hht-HHI-1-Khhhl- hHhhHh

  5. Metallothionein (MT)-III

    DEFF Research Database (Denmark)

    Carrasco, J; Giralt, M; Molinero, A


    Metallothionein-III is a low molecular weight, heavy-metal binding protein expressed mainly in the central nervous system. First identified as a growth inhibitory factor (GIF) of rat cortical neurons in vitro, it has subsequently been shown to be a member of the metallothionein (MT) gene family...... injected rats. The specificity of the antibody was also demonstrated in immunocytochemical studies by the elimination of the immunostaining by preincubation of the antibody with brain (but not liver) extracts, and by the results obtained in MT-III null mice. The antibody was used to characterize...... the putative differences between the rat brain MT isoforms, namely MT-I+II and MT-III, in the freeze lesion model of brain damage, and for developing an ELISA for MT-III suitable for brain samples. In the normal rat brain, MT-III was mostly present primarily in astrocytes. However, lectin staining indicated...

  6. NNDSS - Table III. Tuberculosis (United States)

    U.S. Department of Health & Human Services — NNDSS - Table III. Tuberculosis - 2018.This Table includes total number of cases reported in the United States, by region and by states, in accordance with the...

  7. NNDSS - Table III. Tuberculosis (United States)

    U.S. Department of Health & Human Services — NNDSS - Table III. Tuberculosis - 2017.This Table includes total number of cases reported in the United States, by region and by states, in accordance with the...

  8. Workshop 96. Part III

    Energy Technology Data Exchange (ETDEWEB)



    Part III of the proceedings contain 155 contributions in various fields of science and technology including nuclear engineering, environmental science, and biomedical engineering. Out of these, 10 were selected to be inputted in INIS. (P.A.).

  9. Workshop 96. Part III

    International Nuclear Information System (INIS)


    Part III of the proceedings contain 155 contributions in various fields of science and technology including nuclear engineering, environmental science, and biomedical engineering. Out of these, 10 were selected to be inputted in INIS. (P.A.)

  10. Fusion Power Demonstration III

    International Nuclear Information System (INIS)

    Lee, J.D.


    This is the third in the series of reports covering the Fusion Power Demonstration (FPD) design study. This volume considers the FPD-III configuration that incorporates an octopole end plug. As compared with the quadrupole end-plugged designs of FPD-I and FPD-II, this octopole configuration reduces the number of end cell magnets and shortens the minimum ignition length of the central cell. The end-cell plasma length is also reduced, which in turn reduces the size and cost of the end cell magnets and shielding. As a contiuation in the series of documents covering the FPD, this report does not stand alone as a design description of FPD-III. Design details of FPD-III subsystems that do not differ significantly from those of the FPD-II configuration are not duplicated in this report

  11. III-V microelectronics

    CERN Document Server

    Nougier, JP


    As is well known, Silicon widely dominates the market of semiconductor devices and circuits, and in particular is well suited for Ultra Large Scale Integration processes. However, a number of III-V compound semiconductor devices and circuits have recently been built, and the contributions in this volume are devoted to those types of materials, which offer a number of interesting properties. Taking into account the great variety of problems encountered and of their mutual correlations when fabricating a circuit or even a device, most of the aspects of III-V microelectronics, from fundamental p

  12. Summary of Session III

    International Nuclear Information System (INIS)

    Furman, M.A.


    This is a summary of the talks presented in Session III ''Simulations of Electron-Cloud Build Up'' of the Mini-Workshop on Electron-Cloud Simulations for Proton and Positron Beams ECLOUD-02, held at CERN, 15-18 April 2002

  13. Cobalt(III) complex

    Indian Academy of Sciences (India)


    e, 40 µM complex, 10 hrs after dissolution, f, 40 µM complex, after irradiation dose 15 Gy. and H-atoms result in reduction of Co(III) to Co. (II). 6. It is interesting to see in complex containing multiple ligands what is the fate of electron adduct species formed by electron addition. Reduction to. Co(II) and intramolecular transfer ...

  14. Calculus III essentials

    CERN Document Server

    REA, Editors of


    REA's Essentials provide quick and easy access to critical information in a variety of different fields, ranging from the most basic to the most advanced. As its name implies, these concise, comprehensive study guides summarize the essentials of the field covered. Essentials are helpful when preparing for exams, doing homework and will remain a lasting reference source for students, teachers, and professionals. Calculus III includes vector analysis, real valued functions, partial differentiation, multiple integrations, vector fields, and infinite series.

  15. Pseudo Class III malocclusion

    Directory of Open Access Journals (Sweden)

    Fadia M. Al-Hummayani


    Full Text Available The treatment of deep anterior crossbite is technically challenging due to the difficulty of placing traditional brackets with fixed appliances. This case report represents a none traditional treatment modality to treat deep anterior crossbite in an adult pseudo class III malocclusion complicated by severely retruded, supraerupted upper and lower incisors. Treatment was carried out in 2 phases. Phase I treatment was performed by removable appliance “modified Hawley appliance with inverted labial bow,” some modifications were carried out to it to suit the presented case. Positive overbite and overjet was accomplished in one month, in this phase with minimal forces exerted on the lower incisors. Whereas, phase II treatment was performed with fixed appliances (braces to align teeth and have proper over bite and overjet and to close posterior open bite, this phase was accomplished within 11 month.

  16. Ammonium diphosphitoindate(III

    Directory of Open Access Journals (Sweden)

    Farida Hamchaoui


    Full Text Available The crystal structure of the title compound, NH4[In(HPO32], is built up from InIII cations (site symmetry 3m. adopting an octahedral environment and two different phosphite anions (each with site symmetry 3m. exhibiting a triangular–pyramidal geometry. Each InO6 octahedron shares its six apices with hydrogen phosphite groups. Reciprocally, each HPO3 group shares all its O atoms with three different metal cations, leading to [In(HPO32]− layers which propagate in the ab plane. The ammonium cation likewise has site symmetry 3m.. In the structure, the cations are located between the [In(HPO32]− layers of the host framework. The sheets are held together by hydrogen bonds formed between the NH4+ cations and the O atoms of the framework.

  17. Fast ejendom III

    DEFF Research Database (Denmark)

    Munk-Hansen, Carsten

    Bogen er det tredje bind af tre planlagte bind om fast ejendom: I Overdragelsen, II Bolighandlen og III Ejerbeføjelsen. Fremstillingens giver et grundigt overblik over centrale områder af en omfattende regulering af fast ejendom, med angivelse af litteratur, hvor læseren kan søge yderligere...... oplysning. En ejer af fast ejendom er på særdeles mange områder begrænset i sin råden sammenlignet med ejeren af et formuegode i almindelighed. Fremstillingen tager udgangspunkt i ejerens perspektiv (fremfor samfundets eller myndighedernes). Både den privatretlige og offentligretlige regulering behandles......, eksempelvis ejendomsdannelsen, servitutter, naboretten, hævd, zoneinddelingen, den fysiske planlægning, beskyttelse af natur, beskyttelse af kultur, forurening fra fast ejendom, erstatning for forurening, jordforurening, ekspropriation, byggeri og adgang til fast ejendom....

  18. Semiconducting III-V compounds

    CERN Document Server

    Hilsum, C; Henisch, Heinz R


    Semiconducting III-V Compounds deals with the properties of III-V compounds as a family of semiconducting crystals and relates these compounds to the monatomic semiconductors silicon and germanium. Emphasis is placed on physical processes that are peculiar to III-V compounds, particularly those that combine boron, aluminum, gallium, and indium with phosphorus, arsenic, and antimony (for example, indium antimonide, indium arsenide, gallium antimonide, and gallium arsenide).Comprised of eight chapters, this book begins with an assessment of the crystal structure and binding of III-V compounds, f

  19. Dark matter detection - III

    International Nuclear Information System (INIS)

    Zacek, Viktor


    The quest for the missing mass of the universe has become one of the big challenges of todays particle physics and cosmology. Astronomical observations show that only 1% of the matter of the Universe is luminous. Moreover there is now convincing evidence that 85% of all gravitationally observable matter in the Universe is of a new exotic kind, different from the 'ordinary' matter surrounding us. In a series of three lectures we discuss past, recent and future efforts made world- wide to detect and/or decipher the nature of Dark Matter. In Lecture I we review our present knowledge of the Dark Matter content of the Universe and how experimenters search for it's candidates; In Lecture II we discuss so-called 'direct detection' techniques which allow to search for scattering of galactic dark matter particles with detectors in deep-underground laboratories; we discuss the interpretation of experimental results and the challenges posed by different backgrounds; In Lecture III we take a look at the 'indirect detection' of the annihilation of dark matter candidates in astrophysical objects, such as our sun or the center of the Milky Way; In addition we will have a look at efforts to produce Dark Matter particles directly at accelerators and we shall close with a look at alternative nonparticle searches and future prospects. (author)

  20. Complexes of 4-chlorophenoxyacetates of Nd(III), Gd(III) and Ho(III)

    International Nuclear Information System (INIS)

    Ferenc, W.; Bernat, M; Gluchowska, H.W.; Sarzynski, J.


    The complexes of 4-chlorophenoxyacetates of Nd(III), Gd(III) and Ho(III) have been synthesized as polycrystalline hydrated solids, and characterized by elemental analysis, spectroscopy, magnetic studies and also by X-ray diffraction and thermogravimetric measurements. The analysed complexes have the following colours: violet for Nd(III), white for Gd(III) and cream for Ho(III) compounds. The carboxylate groups bind as bidentate chelating (Ho) or bridging ligands (Nd, Gd). On heating to 1173K in air the complexes decompose in several steps. At first, they dehydrate in one step to form anhydrous salts, that next decompose to the oxides of respective metals. The gaseous products of their thermal decomposition in nitrogen were also determined and the magnetic susceptibilities were measured over the temperature range of 76-303K and the magnetic moments were calculated. The results show that 4-chlorophenoxyacetates of Nd(III), Gd(III) and Ho(III) are high-spin complexes with weak ligand fields. The solubility value in water at 293K for analysed 4-chlorophenoxyacetates is in the order of 10 -4 mol/dm 3 . (author)

  1. PREFACE: Quantum Optics III (United States)

    Orszag, M.; Retamal, J. C.; Saavedra, C.; Wallentowitz, S.


    All the 50 years of conscious pondering did not bring me nearer to an answer to the question `what is light quanta?'. Nowadays, every rascal believes, he knows it, however, he is mistaken. (A Einstein, 1951 in a letter to M Besso) Quantum optics has played a key role in physics in the last several decades. On the other hand, in these early decades of the information age, the flow of information is becoming more and more central to our daily life. Thus, the related fields of quantum information theory as well as Bose-Einstein condensation have acquired tremendous importance in the last couple of decades. In Quantum Optics III, a fusion of these fields appears in a natural way. Quantum Optics III was held in Pucón, Chile, in 27-30 of November, 2006. This beautiful location in the south of Chile is near the lake Villarrica and below the snow covered volcano of the same name. This fantastic environment contributed to a relaxed atmosphere, suitable for informal discussion and for the students to have a chance to meet the key figures in the field. The previous Quantum Optics conferences took place in Santiago, Chile (Quantum Optics I, 2000) and Cozumel, Mexico (Quantum Optics II, 2004). About 115 participants from 19 countries attended and participated in the meeting to discuss a wide variety of topics such as quantum-information processing, experiments related to non-linear optics and squeezing, various aspects of entanglement including its sudden death, correlated twin-photon experiments, light storage, decoherence-free subspaces, Bose-Einstein condensation, discrete Wigner functions and many more. There was a strong Latin-American participation from Argentina, Brazil, Chile, Colombia, Peru, Uruguay, Venezuela and Mexico, as well as from Europe, USA, China, and Australia. New experimental and theoretical results were presented at the conference. In Latin-America a quiet revolution has taken place in the last twenty years. Several groups working in quantum optics and

  2. Basel III D: Swiss Finish to Basel III


    Christian M. McNamara; Natalia Tente; Andrew Metrick


    After the Basel Committee on Banking Supervision (BCBS) introduced the Basel III framework in 2010, individual countries confronted the question of how best to implement the framework given their unique circumstances. Switzerland, with a banking industry that is both heavily concentrated and very large relative to the size of its overall economy, faced a special challenge. It ultimately adopted what is sometimes referred to as the “Swiss Finish” to Basel III – enhanced requirements applicable...

  3. Outcome of tyrosinaemia type III. (United States)

    Ellaway, C J; Holme, E; Standing, S; Preece, M A; Green, A; Ploechl, E; Ugarte, M; Trefz, F K; Leonard, J V


    Tyrosinaemia type III is a rare disorder caused by a deficiency of 4-hydroxyphenylpyruvate dioxygenase, the second enzyme in the catabolic pathway of tyrosine. The majority of the nine previously reported patients have presented with neurological symptoms after the neonatal period, while others detected by neonatal screening have been asymptomatic. All have had normal liver and renal function and none has skin or eye abnormalities. A further four patients with tyrosinaemia type III are described. It is not clear whether a strict low tyrosine diet alters the natural history of tyrosinaemia type III, although there remains a suspicion that treatment may be important, at least in infancy.

  4. Thermodecomposition of lanthanides (III) and ytrium (III) glucoheptonates

    International Nuclear Information System (INIS)

    Giolito, J.


    The lanthanides (III) and yttrium (III) glucoheptonates as well the D-glucoheptono 1-4 lactone were studied using common analytical methods, elemental microanalysis of carbon and hydrogen, thermogravimetry and differential scanning calorimetry. These compounds were prepared from the reaction between the lanthanides (III) and yttrium (III) hydroxides and glucoheptonic acid aqueous solution obtained by means of the delta lactone hydrolysis of this acid. After stoichiometric reaction the compounds were precipitated by the addition of absolute ethanol, washed with the same solvent and dried in desiccator. Thermogravimetric the (TG) curves of the lanthanides glucoheptonates of the ceric group present thermal profiles with enough differences permitting an easy caracterization of each compound and the yttrium (III) glucoheptonate TG curve showed a great similarity with the erbium (III) compound TG curve. The differential scanning calometry (DSC) curves showed endothermic and exothermic peaks by their shape, height and position (temperature) permit an easy and rapid identification of each compound specially if DSC and TG curves were examined simultaneously. (author) [pt

  5. Transformational III-V Electronics

    KAUST Repository

    Nour, Maha A.


    Flexible electronics using III-V materials for nano-electronics with high electron mobility and optoelectronics with direct band gap are attractive for many applications. This thesis describes a complementary metal oxide semiconductor (CMOS

  6. Complexes of lanthanum(III), cerium(III), samarium(III) and dysprosium(III) with substituted piperidines

    Energy Technology Data Exchange (ETDEWEB)

    Manhas, B S; Trikha, A K; Singh, H; Chander, M


    Complexes of the general formulae M/sub 2/Cl/sub 6/(L)/sub 3/.C/sub 2/H/sub 5/OH and M/sub 2/(NO/sub 3/)/sub 6/(L)/sub 2/.CH/sub 3/OH have been synthesised by the reactions of chlorides and nitrates of La(III), Ce(III), Sm(III) and Dy(III) with 2-methylpiperidine, 3-methylpiperidine and 4-methylpiperidine. These complexes have been characterised on the basis of their elemental analysis, and IR and electronic reflectance spectra. IR spectral data indicate the presence of coordinated ethanol and methanol molecules and bidentate nitrate groups. Coordination numbers of the metal ions vary from 5 to 8. 19 refs.

  7. Celestine III and the North

    DEFF Research Database (Denmark)

    Nielsen, Torben Kjersgaard


    Artiklen gennemgår pave Cølestin IIIs forhold til de nordiske kongeriger i perioden 1191-1198. Artiklen viser, at paven, som i forskningen traditionelt år har stået i skyggen af sin berømte, energiske og især: yngre efterfølger, Innocens III, har været på forkant med udviklingen i de nordiske rig...

  8. Spectrophotometric and pH-Metric Studies of Ce(III, Dy(III, Gd(III,Yb(III and Pr(III Metal Complexes with Rifampicin

    Directory of Open Access Journals (Sweden)

    A. N. Sonar


    Full Text Available The metal-ligand and proton-ligand stability constant of Ce(III, Dy(III, Gd(III,Yb(III and Pr(III metals with substituted heterocyclic drug (Rifampicin were determined at various ionic strength by pH metric titration. NaClO4 was used to maintain ionic strength of solution. The results obtained were extrapolated to the zero ionic strength using an equation with one individual parameter. The thermodynamic stability constant of the complexes were also calculated. The formation of complexes has been studied by Job’s method. The results obtained were of stability constants by pH metric method is confirmed by Job’s method.

  9. The global quantum duality principle: theory, examples, and applications


    Gavarini, Fabio


    Let R be an integral domain, h non-zero in R such that R/hR is a field, and HA the category of torsionless (or flat) Hopf algebras over R. We call any H in HA "quantized function algebra" (=QFA), resp. "quantized (restricted) universal enveloping algebra" (=QrUEA), at h if H/hH is the function algebra of a connected Poisson group, resp. the (restricted, if R/hR has positive characteristic) universal enveloping algebra of a (restricted) Lie bialgebra. We establish an "inner" Galois' correspond...

  10. Quimera de ADN polimerasa del fago ϕ29


    Salas, Margarita; Vega, Miguel de; Lázaro, José M.; Blanco, Luis; Mencía, Mario


    Quimera de ADN polimerasa del fago 29. La presente invención se encuadra dentro del campo de la biotecnología. Específicamente, se refiere a una quimera de ADN polimerasa que comprende una región aminoterminal (N-terminal), que codifica para una ADN polimerasa del tipo 29, y una región carboxilo-terminal (C-terminal), que comprende, al menos, un dominio HhH, que se encuentran unidas mediante una secuencia aminoacídica conectora y a su uso para la replicación, amplifi...

  11. Making progress with PISC III

    International Nuclear Information System (INIS)

    Crutzen, S.; Nichols, R.; McDonald, N.


    The thirdphase of the Programme for the Inspection of Steel Components (PISC III) was begun in 1986 with the aim of assessing inspection capability and reliability for actual defects in full scale components under realistic nuclear power plant conditions. It is organized by the OECD Nuclear Energy Agency and the Ispra Joint Research Centre of the European Communities Commission. The objectives and status of each of the seven areas of PISC III are given. The areas are: real contaminated structures; full scale vessel tests; nozzles and dissimilar metal welds; austenitic steel testing; steam generator integrity testing; mathematical modelling of non-destructive examination; and human reliability studies. (U.K.)

  12. Graphics Gems III IBM version

    CERN Document Server

    Kirk, David


    This sequel to Graphics Gems (Academic Press, 1990), and Graphics Gems II (Academic Press, 1991) is a practical collection of computer graphics programming tools and techniques. Graphics Gems III contains a larger percentage of gems related to modeling and rendering, particularly lighting and shading. This new edition also covers image processing, numerical and programming techniques, modeling and transformations, 2D and 3D geometry and algorithms,ray tracing and radiosity, rendering, and more clever new tools and tricks for graphics programming. Volume III also includes a

  13. Organometallic neptunium(III) complexes. (United States)

    Dutkiewicz, Michał S; Farnaby, Joy H; Apostolidis, Christos; Colineau, Eric; Walter, Olaf; Magnani, Nicola; Gardiner, Michael G; Love, Jason B; Kaltsoyannis, Nikolas; Caciuffo, Roberto; Arnold, Polly L


    Studies of transuranic organometallic complexes provide a particularly valuable insight into covalent contributions to the metal-ligand bonding, in which the subtle differences between the transuranium actinide ions and their lighter lanthanide counterparts are of fundamental importance for the effective remediation of nuclear waste. Unlike the organometallic chemistry of uranium, which has focused strongly on U(III) and has seen some spectacular advances, that of the transuranics is significantly technically more challenging and has remained dormant. In the case of neptunium, it is limited mainly to Np(IV). Here we report the synthesis of three new Np(III) organometallic compounds and the characterization of their molecular and electronic structures. These studies suggest that Np(III) complexes could act as single-molecule magnets, and that the lower oxidation state of Np(II) is chemically accessible. In comparison with lanthanide analogues, significant d- and f-electron contributions to key Np(III) orbitals are observed, which shows that fundamental neptunium organometallic chemistry can provide new insights into the behaviour of f-elements.

  14. Ion temperatures in TORTUR III

    International Nuclear Information System (INIS)

    Hendriks, F.B.


    Spatially resolved ion-energy distributions are presented for discharges in the TORTUR III tokamak. The measurements are performed in an active method, using a neutral hydrogen probing beam of 20-30 keV, to enhance charge-exchange processes along its path, as well as by the usual passive method. Ion temperatures can amount up to 1 keV

  15. Synthesis and characterization of La(III), Pr(III), Nd(III), Sm(III), Eu(III), Gd(III), Tb(III) and Dy(III) complexes of 2-acetylfuran-2-thenoylhydrazone

    International Nuclear Information System (INIS)

    Singh, B.; Singh, Praveen K.


    The reaction of 2-acetylfuran-2-thenoylhydrazone(afth) with Ln(III) trichlorides yields complexes of the type [Ln(afth)Cl 2 (H 2 O)(EtOH)]Cl, [Ln(III) = La, Pr, Nd, Sm, Eu, Gd, Tb and Dy]. The complexes have been characterized by molar conductance, magnetic susceptibility and TGA and DTA measurements, magnetic susceptibility and TGA and DTA measurements, FAB mass, infrared, proton NMR, electronic absorption and emission spectra. The terbium complex is found to be monomer from the FAB mass spectrum. The IR and NMR spectra suggest neutral tridentate behaviour of the Schiff base. A coordination number seven is proposed around the metal ions. Emission spectra suggest C 3v , symmetry around the metal ion with capped octahedron geometry for the europium complex. (author)

  16. Sorption of trace amounts of gallium (III) on iron (III) oxide

    Energy Technology Data Exchange (ETDEWEB)

    Music, S; Gessner, M; Wolf, R H.H. [Institut Rudjer Boskovic, Zagreb (Yugoslavia)


    The sorption of trace amounts of gallium(III) on iron(III) oxide has been studied as a function of pH. Optimum conditions have been found for the preconcentration of traces of gallium(III) by iron(III) oxide. The influence of surface active substances and of complexing agents on the sorption of trace amounts of gallium(III) on iron(III) oxide has been also studied.

  17. Sorption of trace amounts of gallium (III) on iron (III) oxide

    International Nuclear Information System (INIS)

    Music, S.; Gessner, M.; Wolf, R.H.H.


    The sorption of trace amounts of gallium(III) on iron(III) oxide has been studied as a function of pH. Optimum conditions have been found for the preconcentration of traces of gallium(III) by iron(III) oxide. The influence of surface active substances and of complexing agents on the sorption of trace amounts of gallium(III) on iron(III) oxide has been also studied. (orig.) [de

  18. The Negotiation of Basel III

    DEFF Research Database (Denmark)

    Just, Sine Nørholm


    While the Basel Accords of 1988 and 2004 (Basel I and Basel II) ostensibly set out to regulate bank risk at the international level, they were effectively in the grip of neoliberal beliefs in the self-regulating potential of free markets. In 2009–2011, the Basel Accords were revised once more wit...... agency, the empirical argument is substantiated through textual–intertextual analysis of the rhetorical circulation of affective signs in the Basel III negotiations....

  19. Firebird-III program description

    International Nuclear Information System (INIS)

    Lin, M.R.; Prawirosochardjo, S.; Rennick, D.F.; Wessman, E.; Blain, R.J.D.; Wilson, J.M.


    The FIREBIRD-III digital computer program is a general network code developed primarily for predicting the thermalhydraulic behaviour of CANDU power reactors during a postulated loss-of-coolant accident and the subsequent emergency coolant injection. Because of its flexibility, the code can also be used to solve a large variety of general two-phase flow problems. This report describes the thermalhydraulic models and the computation methods used in the program

  20. Mechatronic systems and materials III

    CERN Document Server

    Gosiewski, Zdzislaw


    This very interesting volume is divided into 24 sections; each of which covers, in detail, one aspect of the subject-matter: I. Industrial robots; II. Microrobotics; III. Mobile robots; IV. Teleoperation, telerobotics, teleoperated semi-autonomous systems; V. Sensors and actuators in mechatronics; VI. Control of mechatronic systems; VII. Analysis of vibration and deformation; VIII. Optimization, optimal design; IX. Integrated diagnostics; X. Failure analysis; XI. Tribology in mechatronic systems; XII. Analysis of signals; XIII. Measurement techniques; XIV. Multifunctional and smart materials;

  1. Revised SNAP III Training Manual

    Energy Technology Data Exchange (ETDEWEB)

    Moss, Calvin Elroy [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Gonzales, Samuel M. [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Myers, William L. [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Nelson, Mark Andrew [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Rothrock, Richard Brian [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Salazar, Samuel A. [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Sorensen, Eric Byron [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Sundby, Gary M. [Los Alamos National Lab. (LANL), Los Alamos, NM (United States)


    The Shielded Neutron Assay Probe (SNAP) technique was developed to determine the leakage neutron source strength of a radioactive object. The original system consisted of an EberlineTM Mini-scaler and discrete neutron detector. The system was operated by obtaining the count rate with the EberlineTM instrument, determining the absolute efficiency from a graph, and calculating the neutron source strength by hand. In 2003 the SNAP III, shown in Figure 1, was designed and built. It required the operator to position the SNAP, and then measure the source-to-detector and detectorto- reflector distances. Next the operator entered the distance measurements and started the data acquisition. The SNAP acquired the required count rate and then calculated and displayed the leakage neutron source strength (NSS). The original design of the SNAP III is described in SNAP III Training Manual (ER-TRN-PLN-0258, Rev. 0, January 2004, prepared by William Baird) This report describes some changes that have been made to the SNAP III. One important change is the addition of a LEMO connector to provide neutron detection output pulses for input to the MC-15. This feature is useful in active interrogation with a neutron generator because the MC-15 has the capability to only record data when it is not gated off by a pulse from the neutron generator. This avoids recording of a lot of data during the generator pulses that are not useful. Another change was the replacement of the infrared RS-232 serial communication output by a similar output via a 4-pin LEMO connector. The current document includes a more complete explanation of how to estimate the amount of moderation around a neutron-emitting source.

  2. Titanium gettering in Doublet III

    International Nuclear Information System (INIS)

    de Grassie, J.S.; Callis, R.; Campbell, G.


    The application of mild titanium gettering in the Doublet III tokamak has led to a significant improvement in the obtainable operating regimes and discharge parameters for all of the many plasma cross-sectional shapes studied. With gettering, low-Z impurities and radiated power are greatly reduced. The maximum line averaged electron density has increased 50% (anti n/sub e max/ approx. 1 x 10 20 /m 3 ), corresponding to a Murakami coefficient of nearly 6

  3. Improving Minuteman III Maintenance Concepts (United States)


    the ground . Then figure out what your challenges are. We’ll have those” (Pappalardo, 2011). Another challenge facing the maintenance assets aged as indicated by the pattern ‘B’ shown in Figure 2. With the increase in the mechanization of processes, more attention has been...concepts could be applied to the sustainment of the MM III as well as benefit its planned replacement, the Ground Based Strategic Deterrent (GBDS

  4. French participation to PISC III

    International Nuclear Information System (INIS)

    Birac, C.


    The PISC III programme was set up in 1986 after the conclusions of the PISC II programme. The main objective was assessment of ISI procedures on few particular components or materials. France with IPSN, CEA/DTA, DCN INDRET, EDF, FRAMATOME and INTERCONTROLE decided to have an important participation in several of the eight actions. This paper describes shortly the key points of this participation and the consequences in France. (authors). 10 figs., 1 tab

  5. Basel III and Asset Securitization

    Directory of Open Access Journals (Sweden)

    M. Mpundu


    Full Text Available Asset securitization via special purpose entities involves the process of transforming assets into securities that are issued to investors. These investors hold the rights to payments supported by the cash flows from an asset pool held by the said entity. In this paper, we discuss the mechanism by which low- and high-quality entities securitize low- and high-quality assets, respectively, into collateralized debt obligations. During the 2007–2009 financial crisis, asset securitization was seriously inhibited. In response to this, for instance, new Basel III capital and liquidity regulations were introduced. Here, we find that we can explicitly determine the transaction costs related to low-quality asset securitization. Also, in the case of dynamic and static multipliers, the effects of unexpected negative shocks such as rating downgrades on asset price and input, debt obligation price and output, and profit will be quantified. In this case, we note that Basel III has been designed to provide countercyclical capital buffers to negate procyclicality. Moreover, we will develop an illustrative example of low-quality asset securitization for subprime mortgages. Furthermore, numerical examples to illustrate the key results will be provided. In addition, connections between Basel III and asset securitization will be highlighted.

  6. Organometallic neptunium(III) complexes (United States)

    Dutkiewicz, Michał S.; Farnaby, Joy H.; Apostolidis, Christos; Colineau, Eric; Walter, Olaf; Magnani, Nicola; Gardiner, Michael G.; Love, Jason B.; Kaltsoyannis, Nikolas; Caciuffo, Roberto; Arnold, Polly L.


    Studies of transuranic organometallic complexes provide a particularly valuable insight into covalent contributions to the metal-ligand bonding, in which the subtle differences between the transuranium actinide ions and their lighter lanthanide counterparts are of fundamental importance for the effective remediation of nuclear waste. Unlike the organometallic chemistry of uranium, which has focused strongly on UIII and has seen some spectacular advances, that of the transuranics is significantly technically more challenging and has remained dormant. In the case of neptunium, it is limited mainly to NpIV. Here we report the synthesis of three new NpIII organometallic compounds and the characterization of their molecular and electronic structures. These studies suggest that NpIII complexes could act as single-molecule magnets, and that the lower oxidation state of NpII is chemically accessible. In comparison with lanthanide analogues, significant d- and f-electron contributions to key NpIII orbitals are observed, which shows that fundamental neptunium organometallic chemistry can provide new insights into the behaviour of f-elements.

  7. Study of type III ELMs in JET

    NARCIS (Netherlands)

    Sartori, R.; Saibene, G.; Horton, L. D.; Becoulet, M.; Budny, R.; Borba, D.; Chankin, A.; Conway, G. D.; Cordey, G.; McDonald, D.; Guenther, K.; von Hellermann, M. G.; Igithkanov, Y.; Loarte, A.; Lomas, P. J.; Pogutse, O.; Rapp, J.


    This paper presents the results of JET experiments aimed at studying the operational space of plasmas with a Type III ELMy edge, in terms of both local and global plasma parameters. In JET, the Type III ELMy regime has a wide operational space in the pedestal n(e)-T-e diagram, and Type III ELMs are

  8. Sparkle/PM3 for the modeling of europium(III), gadolinium(III), and terbium(III) complexes

    International Nuclear Information System (INIS)

    Freire, Ricardo O.; Rocha, Gerd B.; Simas, Alfredo M.


    The Sparkle/PM3 model is extended to europium(III), gadolinium(III), and terbium(III) complexes. The validation procedure was carried out using only high quality crystallographic structures, for a total of ninety-six Eu(III) complexes, seventy Gd(III) complexes, and forty-two Tb(III) complexes. The Sparkle/PM3 unsigned mean error, for all interatomic distances between the trivalent lanthanide ion and the ligand atoms of the first sphere of coordination, is: 0.080 A for Eu(III); 0.063 A for Gd(III); and 0.070 A for Tb(III). These figures are similar to the Sparkle/AM1 ones of 0.082 A, 0.061 A, and 0.068 A respectively, indicating they are all comparable parameterizations. Moreover, their accuracy is similar to what can be obtained by present-day ab initio effective core potential full geometry optimization calculations on such lanthanide complexes. Finally, we report a preliminary attempt to show that Sparkle/PM3 geometry predictions are reliable. For one of the Eu(III) complexes, BAFZEO, we created hundreds of different input geometries by randomly varying the distances and angles of the ligands to the central Eu(III) ion, which were all subsequently fully optimized. A significant trend was unveiled, indicating that more accurate local minima geometries cluster at lower total energies, thus reinforcing the validity of sparkle model calculations. (author)

  9. Europium (III) and americium (III) stability constants with humic acid

    International Nuclear Information System (INIS)

    Torres, R.A.; Choppin, G.R.


    The stability constants for tracer concentrations of Eu(III) and Am(III) complexes with a humic acid extracted from a lake-bottom sediment were measured using a solvent extraction system. The organic extractant was di(2-ethylhexyl)-phosphoric acid in toluene while the humate aqueous phase had a constant ionic strength of 0.1 M (NaClO 4 ). Aqueous humic acid concentrations were monitored by measuring uv-visible absorbances at approx.= 380 nm. The total carboxylate capacity of the humic acid was determined by direct potentiometric titration to be 3.86 +- 0.03 meq/g. The humic acid displayed typical characteristics of a polyelectrolyte - the apparent pKsub(a), as well as the calculated metal ion stability constants increased as the degree of ionization (α) increased. The binding data required a fit of two stability constants, β 1 and β 2 , such that for Eu, log β 1 = 8.86 α + 4.39, log β 2 = 3.55 α + 11.06 while for Am, log β 1 = 10.58 α + 3.84, log β 2 = 5.32 α + 10.42. With hydroxide, carbonate, and humate as competing ligands, the humate complex associated with the β 1 constant is calculated to be the dominant species for the trivalent actinides and lanthanides under conditions present in natural waters. (orig.)

  10. Recent results for Mark III

    International Nuclear Information System (INIS)

    Brient, J.C.


    This paper presents recent results from the Mark III detector at SPEAR, in the open charm sector. The first topic discussed is the reanalysis of the direct measurement of the D hadronic branching fractions, where a detailed study has been made of the Cabibbo suppressed and multi-π 0 's D decays backgrounds in the double tag sample. Next, the Dalitz plot analysis of the D decays to Kππ is presented, leading to the relative fractions of three-body versus pseudoscalarvector decays. 7 refs., 5 figs

  11. Charm physics at BES III

    International Nuclear Information System (INIS)

    Wang Yifang


    Since the discovery of J/Ψ and the τ lepton in 70's, the study of τ-charm physics became very active: several dedicated e + e - colliders were built and tremendous progress were obtained. In this paper, the main reasoning,the content and the characteristics of the τ-charm physics study are discussed, together with the scientific motivations and the latest results of the recently completed upgrade of the Beijing Electron-Positron Collider (BEPC II) and the new Beijing Spectrometer (BES III). (authors)

  12. The Mark III vertex chamber

    International Nuclear Information System (INIS)

    Adler, J.; Bolton, T.; Bunnell, K.


    The design and construction of the new Mark III vertex chamber is described. Initial tests with cosmic rays prove the ability of track reconstruction and yield triplet resolutions below 50 μm at 3 atm using argon/ethane (50:50). Also performed are studies using a prototype of a pressurized wire vertex chamber with 8 mm diameter straw geometry. Spatial resolution of 35mm was obtained using dimethyl ether (DME) at 1 atm and 30 μm using argon/ethane (50/50 mixture) at 4 atm. Preliminary studies indicate the DME to adversely affect such materials as aluminized Mylar and Delrin

  13. Isothiocyanato complexes of Gd(III), Tb(III), Dy(III) and Ho(III) with 2-(2'-pyridyl)benzimidazole

    Energy Technology Data Exchange (ETDEWEB)

    Mishra, A; Singh, V K


    Six-coordinated complexes of the type (Ln(PyBzH)/sub 2/NCS.H/sub 2/O) (NCS)/sub 2/.nH/sub 2/O/mC/sub 2/H/sub 5/OH (Ln = Gd(III), Tb(III), Dy(III) and Ho(III), n=1-2; m=1) have been prepared from Ln(NCS)/sub 6//sup 3 -/. The room temperature magnetic moment values confirm the terpositive state of the lanthanide ions. Infrared spectra suggest the N-coordination of thiocyanate group. Electronic spectral studies of Tb(III), Dy(III) and Ho(III) complexes have been made in terms of LSJ term energies. 13 refs.

  14. Transformational III-V Electronics

    KAUST Repository

    Nour, Maha A.


    Flexible electronics using III-V materials for nano-electronics with high electron mobility and optoelectronics with direct band gap are attractive for many applications. This thesis describes a complementary metal oxide semiconductor (CMOS) compatible process for transforming traditional III-V materials based electronics into flexible one. The thesis reports releasing 200 nm of Gallium Arsenide (GaAs) from 200 nm GaAs / 300 nm Aluminum Arsenide (AlAs) stack on GaAs substrate using diluted hydrofluoric acid (HF). This process enables releasing a single top layer compared to peeling off all layers with small sizes at the same time. This is done utilizing a network of release holes that contributes to the better transparency (45 % at 724 nm wavelengths) observed. Fabrication of metal oxide semiconductor capacitor (MOSCAPs) on GaAs is followed by releasing it to have devices on flexible 200 nm GaAs. Similarly, flexible GaSb and InP fabrication process is also reported to transform traditional electronics into large-area flexible electronics.

  15. The neutral Higgs self-couplings in the (h)MSSM (United States)

    Chalons, G.; Djouadi, A.; Quevillon, J.


    We consider the Minimal Supersymmetric extension of the Standard Model in the regime where the supersymmetric breaking scale is extremely large. In this MSSM, not only the Higgs masses will be affected by large radiative corrections, the dominant part of which is provided by the third generation quark/squark sector, but also the various self-couplings among the Higgs states. In this note, assuming that squarks are extremely heavy, we evaluate the next-to-leading order radiative corrections to the two neutral CP-even Higgs self-couplings λHhh and λhhh and to the partial decay width Γ (H → hh) that are most relevant at the LHC. The calculation is performed using an effective field theory approach that resums the large logarithmic squark contributions and allows to keep under control the perturbative expansion. Since the direct loop vertex corrections are generally missing in this effective approach, we have properly renormalised the effective theory to take them into account. Finally, we perform a comparison of the results in this effective MSSM with those obtained in a much simpler way in the so-called hMSSM approach in which the mass value for the lightest Higgs boson Mh = 125 GeV is used as an input. We show that the hMSSM provides a reasonably good approximation of the corrected self-couplings and H → hh decay rate and, hence, it can be used also in these cases.

  16. Terminal Area Forecasts, FY 1993-2005 (United States)


    4 6 0 H -4 ~ M 0~) mo~io oo o o moo- ~ ~ 7~I~~ HHHHH HHHH H H HHHHHH H H C~6HHHHHHH- HHHH H H 0 I Iv En 6O 01~0 0 0HH H HH H H H0 HHHNHHHH 0H0H H H Ci...OD o IWWWn W 0no-D A % MMH NM ww H mo 1-4IHr- i14 4H - ’ H~~ H. HOHOHHH 444 HHH N H r, In~o- v v𔃺wr, - - C4~~4CC( C44Ce (4 C4C M4 C NMVMV NNNm HHHHHH ...HHHH H ei I ~ u~o- O~0H a)I 4 HHHHHH HHHH r-4 Nl H xmoHmm virewee o In HHnw Hwm0H HHH H HnW 0 H 0C4lHO 1HH H HM M M MMMMO 0 0 0 0 4HHHH-OHHHHHN N

  17. Cooperation between catalytic and DNA binding domains enhances thermostability and supports DNA synthesis at higher temperatures by thermostable DNA polymerases. (United States)

    Pavlov, Andrey R; Pavlova, Nadejda V; Kozyavkin, Sergei A; Slesarev, Alexei I


    We have previously introduced a general kinetic approach for comparative study of processivity, thermostability, and resistance to inhibitors of DNA polymerases [Pavlov, A. R., et al. (2002) Proc. Natl. Acad. Sci. U.S.A.99, 13510-13515]. The proposed method was successfully applied to characterize hybrid DNA polymerases created by fusing catalytic DNA polymerase domains with various sequence-nonspecific DNA binding domains. Here we use the developed kinetic analysis to assess basic parameters of DNA elongation by DNA polymerases and to further study the interdomain interactions in both previously constructed and new chimeric DNA polymerases. We show that connecting helix-hairpin-helix (HhH) domains to catalytic polymerase domains can increase thermostability, not only of DNA polymerases from extremely thermophilic species but also of the enzyme from a faculatative thermophilic bacterium Bacillus stearothermophilus. We also demonstrate that addition of Topo V HhH domains extends efficient DNA synthesis by chimerical polymerases up to 105 °C by maintaining processivity of DNA synthesis at high temperatures. We found that reversible high-temperature structural transitions in DNA polymerases decrease the rates of binding of these enzymes to the templates. Furthermore, activation energies and pre-exponential factors of the Arrhenius equation suggest that the mechanism of electrostatic enhancement of diffusion-controlled association plays a minor role in binding of templates to DNA polymerases.

  18. Cooperation between Catalytic and DNA-binding Domains Enhances Thermostability and Supports DNA Synthesis at Higher Temperatures by Thermostable DNA Polymerases (United States)

    Pavlov, Andrey R.; Pavlova, Nadejda V.; Kozyavkin, Sergei A.; Slesarev, Alexei I.


    We have previously introduced a general kinetic approach for comparative study of processivity, thermostability, and resistance to inhibitors of DNA polymerases (Pavlov et. al., (2002) Proc. Natl. Acad. Sci. USA 99, 13510–13515). The proposed method was successfully applied to characterize hybrid DNA polymerases created by fusing catalytic DNA polymerase domains with various non-specific DNA binding domains. Here we use the developed kinetic analysis to assess basic parameters of DNA elongation by DNA polymerases and to further study the interdomain interactions in both previously constructed and new chimeric DNA polymerases. We show that connecting Helix-hairpin-Helix (HhH) domains to catalytic polymerase domains can increase thermostability, not only of DNA polymerases from extremely thermophilic species, but also of the enzyme from a faculatative thermophilic bacterium Bacillus stearothermophilus. We also demonstrate that addition of TopoV HhH domains extends efficient DNA synthesis by chimerical polymerases up to 105°C by maintaining processivity of DNA synthesis at high temperatures. We also found that reversible high-temperature structural transitions in DNA polymerases decrease the rates of binding of these enzymes to the templates. Furthermore, activation energies and pre-exponential factors of the Arrhenius equation suggest that the mechanism of electrostatic enhancement of diffusion-controlled association plays a minor role in binding templates to DNA polymerases. PMID:22320201

  19. Changing man-land interrelations in China's farming area under urbanization and its implications for food security. (United States)

    Long, Hualou; Ge, Dazhuan; Zhang, Yingnan; Tu, Shuangshuang; Qu, Yi; Ma, Li


    The Huang-Huai-Hai Plain (HHH) is typical of China's farming area, and was predicted as one of the fastest growing areas of urbanization in the world. Since the turn of the new millennium, construction land and farmland transitions in this region driven by rapid urbanization have resulted in dramatic loss of farmland, which triggered a serious threat to regional even national food security. In this paper, the coupling relationships between per capita construction land transition (PCCT) and per capita farmland transition (PCFT) in the HHH and their implications for regional food security are analyzed. During 2000-2015, the farmland decreased by 8.59%, 72.25% of which were occupied by construction land. There are two major coupling types between PCCT and PCFT, one is the double increasing of per capita construction land area (PCCA) and per capita farmland area (PCFA); another is the increasing of PCCA and the decreasing of PCFA. The fluctuant increasing of PCCT and decreasing of PCFT coexisted and presented symmetrical coupling characteristics in space. Physical, location, transportation and socio-economic factors play significantly different roles in driving PCCT and PCFT. The implications for ensuring food security involve promoting the reclamation and redevelopment of inefficient and unused urban-rural construction land, reducing inefficient occupation of farmland resources, developing appropriate scale management of agriculture, and establishing a better social security system to smoothly settle down the floating rural population in the city. Copyright © 2017 Elsevier Ltd. All rights reserved.

  20. Formation constants of Sm(III), Dy(III), Gd(III), Pr(III) and Nd(III) complexes of tridentate schiff base, 2-[(1H-benzimidazol-2-yl-methylene) amino] phenol

    International Nuclear Information System (INIS)

    Omprakash, K.L.; Chandra Pal, A.V.; Reddy, M.L.N.


    A new tridentate schiff base, 2- (1H-benzimidazol-2-yl-methylene)amino phenol derived from benzimididazole-2-carbo-xaldehyde and 2-aminophenol has been synthesised and characterised by spectral and analytical data. Proton-ligand formation constants of the schiff base and metal-ligand formation constants of its complexes with Sm(III), Dy(III), Gd(III), Nd(III) and Pr(III) have been determined potentiometrically in 50% (v/v) aqueous dioxane at an ionic strength of 0.1M (NaClO 4 ) and at 25deg C using the Irving-Rossotti titration technique. The order of stability constants (logβ 2 ) is found to be Sm(III)>Dy(III)>Gd(III)>Pr(III)>Nd(III). (author)

  1. Formation constants of Sm(III), Dy(III), Gd(III), Pr(III) and Nd(III) complexes of tridentate schiff base, 2-((1H-benzimidazol-2-yl-methylene) amino) phenol

    Energy Technology Data Exchange (ETDEWEB)

    Omprakash, K L; Chandra Pal, A V; Reddy, M L.N. [Osmania Univ., Hyderabad (India). Dept. of Chemistry


    A new tridentate schiff base, 2- (1H-benzimidazol-2-yl-methylene)amino phenol derived from benzimididazole-2-carbo-xaldehyde and 2-aminophenol has been synthesised and characterised by spectral and analytical data. Proton-ligand formation constants of the schiff base and metal-ligand formation constants of its complexes with Sm(III), Dy(III), Gd(III), Nd(III) and Pr(III) have been determined potentiometrically in 50% (v/v) aqueous dioxane at an ionic strength of 0.1M (NaClO/sub 4/) and at 25deg C using the Irving-Rossotti titration technique. The order of stability constants (log..beta../sub 2/) is found to be Sm(III)>Dy(III)>Gd(III)>Pr(III)>Nd(III).

  2. The SINTRAN III NODAL system

    International Nuclear Information System (INIS)

    Skaali, T.B.


    NODAL is a high level programming language based on FOCAL and SNOBOL4, with some influence from BASIC. The language was developed to operate on the computer network controlling the SPS accelerator at CERN. NODAL is an interpretive language designed for interactive use. This is the most important aspect of the language, and is reflected in its structure. The interactive facilities make it possible to write, debug and modify programs much faster than with compiler based languages like FORTRAN and ALGOL. Apart from a few minor modifications, the basic part of the Oslo University NODAL system does not differ from the CERN version. However, the Oslo University implementation has been expanded with new functions which enable the user to execute many of the SINTRAN III monitor calls from the NODAL level. In particular the most important RT monitor calls have been implemented in this way, a property which renders possible the use of NODAL as a RT program administrator. (JIW)

  3. Solvent effects on extraction of aluminum(III), gallium(III), and indium(III), with decanoic acid

    International Nuclear Information System (INIS)

    Yamada, Hiromichi; Hayashi, Hisao; Fujii, Yukio; Mizuta, Masateru


    Extraction of aluminum(III) and indium(III) with decanoic acid in 1-octanol was carried out at 25 deg C and at an aqueous ionic strength of 0.1 mol dm -3 (NaClO 4 ). Monomeric and tetrameric aluminum(III) decanoates and monomeric indium(III) decanoate are responsible for the extraction. From a comparison of the present results with those obtained from the previous works, the polymerization of the extracted species was found to be more extensive in benzene than in 1-octanol, and the metal decanoates were highly polymerized in the following order in both solvents: Al > Ga > In. (author)

  4. Separation studies of La(III) and Ce(III)/Nd(III)/Pr(III)/Sm(III) from chloride solution using DEHPA/PC88A in petrofin

    International Nuclear Information System (INIS)

    Acharya, Sagarika; Mishra, Sujata; Bhatta, B.C.


    The separation of La(III) and four other lanthanides. Ce, Nd, Pr and Sm from chloride solution has been studied using the two acidic organophosphorous extractants, DEHPA and PC88A in petrofin at pH 4.3. The metal content analysis was done using an ICP-OES spectrophotometer. The separation factors (β) was calculated and for La-Sm pair highest value of 9.7 was obtained. (author)

  5. Nitrato-complexes of Y(III), La(III), Ce(III), Pr(III), Nd(III), Sm(III), Gd(III), Tb(III), Dy(III) and Ho(III) with 2-(2'-pyridyl) benzimidazole

    International Nuclear Information System (INIS)

    Mishra, A.; Singh, M.P.; Singh, V.K.


    The nitrato-complexes, [Y(PyBzH) 2 (NO 3 ) 2 ]NO 3 .H 2 O and Nd, Sm, Gd, Tb, Dy, Ho ; n=1-3, m=0-0.5 ; PyBzh=2-(2 -pyridyl)benzimidazole] are formed on interaction of the ligand with metal nitrates in ethanol. The electrical conductance values (116-129 ohm -1 cm 2 mol -1 ) suggest 1:1 electrolyte-nature of the complexes. Magnetic moment values of Ce(2.53 B.M.), Pr(3.62 B.M.), Nd(3.52 B.M.), Sm(1.70 B.M.), Gd(8.06 B.M.), Tb(9.44 B.M.), Dy(10.56 B.M.) and Ho(10.51 B.M.) in the complexes confirm the terpositive state of the metals. Infrared evidences are obtained for the existance of both coordinated (C 2 v) and uncoordinated (D 3 h) nitrate groups. Electronic absorption spectra of Pr(III)-, Nd(III)-, Sm(III)-, Tb(III)-, Dy(III)- and Ho(III)-complexes have been analysed in the light of LSJ terms. (author)

  6. Nitrato-complexes of Y(III), La(III), Ce(III), Pr(III), Nd(III), Sm(III), Gd(III), Tb(III), Dy(III) and Ho(III) with 2-(2'-pyridyl) benzimidazole

    Energy Technology Data Exchange (ETDEWEB)

    Mishra, A; Singh, M P; Singh, V K


    The nitrato-complexes, (Y(PyBzH)/sub 2/(NO/sub 3/)/sub 2/)NO/sub 3/.H/sub 2/O and Nd, Sm, Gd, Tb, Dy, Ho ; n=1-3, m=0-0.5 ; PyBzh=2-(2 -pyridyl)benzimidazole) are formed on interaction of the ligand with metal nitrates in ethanol. The electrical conductance values (116-129 ohm/sup -1/cm/sup 2/mol/sup -1/) suggest 1:1 electrolyte-nature of the complexes. Magnetic moment values of Ce(2.53 B.M.), Pr(3.62 B.M.), Nd(3.52 B.M.), Sm(1.70 B.M.), Gd(8.06 B.M.), Tb(9.44 B.M.), Dy(10.56 B.M.) and Ho(10.51 B.M.) in the complexes confirm the positive state of the metals. Infrared evidences are obtained for the existance of both coordinated (C/sub 2/v) and uncoordinated (D/sub 3/h) nitrate groups. Electronic absorption spectra of Pr(III)-, Nd(III)-, Sm(III)-, Tb(III)-, Dy(III)- and Ho(III)-complexes have been analysed in the light of LSJ terms.

  7. DSM-III-R and religion. (United States)

    Post, S G


    The interpretation of religion in DSM-III-R contains considerable negative bias and contributes to unfair stereotypes of religious persons. Particularly new religious movements and religious conversion are unfairly interpreted under the DSM-III-R heading, 'Dissociative Disorder Not Otherwise Specified'. It is suggested that a more balanced and respectful interpretation of religion is needed in DSM-III-R, since psychiatry through its official nomenclature should not contribute to social intolerance of religious nonconformity.

  8. Sorption of small amounts of europium(III) on iron(III) hydroxide and oxide

    International Nuclear Information System (INIS)

    Music, S.; Gessner, M.; Wolf, R.H.H.


    The sorption of small amounts of europium(III) on iron(III) hydroxide and oxide has been studied as a function of pH. The mechanism of sorption is discussed. Optimum conditions have been found for the preconcentration of small or trace amounts of europium(III) by iron(III) hydroxide and oxide. The influence of complexing agents (EDTA, oxalate, tartrate and 5-sulfosalicylic acid) on the sorption of small amounts of europium(III) on iron(III) oxide has also been studied. (author)

  9. Characterization of ribonuclease III from Brucella. (United States)

    Wu, Chang-Xian; Xu, Xian-Jin; Zheng, Ke; Liu, Fang; Yang, Xu-Dong; Chen, Chuang-Fu; Chen, Huan-Chun; Liu, Zheng-Fei


    Bacterial ribonuclease III (RNase III) is a highly conserved endonuclease, which plays pivotal roles in RNA maturation and decay pathways by cleaving double-stranded structure of RNAs. Here we cloned rncS gene from the genomic DNA of Brucella melitensis, and analyzed the cleavage properties of RNase III from Brucella. We identified Brucella-encoding small RNA (sRNA) by high-throughput sequencing and northern blot, and found that sRNA of Brucella and Homo miRNA precursor (pre-miRNA) can be bound and cleaved by B.melitensis ribonuclease III (Bm-RNase III). Cleavage activity of Bm-RNase III is bivalent metal cations- and alkaline buffer-dependent. We constructed several point mutations in Bm-RNase III, whose cleavage activity indicated that the 133th Glutamic acid residue was required for catalytic activity. Western blot revealed that Bm-RNase III was differently expressed in Brucella virulence strain 027 and vaccine strain M5-90. Collectively, our data suggest that Brucella RNase III can efficiently bind and cleave stem-loop structure of small RNA, and might participate in regulation of virulence in Brucella. Copyright © 2016 Elsevier B.V. All rights reserved.

  10. Potentiometric studies on some ternary complexes of Nd(III), Sm(III), Gd(III) and Ho(III) with cyclohexanediaminetetraacetic acid as primary ligand

    International Nuclear Information System (INIS)

    Marathe, D.G.; Munshi, K.N.


    The formation constants of the ternary complexes of neodymium(III), samarium(III), gadlonium(III) and holmium(III) with cyclohexanediaminetetraacetic acid (CyDTA) as primary ligand and dihydroxynaphthalene (DHN), dihydroxynaphthalene-6-sulphonic acid (DHNSA) and cateechol-3,5-disulphonic acid (CDSA) as secondary ligands have been investigated by potentiometric titration technique. The secondary ligands have been investigated by potentiometric titration technique. The values of formation constants of 1:1:1 ternary chelates are reported at three different temperatures, and at a fixed ionic strength, μ = 0.1 M (NaClO 4 ). (author)

  11. The Moessbauer effect in Fe(III) HEDTA, Fe(III) EDTA, and Fe(III) CDTA compounds

    International Nuclear Information System (INIS)

    Prado, F.R.


    The dependence of Moessbauer spectra with pH value of Fe(III)HEDTA and Fe(III)CDTA compounds is studied. Informations on formation processes of LFe-O-FeL (L=ligand) type dimers by the relation of titration curves of Fe(III)EDTA, Fe(III)HEDTA and Fe(III)CDTA compounds with the series of Moessbauer spectra, are obtained. Some informations on Fe-O-Fe bond structure are also obtained. Comparing the titration curves with the series of Moessbauer spectra, it is concluded that the dimerization process begins when a specie of the form FeXOH α (X = EDTA, HEDTA, CDTA; α = -1, -2) arises. (M.C.K.) [pt

  12. Extraction and stripping of neodymium (III) and dysprosium (III) by TRUEX solvent

    International Nuclear Information System (INIS)

    Rout, Alok; Venkatesan, K.A.; Antony, M.P.; Srinivasan, T.G.; Vasudeva Rao, P.R.


    McCabe-Thiele diagram for the extraction and stripping of Nd (III) and Dy (III) by TRUEX solvent has been constructed to determine the number of stages required for complete extraction and stripping. (author)

  13. Standards in neurosonology. Part III

    Directory of Open Access Journals (Sweden)

    Joanna Wojczal


    Full Text Available The paper presents standards related to ultrasound imaging of the cerebral vasculature and structures. The aim of this paper is to standardize both the performance and description of ultrasound imaging of the extracranial and intracranial cerebral arteries as well as a study of a specific brain structure, i.e. substantia nigra hyperechogenicity. The following aspects are included in the description of standards for each ultrasonographic method: equipment requirements, patient preparation, study technique and documentation as well as the required elements of ultrasound description. Practical criteria for the diagnosis of certain pathologies in accordance with the latest literature were also presented. Furthermore, additional comments were included in some of the sections. Part I discusses standards for the performance, documentation and description of different ultrasound methods (Duplex, Doppler. Part II and III are devoted to standards for specific clinical situations (vasospasm, monitoring after the acute stage of stroke, detection of a right-to-left shunts, confirmation of the arrest of the cerebral circulation, an assessment of the functional efficiency of circle of Willis, an assessment of the cerebrovascular vasomotor reserve as well as the measurement of substantia nigra hyperechogenicity.

  14. Modal Profiles for the WISC-III. (United States)

    Pritchard, David A.; Livingston, Ronald B.; Reynolds, Cecil R.; Moses, James A., Jr.


    Presents a normative typology for classifying the Wechsler Intelligence Scale for Children-Third Edition (WISC-III) factor index profiles according to profile shape. Current analyses indicate that overall profile level accounted for a majority of the variance in WISC-III index scores, but a considerable proportion of the variance was because of…

  15. The OPAL phase III microvertex detector

    International Nuclear Information System (INIS)

    De Jong, S.


    A description of the OPAL Phase III microvertex detector is given. Special emphasis is put on problems that have been encountered in the installation and operation of the different phases of the OPAL microvertex detector leading to the present Phase III detector and their cures. A short description of the new OPAL radiation monitoring and beam dump system is also given. (orig.)

  16. National Coastal Condition Report III Factsheet (United States)

    The National Coastal Condition Report III (NCCR III) is the third in a series of environmental assessments of U.S. coastal waters and the Great Lakes. The report includes assessments of the nation’s estuaries in the contiguous 48 states and Puerto Rico.

  17. National Coastal Condition Report III (2008) (United States)

    The National Coastal Condition Report III (NCCR III) is the third in a series of environmental assessments of U.S. coastal waters and the Great Lakes. The report includes assessments of the nation’s estuaries in the contiguous 48 states and Puerto Rico.

  18. Oral Assessment Kit, Levels II & III. Draft. (United States)

    Agrelo-Gonzalez, Maria; And Others

    The assessment packet includes a series of oral tests to help develop speaking as an integral part of second language instruction at levels II and III. It contains: 8 mini-tests for use at level II; 9 mini-tests for use at level III; a rating scale and score sheet masters for evaluating performance on these tests; and a collection of suggested…

  19. Antithrombin III for critically ill patients

    DEFF Research Database (Denmark)

    Allingstrup, Mikkel; Wetterslev, Jørn; Ravn, Frederikke B


    Background: Critical illness is associated with uncontrolled inflammation and vascular damage which can result in multiple organ failure and death. Antithrombin III (AT III) is an anticoagulant with anti-inflammatory properties but the efficacy and any harmful effects of AT III supplementation...... in critically ill patients are unknown. This review was published in 2008 and updated in 2015.  Objectives: To examine: 1. The effect of AT III on mortality in critically ill participants. 2. The benefits and harms of AT III. We investigated complications specific and not specific to the trial intervention......, bleeding events, the effect on sepsis and disseminated intravascular coagulation (DIC) and the length of stay in the intensive care unit (ICU) and in hospital in general.  Search methods: We searched the following databases from inception to 27 August 2015: Cochrane Central Register of Controlled Trials...

  20. Uranium (III)-Plutonium (III) co-precipitation in molten chloride (United States)

    Vigier, Jean-François; Laplace, Annabelle; Renard, Catherine; Miguirditchian, Manuel; Abraham, Francis


    Co-management of the actinides in an integrated closed fuel cycle by a pyrochemical process is studied at the laboratory scale in France in the CEA-ATALANTE facility. In this context the co-precipitation of U(III) and Pu(III) by wet argon sparging in LiCl-CaCl2 (30-70 mol%) molten salt at 705 °C is studied. Pu(III) is prepared in situ in the molten salt by carbochlorination of PuO2 and U(III) is then introduced as UCl3 after chlorine purge by argon to avoid any oxidation of uranium up to U(VI) by Cl2. The oxide conversion yield through wet argon sparging is quantitative. However, the preferential oxidation of U(III) in comparison to Pu(III) is responsible for a successive conversion of the two actinides, giving a mixture of UO2 and PuO2 oxides. Surprisingly, the conversion of sole Pu(III) in the same conditions leads to a mixture of PuO2 and PuOCl, characteristic of a partial oxidation of Pu(III) to Pu(IV). This is in contrast with coconversion of U(III)-Pu(III) mixtures but in agreement with the conversion of Ce(III).

  1. Association of Eu(III) and Cm(III) with Bacillus subtilis and Halobacterium salinarum

    International Nuclear Information System (INIS)

    Ozaki, Takuo; Kimura, Takaumi; Ohnuki, Toshihiko; Yoshida, Zenko


    Adsorption behavior of Eu(III) and Cm(III) by Bacillus subtilis and Halobacterium salinarum was investigated. Both microorganisms showed almost identical pH dependence on the distribution ratio (K d ) of the metals examined, i.e., K d of Eu(III) and Cm(III) increased with an increase of pH. The coordination state of Eu(III) adsorbed on the microorganisms was studied by time-resolved laser-induced fluorescence spectroscopy (TRLFS). The coordination states of Eu(III) adsorbed on the B. subtilis and H. salinarum was of different characteristics. H. salinarum exhibited more outer-spherical interaction with Eu(III) than B. subtilis. (author)

  2. Fluorimetric determination of samarium(III) and europium(III) in neodymium oxide by separation with a resin column

    Energy Technology Data Exchange (ETDEWEB)

    Shaorong Liu; Jian Meng (Beijing Research Institute of Chemical Engineering and Metallurgy (China)); Wenhua Liu (General Research Institute for Non-Ferrous Metals (China))


    When thenoyltrifluoroacetone-phenanthroline-Triton X-100 is used to determine samarium(III) and europium(III) fluorimetrically, only a limited amount of neodymium(III) can be tolerated. By using an on- line separation which can partially separate neodymium(III) from samarium(III), a practical and convenient method was developed to detect samarium(III) at concentrations >0.05% and europium(III) at concentrations >0.005% in neodymium oxide. (author). 7 refs.; 4 figs.; 3 tabs.

  3. Fluorimetric determination of samarium(III) and europium(III) in neodymium oxide by separation with a resin column

    International Nuclear Information System (INIS)

    Shaorong Liu; Jian Meng; Wenhua Liu


    When thenoyltrifluoroacetone-phenanthroline-Triton X-100 is used to determine samarium(III) and europium(III) fluorimetrically, only a limited amount of neodymium(III) can be tolerated. By using an on- line separation which can partially separate neodymium(III) from samarium(III), a practical and convenient method was developed to detect samarium(III) at concentrations >0.05% and europium(III) at concentrations >0.005% in neodymium oxide. (author). 7 refs.; 4 figs.; 3 tabs

  4. Timely management of developing class III malocclusion

    Directory of Open Access Journals (Sweden)

    M R Yelampalli


    Full Text Available Timing of orthodontic treatment, especially for children with developing class III malocclusions, has always been somewhat controversial, and definitive treatment tends to be delayed for severe class III cases. Developing class III patients with moderate to severe anterior crossbite and deep bite may need early intervention in some selected cases. Class III malocclusion may develop in children as a result of an inherent growth abnormality, i.e. true class III malocclusion, or as a result of premature occlusal contacts causing forward functional shift of the mandible, which is known as pseudo class III malocclusion. These cases, if not treated at the initial stage of development, interfere with normal growth of the jaw bases and may result in severe facial deformities. The treatment should be carried out as early as possible for permitting normal growth of the skeletal bases. This paper deals with the selection of an appropriate appliance from the various current options available for early intervention in developing class III malocclusion through two case reports.

  5. Thermodynamic data for predicting concentrations of Pu(III), Am(III), and Cm(III) in geologic environments

    Energy Technology Data Exchange (ETDEWEB)

    Rai, Dhanpat; Rao, Linfeng; Weger, H.T.; Felmy, A.R. [Pacific Northwest National Laboratory, WA (United States); Choppin, G.R. [Florida State University, Florida (United States); Yui, Mikazu [Japan Nuclear Cycle Development Inst., Tokai Works, Tokai, Ibaraki (Japan)


    This report provides thermodynamic data for predicting concentrations of Pu(III), Am(III), and Cm(III) in geologic environments, and contributes to an integration of the JNC chemical thermodynamic database, JNC-TDB (previously PNC-TDB), for the performance analysis of geological isolation system for high-level radioactive wastes. Thermodynamic data for the formation of complexes or compounds with hydroxide, chloride, fluoride, carbonate, nitrate, sulfate and phosphate are discussed in this report. Where data for specific actinide(III) species are lacking, the data were selected based on chemical analogy to other trivalent actinides. In this study, the Pitzer ion-interaction model is mainly used to extrapolate thermodynamic constants to zero ionic strength at 25degC. (author)

  6. III-V semiconductor materials and devices

    CERN Document Server

    Malik, R J


    The main emphasis of this volume is on III-V semiconductor epitaxial and bulk crystal growth techniques. Chapters are also included on material characterization and ion implantation. In order to put these growth techniques into perspective a thorough review of the physics and technology of III-V devices is presented. This is the first book of its kind to discuss the theory of the various crystal growth techniques in relation to their advantages and limitations for use in III-V semiconductor devices.

  7. Sorption behavior of europium(III) and curium(III) on the cell surfaces of microorganisms

    International Nuclear Information System (INIS)

    Ozaki, T.; Kimura, T.; Ohnuki, T.; Yoshida, Z.; Gillow, J.B.; Francis, A.J.


    We investigated the association of europium(III) and curium(III) with the microorganisms Chlorella vulgaris, Bacillus subtilis, Pseudomonas fluorescens, Halomonas sp., Halobacterium salinarum, and Halobacterium halobium. We determined the kinetics and distribution coefficients (K d ) for Eu(III) and Cm(III) sorption at pH 3-5 by batch experiments, and evaluated the number of water molecules in the inner-sphere (N H 2 O ) and the degree of strength of ligand field (R E/M ) for Eu(III) by time-resolved laser-induced fluorescence spectroscopy (TRLFS). Exudates from C. vulgaris, Halomonas sp., and H. halobium had an affinity for Eu(III) and Cm(III). The log K d of Eu(III) and Cm(III) showed that their sorption was not fully due to the exchange with three protons on the functional groups on cell surfaces. The halophilic microorganisms (Halomonas sp., Halobacterium salinarum, H. halobium) showed almost no pH dependence in log K d , indicating that an exchange with Na + on the functional groups was involved in their sorption. The ΔN H 2 O (= 9 - N H 2 O ) for Eu(III) on C. vulgaris was 1-3, while that for the other microorganisms was over 3, demonstrating that the coordination of Eu(III) with C. vulgaris was predominantly an outer-spherical process. The R E/M for Eu(III) on halophilic microorganisms was 2.5-5, while that for non-halophilic ones was 1-2.5. This finding suggests that the coordination environment of Eu(III) on the halophilic microorganisms is more complicated than that on the other three non-halophilic ones. (orig.)

  8. Sorption behavior of europium(III) and curium(III) on the cell surfaces of microorganisms

    Energy Technology Data Exchange (ETDEWEB)

    Ozaki, T.; Kimura, T.; Ohnuki, T.; Yoshida, Z. [Advanced Science Research Center, Japan Atomic Energy Research Inst., Ibaraki (Japan); Gillow, J.B.; Francis, A.J. [Environmental Sciences Dept., Brookhaven National Lab., Upton, NY (United States)


    We investigated the association of europium(III) and curium(III) with the microorganisms Chlorella vulgaris, Bacillus subtilis, Pseudomonas fluorescens, Halomonas sp., Halobacterium salinarum, and Halobacterium halobium. We determined the kinetics and distribution coefficients (K{sub d}) for Eu(III) and Cm(III) sorption at pH 3-5 by batch experiments, and evaluated the number of water molecules in the inner-sphere (N{sub H{sub 2}O}) and the degree of strength of ligand field (R{sub E/M}) for Eu(III) by time-resolved laser-induced fluorescence spectroscopy (TRLFS). Exudates from C. vulgaris, Halomonas sp., and H. halobium had an affinity for Eu(III) and Cm(III). The log K{sub d} of Eu(III) and Cm(III) showed that their sorption was not fully due to the exchange with three protons on the functional groups on cell surfaces. The halophilic microorganisms (Halomonas sp., Halobacterium salinarum, H. halobium) showed almost no pH dependence in log K{sub d}, indicating that an exchange with Na{sup +} on the functional groups was involved in their sorption. The {delta}N{sub H{sub 2}O} (= 9 - N{sub H{sub 2}O}) for Eu(III) on C. vulgaris was 1-3, while that for the other microorganisms was over 3, demonstrating that the coordination of Eu(III) with C. vulgaris was predominantly an outer-spherical process. The R{sub E/M} for Eu(III) on halophilic microorganisms was 2.5-5, while that for non-halophilic ones was 1-2.5. This finding suggests that the coordination environment of Eu(III) on the halophilic microorganisms is more complicated than that on the other three non-halophilic ones. (orig.)

  9. III Advanced Ceramics and Applications Conference

    CERN Document Server

    Gadow, Rainer; Mitic, Vojislav; Obradovic, Nina


    This is the Proceedings of III Advanced Ceramics and Applications conference, held in Belgrade, Serbia in 2014. It contains 25 papers on various subjects regarding preparation, characterization and application of advanced ceramic materials.

  10. Workshop III – Cosmology: Observations versus theories

    Indian Academy of Sciences (India)

    599–601. Workshop III – Cosmology: Observations versus theories. T R SESHADRI ... The gravitational lens image separation distribution function in the presence of evolving models of ... Restoration of local electroweak symmetry is achieved.

  11. First results from Mark III at SPEAR

    International Nuclear Information System (INIS)

    Einsweiler, K.F.

    The paper presents data on meson decays obtained using the MARK III detector operating at SPEAR. Results on hadronic decays; decays of the etasub(e); and results on radiative decays; are all described. (U.K.)

  12. Damping of type III solar radio bursts

    International Nuclear Information System (INIS)

    Levin, B.N.


    The meter- and decameter-wavelength damping of type III bursts may be attributable to stabilization of the Langmuir-wave instability of the fast-electron streams through excitation of cyclotron-branch plasma waves

  13. Study of Type III ELMs in JET

    Energy Technology Data Exchange (ETDEWEB)

    Sartori, R [EFDA Close Support Unit, Garching, 2 Boltzmannstrasse, Garching (Germany); Saibene, G [EFDA Close Support Unit, Garching, 2 Boltzmannstrasse, Garching (Germany); Horton, L D [Association Euratom-IPP, MPI fuer Plasmaphysik, 2 Boltzmannstrasse, Garching (Germany); Becoulet, M [Association Euratom-CEA, CE Cadarache, F-13108 St Paul-lez-Durance, CEDEX (France); Budny, R [PPPL, Princeton University, PO Box 451, Princeton, NJ 08543 (United States); Borba, D [Associacao EURATOM/IST, Centro de Fusao Nuclear, 1096 Lisbon, CODEX (Portugal); Chankin, A [Association Euratom-IPP, MPI fuer Plasmaphysik, 2 Boltzmannstrasse, Garching (Germany); Conway, G D [Association Euratom-IPP, MPI fuer Plasmaphysik, 2 Boltzmannstrasse, Garching (Germany); Cordey, G [EURATOM-UKAEA Fusion Association, Culham Science Centre, Abingdon, OX14 3DB (United Kingdom); McDonald, D [EURATOM-UKAEA Fusion Association, Culham Science Centre, Abingdon, OX14 3DB (United Kingdom); Guenther, K [EURATOM-UKAEA Fusion Association, Culham Science Centre, Abingdon, OX14 3DB (United Kingdom); Hellermann, M G von [FOM-Rijnhuizen, Ass. Euratom-FOM, TEC, PO Box 1207, 3430 BE Nieuwegein (Netherlands); Igithkanov, Yu [Max-Planck-Institute for Plasma Physics, Teilinstitut Greifswald, EURATOM Ass., D-17491, Greifswald (Germany); Loarte, A [EFDA Close Support Unit, Garching, 2 Boltzmannstrasse, Garching (Germany); Lomas, P J [EURATOM-UKAEA Fusion Association, Culham Science Centre, Abingdon, OX14 3DB (United Kingdom); Pogutse, O [EURATOM-UKAEA Fusion Association, Culham Science Centre, Abingdon, OX14 3DB (United Kingdom); Rapp, J [EFDA Close Support Unit, Culham, Abingdon OX14 3DB (United Kingdom)


    This paper presents the results of JET experiments aimed at studying the operational space of plasmas with a Type III ELMy edge, in terms of both local and global plasma parameters. In JET, the Type III ELMy regime has a wide operational space in the pedestal n{sub e} - T{sub e} diagram, and Type III ELMs are observed in standard ELMy H-modes as well as in plasmas with an internal transport barrier (ITB). The transition from an H-mode with Type III ELMs to a steady state Type I ELMy H-mode requires a minimum loss power, P{sub TypeI}. P{sub TypeI} decreases with increasing plasma triangularity. In the pedestal n{sub e} - T{sub e} diagram, the critical pedestal temperature for the transition to Type I ELMs is found to be inversely proportional to the pedestal density (T{sub crit} {proportional_to} 1/n) at a low density. In contrast, at a high density, T{sub crit}, does not depend strongly on density. In the density range where T{sub crit} {proportional_to} 1/n, the critical power required for the transition to Type I ELMs decreases with increasing density. Experimental results are presented suggesting a common mechanism for Type III ELMs at low and high collisionality. A single model for the critical temperature for the transition from Type III to Type I ELMs, based on the resistive interchange instability with magnetic flutter, fits well the density and toroidal field dependence of the JET experimental data. On the other hand, this model fails to describe the variation of the Type III n{sub e} - T{sub e} operational space with isotopic mass and q{sub 95}. Other results are instead suggestive of a different physics for Type III ELMs. At low collisionality, plasma current ramp experiments indicate a role of the edge current in determining the transition from Type III to Type I ELMs, while at high collisionality, a model based on resistive ballooning instability well reproduces, in term of a critical density, the experimentally observed q{sub 95} dependence of the

  14. Magnetic interactions in iron (III) porphyrin chlorides

    International Nuclear Information System (INIS)

    Ernst, J.; Subramanian, Japyesan; Fuhrhop, J.H.


    Intermolecular exchange interactions in iron(III) porphyrin chlorides (porphyrin = OEP, proto, TPP) have been studied by X-ray structure, EPR and magnetic susceptibility studies. The crystal structure of Fe(III)OEP-Cl was found to be different from that of the other two. Different types of exchange broadened EPR-spectra are obtained which are attributable to the arrangement in the crystals. The EPR results correlate well with magnetic susceptibility data. (orig.) [de

  15. IIIST1\\NTI-i\\III.

    African Journals Online (AJOL)

    guests in September 1914. (1) Major-General Sir Lothian Nicholson. KCB, CMG, and Major H 1. MacMullen, MC, History of the East Lancashire Regiment in the Great. War 1914-1918, Littlebury. Bros, Ltd. Liverpool,. 1936. p 114. Ti\\.~TI(~S-1\\ IIIST ••III. ~SI Til VI~V. I..•f :01 i\\. f~•• 10III.SOIl ~IIII~ 1~lt. The study of military tactics ...

  16. Introduction of Basel III: Opportunities and Challenges


    Madzova, Violeta


    Basel III is an opportunity as well as a challenge for the banks. It was developed from the existing Basel II framework, and the most signifi cant differences for banks are the introduction of liquidity and leverage ratios, and enhanced minimum capital requirements. An effective implementation of Basel III need to demonstrate to regulators, customers, and shareholders that the bank are recovering well from the global banking crisis of 2008 and provide a solid foundation for the next dev...

  17. NCEP ATP III dan Framingham score


    Hasan, Refli; Fahila, Reny


    Laporan ini merupakan Program Pendidikan Kolesterol National yang diperbaharui yaitu pedoman klinis untuk melakukan pengujian kolesterol dan manajemen. ATP III dibuat berdasarkan bukti dan laporan ekstensif yang akan menjadi referensi dan rekomendasi ilmiah. Laporan ATP III dapat dijadikan pedoman untuk pemberian terapi penurun kolesterol yang intensif dalam praktek. Pedoman ini hanya sebagai informasi , tidak dapat mempengaruhi secara mutlak dalam penilaian klinis dokter yang akhirnya menent...


    Directory of Open Access Journals (Sweden)

    Enrique Luis Muñoz Vélez


    Full Text Available El trabajo se inspira en las conversaciones con Paulino Salgado Valdez. Entrevistas con Batata III en Bogotá, 1998 y en Cartagena en el 2000 en el marco del Encuentro de los países andinos. Batata III nace el 29 de mayo de 1927 en el Palenque de San Basilio en el departamento de Bolívar, muere en Bogotá el viernes 23 de enero del 2004.

  19. Complexation of trivalent actinides and lanthanides with hydrophilic N-donor ligands for Am(III)/Cm(III) and An(III)/Ln(III) separation; Komplexierung von trivalenten Actiniden und Lanthaniden mit hydrophilen N-Donorliganden zur Am(III)/Cm(III)- bzw. An(III)/Ln(III)-Trennung

    Energy Technology Data Exchange (ETDEWEB)

    Wagner, Christoph


    The implementation of actinide recycling processes is considered in several countries, aiming at the reduction of long-term radiotoxicity and heat load of used nuclear fuel. This requires the separation of the actinides from the fission and corrosion products. The separation of the trivalent actinides (An(III)) Am(III) and Cm(III), however, is complicated by the presence of the chemically similar fission lanthanides (Ln(III)). Hydrophilic N-donor ligands are employed as An(III) or Am(III) selective complexing agents in solvent extraction to strip An(III) or Am(III) from an organic phase loaded with An(III) and Ln(III). Though they exhibit excellent selectivity, the complexation chemistry of these ligands and the complexes formed during solvent extraction are not sufficiently characterized. In the present thesis the complexation of An(III) and Ln(III) with hydrophilic N-donor ligands is studied by time resolved laser fluorescence spectroscopy (TRLFS), UV/Vis, vibronic sideband spectroscopy and solvent extraction. TRLFS studies on the complexation of Cm(III) and Eu(III) with the Am(III) selective complexing agent SO{sub 3}-Ph-BTBP (tetrasodium 3,3{sup '},3'',3{sup '''}-([2,2{sup '}-bipyridine]-6,6{sup '}-diylbis(1,2,4-triazine-3,5,6-triyl)) tetrabenzenesulfonate) revealed the formation of [M(SO{sub 3}-Ph-BTBP){sub n}]{sup (4n-3)-} complexes (M = Cm(III), Eu(III); n = 1, 2). The conditional stability constants were determined in different media yielding two orders of magnitude larger β{sub 2}-values for the Cm(III) complexes, independently from the applied medium. A strong impact of ionic strength on the stability and stoichiometry of the formed complexes was identified, resulting from the stabilization of the pentaanionic [M(SO{sub 3}-Ph-BTBP){sub 2}]{sup 5-} complex with increasing ionic strength. Thermodynamic studies of Cm(III)-SO{sub 3}-Ph-BTBP complexation showed that the proton concentration of the applied medium impacts

  20. Gender differences in Class III malocclusion. (United States)

    Baccetti, Tiziano; Reyes, Brian C; McNamara, James A


    This study evaluated gender differences in the cephalometric records of a large-scale cross-sectional sample of Caucasian subjects with Class III malocclusion at different developmental ages. The purpose also was to provide average age-related and sex-related data for craniofacial measures in untreated Class III subjects that are used as reference in the diagnostic appraisal of the patient with Class III disharmony. The sample examined consisted of 1094 pretreatment lateral cephalometric records (557 female subjects and 537 male subjects) of Caucasian Class III individuals. The age range for female subjects was between three years six months and 57 years seven months. The male subject group ranged from three years three months to 48 years five months. Twelve age groups were identified. Skeletal maturity at different age periods also was determined using the stage of cervical vertebral maturation. Gender differences for all cephalometric variables were analyzed using parametric statistics. The findings of the study indicated that Class III malocclusion is associated with a significant degree of sexual dimorphism in craniofacial parameters, especially from the age of 13 onward. Male subjects with Class III malocclusion present with significantly larger linear dimensions of the maxilla, mandible, and anterior facial heights when compared with female subjects during the circumpubertal and postpubertal periods.

  1. WISC-III e WAIS-III na avaliação da inteligência de cegos WISC-III/WAIS-III en ciegos WISC-III and WAIS-III in intellectual assessment of blind people

    Directory of Open Access Journals (Sweden)

    Elizabeth do Nascimento


    Full Text Available Diante da escassez de pesquisas nacionais e de testes psicológicos destinados a avaliar pessoas cegas, desenvolveu-se um estudo psicométrico com as escalas verbais dos testes WISC-III e WAIS-III. Após as adaptações de alguns estímulos e das instruções, os testes foram aplicados em crianças (N = 120 e adultos (N = 52 residentes em Belo Horizonte. Os resultados indicaram que as escalas verbais modificadas apresentam uma boa consistência interna (alfa> 0,80. Além disso, a investigação da validade fatorial identifica a presença clara de apenas um componente. Este componente explica 81% e 64% para o WISC-III e WAIS-III, respectivamente. Conclui-se que as adaptações a que se procedeu não afetaram a estrutura fatorial das escalas. Deste modo, os profissionais poderão utilizar as escalas modificadas para avaliar a inteligência de pessoas cegas.Frente a la escasez de investigaciones nacionales asi como la ausencia de tests psicológicos que evaluen personas ciegas, se ha desarrollado un estudio psicometrico com la escalas verbales del WISC-III y WAIS-III. Posteriormente a las adaptaciones de algunos estímulos y de las instrucciones, las escalas fueron aplicadas a una muestra de niños (n=120 y de adultos (n=52 residentes en la ciudad de Belo Horizonte-Brasil. Los resultados indican que las escalas verbales modificadas presentan una alta fiabilidad (alpha >0,80 asi como la presencia clara de un unico componente responsable por 81% y 64% de la variancia del WIC-III e WAIS-III respectivamente. Se ha concluido que las modificaciones efectuadas no han comprometido la estructura factorial de las escalas verbales. Por tanto, los profesionales psicólogos pueden utilizar las escalas modificadas para la evaluación de la inteligencia de personas portadoras de ceguera.Owing to the almost lack of a national research on psychological testing for the evaluation of blind people, a psychometric study has been developed with the WISC-III and WAIS-III

  2. Solvent extraction of anionic chelate complexes of lanthanum(III), europium(III), lutetium(III), scandium(III), and indium(III) with 2-thenoyltrifluoroacetone as ion-pairs with tetrabutylammonium ions

    International Nuclear Information System (INIS)

    Noro, Junji; Sekine, Tatsuya.


    The solvent extraction of lanthanum(III), europium(III), lutetium(III), scandium(III), and indium(III) in 0.1 mol dm -3 sodium nitrate solutions with 2-thenoyltrifluoroacetone (Htta) in the absence and presence of tetrabutylammonium ions (tba + ) into carbon tetrachloride was measured. The extraction of lanthanum(III), europium(III), and lutetium(III) was greatly enhanced by the addition of tba + ; this could be explained in terms of the extraction of a ternary complex, M(tta) 4 - tba + . However, the extractions of scandium(III) and indium(III) were nearly the same when tba + was added. The data were treated on the basis of the formation equilibrium of the ternary complex from the neutral chelate, M(tta) 3 , with the extracted ion-pairs of the reagents, tta - tba + , in the organic phase. It was concluded that the degree of association of M(tta) 3 with the ion-pair, tta - tba + , is greater in the order La(tta) 3 ≅ Eu(tta) 3 > Lu(tta) 3 , or that the stability of the ternary complex in the organic phase is higher in the order La(tta) 4 - tba + ≅ Eu(tta) 4 - tba + > Lu(tta) 4 - tba + . This is similar to those of adduct metal chelates of Htta with tributylphosphate (TBP) in synergistic extraction systems. (author)

  3. WISC-III e WAIS-III na avaliação da inteligência de cegos WISC-III/WAIS-III en ciegos WISC-III and WAIS-III in intellectual assessment of blind people


    Elizabeth do Nascimento; Carmen Elvira Flores-Mendoza


    Diante da escassez de pesquisas nacionais e de testes psicológicos destinados a avaliar pessoas cegas, desenvolveu-se um estudo psicométrico com as escalas verbais dos testes WISC-III e WAIS-III. Após as adaptações de alguns estímulos e das instruções, os testes foram aplicados em crianças (N = 120) e adultos (N = 52) residentes em Belo Horizonte. Os resultados indicaram que as escalas verbais modificadas apresentam uma boa consistência interna (alfa> 0,80). Além disso, a investigação da vali...

  4. Hybrid III-V/silicon lasers (United States)

    Kaspar, P.; Jany, C.; Le Liepvre, A.; Accard, A.; Lamponi, M.; Make, D.; Levaufre, G.; Girard, N.; Lelarge, F.; Shen, A.; Charbonnier, P.; Mallecot, F.; Duan, G.-H.; Gentner, J.-.; Fedeli, J.-M.; Olivier, S.; Descos, A.; Ben Bakir, B.; Messaoudene, S.; Bordel, D.; Malhouitre, S.; Kopp, C.; Menezo, S.


    The lack of potent integrated light emitters is one of the bottlenecks that have so far hindered the silicon photonics platform from revolutionizing the communication market. Photonic circuits with integrated light sources have the potential to address a wide range of applications from short-distance data communication to long-haul optical transmission. Notably, the integration of lasers would allow saving large assembly costs and reduce the footprint of optoelectronic products by combining photonic and microelectronic functionalities on a single chip. Since silicon and germanium-based sources are still in their infancy, hybrid approaches using III-V semiconductor materials are currently pursued by several research laboratories in academia as well as in industry. In this paper we review recent developments of hybrid III-V/silicon lasers and discuss the advantages and drawbacks of several integration schemes. The integration approach followed in our laboratory makes use of wafer-bonded III-V material on structured silicon-on-insulator substrates and is based on adiabatic mode transfers between silicon and III-V waveguides. We will highlight some of the most interesting results from devices such as wavelength-tunable lasers and AWG lasers. The good performance demonstrates that an efficient mode transfer can be achieved between III-V and silicon waveguides and encourages further research efforts in this direction.

  5. Hydration structure of Ti(III) and Cr(III): Monte Carlo simulation ...

    African Journals Online (AJOL)

    Classical Monte Carlo simulations were performed to investigate the solvation structures of Ti(III) and Cr(III) ions in water with only ion-water pair interaction potential and by including three-body correction terms. The hydration structures were evaluated in terms of radial distribution functions, coordination numbers and ...

  6. Teachers' Guide to Music Appreciation III A and III B in the Senior High School. (United States)

    Scott, J. Mark; Dawkins, Barbara R.

    This guide to music appreciation courses was developed for use in senior high schools in Duval County, Jacksonville, Florida. Music Appreciation III A examines the development of music, from the Gothic period through the Classical period. Music Appreciation III B examines the development of music from the Romantic period through the 1970s.…

  7. NMR and TRLFS studies of Ln(iii) and An(iii) C5-BPP complexes. (United States)

    Adam, Christian; Beele, Björn B; Geist, Andreas; Müllich, Udo; Kaden, Peter; Panak, Petra J


    C5-BPP is a highly efficient N-donor ligand for the separation of trivalent actinides, An(iii), from trivalent lanthanides, Ln(iii). The molecular origin of the selectivity of C5-BPP and many other N-donor ligands of the BTP-type is still not entirely understood. We present here the first NMR studies on C5-BPP Ln(iii) and An(iii) complexes. C5-BPP is synthesized with 10% 15 N labeling and characterized by NMR and LIFDI-MS methods. 15 N NMR spectroscopy gives a detailed insight into the bonding of C5-BPP with lanthanides and Am(iii) as a representative for trivalent actinide cations, revealing significant differences in 15 N chemical shift for coordinating nitrogen atoms compared to Ln(iii) complexes. The temperature dependence of NMR chemical shifts observed for the Am(iii) complex indicates a weak paramagnetism. This as well as the observed large chemical shift for coordinating nitrogen atoms show that metal-ligand bonding in Am(C5-BPP) 3 has a larger share of covalence than in lanthanide complexes, confirming earlier studies. The Am(C5-BPP) 3 NMR sample is furthermore spiked with Cm(iii) and characterized by time-resolved laser fluorescence spectroscopy (TRLFS), yielding important information on the speciation of trace amounts of minor complex species.

  8. Enhancement of the fluorescence of the samarium (III) complex by gadolinium (III)

    International Nuclear Information System (INIS)

    Yun-Xiang, C.; Zhang-Hua, L.


    The increase in sensitivity and selectivity of reactions in which colored species are formed by the addition of different metal ions is an area of research that has recently been developed. This phenomenon, which is sometimes called cocolaration effect, has been explained by the formation of mixed metal complex. The authors found an analogous phenomenon of reactions forming fluorescent complexes. The complexes of Sm(III)-thenoyltrifluoroacetone (TTA)-phenanthroline (Phen)-Triton-X-100 (TX-100) and Gd(III) (or La(III), Lu(III) and Y(III))-TTA-Phen-TX-100 had practically no fluorescence separately. Instead, a fluorescence-enhancement phenomenon caused by adding Gd or La, Lu and Y ions to the system was observed for the first time. The intensity of the enhanced fluorescence of Sm(III) complex was increased in the following order: La< Y< Lu< Gd. By analogy with cocoloration effect, the authors call this new fluorescence-enhancement phenomenon the co-fluorescence effect. The object of this work was to study the enhancement effect of Gd(III) on the fluorescence of the Sm(III)-TTA-Phen-TX-100 system. The recommended fluorimetric method has been applied to the determination of trace amounts of samarium in ytterbium oxide with satisfactory results. A general reaction mechanism for the system studied was proposed

  9. Transuranium perrhenates: Np(IV), Pu(IV) and (III), Am (III)

    International Nuclear Information System (INIS)

    Silvestre, Jean-Paul; Freundlich, William; Pages, Monique


    Synthesis in aqueous solution and by solid state reactions, crystallographical characterization and study of the stability of some transuranium perrhenates: Asup(n+)(ReO 4 - )sub(n) (A=Np(IV), Pu(IV), Pu(III), Am(III) [fr

  10. The steam generator programme of PISC III

    International Nuclear Information System (INIS)

    Birac, C.; Herkenrath, H.


    The PISC III Actions are intended to extend the results and methodologies of the previous PISC excercises, i.e. the validation of the capabilities of the various examination techniques when used on real defects in real components under real conditions of inspection. Being aware of the important safety role that steam generator tubes play as barrier between primary and secondary cooling system and of the industrial problems that the degradation of these tubes can create, the PISC III Management Board agreed to include in the PISC III Programme a special Action on Steam Generator Tubes Testing (SGT). It was decided to organize the programme in three phases, including Round Robin Tests (RRT): - capability tests on loose tubes, - capability tests on transportable mock-ups, - reliability tests on fixed mock-ups including some interesting SURRY tubes

  11. Gait and Function in Class III Obesity

    Directory of Open Access Journals (Sweden)

    Catherine Ling


    Full Text Available Walking, more specifically gait, is an essential component of daily living. Walking is a very different activity for individuals with a Body Mass Index (BMI of 40 or more (Class III obesity compared with those who are overweight or obese with a BMI between 26–35. Yet all obesity weight classes receive the same physical activity guidelines and recommendations. This observational study examined the components of function and disability in a group with Class III obesity and a group that is overweight or has Class I obesity. Significant differences were found between the groups in the areas of gait, body size, health condition, and activity capacity and participation. The Timed Up and Go test, gait velocity, hip circumference, and stance width appear to be most predictive of activity capacity as observed during gait assessment. The findings indicate that Class III-related gait is pathologic and not a normal adaptation.

  12. BALTICA III. Plant condition and life management

    International Nuclear Information System (INIS)

    Hietanen, S.; Auerkari, P.


    The BALTICA III, International Conference on Plant Condition and Life Management was held on June 6 - 8, 1995 on board Silja Serenade on its cruise between Helsinki - Stockholm and at the Forest Lake Hotel Korpilampi in Espoo. BALTICA III provides forum for the transfer of technology from applied research to practise. This is the second volume of the publications, which contain the presentations given at the BALTICA III, Plant Condition and Life Management. A total of 45 articles report recent experience in plant condition and life management. The conference focuses on recent applications that have been demonstrated for the benefit of safe and economical operation of power plants. Practical approach is emphasised, including the presentations that aim to provide insight into new techniques, improvements in assessment methodologies as well as maintenance strategies. Compared to earlier occasions in the BALTICA series, a new aspect is in the applications of knowledge-based systems in the service of power plant life management. (orig.)

  13. Electrochemical reduction of Eu (III) in propionic media

    International Nuclear Information System (INIS)

    Brotto, M.E.; Rabockai, T.


    Some chronopotentiometric studies of Eu (III) electro-reducion in propionic media that suggests the presence of two parallel rections: Eu (III) → Eu (II) and Eu (III) → Eu (II) → Y are presented. Some experimental data, such Eu (III) reducion, electrolysis of solutions and ionic power of the system are discussed. (M.J.C.) [pt

  14. SIMMER-III analytic thermophysical property model

    International Nuclear Information System (INIS)

    Morita, K; Tobita, Y.; Kondo, Sa.; Fischer, E.A.


    An analytic thermophysical property model using general function forms is developed for a reactor safety analysis code, SIMMER-III. The function forms are designed to represent correct behavior of properties of reactor-core materials over wide temperature ranges, especially for the thermal conductivity and the viscosity near the critical point. The most up-to-date and reliable sources for uranium dioxide, mixed-oxide fuel, stainless steel, and sodium available at present are used to determine parameters in the proposed functions. This model is also designed to be consistent with a SIMMER-III model on thermodynamic properties and equations of state for reactor-core materials. (author)

  15. Aufbau des humanoiden Roboters BART III (United States)

    Resetov, Dimitri; Pietsch, Björn; Gerth, Wilfried

    Der vorliegende Beitrag präsentiert den humanoiden Roboter BART III, der am Institut für Regelungstechnik als eine robuste und erweiterbare Plattform für weiterführende Grundlagenforschung zur zweibeinigen Fortbewegung entwickelt wurde. Im Gegensatz zu den bisher am IRT genutzten Robotern BARt-UH und LISA besitzt der neue Roboter einen beweglichen Oberkörper mit einem Bauchgelenk und Armen. BART III besitzt insgesamt 19 aktive Freiheitsgrade, 12 davon im Unterkörper. Ein weiteres Merkmal des Roboters ist die im gesamten Körper verteilte Ansteuerelektronik, die neben der lokalen Motorregelung diverse sicherheitsrelevante Funktionen übernimmt.

  16. Thermal behaviour of cesiumchloroferrates(III). 4

    International Nuclear Information System (INIS)

    Ziemer, B.; Fest, M.; Hass, D.; Leibnitz, P.


    Tricesium aquapentachloroferrate(III) chloride crystallizes from acid aqueous solutions of FeCl 3 · 6 H 2 O and CsCl in the triclinic space group P-bar1 with a = 714.1 pm, b = 1070.9 pm, c = 950.4 pm, α = 105.65 0 , β = 109.51 0 , γ = 89.08 0 and Z = 2. The compound is formed also from dicesium aquapentachloroferrate(III) and cesium chloride in a solid state reaction. The orientational relationships between the educt and product phases are elucidated, and a topotactic reaction mechanism is discussed. (author)

  17. Prediction of ROSA-III experiment

    International Nuclear Information System (INIS)

    Soda, Kunihisa


    ROSA-III experiment with the simulated BWR system is to investigate thermal hydraulic behavior as well as ECCS performance in a postulated loss-of-coolant accident. RUN 701 assumes average core power, high and low pressure core sprays and low pressure injection of ECCS. Prediction of experiment RUN 701 was made with computer code RELAP-4J. The results indicate the need for ROSA-III pump characteristics to be clarified and for liquid level formation model to be improved. Comparison of the prediction results with the experimental data should reveal the areas of modifications in calculation model. (auth.)

  18. Construction of the Cleo III drift chamber

    International Nuclear Information System (INIS)

    Csorna, S.; Marka, S.; Dickson, M.; Dombrowski, S. von; Peterson, D.; Thies, P.; Glenn, S.; Thorndike, E.H.; Kravchenko, I.


    The CLEO III group is constructing a new chamber to be installed as part of the staged luminosity upgrade program at the Cornell electron storage ring and compatible with the interaction region optics. Although having less radial extent than the current CLEO II tracking system, CLEO III will have equivalent momentum resolution because of material reduction in the drift chamber inner skin and gas. The thin inner skin requires special attention to the end-plate motion due to wire creep. During stringing, use of a robot will fully automate the wire handling on the upper end. (author)

  19. Inner-sphere and outer-sphere complexes of yttrium(III), lanthanum (III), neodymium(III), terbium(III) and thulium(III) with halide ions in N,N-dimethylformamide

    International Nuclear Information System (INIS)

    Takahashi, Ryouta; Ishiguro, Shin-ichi


    The formation of chloro, bromo and iodo complexes of yttrium(III), and bromo and iodo complexes of lanthanum(III), neodymium(III), terbium(III) and thulium(III) has been studied by precise titration calorimetry in N,N-dimethylformamide (DMF) at 25 o C. The formation of [YCl] 2+ , [YCl 2 ] + , [YCl 3 ] and [YCl 4 ] - , and [MBr] 2+ and [MBr 2 ] + (M = Y, La, Nd, Tb, Tm) was revealed, and their formation constants, enthalpies and entropies were determined. It is found that the formation enthalpies change in the sequence ΔH o (Cl) > ΔH o (l), which is unusual for hard metal (III) ions. This implies that, unlike the chloride ion, the bromide ion forms outer-sphere complexes with the lanthanide(III) and yttrium(III) ions in DMF. Evidence for either an inner- or outer-sphere complex was obtained from 89 Y NMR spectra for Y(ClO 4 ) 3 , YCl 3 and YBr 3 DMF solutions at room temperature. (author)

  20. Luminescence studies of Sm(III) and Cm(III) complexes in NaSCN/DHDECMP extraction systems

    CERN Document Server

    Chung, D Y; Kimura, T


    Laser-induced fluorescence (LIF) studies of Sm(III) and Cm(III) complexes in the NaSCN/DHDECMP solvent extraction system were carried out. Luminescence lifetimes were measured to determine the number of water molecules coordinated to Sm(III), Tb(III), Dy(III), and Cm(III) in the sodium thiocyanate solution and in the DHDECMP phase. The hydration number of Sm(III), Tb(III), Dy(III), and Cm(III) in the sodium thiocyanate solution decreased linearly with increasing sodium thiocyanate concentration. The hydration numbers of Sm(III), Dy(III), and Cm(III) in the DHDECMP phase decreased with increasing sodium thiocyanate concentration. The water molecules in the inner coordination sphere of Sm(III) and Dy(III) extracted into the DHDECMP were not completely removed at low sodium thiocyanate concentration but decreased with increasing sodium thiocyanate concentration. However, in the case of Cm(III) extracted into the DHDECMP phase from the sodium thiocyanate solution, there was no water in the inner coordination sphe...

  1. FutureTox III: Bridges for Translation (United States)

    The present document describes key discussion points and outcomes of a Society of Toxicology (SOT) Contemporary Concepts in Toxicology (CCT) Workshop, entitled FutureTox III1,2 that was held in Crystal City, Virginia, November 19-20, 2015. The workshop built on the many lessons l...

  2. Health Activities Project (HAP), Trial Edition III. (United States)

    Buller, Dave; And Others

    Contained within this Health Activities Project (HAP) trial edition (set III) are a teacher information folio and numerous student activity folios which center around the idea that students in grades 5-8 can control their own health and safety. Each student folio is organized into an Overview, Health Background, Materials, Setting Up, and…

  3. Constraining the Statistics of Population III Binaries (United States)

    Stacy, Athena; Bromm, Volker


    We perform a cosmological simulation in order to model the growth and evolution of Population III (Pop III) stellar systems in a range of host minihalo environments. A Pop III multiple system forms in each of the ten minihaloes, and the overall mass function is top-heavy compared to the currently observed initial mass function in the Milky Way. Using a sink particle to represent each growing protostar, we examine the binary characteristics of the multiple systems, resolving orbits on scales as small as 20 AU. We find a binary fraction of approx. 36, with semi-major axes as large as 3000 AU. The distribution of orbital periods is slightly peaked at approx. < 900 yr, while the distribution of mass ratios is relatively flat. Of all sink particles formed within the ten minihaloes, approx. 50 are lost to mergers with larger sinks, and 50 of the remaining sinks are ejected from their star-forming disks. The large binary fraction may have important implications for Pop III evolution and nucleosynthesis, as well as the final fate of the first stars.

  4. Exploring Flipped Classroom Instruction in Calculus III (United States)

    Wasserman, Nicholas H.; Quint, Christa; Norris, Scott A.; Carr, Thomas


    In an undergraduate Calculus III class, we explore the effect of "flipping" the instructional delivery of content on both student performance and student perceptions. Two instructors collaborated to determine daily lecture notes, assigned the same homework problems, and gave identical exams; however, compared to a more traditional…

  5. Mononuclear non-heme iron(III)

    Indian Academy of Sciences (India)

    Home; Journals; Journal of Chemical Sciences; Volume 123; Issue 2. Mononuclear non-heme iron(III) complexes of linear and tripodal tridentate ligands as functional models for catechol dioxygenases: Effect of -alkyl substitution on regioselectivity and reaction rate. Mallayan Palaniandavar Kusalendiran Visvaganesan.

  6. Monte Carlo studies of ZEPLIN III

    CERN Document Server

    Dawson, J; Davidge, D C R; Gillespie, J R; Howard, A S; Jones, W G; Joshi, M; Lebedenko, V N; Sumner, T J; Quenby, J J


    A Monte Carlo simulation of a two-phase xenon dark matter detector, ZEPLIN III, has been achieved. Results from the analysis of a simulated data set are presented, showing primary and secondary signal distributions from low energy gamma ray events.

  7. Fe (III) complex of mefloquine hydrochloride: Synthesis ...

    African Journals Online (AJOL)

    As part of the ongoing research for more effective antimalarial drug, Fe (III) complex of mefloquine hydrochloride (antimalarial drug) was synthesized using template method. Mefloquine was tentatively found to have coordinated through the hydroxyl and the two nitrogen atoms in the quinoline and piperidine in the structure, ...

  8. 21 CFR 1308.13 - Schedule III. (United States)


    ... 21 Food and Drugs 9 2010-04-01 2010-04-01 false Schedule III. 1308.13 Section 1308.13 Food and... opposite it. (b) Stimulants. Unless specifically excepted or unless listed in another schedule, any... a stimulant effect on the central nervous sxstem, including its salts, isomers (whether optical...

  9. Genetics Home Reference: mitochondrial complex III deficiency (United States)

    ... the energy from food into a form that cells can use. Complex III is one of several complexes that ... in mtDNA. Because egg cells, but not sperm cells, contribute mitochondria to the ... from their mother. These disorders can appear in every generation of ...

  10. Chaos in Kundt Type-III Spacetimes

    International Nuclear Information System (INIS)

    Sakalli, I.; Halilsoy, M.


    We consider geodesic motion in a particular Kundt type-III spacetime in which the Einstein-Yang-Mills equations admit the solutions. On a particular surface as constraint, we project the geodesics into the (x, y) plane and treat the problem as a two-dimensional one. Our numerical study shows that chaotic behavior emerges under reasonable conditions. (general)

  11. Gold(III)-Catalyzed Hydration of Phenylacetylene (United States)

    Leslie, J. Michelle; Tzeel, Benjamin A.


    A guided inquiry-based experiment exploring the regioselectivity of the hydration of phenylacetylene is described. The experiment uses an acidic gold(III) catalyst in a benign methanol/water solvent system to introduce students to alkyne chemistry and key principles of green chemistry. The experiment can be easily completed in approximately 2 h,…

  12. DRDC Support to Exercise Cyber Storm III (United States)


    d’intervention fédéraux portant sur les incidents cybernétiques sont encore relativement peu élaborés et insuffisamment développés et un examen des plans examinés...9 2.7 CSIII Ethics Protocol...30 Annex C .. Exercise Cyber Storm III Ethics

  13. Effects upon metabolic pathways and energy production by Sb(III and As(III/Sb(III-oxidase gene aioA in Agrobacterium tumefaciens GW4.

    Directory of Open Access Journals (Sweden)

    Jingxin Li

    Full Text Available Agrobacterium tumefaciens GW4 is a heterotrophic arsenite [As(III]/antimonite [Sb(III]-oxidizing strain. The As(III oxidase AioAB is responsible for As(III oxidation in the periplasm and it is also involved in Sb(III oxidation in Agrobacterium tumefaciens 5A. In addition, Sb(III oxidase AnoA and cellular H2O2 are also responsible for Sb(III oxidation in strain GW4. However, the deletion of aioA increased the Sb(III oxidation efficiency in strain GW4. In the present study, we found that the cell mobility to Sb(III, ATP and NADH contents and heat release were also increased by Sb(III and more significantly in the aioA mutant. Proteomics and transcriptional analyses showed that proteins/genes involved in Sb(III oxidation and resistance, stress responses, carbon metabolism, cell mobility, phosphonate and phosphinate metabolism, and amino acid and nucleotide metabolism were induced by Sb(III and were more significantly induced in the aioA mutant. The results suggested that Sb(III oxidation may produce energy. In addition, without periplasmic AioAB, more Sb(III would enter bacterial cells, however, the cytoplasmic AnoA and the oxidative stress response proteins were significantly up-regulated, which may contribute to the increased Sb(III oxidation efficiency. Moreover, the carbon metabolism was also activated to generate more energy against Sb(III stress. The generated energy may be used in Sb transportation, DNA repair, amino acid synthesis, and cell mobility, and may be released in the form of heat.

  14. Failures in Phase III: Causes and Consequences. (United States)

    Seruga, Bostjan; Ocana, Alberto; Amir, Eitan; Tannock, Ian F


    Phase III randomized controlled trials (RCT) in oncology fail to lead to registration of new therapies more often than RCTs in other medical disciplines. Most RCTs are sponsored by the pharmaceutical industry, which reflects industry's increasing responsibility in cancer drug development. Many preclinical models are unreliable for evaluation of new anticancer agents, and stronger evidence of biologic effect should be required before a new agent enters the clinical development pathway. Whenever possible, early-phase clinical trials should include pharmacodynamic studies to demonstrate that new agents inhibit their molecular targets and demonstrate substantial antitumor activity at tolerated doses in an enriched population of patients. Here, we review recent RCTs and found that these conditions were not met for most of the targeted anticancer agents, which failed in recent RCTs. Many recent phase III RCTs were initiated without sufficient evidence of activity from early-phase clinical trials. Because patients treated within such trials can be harmed, they should not be undertaken. The bar should also be raised when making decisions to proceed from phase II to III and from phase III to marketing approval. Many approved agents showed only better progression-free survival than standard treatment in phase III trials and were not shown to improve survival or its quality. Introduction of value-based pricing of new anticancer agents would dissuade the continued development of agents with borderline activity in early-phase clinical trials. When collaborating with industry, oncologists should be more critical and better advocates for cancer patients. ©2015 American Association for Cancer Research.

  15. A comparative study of ion exchange properties of antimony (III) tungstoselenite with those of antimony (III) tungstate and antimony (III) selenite

    International Nuclear Information System (INIS)

    Janardanan, C.; Nair, S.M.K.


    A new inorganic ion exchanger, antimony (III) tungstoselenite, has been prepared and characterised. Its exchange capacity and distribution coefficients for various metal ions and the effects of temperature and electrolyte concentrations on ion exchange capacity have been compared with antimony (III) tungstate and antimony (III) selenite. Six binary separations using the exchanger have been carried out. (author). 7 refs., 1 tab

  16. Recent operational history of the new Sandia Pulsed Reactor III (SPR III)

    International Nuclear Information System (INIS)

    Schmidt, T.R.; Estes, B.F.; Reuscher, J.A.


    The Sandia Pulsed Reactor III (SPR III) is a fast-pulse research reactor which was designed and built at Sandia Laboratories and achieved criticality in August 1975. The reactor is now characterized and is in an operational configuration. The core consists of 18 fuel plates (258 kg fuel mass) of fully enriched uranium alloyed with 10 wt.% molybdenum. It is arranged in an annular configuration with an inside diameter of 17.78 cm, an outside diameter of 29.72 cm, and a height of 35.9 cm. The reactor core uses reflectors of copper and aluminum for control and an external bolting arrangement to secure the fuel plates. SPR III and SPR II are operated on an interchangeable basis using the same facility and control system. As of June 1977, SPR III has had over 240 operations with core temperatures up to 541 0 C

  17. Complexes between lanthanide (III) and yttrium (III) picrates and tetra methylene sulfoxide as ligand

    International Nuclear Information System (INIS)

    Silva, M.A.A. da.


    The preparation and characterization of addition compounds between lanthanide (III) and yttrium (III) picrates and tetra methylene sulfoxide as ligand were described. The adducts were prepared in the molar relation 1 (salt): 3(ligand) in ethanol. They are microcrystalline with more intense color than those of their respective hydrated salts. At room temperature conditions they are non hygroscopic and do not present perceptible alterations. They became slightly opalescent, when heated between 363 and 423 K. At higher temperatures under several heating ratios, the behavior shown is the same: melting between 439 and 472 K. The characterization of the compounds was made by elemental analysis, electrolytic conductance measurements, X-ray powder patterns, infrared spectroscopy, visible electronic absorption and emission spectra of the neodymium (III) and europium (III), respectively. (author). 116 refs., 17 tabs., 11 figs

  18. Biomimetic oxidation of piperine and piplartine catalyzed by iron(III) and manganese(III) porphyrins. (United States)

    Schaab, Estela Hanauer; Crotti, Antonio Eduardo Miller; Iamamoto, Yassuko; Kato, Massuo Jorge; Lotufo, Letícia Veras Costa; Lopes, Norberto Peporine


    Synthetic metalloporphyrins, in the presence of monooxygen donors, are known to mimetize various reactions of cytochrome P450 enzymes systems in the oxidation of drugs and natural products. The oxidation of piperine and piplartine by iodosylbenzene using iron(III) and manganese(III) porphyrins yielded mono- and dihydroxylated products, respectively. Piplartine showed to be a more reactive substrate towards the catalysts tested. The structures of the oxidation products were proposed based on electrospray ionization tandem mass spectrometry.

  19. Addition compounds of lanthamide (III) and yttrium (III) hexafluorophosphates and N,N - dimethylformamide

    International Nuclear Information System (INIS)

    Braga, L.S.P.


    Addition compounds of lanthanide (III) and yttrium (III) hexafluorophosphates and N-N-Dimetylformamide are described to characterize the complexes, elemental analysis, melting ranges, molar conductance measurements, X-ray powder patters infrared and Raman spectra, TG and DTA curves, are studied. Information concerning the decomposition of the adducts through the thermogravimetric curves and the differential thermal analysis curves is obtained. (M.J.C.) [pt

  20. Extraction and separation studies of Ga(III, In(III and Tl(III using the neutral organophosphorous extractant, Cyanex-923

    Directory of Open Access Journals (Sweden)

    P. M. DHADKE


    Full Text Available The neutral extractant, Cyanes-923 has been used for the extraction and separation of gallium(III, indium(III and thallium(III from acidic solution. These metal ions were found to be quantitatively extracted with Cyanex-923 in toluene in the pH range 4.5–5.5, 5.0–6.5 and 1.5–3.0, respectively, and from the organic phase they can be stripped with 2.0 mol dm-3 HNO3, 3.0 mol dm-3 HNO3 and 3.0 mol dm-3 HCl, respectively. The effect of pH equilibration period, diluents, diverse ions and stripping agents on the extraction of Ga(III, In(III and Tl(III has been studied. The stroichiometry of the extracted species of these metal ions was determined on the basis of the slope analysis method. The reaction proceed by solvation and the probable extracted species found were [MCl3. 3Cyanex-923] [where M = Ga(III or In(III ] and [HTlCl4. 3Cyanex-923]. Based on these results a sequential procedure for the separation of Ga(III, In(III and Tl(III from each other was developed.

  1. Gd(III)-nanodiamond conjugates for MRI contrast enhancement (United States)

    Manus, Lisa M.; Mastarone, Daniel J.; Waters, Emily A.; Zhang, Xue-Qing; Schultz-Sikma, Elise A.; MacRenaris, Keith W.; Ho, Dean


    A Gd(III)-nanodiamond conjugate [Gd(III)-ND] was prepared and characterized, enabling detection of nanodiamonds by MR imaging. The Gd(III)-ND particles significantly reduced the T1 of water protons with a per-Gd(III) relaxivity of 58.82 ± 1.18 mM−1s−1 at 1.5 Tesla (60 MHz). This represents a tenfold increase compared to the monomer Gd(III) complex (r1 = 5.42 ± 0.20 mM−1s−1) and is among the highest per-Gd(III) relaxivities reported. PMID:20038088

  2. Doublet III beamline: as-built

    International Nuclear Information System (INIS)

    Harder, C.R.; Holland, M.M.; Parker, J.W.; Gunn, J.; Resnick, L.


    In order to fully exploit Doublet III capabilities and to study new plasma physics regimes, a Neutral Beam Injector System has been constructed. Initially, a two beamline system will supply 7 MW of heat to the plasma. The system is currently being expanded to inject approx. 20 MW of power (6 beamlines). Each beamline is equipped with two Lawrence Berkeley Laboratory type rectangular ion sources with 10 cm x 40 cm extraction grids. These sources will accelerate hydrogen ions to 80 keV, with extracted beam currents in excess of 80 A per source expected. The first completed source is currently being tested and conditioned on the High Voltage Test Stand at Lawrence Livermore Laboratory. This paper pictorially reviews the as-built Doublet III neutral beamline with emphasis on component relation and configuration relative to spatial and source imposed design constraints

  3. Correction of a severe Class III malocclusion. (United States)

    Arslan, Seher Gündüz; Kama, Jalan Devecioglu; Baran, Sedat


    The success of early orthopedic treatment in patients with Class III anomalies depends on facial skeletal development and type of treatment. This case report describes the treatment of a 12.6-year-old girl who had a severe Class III malocclusion with a 6-mm anterior crossbite, a deep overbite, a narrow maxilla, and unerupted maxillary canines. The treatment plan included rapid palatal expansion to expand the maxilla, reverse headgear to correct the maxillary retrognathia, a removable anterior inclined bite plane to correct the anterior crossbite and the deep overbite, and fixed edgewise appliances to align the teeth. One canine was brought into alignment, but the other was placed in occlusion in its transposed position. Ideal overjet and overbite relationships were established, and the final esthetic result was pleasing.

  4. Contemporary solutions for managing Class III malocclusion

    Directory of Open Access Journals (Sweden)

    Nathamuni Rengarajan Krishnaswamy


    Full Text Available Although patients with Class III malocclusions constitute a small percentage of the average orthodontic practice, providing them with optimal treatment is a daunting task. The treatment approach is dependent upon the growth status of the individual and the severity of the skeletal dysplasia. For growing individuals, facemask therapy to protract the maxilla is ineffective because of its dependence on dental anchorage to bring forth skeletal correction. Orthodontic camouflage in nongrowing mild skeletal Class III individuals is met with limited success because of the anatomical boundaries and the conventional biomechanics. Orthognathic surgery to correct the maxillomandibular relations is time-consuming, and the facial esthetics is compromised during the orthodontic decompensation period. Contemporary solutions to overcome these limitations are now viable with the use of temporary anchorage devices and by performing surgery prior to orthodontic decompensation. The rationale for employing these contemporary approaches will be discussed in this study with illustrative cases.

  5. Rape embryogenesis. III. Embryo development in time

    Directory of Open Access Journals (Sweden)

    Teresa Tykarska


    Full Text Available It was found that the growth curve of the rape embryo axis is of triple sigmoid type. Embryo growth occurs in 3 phases corresponding to 3 different periods of development. Phase I includes growth of the apical cell up to it's division into two layers of octants. Phase II comprises the increase of the spherical proembryo to the change of its symmetry from radial to bilateral. Phase III includes, growth of the embryo from the heart stage up to the end of embryogenesis. In each phase the relative growth rate increases drastically and then diminishes. The differences in growth intensity during the same phase are several-fold. The growth intensity maximum of the embryo axis occurs in phase II. The phasic growth intensity maxima occur: in phase I during apical cell elongation, :before its division, and in phases II and III in the periods of cell division ;growth in globular and torpedo-shaped -shaped embryos.

  6. Irradiation test of FPGA for BES III

    International Nuclear Information System (INIS)

    Chen Yixin; Liang Hao; Xue Jundong; Liu Baoying; Liu Qiang; Yu Xiaoqi; Zhou Yongzhao; Hou Long


    The irradiation effect of FPGA, applied in Front-end Electronics for experiments of High-Energy Physics, is a serious problem. The performance of FPGA, used in the front-end card of Muon Counters of BES III project, needs to be evaluated under irradiation. SEUs on Altera ACEX 1K FPGA, observed in the experiment under the irradiation of γ ray, 14 and 2.5 MeV neutrons, was investigated. The authors calculated involved cross-section and provided reasonable analysis and evaluation for the result of the experiment. The conclusion about feasibility of applying ACEX 1K FPGA in the front-end card of the readout system of Muon Counters for BES III was given. (authors)

  7. Organic coolant for ARIES-III

    International Nuclear Information System (INIS)

    Sze, D.K.; Sviatoslavsky, I.; Sawan, M.; Gierszewski, P.; Hollies, R.; Sharafat, S.; Herring, S.


    ARIES-III is a D-He 3 reactor design study. It is found that the organic coolant is well suited for the D-He 3 reactor. This paper discusses the unique features of the D-He 3 reactor, and the reason that the organic coolant is compatible with those features. The problems associated with the organic coolant are also discussed. 8 refs., 2 figs., 6 tabs

  8. Engineering design of ARIES-III

    International Nuclear Information System (INIS)

    Sze, D.K.; Wong, C.; Cheng, E.


    An efficient organic cooled low activation ferritic steel first wall and shield has been designed for the D- 3 He power reactor ARIES-III. The design allows removal of the large surface heat load without exceeding temperature and stress design limits. The structure is expected to last for the whole reactor life. The major concerns regarding using the organic coolant in fusion reactors have been greatly alleviated

  9. Doublet III: status and future plans

    International Nuclear Information System (INIS)

    Rawls, J.M.


    A synopsis is presented of the experimental results from the ohmic heating phase of Doublet III, with emphasis on the production of good target plasmas for the upcoming neutral beam injection phase. The program plan for the device over the life of the US-Japan cooperative program is discussed, as is the status of the preliminary investigation into replacing the present vacuum vessel by one better suited for ETF simulation

  10. Neuroscience in Nazi Europe Part III

    DEFF Research Database (Denmark)

    Zeidman, Lawrence A; Kondziella, Daniel


    In Part I, neuroscience collaborators with the Nazis were discussed, and in Part II, neuroscience resistors were discussed. In Part III, we discuss the tragedy regarding european neuroscientists who became victims of the Nazi onslaught on “non-Aryan” doctors. Some of these unfortunate...... of neuroscience, we pay homage and do not allow humanity to forget, lest this dark period in history ever repeat itself....

  11. Objectives and methodology of BIOBADASER phase iii. (United States)

    Sanchez-Piedra, Carlos; Hernández Miguel, M Victoria; Manero, Javier; Roselló, Rosa; Sánchez-Costa, Jesús Tomás; Rodríguez-Lozano, Carlos; Campos, Cristina; Cuende, Eduardo; Fernández-Lopez, Jesús Carlos; Bustabad, Sagrario; Martín Domenech, Raquel; Pérez-Pampín, Eva; Del Pino-Montes, Javier; Millan-Arcineas, Ana Milena; Díaz-González, Federico; Gómez-Reino, Juan Jesús


    Describe the objectives, methods and results of the first year of the new version of the Spanish registry of adverse events involving biological therapies and synthetic drugs with an identifiable target in rheumatic diseases (BIOBADASER III). Multicenter prospective registry of patients with rheumatic inflammatory diseases being treated with biological drugs or synthetic drugs with an identifiable target in rheumatology departments in Spain. The main objective of BIOBADASER Phase III is the registry and analysis of adverse events; moreover, a secondary objective was added consisting of assessing the effectiveness by means of the registry of activity indexes. Patients in the registry are evaluated at least once every year and whenever they experience an adverse event or a change in treatment. The collection of data for phase iii began on 17 December 2015. During the first year, 35 centers participated. The number of patients included in this new phase in December 2016 was 2,664. The mean age was 53.7 years and the median duration of treatment was 8.1 years. In all, 40.4% of the patients were diagnosed with rheumatoid arthritis. The most frequent adverse events were infections and infestations. BIOBADASER Phase III has been launched to adapt to a changing pharmacological environment, with the introduction of biosimilars and small molecules in the treatment of rheumatic diseases. This new stage is adapted to the changes in the reporting of adverse events and now includes information related to activity scores. Copyright © 2017 Elsevier España, S.L.U. and Sociedad Española de Reumatología y Colegio Mexicano de Reumatología. All rights reserved.

  12. Can Basel III Prevent Future Financial Crisis?


    Madzova, Violeta


    The financial sector is crucial for the smooth functioning of the economy. For this reason, the authorities use financial regulation as a means to ensure the stability of the banking system and to correct those ‘market failures’ that would otherwise threaten the solidity of financial institutions. Recently introduced Basel III on the new bank capital and liquidity standards, (that is going to be implemented gradually starting from 2013 till 2019) is changing the way that banks address the...

  13. Doublet III construction and engineering test

    International Nuclear Information System (INIS)



    Progress during FY-78 on the construction and operation of the Doublet III is reported. Detailed discussions about the installation and testing of various components and subsystems, including the B-coil, E-coil, F-coils and support structure, vacuum vessel, vacuum pumping system, limiter, thermal insulation blanket, control system, B-coil power system, E-coil power system, F-coil power system, and motor-generator, are presented. A brief review of the engineering test operation is given

  14. Insight into the Extraction Mechanism of Americium(III) over Europium(III) with Pyridylpyrazole: A Relativistic Quantum Chemistry Study. (United States)

    Kong, Xiang-He; Wu, Qun-Yan; Wang, Cong-Zhi; Lan, Jian-Hui; Chai, Zhi-Fang; Nie, Chang-Ming; Shi, Wei-Qun


    Separation of trivalent actinides (An(III)) and lanthanides (Ln(III)) is one of the most important steps in spent nuclear fuel reprocessing. However, it is very difficult and challenging to separate them due to their similar chemical properties. Recently the pyridylpyrazole ligand (PypzH) has been identified to show good separation ability toward Am(III) over Eu(III). In this work, to explore the Am(III)/Eu(III) separation mechanism of PypzH at the molecular level, the geometrical structures, bonding nature, and thermodynamic behaviors of the Am(III) and Eu(III) complexes with PypzH ligands modified by alkyl chains (Cn-PypzH, n = 2, 4, 8) have been systematically investigated using scalar relativistic density functional theory (DFT). According to the NBO (natural bonding orbital) and QTAIM (quantum theory of atoms in molecules) analyses, the M-N bonds exhibit a certain degree of covalent character, and more covalency appears in Am-N bonds compared to Eu-N bonds. Thermodynamic analyses suggest that the 1:1 extraction reaction, [M(NO 3 )(H 2 O) 6 ] 2+ + PypzH + 2NO 3 - → M(PypzH)(NO 3 ) 3 (H 2 O) + 5H 2 O, is the most suitable for Am(III)/Eu(III) separation. Furthermore, the extraction ability and the Am(III)/Eu(III) selectivity of the ligand PypzH is indeed enhanced by adding alkyl-substituted chains in agreement with experimental observations. Besides this, the nitrogen atom of pyrazole ring plays a more significant role in the extraction reactions related to Am(III)/Eu(III) separation compared to that of pyridine ring. This work could identify the mechanism of the Am(III)/Eu(III) selectivity of the ligand PypzH and provide valuable theoretical information for achieving an efficient Am(III)/Eu(III) separation process for spent nuclear fuel reprocessing.

  15. Evolution of Class III treatment in orthodontics. (United States)

    Ngan, Peter; Moon, Won


    Angle, Tweed, and Moyers classified Class III malocclusions into 3 types: pseudo, dentoalveolar, and skeletal. Clinicians have been trying to identify the best timing to intercept a Class III malocclusion that develops as early as the deciduous dentition. With microimplants as skeletal anchorage, orthopedic growth modification became more effective, and it also increased the scope of camouflage orthodontic treatment for patients who were not eligible for orthognathic surgery. However, orthodontic treatment combined with orthognathic surgery remains the only option for patients with a severe skeletal Class III malocclusion or a craniofacial anomaly. Distraction osteogenesis can now be performed intraorally at an earlier age. The surgery-first approach can minimize the length of time that the malocclusion needs to worsen before orthognathic surgery. Finally, the use of computed tomography scans for 3-dimensional diagnosis and treatment planning together with advances in imaging technology can improve the accuracy of surgical movements and the esthetic outcomes for these patients. Copyright © 2015 American Association of Orthodontists. Published by Elsevier Inc. All rights reserved.


    Directory of Open Access Journals (Sweden)

    Lydia Masako Ferreira

    Full Text Available Objective: Describe the current situation of the area Medicine III of CAPES and detect challenges for the next four years of evaluation. Methods: The area's documents and reports of meetings were read from 2004 to 2013 Medicine III Capes as well as reports and evaluation form of each Postgraduate Program (PPG of the area and the sub-page of the area from the Capes website. The data relating to the evaluation process, the assessment form and faculty, student and scientific production data of all of Post-Graduate Programs of Medicine III were computed and analyzed. From these data were detected the challenges of the area for the next four years (2013-2016. Results: Among the 3,806 PPG, Medicine III had 41 PPG during last triennial evaluation and progressed from 18% to 43% of PPG very good or more concept (triennium 2001-2003 and 2010-2012. Most PPG were located in the South-East region (32, three in the South and two in the North-East. There was no PPG in North or Central-West regions. In 2013 and 2014 there were four approved Professional Master Degree Programs and one Master (M and Doctorate (PhD. The average of permanent professors was 558 teachers with about three students/professor. The number of PhD graduates has increased as well as the reason PhD/MD. The proportion of in high impact periodicals (A1, A2, B1 and B2 jumped from 30% to 50% demonstrating positive community response to the policy area. The challenges identified were: decrease regional asymmetry, increase the number of masters and doctors of excellence, reassessment of Brazilian journals, stimulate and set internationalization indicators, including post-doctors and definition of its indicators, the PPG nucleation analysis, PPG 3x3, include primary and secondary education, professional master and indicators of technological scientific production and solidarity. Conclusion: Medicine III has been scientifically consolidated and their scientific researchers demonstrated maturity

  17. Pangad õhutavad III pensionisambaga liituma / Toivo Tänavsuu

    Index Scriptorium Estoniae

    Tänavsuu, Toivo


    Pangad peavad III pensionisambaga liitumist hädavajalikuks neile, kes soovivad oma elustandardit pensionile minnes säilitada. Pankade prognoose III sambaga liitumise kohta käesolevaks aastaks. Lisa: Pensioniks kogumine

  18. Luminescence study on solvation of americium(III), curium(III) and several lanthanide(III) ions in nonaqueous and binary mixed solvents

    International Nuclear Information System (INIS)

    Kimura, T.; Nagaishi, R.; Kato, Y.; Yoshida, Z.


    The luminescence lifetimes of An(III) and Ln(III) ions [An=Am and Cm; Ln=Nd, Sm, Eu, Tb and Dy] were measured in dimethyl sulfoxide(DMSO), N,N-dimethylformamide(DMF), methanol(MeOH), water and their perdeuterated solvents. Nonradiative decay rates of the ions were in the order of H 2 O > MeOH > DMF > DMSO, indicating that O-H vibration is more effective quencher than C-H, C=O, and S=O vibrations in the solvent molecules. Maximal lifetime ratios τ D /τ H were observed for Eu(III) in H 2 O, for Sm(III) in MeOH and DMF, and for Sm(III) and Dy(III) in DMSO. The solvent composition in the first coordination sphere of Cm(III) and Ln(III) in binary mixed solvents was also studied by measuring the luminescence lifetime. Cm(III) and Ln(III) were preferentially solvated by DMSO in DMSO-H 2 O, by DMF in DMF-H 2 O, and by H 2 O in MeOH-H 2 O over the whole range of the solvent composition. The order of the preferential solvation, i.e., DMSO > DMF > H 2 O > MeOH, correlates with the relative basicity of these solvents. The Gibbs free energy of transfer of ions from water to nonaqueous solvents was further estimated from the degree of the preferential solvation. (orig.)

  19. 25 CFR 522.12 - Revocation of class III gaming. (United States)


    ... 25 Indians 2 2010-04-01 2010-04-01 false Revocation of class III gaming. 522.12 Section 522.12 Indians NATIONAL INDIAN GAMING COMMISSION, DEPARTMENT OF THE INTERIOR APPROVAL OF CLASS II AND CLASS III ORDINANCES AND RESOLUTIONS SUBMISSION OF GAMING ORDINANCE OR RESOLUTION § 522.12 Revocation of class III...

  20. 25 CFR 502.4 - Class III gaming. (United States)


    ... 25 Indians 2 2010-04-01 2010-04-01 false Class III gaming. 502.4 Section 502.4 Indians NATIONAL INDIAN GAMING COMMISSION, DEPARTMENT OF THE INTERIOR GENERAL PROVISIONS DEFINITIONS OF THIS CHAPTER § 502.4 Class III gaming. Class III gaming means all forms of gaming that are not class I gaming or class...

  1. On the uniqueness of the injective III1 factor

    DEFF Research Database (Denmark)

    Haagerup, U.


    We give a new proof of a theorem due to Alain Connes, that an injective factor N of type III1 with separable predual and with trivial bicentralizer is isomorphic to the Araki-Woods type III1 factor R∞. This, combined with the author's solution to the bicentralizer problem for injective III1 facto...

  2. Antisites in III-V semiconductors: Density functional theory calculations

    KAUST Repository

    Chroneos, A.; Tahini, Hassan Ali; Schwingenschlö gl, Udo; Grimes, R. W.


    as a function of the Fermi level and under different growth conditions. The formation energies of group III antisites (III V q) decrease with increasing covalent radius of the group V atom though not group III radius, whereas group V antisites (V I I I

  3. 40 CFR 300.220 - Related Title III issues. (United States)


    ... 40 Protection of Environment 27 2010-07-01 2010-07-01 false Related Title III issues. 300.220 Section 300.220 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) SUPERFUND, EMERGENCY... PLAN Planning and Preparedness § 300.220 Related Title III issues. Other related Title III requirements...

  4. 77 FR 64397 - Order of Succession for HUD Region III (United States)


    ... Region III AGENCY: Office of Field Policy and Management, HUD. ACTION: Notice of Order of Succession... Office and its Field Offices (Region III). This Order of Succession supersedes all prior Orders of Succession for HUD Region III. DATES: Effective Date: October 9, 2012. FOR FURTHER INFORMATION CONTACT...


    Ferreira, Lydia Masako


    Describe the current situation of the area Medicine III of CAPES and detect challenges for the next four years of evaluation. The area's documents and reports of meetings were read from 2004 to 2013 Medicine III Capes as well as reports and evaluation form of each Postgraduate Program (PPG) of the area and the sub-page of the area from the Capes website. The data relating to the evaluation process, the assessment form and faculty, student and scientific production data of all of Post-Graduate Programs of Medicine III were computed and analyzed. From these data were detected the challenges of the area for the next four years (2013-2016). Among the 3,806 PPG, Medicine III had 41 PPG during last triennial evaluation and progressed from 18% to 43% of PPG very good or more concept (triennium 2001-2003 and 2010-2012). Most PPG were located in the South-East region (32), three in the South and two in the North-East. There was no PPG in North or Central-West regions. In 2013 and 2014 there were four approved Professional Master Degree Programs and one Master (M) and Doctorate (PhD). The average of permanent professors was 558 teachers with about three students/professor. The number of PhD graduates has increased as well as the reason PhD/MD. The proportion of in high impact periodicals (A1, A2, B1 and B2) jumped from 30% to 50% demonstrating positive community response to the policy area. The challenges identified were: decrease regional asymmetry, increase the number of masters and doctors of excellence, reassessment of Brazilian journals, stimulate and set internationalization indicators, including post-doctors and definition of its indicators, the PPG nucleation analysis, PPG 3x3, include primary and secondary education, professional master and indicators of technological scientific production and solidarity. Medicine III has been scientifically consolidated and their scientific researchers demonstrated maturity reaching a high level and matched to areas of greatest

  6. Interaction of Eu(III) and Cm(III) with mucin. A key component of the human mucosa

    Energy Technology Data Exchange (ETDEWEB)

    Wilke, Claudia; Barkleit, Astrid [Helmholtz-Zentrum Dresden-Rossendorf e.V., Dresden (Germany). Chemistry of the F-Elements


    To evaluate the potential health risks caused by the ingestion of lanthanides (Ln) and actinides (An), investigations into the chemical behavior of these metals in the human gastrointestinal tract are necessary. Mucin is an important part of the protective mucosa layer in the digestive system. We have recently reported that mucin interacts strongly with Eu(III) and Cm(III), representatives of Ln(III) and An(III), respectively, under in vivo conditions. In order to investigate the complexation behavior of this protein with Ln(III)/An(III), TRLFS measurements were performed on Eu(III)/Cm(III)-mucin solutions with different protein concentrations and at different pH. The results indicate the formation of at least two independent mucin species. At higher pH, the formation of hydroxide species was also observed.

  7. Interaction of Eu(III) and Cm(III) with mucin. A key component of the human mucosa

    International Nuclear Information System (INIS)

    Wilke, Claudia; Barkleit, Astrid


    To evaluate the potential health risks caused by the ingestion of lanthanides (Ln) and actinides (An), investigations into the chemical behavior of these metals in the human gastrointestinal tract are necessary. Mucin is an important part of the protective mucosa layer in the digestive system. We have recently reported that mucin interacts strongly with Eu(III) and Cm(III), representatives of Ln(III) and An(III), respectively, under in vivo conditions. In order to investigate the complexation behavior of this protein with Ln(III)/An(III), TRLFS measurements were performed on Eu(III)/Cm(III)-mucin solutions with different protein concentrations and at different pH. The results indicate the formation of at least two independent mucin species. At higher pH, the formation of hydroxide species was also observed.

  8. Mechanisms for Fe(III) oxide reduction in sedimentary environments (United States)

    Nevin, Kelly P.; Lovely, Derek R.


    Although it was previously considered that Fe(III)-reducing microorganisms must come into direct contact with Fe(III) oxides in order to reduce them, recent studies have suggested that electron-shuttling compounds and/or Fe(III) chelators, either naturally present or produced by the Fe(III)-reducing microorganisms themselves, may alleviate the need for the Fe(III) reducers to establish direct contact with Fe(III) oxides. Studies with Shewanella alga strain BrY and Fe(III) oxides sequestered within microporous beads demonstrated for the first time that this organism releases a compound(s) that permits electron transfer to Fe(III) oxides which the organism cannot directly contact. Furthermore, as much as 450 w M dissolved Fe(III) was detected in cultures of S. alga growing in Fe(III) oxide medium, suggesting that this organism releases compounds that can solublize Fe(III) from Fe(III) oxide. These results contrast with previous studies, which demonstrated that Geobacter metallireducens does not produce electron-shuttles or Fe(III) chelators. Some freshwater aquatic sediments and groundwaters contained compounds, which could act as electron shuttles by accepting electrons from G. metallireducens and then transferring the electrons to Fe(III). However, other samples lacked significant electron-shuttling capacity. Spectroscopic studies indicated that the electron-shuttling capacity of the waters was not only associated with the presence of humic substances, but water extracts of walnut, oak, and maple leaves contained electron-shuttling compounds did not appear to be humic substances. Porewater from a freshwater aquatic sediment and groundwater from a petroleum-contaminated aquifer contained dissolved Fe(III) (4-16 w M), suggesting that soluble Fe(III) may be available as an electron acceptor in some sedimentary environments. These results demonstrate that in order to accurately model the mechanisms for Fe(III) reduction in sedimentary environments it will be necessary

  9. Preparation and characterisation of mixed ligand complexes of Co(III), Fe(III) and Cr(III) containing phthalimide and phenols

    International Nuclear Information System (INIS)

    Miah, M.A.J.; Islam, M.S.; Pal, S.C.; Barma, T.K.


    Some novel mixed ligand complexes of Co(III), Fe(III) and Cr(III) containing phthalimide as primary and 2-aminophenol and 3-aminophenol as secondary ligands have been synthesized and characterised on the basis of elemental analyses, conductivity and magnetic measurements and infrared and electronic spectral studies. Complexes containing 2-aminophenol are 1:1 electrolyte in N,N dimethylformamide. Spectral studies indicate that all the complexes exhibit octahedral geometry. The complexes have the general composition; K[M(pim)/sub 2/(L)/sub 2/]; where m=Co(III), Fe(III) and Cr(III), pim-anion of phthalimamide and L=anion of 2-aminophenol and 3-aminophenol. (author)

  10. Synchrotron measurement of the 3D shape of X-ray reflections from the {gamma}/{gamma}{sup '}-microstructure of nickel-base superalloys

    Energy Technology Data Exchange (ETDEWEB)

    Epishin, Alexander; Link, Thomas; Ulbricht, Alexander; Bansal, Mamta [Technical Univ. of Berlin (Germany). Inst. of Material Science and Technology; Zizak, Ivo [Helmholtz-Zentrum Berlin for Materials and Energy BESSY II, Berlin (Germany)


    The 3D shape of X-ray reflections from the {gamma}/{gamma}{sup '}-microstructure of a nickel-base superalloy was investigated using synchrotron X-ray radiation and a position sensitive area detector. The measurements were performed on the 4{sup th} generation single-crystal nickel-base superalloy TMS138. The results show that X-ray reflections from non-cubic crystallographic planes have a complex 3D shape which changes during rafting. The 3D intensity distributions contain information about the spacing of the planes and their orientation as well. Whereas h00 reflections show the usual splitting into a {gamma}{sup '} and one {gamma}-subreflection, the hh0 and hhh reflections show two and three {gamma}-peaks respectively, resulting from the different types of {l_brace}100{r_brace} matrix channels. Therefore, these 3D diffraction measurements supply additional information about the spatial distribution of microstrains. (orig.)

  11. Calculations of multi-particle processes at the one-loop level: precise predictions for the LHC

    International Nuclear Information System (INIS)

    Karg, Stefan


    We present a calculation of the loop-induced processes gg→HH and gg→HHH, and investigate the observability of multi-Higgs boson production at the LHC in the Standard Model and beyond. While the SM cross sections are too small to allow observation at the LHC, we demonstrate that physics beyond the SM can lead to amplified, observable cross sections. Furthermore, the applicability of the heavy top quark approximation in two- and three-Higgs boson production is investigated. The calculation of the process PP→VV+jet at NLO is an important background process to Higgs production in association with a jet at the LHC. We compute the virtual corrections to this process which form the ''bottleneck'' for obtaining a complete NLO prediction. The resulting analytic expressions are generated with highly automated computer routines and translated into a flexible Fortran code, which can be employed in the computation of differential cross sections of phenomenological interest. (orig.)

  12. CARE07 Coordinated Accelerator Research in Europe

    CERN Multimedia


    Annual Meeting, at CERN, 29-31 October 2007 The CARE project started on 1st January 2004 and will end on 31st December 2008. At the end of each year, the progress and status of its activities are reported in a general meeting. This year, the meeting takes place at CERN. The CARE objective is to generate structured and integrated European cooperation in the field of accelerator research and related R&D. The programme includes the most advanced scientific and technological developments, relevant to accelerator research for particle physics. It is articulated around three Networking Activities and four Joint Activities. The Networking Activities ELAN, BENE and HHH aim to better coordinate R&D efforts at the European level and to strengthen Europe’s ability to produce intense and high-energy particle beams (electrons and positrons, muons and neutrinos, protons and ions, respectively). The Joint Activities, SRF, PHIN, HIPPI and NED, aim at technical developments on s...

  13. CARE07 Coordinated Accelerator Research in Europe

    CERN Multimedia


    Annual Meeting, at CERN, 29-31 October 2007 The CARE project started on 1st January 2004 and will end on 31st December 2008. At the end of each year, the progress and status of its activities are reported in a general meeting. This year, the meeting is taking place at CERN. The CARE objective is to generate structured and integrated European cooperation in the field of accelerator research and related R&D. The programme includes the most advanced scientific and technological developments, relevant to accelerator research for particle physics. It is articulated around three Networking Activities and four Joint Activities. The Networking Activities ELAN, BENE and HHH aim to better coordinate R&D efforts at the European level and to strengthen Europe’s ability to produce intense and high-energy particle beams (electrons and positrons, muons and neutrinos, protons and ions, respectively). The Joint Activities, SRF, PHIN, HIPPI and NED, aim at technical developments ...

  14. Probing anomalous couplings using di-Higgs production in electron–proton collisions

    Directory of Open Access Journals (Sweden)

    Mukesh Kumar


    Full Text Available A proposed high energy Future Circular Hadron-Electron Collider would provide sufficient energy in a clean environment to probe di-Higgs production. Using this channel we show that the azimuthal angle correlation between the missing transverse energy and the forward jet is a very good probe for the non-standard hhh and hhWW couplings. We give the exclusion limits on these couplings as a function of integrated luminosity at a 95% C.L. using the fiducial cross sections. With appropriate error fitting methodology we find that the Higgs boson self coupling could be measured to be ghhh(1=1.00−0.17(0.12+0.24(0.14 of its expected Standard Model value at s=3.5(5.0 TeV for an ultimate 10 ab−1 of integrated luminosity.

  15. The Higgs vacuum uplifted. Revisiting the electroweak phase transition with a second Higgs doublet

    Energy Technology Data Exchange (ETDEWEB)

    Dorsch, G.C. [Deutsches Elektronen-Synchrotron (DESY), Hamburg (Germany); Huber, S.J. [Sussex Univ., Brighton (United Kingdom). Dept. of Physics and Astronomy; Mimasu, K. [Sussex Univ., Brighton (United Kingdom). Dept. of Physics and Astronomy; Louvain Univ. Catholique, Louvain-la-Neuve (Belgium). Center for Cosmology, Particle Physics and Phenomenology; No, J.M. [King' s College, London (United Kingdom). Dept. of Physics; Sussex Univ., Brighton (United Kingdom). Dept. of Physics and Astronomy


    The existence of a second Higgs doublet in Nature could lead to a cosmological first order electroweak phase transition and explain the origin of the matter-antimatter asymmetry in the Universe. We explore the parameter space of such a two-Higgs-doublet-model and show that a first order electroweak phase transition strongly correlates with a significant uplifting of the Higgs vacuum w.r.t. its Standard Model value. We then obtain the spectrum and properties of the new scalars H{sub 0}, A{sub 0} and H{sup ±} that signal such a phase transition, showing that the decay A{sub 0}→H{sub 0}Z at the LHC and a sizable deviation in the Higgs self-coupling λ{sub hhh} from its SM value are sensitive indicators of a strongly first order electroweak phase transition in the 2HDM.

  16. Survey of Foods to Improve Logistic Support and Extend Mission Endurance of Submarines (United States)


    OrfiioKiM-<njrvj(Mio»o , jj o o 3 I * » X 30333-*HHHH-< HHHHHH ^l|rl|K1J.l|^ IJ V _! OvJ iM -• <\\ t\\ >- < <’JH J/IOJSH’J J £ <v <o (M...3x»N""»"""io«"io»x»<ij»po»"""ioiO""ir>"""H""<\\i-"-"»"Oj""""fij«"Cij-"»"<\\jcij-"<\\jio*"io»"«"»"Ki»0""p"> loooooooHHH-Hrt- HHHHHH

  17. General/Flag Officer Worldwide Roster, December 1986 (United States)


    H O t- ON O o O H 00 H J" 00 00 00 cO H ON O ^r CO t>*- in ITN o o o O vH NO VD vo ^t CO CO CO CO 8 S § § o HHHHHH ^HHHH OOOOOOOOOOO...8 e § u. OS r.% ̂ l^J^,^^ a üJ H (0 O DC UJ a i D -I a O $ a UJ ü o -J < cc UJ z UJ o 8 HHHHHH <MHHr-»r-(HHH...4h-HN r4 r4 r4 T4 CM H O O OOOO o o CM <n t- H o m H H H O O H H O lT\\\\f\\)0 CM CO CO CO CO \\0 CM H H CO 00 CO GO HHHHHH -SON-H OOOOOOCMHHO

  18. Workshop on Accelerator Magnet Superconductors, Design and Optimization

    CERN Document Server

    WAMSDO Workshop


    This report contains the proceedings of the CARE-HHH-AMT Workshop on Accelerator Magnet Superconductors, Design and Optimization (WAMSDO) held at CERN from 19 to 23 May 2008. The needs in terms of superconducting magnets for the accelerator projects were discussed, mainly for the LHC interaction regions and injector upgrades, and for the GSI FAIR complex. The first part of the workshop focused on the development of superconductor and cables, i.e., low-loss Nb-Ti cables, Nb$_{3}$Sn and high-temperature superconductors. An industry session summarized the actual plans and status of the activities in the main European industries. Then, a worldwide status of the high field magnets programme was presented. A special session was devoted to fast cycled magnets, including FAIR facilities and LHC injector upgrades. A final session focused on the optimization methods and numerical tools for magnet design.

  19. Effect of Thickener and Gasoline Quality on the Properties of Napalm Fuels (United States)


    6 ’ So H S3 lOCDCCtDOnroO) )««0 0)<E«DO «Hf-IG)IQ|Q0l*-<OO«[> P"iS OOONQHC O «3 IO HHO ’ »O «TOO «XOHCOOilNHIOIOOOIOC- 1’ 01 CD...OOO0JC0O’OCDtf> Cpl0rHl0*OtQlGDtH£CUO>Q O^CUi-KO .O »tOO» »on feCDOl HH(«niQ9 »HHH(0 HHO « I l«KJB* ©HN«(Dlf^V®Ct

  20. 9,10-phenanthrenesemiquinone radical complexes of ruthenium(III), osmium(III) and rhodium(III) and redox series. (United States)

    Biswas, Manas Kumar; Patra, Sarat Chandra; Maity, Amarendra Nath; Ke, Shyue-Chu; Weyhermüller, Thomas; Ghosh, Prasanta


    Reactions of 9,10-phenanthrenequinone (PQ) in toluene with [M(II)(PPh3)3X2] at 298 K afford green complexes, trans-[M(PQ)(PPh3)2X2] (M = Ru, X = Cl, 1; M = Os, X = Br, 2) in moderate yields. Reaction of anhydrous RhCl3 with PQ and PPh3 in boiling ethanol affords the dark brown paramagnetic complex, cis-[Rh(PQ)(PPh3)2Cl2] (3) in good yields. Diffusion of iodine solution in n-hexane to the trans-[Os(PQ) (PPh3)2(CO)(Br)] solution in CH2Cl2 generates the crystals of trans-[Os(PQ)(PPh3)2(CO)(Br)](+)I3(-), (4(+))I3(-)), in lower yields. Single crystal X-ray structure determinations of 1·2toluene, 2·CH2Cl2 and 4(+)I3(-), UV-vis/NIR absorption spectra, EPR spectra of 3, electrochemical activities and DFT calculations on 1, 2, trans-[Ru(PQ)(PMe3)2Cl2] (1Me), trans-[Os(PQ)(PMe3)2Br2] (2Me), cis-[Rh(PQ)(PMe3)2Cl2] (3Me) and their oxidized and reduced analogues including trans-[Os(PQ)(PMe3)2(CO)(Br)](+) (4Me(+)) substantiated that 1-3 are the 9,10-phenanthrenesemiquinone radical (PQ(˙-)) complexes of ruthenium(III), osmium(III) and rhodium(III) and are defined as trans/cis-[M(III)(PQ(˙-))(PPh3)2X2] with a minor contribution of the resonance form trans/cis-[M(II)(PQ)(PPh3)2X2]. Two comparatively longer C-O (1.286(4) Å) and the shorter C-C lengths (1.415(7) Å) of the OO-chelate of 1·2toluene and 2·CH2Cl2 and the isotropic fluid solution EPR signal at g = 1.999 of 3 are consistent with the existence of the reduced PQ(˙-) ligand in 1-3 complexes. Anisotropic EPR spectra of the frozen glasses (g11 = g22 = 2.0046 and g33 = 1.9874) and solids (g11 = g22 = 2.005 and g33 = 1.987) instigate the contribution of the resonance form, cis-[Rh(II)(PQ)(PPh3)2Cl2] in 3. DFT calculations established that the closed shell singlet (CSS) solutions of 1Me and 2Me are unstable due to open shell singlet (OSS) perturbation. However, the broken symmetry (BS) (1,1) Ms = 0 solutions of 1Me and 2Me are respectively 22.6 and 24.2 kJ mole(-1) lower in energy and reproduced the experimental bond

  1. Determination of Cu(III) and Cu(II)+Cu(III) in superconducting copper ceramics

    International Nuclear Information System (INIS)

    Nedelcheva, T.; Kostadinova, L.; Stoyanova-Ivanova, A.; Ivanova, I.


    Copper(III) and total copper in superconducting Y-Ba-Cu oxide and related compounds can be determinated by two successive iodimetric titrations after the sample has been dissolved under Ar in HCl/KI medium. First, the iodine equivalent to copper(III) is titrated with Na 2 S 2 O 3 solution at pH 4.8, copper(II) being masked with EDTA. The total copper is then determined in the same solution by demasking with acid and iodide, followed by iodimetric titration. The method is both accurate and reproducible. The relative standard deviations for 1.074% copper(III) and 23.37% total copper are 0.8% and 0.3%, respectively. (orig.)

  2. A binuclear Fe(III)Dy(III) single molecule magnet. Quantum effects and models. (United States)

    Ferbinteanu, Marilena; Kajiwara, Takashi; Choi, Kwang-Yong; Nojiri, Hiroyuki; Nakamoto, Akio; Kojima, Norimichi; Cimpoesu, Fanica; Fujimura, Yuichi; Takaishi, Shinya; Yamashita, Masahiro


    The binuclear [FeIII(bpca)(mu-bpca)Dy(NO3)4], having Single Molecule Magnet (SMM) properties, belonging to a series of isostructural FeIIILnIII complexes (Ln = Eu, Gd, Tb, Dy, Ho) and closely related FeIILnIII chain structures, was characterized in concise experimental and theoretical respects. The low temperature magnetization data showed hysteresis and tunneling. The anomalous temperature dependence of Mössbauer spectra is related to the onset of magnetic order, consistent with the magnetization relaxation time scale resulting from AC susceptibility measurements. The advanced ab initio calculations (CASSCF and spin-orbit) revealed the interplay of ligand field, spin-orbit, and exchange effects and probed the effective Ising nature of the lowest states, involved in the SMM and tunneling effects.

  3. Heterobimetallic gadolinium(III)-iron(III) complex of DTPA-bis(3-hydroxytyramide)

    International Nuclear Information System (INIS)

    Parac-Vogt, Tatjana N.; Kimpe, Kristof; Binnemans, Koen


    A derivative of diethylenetriamine-N,N,N',N'',N''-pentaacetic acid (DTPA), carrying two catechol functional groups has been synthesised by the reaction between DTPA-bis(anhydride) and 3-hydroxytyramine (dopamine). The ligand DTPA-bis(3-hydroxytyramide), [DTPA(HTA) 2 ], is able to form stable heterobimetallic complexes with gadolinium(III) and iron(III) ions. The gadolinium(III) occupies the internal coordination cage of DTPA formed by three nitrogens, two carboxylate and two amide oxygens, while the [Fe(NTA)(H 2 O) 2 ] (nitrilotriacetic acid, NTA) binds to catechol units by the substitution of two water ligands. The formation of polymeric species was avoided by using the tripodal NTA ligand. The heterobimetallic complex was characterised by means of visible absorption spectroscopy, electron spray ionisation-mass spectrometry (ESI-MS), and nuclear magnetic resonance (NMR) spectroscopy

  4. Alimentos industrializados congelados gama III y IV


    Tupone Reverter, Paula


    El presente estudio tiene como objetivo, indagar sobre el consumo, el grado de información y contenido de sodio, grasas saturadas y colesterol de los principales alimentos congelados Gama III y V consumidos por los encuestados. A partir de esto, se realiza una encuesta de frecuencia de consumo y preguntas varias a 250 personas de entre 30 a 60 años, que concurren a cuatro supermercados de la ciudad de Mar del Plata, para determinar el conocimiento por parte de los encuestados e...

  5. Decay time of type III solar bursts

    International Nuclear Information System (INIS)

    Alvarez, H.; Haddock, F.T.


    Sixty-four Type III bursts that drifted to frequencies below 600 kHz between March 1968 and February 1970 were analyzed. Decay times were measured and combined with published data ranging up to about 200 MHz. By fitting power functions to the computed and observed decay times, and using the local plasma hypothesis, it was found that the ratio rho of computed to observed values varies with radiocentric radial distance according to a power function rho = 3r 0 . 7 . (U.S.)

  6. Power flow evaluations for HERMES III

    International Nuclear Information System (INIS)

    Smith, D.L.; Ramirez, J.J.; Corley, J.P.; Hasti, D.E.


    A study has been conducted to evaluate the transfer of electro-magnetic pulses from water dielectric strip transmission lines into a diode insulator stack. The HERMES III Scale Model Experiments (HERMEX) included single-stage diodes as well as multistage models in which a variety of parallel/series combinations of strip transmission lines (strip lines) were used to evaluate the voltage adding efficiency at the diode. A technique has been established to estimate an equivalent shunt impedance across the diode due to the nearby uncharged water volume

  7. Silicon photonics III systems and applications

    CERN Document Server

    Lockwood, David


    This book is volume III of a series of books on silicon photonics. It reports on the development of fully integrated systems where many different photonics component are integrated together to build complex circuits. This is the demonstration of the fully potentiality of silicon photonics. It contains a number of chapters written by engineers and scientists of the main companies, research centers and universities active in the field. It can be of use for all those persons interested to know the potentialities and the recent applications of silicon photonics both in microelectronics, telecommunication and consumer electronics market.

  8. Research in collegiate mathematics education III

    CERN Document Server

    Arcavi, A; Kaput, Jim; Dubinsky, Ed; Dick, Thomas


    Volume III of Research in Collegiate Mathematics Education (RCME) presents state-of-the-art research on understanding, teaching, and learning mathematics at the post-secondary level. This volume contains information on methodology and research concentrating on these areas of student learning: Problem solving. Included here are three different articles analyzing aspects of Schoenfeld's undergraduate problem-solving instruction. The articles provide new detail and insight on a well-known and widely discussed course taught by Schoenfeld for many years. Understanding concepts. These articles fe

  9. Doping of III-nitride materials


    Pampili, Pietro; Parbrook, Peter J.


    In this review paper we will report the current state of research regarding the doping of III-nitride materials and their alloys. GaN is a mature material with both n-type and p-type doping relatively well understood, and while n-GaN is easily achieved, p-type doping requires much more care. There are significant efforts to extend the composition range that can be controllably doped for AlGaInN alloys. This would allow application in shorter and longer wavelength optoelectronics as well as ex...

  10. Kuosheng Mark III containment analyses using GOTHIC

    Energy Technology Data Exchange (ETDEWEB)

    Lin, Ansheng, E-mail:; Chen, Yen-Shu; Yuann, Yng-Ruey


    Highlights: • The Kuosheng Mark III containment model is established using GOTHIC. • Containment pressure and temperature responses due to LOCA are presented. • The calculated results are all below the design values and compared with the FSAR results. • The calculated results can be served as an analysis reference for an SPU project in the future. -- Abstract: Kuosheng nuclear power plant in Taiwan is a twin-unit BWR/6 plant, and both units utilize the Mark III containment. Currently, the plant is performing a stretch power uprate (SPU) project to increase the core thermal power to 103.7% OLTP (original licensed thermal power). However, the containment response in the Kuosheng Final Safety Analysis Report (FSAR) was completed more than twenty-five years ago. The purpose of this study is to establish a Kuosheng Mark III containment model using the containment program GOTHIC. The containment pressure and temperature responses under the design-basis accidents, which are the main steam line break (MSLB) and the recirculation line break (RCLB) accidents, are investigated. Short-term and long-term analyses are presented in this study. The short-term analysis is to calculate the drywell peak pressure and temperature which happen in the early stage of the LOCAs. The long-term analysis is to calculate the peak pressure and temperature of the reactor building space. In the short-term analysis, the calculated peak drywell to wetwell differential pressure is 140.6 kPa for the MSLB, which is below than the design value of 189.6 kPa. The calculated peak drywell temperature is 158 °C, which is still below the design value of 165.6 °C. In addition, in the long-term analysis, the calculated peak containment pressure is 47 kPa G, which is below the design value of 103.4 kPa G. The calculated peak values of containment temperatures are 74.7 °C, which is lower than the design value of 93.3 °C. Therefore, the Kuosheng Mark III containment can maintain the integrity after

  11. RAS III - concept and operating experience

    International Nuclear Information System (INIS)

    Kunze, U.; Wander, J.


    A new noise analysis system RAS III is being employed at the Greifswald NPP 'Bruno Leuschner' units 5 and 6 which differs from its forerunner types by an extended number of measuring points and a higher degree of automation. Substantial prerequisite of the system's full efficiency is implementation of efficient signal monitoring techniques that free the power plant engineer from routine work as well. The system has therefore been completed by algorithms established for automatic noise signal spectra control and for monitoring the pressure vessel vibrations. Moreover, a number of special techniques have been developed, such as for recording velocity-time plots during control element drop experiments. (author)

  12. Moessbauer study of iron(III) salicylates

    Energy Technology Data Exchange (ETDEWEB)

    Mahesh, K; Sharma, N D; Gupta, D C [Kurukshetra Univ. (India). Dept. of Physics; Puri, D M [Kurukshetra Univ. (India). Dept. of Chemistry


    Moessbauer infrared and magnetic studies of different basic salicylates of iron(III) are reported. Comparison of observed isomer shift and quadrupole splitting with the earlier work allows to assign the trinuclear chain structure to the complexes wherein the central iron atom in the chain is considered to be octahedrally coordinated in case of salicylate and 4-aminosalicylate derivatives, and pentacoordinated for the thiosalicylate with the terminal iron atom in tetrahedral symmetry. The Moessbauer parameters and indicate the high spin state of the central iron atom and low spin state for the terminal ones.

  13. Nutrición vegetal (III).


    Moyeja Santana, Juan de Jesús


    Editorial. Suniaga Q., José La codorniz fuente proteica para consumo humano. Díaz Cuellar, Doraida R. y González, Diomary Diagnóstico de parásitos gastrointestinales en bovinos y su importancia en la productividad de los sistemas ganaderos. Castillo O., Mayela; Hernández, Javier A.; Betancourt, Arquímedes y Suniaga Q., José Nutrición vegetal (II). Moyeja Santana, Juan de Jesús Nutrición vegetal (III). Moyeja Santana, Juan de Jesús Plagas chupadoras de las cítrica...

  14. NRL transmittance measurements at DIRT-III (United States)

    Curcio, J. A.; Haught, K. M.; Woytko, M. A.; Gott, C.


    This is a final report on NRL experiments at the DIRT-III tests at Fort Polk, Louisiana in April - May 1980. Spectral transmission data at 3 wavelengths 0.55 microns, 1.06 microns and 10.4 microns is reported for 27 events in natural soil and various prepared soils. Spectral transmittance of smoke and dust clouds generated by explosive charges was found to be independent of wavelengths in about 50% of the events where useful data was obtained. When the charge was buried in wet natural soil transmittance at 10.4 microns was transmittance at 0.55 microns .

  15. Temporal development of cross-neutralization between HTLV-III B and HTLV-III RF in experimentally infected chimpanzees

    NARCIS (Netherlands)

    Goudsmit, J.; Thiriart, C.; Smit, L.; Bruck, C.; Gibbs, C. J.


    Sera from chimpanzees inoculated respectively with HTLV-III B, LAV, HTLV-III RF and brain tissue from an AIDS patient were analysed for neutralizing activity by two methods: a cell fusion inhibition test (CFI) using HTLV-III B infected cells as inoculum and CD4+ cells as target and a replication

  16. Extraction behaviour of Am(III) and Eu(III) from nitric acid medium in TEHDGA-HDEHP impregnated resins

    Energy Technology Data Exchange (ETDEWEB)

    Saipriya, G.; Kumar, T. [Bhabha Atomic Research Centre Facilities, Kalpakkam (India). Kalpakkam Reprocessing Plant; Kumaresan, R.; Nayak, P.K.; Venkatesan, K.A.; Antony, M.P. [Indira Gandhi Center for Atomic Research, Kalpakkam (India). Fuel Chemistry Div.


    The extraction behaviour of Am(III) and Eu(III) from nitric acid medium was studied in the solvent impregnated resins containing extractants such as tetra-bis(2-ethylhexyl)diglycolamide (TEHDGA) or bis-(2-ethylhexyl)phosphoric acid (HDEHP) or mixture of TEHDGA+HDEHP. The rate of extraction of Am(III) and Eu(III) from 1 M nitric acid and the effect of various parameters, such as the concentration of nitric acid in aqueous phase and concentration of TEHDGA and HDEHP in resin phase, on the distribution coefficient of Am(III) and Eu(III) was studied. The distribution coefficient of Am(III) and Eu(III) in HDEHP-impregnated resin decreased and that in TEHDGA-impregnated resin increased, with increase in the concentration of nitric acid. However, in (TEHDGA+HDEHP) - impregnated resin, synergic extraction was observed at lower nitric acid concentration and antagonism at higher nitric acid concentration. The mechanism of Am(III) and Eu(III) extraction in the combined resin was investigated by slope analysis method. The extraction of various metal ions present in the fast reactor simulated high-level liquid waste was studied. The separation factor of Am(III) over Eu(III) was studied using citrate-buffered diethylenetriaminepentaacetic acid (DTPA) solution.

  17. The role of Ce(III) in BZ oscillating reactions (United States)

    Nogueira, Paulo A.; Varela, Hamilton; Faria, Roberto B.


    Herein we present results on the oscillatory dynamics in the bromate-oxalic acid-acetone-Ce(III)/Ce(IV) system in batch and also in a CSTR. We show that Ce(III) is the necessary reactant to allow the emergence of oscillations. In batch, oscillations occur with Ce(III) and also with Ce(IV), but no induction period is observed with Ce(III). In a CSTR, no oscillations were found using a freshly prepared Ce(IV), but only when the cerium-containing solution was aged, allowing partial conversion of Ce(IV) to Ce(III) by reaction with acetone.

  18. Antithrombin III for critically ill patients

    DEFF Research Database (Denmark)

    Allingstrup, Mikkel; Wetterslev, Jørn; Ravn, Frederikke B


    PURPOSE: Antithrombin III (AT III) is an anticoagulant with anti-inflammatory properties. We assessed the benefits and harms of AT III in critically ill patients. METHODS: We searched from inception to 27 August 2015 in CENTRAL, MEDLINE, EMBASE, CAB, BIOSIS and CINAHL. We included randomized...... participants). However, for all other outcome measures and analyses, the results did not reach statistical significance. CONCLUSIONS: There is insufficient evidence to support AT III substitution in any category of critically ill participants including those with sepsis and DIC. AT III did not show an impact...

  19. New analogues of Cucurbita maxima trypsin inhibitor III (CMTI III) with simplified structure. (United States)

    Rolka, K; Kupryszewski, G; Rózycki, J; Ragnarsson, U; Zbyryt, T; Otlewski, J


    Seven new analogues of trypsin inhibitor CMTI III were obtained by solid-phase peptide synthesis. Three analogues contained only two, instead of three, disulfide bridges, whereas the molecules of the next four analogues were shortened at the N- and/or C-terminus. The elimination of one disulfide bridge in CMTI III induces a decrease in the association equilibrium constants by 6-7 orders of magnitude, whereas the removal of one, two or three amino-acid residues at the N- and/or C-terminus does not significantly affect the activity.

  20. Synthesis, characterization and stability of Cr(III) and Fe(III) hydroxides

    International Nuclear Information System (INIS)

    Papassiopi, N.; Vaxevanidou, K.; Christou, C.; Karagianni, E.; Antipas, G.S.E.


    Highlights: • Fe(III)–Cr(III) hydroxides enhance groundwater quality better than pure Cr(III) compounds. • Crystalline Cr(OH) 3 ·3H 2 O was unstable, with a solubility higher than 50 μg/l. • Amorphous Cr(OH) 3 (am) was stable with a solubility lower than 50 μg/l in the range 5.7 0.75 Cr 0.25 (OH) 3 , the stability region was extended to 4.8 3 ·xH 2 O whereas in the presence of iron the precipitate is a mixed Fe (1−x) Cr x (OH) 3 phase. In this study, we report on the synthesis, characterisation and stability of mixed (Fe x ,Cr 1−x )(OH) 3 hydroxides as compared to the stability of Cr(OH) 3 . We established that the plain Cr(III) hydroxide, abiding to the approximate molecular formula Cr(OH) 3 ·3H 2 O, was crystalline, highly soluble, i.e. unstable, with a tendency to transform into the stable amorphous hydroxide Cr(OH) 3 (am) phase. Mixed Fe 0.75 Cr 0.25 (OH) 3 hydroxides were found to be of the ferrihydrite structure, Fe(OH) 3 , and we correlated their solubility to that of a solid solution formed by plain ferrihydrite and the amorphous Cr(III) hydroxide. Both our experimental results and thermodynamic calculations indicated that mixed Fe(III)–Cr(III) hydroxides are more effective enhancers of groundwater quality, in comparison to the plain amorphous or crystalline Cr(III) hydroxides, the latter found to have a solubility typically higher than 50 μg/l (maximum EU permitted Cr level in drinking water), while the amorphous Cr(OH) 3 (am) phase was within the drinking water threshold in the range 5.7 0.75 Cr 0.25 (OH) 3 hydroxides studied were of extended stability in the 4.8 < pH < 13.5 range

  1. GIS-measured walkability, transit, and recreation environments in relation to older Adults' physical activity: A latent profile analysis. (United States)

    Todd, Michael; Adams, Marc A; Kurka, Jonathan; Conway, Terry L; Cain, Kelli L; Buman, Matthew P; Frank, Lawrence D; Sallis, James F; King, Abby C


    An infrequently studied question is how diverse combinations of built environment (BE) features relate to physical activity (PA) for older adults. We derived patterns of geographic information systems- (GIS) measured BE features and explored how they accounted for differences in objective and self-reported PA, sedentary time, and BMI in a sample of older adults. Senior Neighborhood Quality of Life Study participants (N=714, aged 66-97years, 52.1% women, 29.7% racial/ethnic minority) were sampled in 2005-2008 from the Seattle-King County, WA and Baltimore, MD-Washington, DC regions. Participants' home addresses were geocoded, and net residential density, land use mix, retail floor area ratio, intersection density, public transit density, and public park and private recreation facility density measures for 1-km network buffers were derived. Latent profile analyses (LPAs) were estimated from these GIS-based measures. In multilevel regression models, profiles were compared on accelerometer-measured moderate-to-vigorous PA (MVPA) and sedentary time and self-reported PA, adjusting for covariates and clustering. Analyses were conducted in 2014-2015. LPAs yielded three profiles: low walkability/transit/recreation (L-L-L); mean walkability/transit/recreation (M-M-M); and high walkability/transit/recreation (H-H-H). Three PA outcomes were more favorable in the HHH than the LLL profile group (difference of 7.2min/day for MVPA, 97.8min/week for walking for errands, and 79.2min/week for walking for exercise; all pswalkability index, suggesting that diverse BE features are important for healthy aging. Copyright © 2016 Elsevier Inc. All rights reserved.

  2. Patterns of Walkability, Transit, and Recreation Environment for Physical Activity. (United States)

    Adams, Marc A; Todd, Michael; Kurka, Jonathan; Conway, Terry L; Cain, Kelli L; Frank, Lawrence D; Sallis, James F


    Diverse combinations of built environment (BE) features for physical activity (PA) are understudied. This study explored whether patterns of GIS-derived BE features explained objective and self-reported PA, sedentary behavior, and BMI. Neighborhood Quality of Life Study participants (N=2,199, aged 20-65 years, 48.2% female, 26% ethnic minority) were sampled in 2001-2005 from Seattle / King County WA and Baltimore MD / Washington DC regions. Their addresses were geocoded to compute net residential density, land use mix, retail floor area ratio, intersection density, public transit, and public park and private recreation facility densities using a 1-km network buffer. Latent profile analyses (LPAs) were estimated from these variables. Multilevel regression models compared profiles on accelerometer-measured moderate to vigorous PA (MVPA) and self-reported PA, adjusting for covariates and clustering. Analyses were conducted in 2013-2014. Seattle region LPAs yielded four profiles, including low walkability/transit/recreation (L-L-L); mean walkability/transit/recreation (M-M-M); moderately high walkability/transit/recreation (MH-MH-MH); and high walkability/transit/recreation (H-HH). All measures were higher in the HHH than the LLL profile (difference of 17.1 minutes/day for MVPA, 146.5 minutes/week for walking for transportation, 58.2 minutes/week for leisure-time PA, and 2.2 BMI points; all pwalkability index. Copyright © 2015 American Journal of Preventive Medicine. Published by Elsevier Inc. All rights reserved.

  3. Comorbid trajectories of substance use as predictors of Antisocial Personality Disorder, Major Depressive Episode, and Generalized Anxiety Disorder. (United States)

    Brook, Judith S; Zhang, Chenshu; Rubenstone, Elizabeth; Primack, Brian A; Brook, David W


    To determine longitudinal associations between patterns of comorbid cigarette, alcohol, and marijuana use and Antisocial Personality Disorder (ASPD), Major Depressive Episode (MDE), and Generalized Anxiety Disorder (GAD) in adulthood. A random community-based sample [X̅ age=36.6 (SD=2.8)] from the Children and Adults in the Community Study, an on-going investigation of substance use and psychiatric disorders. Data were collected at six time waves. Conjoint trajectories of cigarette, alcohol, and marijuana use spanning adolescence to adulthood were determined; multivariable logistic regression analyses assessed associations between trajectory group membership and having ASPD, MDE, or GAD in adulthood. Five conjoint trajectory groups were obtained: HHH (chronic cigarette, alcohol, and marijuana use), DDD (delayed/late-starting cigarette, alcohol, and marijuana use), LML (low/no smoking, moderate alcohol use, occasional marijuana use), HMN (chronic smoking, moderate alcohol use, no marijuana use), and NON (occasional alcohol use only). Compared with members of the NON group, those in the HHH group had significantly greater odds for having ASPD (Adjusted Odds Ratio [AOR]=28.52, 95% Confidence Interval [CI]=9.44-86.17), MDE (AOR=2.67, 95% CI=1.14-6.26), and GAD (AOR=6.39, 95% CI=2.62-15.56). Members of the DDD, LML, and HMN groups had weaker and less consistent associations with the three psychiatric outcomes. In a large, community-based sample, long-term concurrent use of more than one substance was associated with both externalizing and internalizing psychiatric disorders in adulthood. Prevention and treatment programs might target individuals in the community and general clinical populations with comorbid substance use, even if they haven't been identified as having a substance use disorder. Copyright © 2016 Elsevier Ltd. All rights reserved.

  4. One-loop radiative correction to the triple Higgs coupling in the Higgs singlet model

    Directory of Open Access Journals (Sweden)

    Shi-Ping He


    Full Text Available Though the 125 GeV Higgs boson is consistent with the standard model (SM prediction until now, the triple Higgs coupling can deviate from the SM value in the physics beyond the SM (BSM. In this paper, the radiative correction to the triple Higgs coupling is calculated in the minimal extension of the SM by adding a real gauge singlet scalar. In this model there are two scalars h and H and both of them are mixing states of the doublet and singlet. Provided that the mixing angle is set to be zero, namely the SM limit, h is the pure left-over of the doublet and its behavior is the same as that of the SM at the tree level. However the loop corrections can alter h-related couplings. In this SM limit case, the effect of the singlet H may show up in the h-related couplings, especially the triple h coupling. Our numerical results show that the deviation is sizable. For λΦS=1 (see text for the parameter definition, the deviation δhhh(1 can be 40%. For λΦS=1.5, the δhhh(1 can reach 140%. The sizable radiative correction is mainly caused by three reasons: the magnitude of the coupling λΦS, light mass of the additional scalar and the threshold enhancement. The radiative corrections for the hVV, hff couplings are from the counter-terms, which are the universal correction in this model and always at O(1%. The hZZ coupling, which can be precisely measured, may be a complementarity to the triple h coupling to search for the BSM. In the optimal case, the triple h coupling is very sensitive to the BSM physics, and this model can be tested at future high luminosity hadron colliders and electron–positron colliders.

  5. Sources of type III solar microwave bursts

    Directory of Open Access Journals (Sweden)

    Zhdanov D.A.


    Full Text Available Microwave fine structures allow us to study plasma evolution in an energy release region. The Siberian Solar Radio Telescope (SSRT is a unique instrument designed to examine fine structures at 5.7 GHz. A complex analysis of data from RATAN-600, 4–8 GHz spectropolarimeter, and SSRT, simultaneously with EUV data, made it possible to localize sources of III type microwave bursts in August 10, 2011 event within the entire frequency band of burst occurrence, as well as to determine the most probable region of primary energy release. To localize sources of III type bursts from RATAN-600 data, an original method for data processing has been worked out. At 5.7 GHz, the source of bursts was determined along two coordinates, whereas at 4.5, 4.7, 4.9, 5.1, 5.3, 5.5, and 6.0 GHz, their locations were identified along one coordinate. The size of the burst source at 5.1 GHz was found to be maximum as compared to those at other frequencies.

  6. Radioactivity backgrounds in ZEPLIN-III (United States)

    Araújo, H. M.; Akimov, D. Yu.; Barnes, E. J.; Belov, V. A.; Bewick, A.; Burenkov, A. A.; Chepel, V.; Currie, A.; Deviveiros, L.; Edwards, B.; Ghag, C.; Hollingsworth, A.; Horn, M.; Kalmus, G. E.; Kobyakin, A. S.; Kovalenko, A. G.; Lebedenko, V. N.; Lindote, A.; Lopes, M. I.; Lüscher, R.; Majewski, P.; Murphy, A. St. J.; Neves, F.; Paling, S. M.; Pinto da Cunha, J.; Preece, R.; Quenby, J. J.; Reichhart, L.; Scovell, P. R.; Silva, C.; Solovov, V. N.; Smith, N. J. T.; Smith, P. F.; Stekhanov, V. N.; Sumner, T. J.; Thorne, C.; Walker, R. J.


    We examine electron and nuclear recoil backgrounds from radioactivity in the ZEPLIN-III dark matter experiment at Boulby. The rate of low-energy electron recoils in the liquid xenon WIMP target is 0.75 ± 0.05 events/kg/day/keV, which represents a 20-fold improvement over the rate observed during the first science run. Energy and spatial distributions agree with those predicted by component-level Monte Carlo simulations propagating the effects of the radiological contamination measured for materials employed in the experiment. Neutron elastic scattering is predicted to yield 3.05 ± 0.5 nuclear recoils with energy 5-50 keV per year, which translates to an expectation of 0.4 events in a 1 yr dataset in anti-coincidence with the veto detector for realistic signal acceptance. Less obvious background sources are discussed, especially in the context of future experiments. These include contamination of scintillation pulses with Cherenkov light from Compton electrons and from β activity internal to photomultipliers, which can increase the size and lower the apparent time constant of the scintillation response. Another challenge is posed by multiple-scatter γ-rays with one or more vertices in regions that yield no ionisation. If the discrimination power achieved in the first run can be replicated, ZEPLIN-III should reach a sensitivity of ˜1 × 10-8pb · yr to the scalar WIMP-nucleon elastic cross-section, as originally conceived.

  7. ARIES-III divertor engineering design

    International Nuclear Information System (INIS)

    Wong, C.P.C.; Schultz, K.R.; Cheng, E.T.; Grotz, S.; Hasan, M.A.; Najmabadi, F.; Sharafat, S.; Herring, J.S.; Valenti, M.; Steiner, D.


    This paper reports the engineering design of the ARIES-III double- null divertor. The divertor coolant tubes are made from W-3Re alloy and cooled by subcooled flow boiling of organic coolant. A coating of 4 mm thick tungsten is plasma sprayed onto the divertor surface. This W layer can withstand the thermal deposition of a few disruptions. At a maximum surface heat flux of 5.4 MW/m 2 , a conventional divertor design can be used. The divertor surface is contoured to have a constant heat flux of 5.4 MW/m 2 . The net erosion of the W-surface was found to be negligible at about 0.1 mm/year. After 3 years of operation, the W-3Re alloy ARIES-III divertor can be disposed of as Class A waste. In order to control the prompt dose release at site boundary to less than 200 Rem, isotopic tailoring of the W-alloy will be needed

  8. ARIES-III divertor engineering design

    Energy Technology Data Exchange (ETDEWEB)

    Wong, C.P.C.; Schultz, K.R. [General Atomics, San Diego, CA (United States); Cheng, E.T. [TSI Research, Solana Beach, CA (United States); Grotz, S.; Hasan, M.A.; Najmabadi, F.; Sharafat, S. [California Univ., Los Angeles, CA (United States). Dept. of Mechanical, Aerospace and Nuclear Engineering; Brooks, J.N.; Ehst, D.A.; Sze, D.K. [Argonne National Lab., IL (United States); Herring, J.S. [EG and G Idaho, Inc., Idaho Falls, ID (United States); Valenti, M.; Steiner, D. [Rensselaer Polytechnic Inst., Troy, NY (United States). Plasma Dynamics Lab.


    This paper reports the engineering design of the ARIES-III double- null divertor. The divertor coolant tubes are made from W-3Re alloy and cooled by subcooled flow boiling of organic coolant. A coating of 4 mm thick tungsten is plasma sprayed onto the divertor surface. This W layer can withstand the thermal deposition of a few disruptions. At a maximum surface heat flux of 5.4 MW/m{sup 2}, a conventional divertor design can be used. The divertor surface is contoured to have a constant heat flux of 5.4 MW/m{sup 2}. The net erosion of the W-surface was found to be negligible at about 0.1 mm/year. After 3 years of operation, the W-3Re alloy ARIES-III divertor can be disposed of as Class A waste. In order to control the prompt dose release at site boundary to less than 200 Rem, isotopic tailoring of the W-alloy will be needed.

  9. The CRESST-III detector module

    Energy Technology Data Exchange (ETDEWEB)

    Wuestrich, Marc [Max-Planck-Institut f. Physik (Werner-Heisenberg-Institut) (Germany); Collaboration: CRESST-Collaboration


    The direct dark matter experiment CRESST uses scintillating calorimeters to detected WIMP induced nuclear scattering in CaWO{sub 4} single crystals. Equipped with transition edge sensors (TESs), these detectors can achieve detection thresholds well below 1 keV. The last physics run of CRESST-II proved the high potential of the experiment especially for small WIMP masses and triggered the development of a new detector module using much smaller CaWO{sub 4} main absorbers. The upcoming CRESST-III run will mainly be equipped with these newly developed modules, which combine a fully scintillating detector housing with an improved detection threshold (<100 keV). While many features of the new module were adapted from previous module designs in an improved way, also new features are implemented like instrumented sticks (iSticks) holding the crystals and optimized TES structures for phonon and light detectors. First tests above ground validated the improved performance of these detector modules and promise to explore new regions in the WIMP parameter space in the next CRESST-III run.

  10. A view from Cheyenne Mountain: Generation III's perspective of Keystone III. (United States)

    Bliss, Erika; Cadwallader, Kara; Steyer, Terrence E; Clements, Deborah S; Devoe, Jennifer E; Fink, Kenneth; Khubesrian, Marina; Lyons, Paul; Steiner, Elizabeth; Weismiller, David


    In October 2000 the family of family medicine convened the Keystone III conference at Cheyenne Mountain Resort. Keystone III participants included members of Generation I (entered practice before 1970), Generation II (entered 1970-1990), and Generation III (entered after 1990). They represented a wide range of family physicians, from medical students to founders of the discipline, and from small-town solo practice to academic medicine. During the conference, the three generations worked together and separately thinking about the past, present, and future of family medicine, our roles in it, and how the understanding of a family physician and our discipline had and would continue to evolve. After the conference, the 10 Generation III members wrote the article published here, reflecting on our experiences as new physicians and physicians in training, and the similarities and differences between our experiences and those of physicians in Generations I and II. Key similarities included commitment to whole-person care, to a wide scope of practice, to community health, and to ongoing engagement with our discipline. Key differences included our understanding of availability, the need for work-life balance, the role of technology in the physician-patient relationship, and the perceptions of the relationship between medicine and a range of outside forces such as insurance and government. This article, presented with only minor edits, thus reflects accurately our perceptions in late 2000. The accompanying editorial reflects our current perspective.

  11. Stratospheric Aerosol and Gas Experiment III on the International Space Station (SAGE III/ISS) (United States)

    Gasbarre, Joseph; Walker, Richard; Cisewski, Michael; Zawodny, Joseph; Cheek, Dianne; Thornton, Brooke


    The Stratospheric Aerosol and Gas Experiment III on the International Space Station (SAGE III/ISS) mission will extend the SAGE data record from the ideal vantage point of the International Space Station (ISS). The ISS orbital inclination is ideal for SAGE measurements providing coverage between 70 deg north and 70 deg south latitude. The SAGE data record includes an extensively validated data set including aerosol optical depth data dating to the Stratospheric Aerosol Measurement (SAM) experiments in 1975 and 1978 and stratospheric ozone profile data dating to the Stratospheric Aerosol and Gas Experiment (SAGE) in 1979. These and subsequent data records, notably from the SAGE II experiment launched on the Earth Radiation Budget Satellite in 1984 and the SAGE III experiment launched on the Russian Meteor-3M satellite in 2001, have supported a robust, long-term assessment of key atmospheric constituents. These scientific measurements provide the basis for the analysis of five of the nine critical constituents (aerosols, ozone (O3), nitrogen dioxide (NO2), water vapor (H2O), and air density using O2) identified in the U.S. National Plan for Stratospheric Monitoring. SAGE III on ISS was originally scheduled to fly on the ISS in the same timeframe as the Meteor-3M mission, but was postponed due to delays in ISS construction. The project was re-established in 2009.

  12. Structural Characterization of Am(III)- and Pu(III)-DOTA Complexes. (United States)

    Audras, Matthieu; Berthon, Laurence; Berthon, Claude; Guillaumont, Dominique; Dumas, Thomas; Illy, Marie-Claire; Martin, Nicolas; Zilbermann, Israel; Moiseev, Yulia; Ben-Eliyahu, Yeshayahu; Bettelheim, Armand; Cammelli, Sebastiano; Hennig, Christoph; Moisy, Philippe


    The complexation of 1,4,7,10-tetrazacyclodecane-1,4,7,10-tetraacetic acid (DOTA) ligand with two trivalent actinides (Am 3+ and Pu 3+ ) was investigated by UV-visible spectrophotometry, NMR spectroscopy, and extended X-ray absorption fine structure in conjunction with computational methods. The complexation process of these two cations is similar to what has been previously observed with lanthanides(III) of similar ionic radius. The complexation takes place in different steps and ends with the formation of a (1:1) complex [(An(III)DOTA)(H 2 O)] - , where the cation is bonded to the nitrogen atoms of the ring, the four carboxylate arms, and a water molecule to complete the coordination sphere. The formation of An(III)-DOTA complexes is faster than the Ln(III)-DOTA systems of equivalent ionic radius. Furthermore, it is found that An-N distances are slightly shorter than Ln-N distances. Theoretical calculations showed that the slightly higher affinity of DOTA toward Am over Nd is correlated with slightly enhanced ligand-to-metal charge donation arising from oxygen and nitrogen atoms.

  13. Synthesis, characterization and stability of Cr(III) and Fe(III) hydroxides

    Energy Technology Data Exchange (ETDEWEB)

    Papassiopi, N.; Vaxevanidou, K.; Christou, C.; Karagianni, E.; Antipas, G.S.E., E-mail:


    Highlights: • Fe(III)–Cr(III) hydroxides enhance groundwater quality better than pure Cr(III) compounds. • Crystalline Cr(OH){sub 3}·3H{sub 2}O was unstable, with a solubility higher than 50 μg/l. • Amorphous Cr(OH){sub 3}(am) was stable with a solubility lower than 50 μg/l in the range 5.7 < pH < 11. • For mixed Fe{sub 0.75}Cr{sub 0.25}(OH){sub 3}, the stability region was extended to 4.8 < pH < 13.5. -- Abstract: Chromium is a common contaminant of soils and aquifers and constitutes a major environmental problem. In nature, chromium usually exists in the form of two oxidation states, trivalent, Cr(III), which is relatively innocuous for biota and for the aquatic environment, and hexavalent, Cr(VI) which is toxic, carcinogenic and very soluble. Accordingly, the majority of wastewater and groundwater treatment technologies, include a stage where Cr(VI) is reduced to Cr(III), in order to remove chromium from the aqueous phase and bind the element in the form of environmentally stable solid compounds. In the absence of iron the final product is typically of the form Cr(OH){sub 3}·xH{sub 2}O whereas in the presence of iron the precipitate is a mixed Fe{sub (1−x)}Cr{sub x}(OH){sub 3} phase. In this study, we report on the synthesis, characterisation and stability of mixed (Fe{sub x},Cr{sub 1−x})(OH){sub 3} hydroxides as compared to the stability of Cr(OH){sub 3}. We established that the plain Cr(III) hydroxide, abiding to the approximate molecular formula Cr(OH){sub 3}·3H{sub 2}O, was crystalline, highly soluble, i.e. unstable, with a tendency to transform into the stable amorphous hydroxide Cr(OH){sub 3}(am) phase. Mixed Fe{sub 0.75}Cr{sub 0.25}(OH){sub 3} hydroxides were found to be of the ferrihydrite structure, Fe(OH){sub 3}, and we correlated their solubility to that of a solid solution formed by plain ferrihydrite and the amorphous Cr(III) hydroxide. Both our experimental results and thermodynamic calculations indicated that mixed Fe(III)–Cr(III

  14. Gen-III/III+ reactors. Solving the future energy supply shortfall. The SWR-1000 option

    International Nuclear Information System (INIS)

    Stosic, Z.V.


    Deficiency of non-renewable energy sources, growing demand for electricity and primary energy, increase in population, raised concentration of greenhouse gases in the atmosphere and global warming are the facts which make nuclear energy currently the most realistic option to replace fossil fuels and satisfy global demand. The nuclear power industry has been developing and improving reactor technology for almost five decades and is now ready for the next generation of reactors which should solve the future energy supply shortfall. The advanced Gen-III/III+ (Generation III and/or III+) reactor designs incorporate passive or inherent safety features which require no active controls or operational intervention to manage accidents in the event of system malfunction. The passive safety equipment functions according to basic laws of physics such as gravity and natural convection and is automatically initiated. By combining these passive systems with proven active safety systems, the advanced reactors can be considered to be amongst the safest equipment ever made. Since the beginning of the 90's AREVA NP has been intensively engaged in the design of two advanced Gen-III+ reactors: (i) PWR (Pressurized Water Reactor) EPR (Evolutionary Power Reactor) and (ii) BWR (Boiling Water Reactor) SWR-1000. The SWR-1000 reactor design marks a new era in the successful tradition of BWR technology. It meets the highest safety standards, including control of a core melt accident. This is achieved by supplementing active safety systems with passive safety equipment of diverse design for accident detection and control and by simplifying systems needed for normal plant operation. A short construction period, flexible fuel cycle lengths and a high fuel discharge burn-up contribute towards meeting economic goals. The SWR-1000 completely fulfils international nuclear regulatory requirements. (author)

  15. Mixed ligand complexes of some of the rare earths. La(III)-, Pr(III)- or Nd-(III)-CDTA-Hydroxy Acids

    Energy Technology Data Exchange (ETDEWEB)

    Rana, H S; Tandon, J P [Rajasthan Univ., Jaipur (India). Chemical Labs.


    Biligand complexes of the 1:1 Ln(III)-1,2-diaminocyclohexane-tetraacetic acid (CDTA) chelate with hydroxy acids (where hydroxy acids = salicylic acid (SA); Sulphosalicylic acid (SSA) and 8-hydroxyquinoline-5-sulphonic acid (HQSA)) have been investigated by potentiometric titration. Their formation constants have been calculated ( 3/; and t=30+-1 deg C) as 4.60 +-0.03, 5.46+-0.03, 5.87+-0.05; 3.12+-0.04, 3.95+-0.05, 4.42+-0.07; 2.73+-0.06, 3.45+-0.05 and 3.90+-0.08 for Ln(III)-CDTA-SA,-SSA, and -HQSA respectively (where Ln=La, Pr or Nd). The value of log Ksub(MAB) follows the order: La(III)).

  16. Antithrombin III in animal models of sepsis and organ failure. (United States)

    Dickneite, G


    Antithrombin III (AT III) is the physiological inhibitor of thrombin and other serine proteases of the clotting cascade. In the development of sepsis, septic shock and organ failure, the plasma levels of AT III decrease considerably, suggesting the concept of a substitution therapy with the inhibitor. A decrease of AT III plasma levels might also be associated with other pathological disorders like trauma, burns, pancreatitis or preclampsia. Activation of coagulation and consumption of AT III is the consequence of a generalized inflammation called SIRS (systemic inflammatory response syndrome). The clotting cascade is also frequently activated after organ transplantation, especially if organs are grafted between different species (xenotransplantation). During the past years AT III has been investigated in numerous corresponding disease models in different animal species which will be reviewed here. The bulk of evidence suggests, that AT III substitution reduces morbidity and mortality in the diseased animals. While gaining more experience with AT III, the concept of substitution therapy to maximal baseline plasma levels (100%) appears to become insufficient. Evidence from clinical and preclinical studies now suggests to adjust the AT III plasma levels to about 200%, i.e., doubling the normal value. During the last few years several authors proposed that AT III might not only be an anti-thrombotic agent, but to have in addition an anti-inflammatory effect.

  17. Radiometric titration of thallium(III) with EDTA

    International Nuclear Information System (INIS)

    Rao, V.R.S.; Pulla Rao, Ch.; Tataiah, G.


    Radioactive solutions containing very small amounts of thallium(III) can be determined by radiometric titration using ammonia as hydrolysing agent. Aqueous solution of thallium(I) (both inactive and radioactive) is treated with bromine water till the appearance of the brown colour of bromine, and the solution is warmed to 80 deg C to expel the excess bromine. By this procedure all thallium(I) is quantitatively oxidised to thallium(III). An aqueous solution of ammonia is added to precipitate thallium(III) as thallic oxide. It is then filtered, washed with water to free it from bromide and then dissolved in 2N HCl and the solution is then standardised. 2 ml of this solution is transferred to a 20 ml volumetric flask, 1 ml of radioactive thallium(III) solution to be standardised is added as well as incremental amounts of EDTA solution and mixed thoroughly. Uncomplexed thallium(III) is then precipitated by the addition of an ammonia solution and diluted to 20 ml. Required amount of this mixture is centrifuged. The beta activity of the supernatant aliquot is measured using a GM counter. Quantitative determination of Tl(III) in the range of 1-10 μM can be carried out. The interference of cations such as Au(III), iron(III), Ga(III) can be eliminated by pretreatment of the Tl(III) solution before carrying out radiometric titration. The results obtained are reproducible and accurate to +-3%. (T.I.)

  18. SPEAR III: A brighter source at SSRL

    International Nuclear Information System (INIS)

    Hettel, R.; Boyce, R.; Brennan, S.


    By replacing the magnets and vacuum chamber for the 3 GeV SPEAR II storage ring, the natural emittance of the machine can be reduced from 130 to 18 nm-rad and the stored current can be raised from 100 to 200 mA with a 50 h lifetime. This configuration increases focused photon flux for insertion device beamlines by an order of magnitude and the photon brightness for future undulators would exceed 10 18 at 5 keV. Due to a higher critical energy, the photon flux in the 20 keV range for bending magnet beamlines increases by more than two orders of magnitude. We present preliminary SPEAR III design study results and plans to implement the facility upgrade with minimal downtime for SSRL users

  19. The Davros III supervisory control system

    International Nuclear Information System (INIS)

    Rice, P.


    Magnox Electric's Remote Operations Branch deploy a wide variety of remote inspection and maintenance tools into nuclear plant in order to perform a variety of tasks. In recent years much progress has been made on low-level control of individual manipulator axes, and a parallel need has emerged for a supervisory system to assist the operator in the control of the whole system. Some requirements are: 1) to improve operator control of systems; 2) to simplify software maintenance and version control; 3) to reduce the likelihood of damage to manipulators; 4) to assist with rehearsals and simulations. Davros III is a PC software system which has been developed over a number of years to address these requirements. In a single program capable of being configured for a wide variety of applications, it provides a technique for following pretaught routes, a comprehensive and fully configurable interlock system and several different facilities for simulation. (author)

  20. The Davros III supervisory control system

    International Nuclear Information System (INIS)

    Rice, P.


    Magnox Electric's Remote Operations Bbranch deploy a wide variety of remote inspection and maintenance tools into nuclear plant in order to perform a variety of tasks. In recent years much progress has been made on low-level control of individual manipulator axes and a parallel need has emerged for a supervisory system to assist the operator in the control of the whole system. Some requirements are: 1, To improve operator control of systems. 2, To simplify software maintenance and version control. 3, To reduce the likelihood of damage to manipulators. 4, To assist with rehearsals and simulations. Davros III is a PC software system which has been developed over a number of years to address these requirements. In a single program capable of being configured for a wide variety of applications, it provides a technique for following pretaught routes, a comprehensive and fully configurable interlock system and several different facilities for simulation. (author)

  1. Results on the iota from Mark III

    International Nuclear Information System (INIS)

    Richman, J.D.


    A survey is presented of Mark III results on the iota(1440), a possible glueball state observed in radiative J/psi decays. The measurements include a spin-parity determination using both the iota → Ksub(s) 0 K +- π +- and iota → K + K - π 0 decay modes; an upper limit on the K*anti-K content of the Kanti-Kπ Dalitz plot; branching fractions and isospin; stringent upper limits for several hadronic channels, including iota → zetaπ→etaππ; and results from a search for iota radiative decays into vector mesons. These measurements are discussed in the context of theoretical ideas about the iota and results on the E(1420), a state observed in hadronic interactions. 11 refs., 7 figs

  2. Conference on Fractals and Related Fields III

    CERN Document Server

    Seuret, Stéphane


    This contributed volume provides readers with an overview of the most recent developments in the mathematical fields related to fractals, including both original research contributions, as well as surveys from many of the leading experts on modern fractal theory and applications. It is an outgrowth of the Conference of Fractals and Related Fields III, that was held on September 19-25, 2015 in île de Porquerolles, France. Chapters cover fields related to fractals such as harmonic analysis, multifractal analysis, geometric measure theory, ergodic theory and dynamical systems, probability theory, number theory, wavelets, potential theory, partial differential equations, fractal tilings, combinatorics, and signal and image processing. The book is aimed at pure and applied mathematicians in these areas, as well as other researchers interested in discovering the fractal domain.

  3. The Doublet III neutral beam injector cryosystem

    International Nuclear Information System (INIS)

    Langhorn, A.R.


    This chapter describes neutral beam injection into the Doublet III tokamak for plasma heating experiments. Cryopanels employed in the beamline vacuum pumping system are force flow cooled to 3.8 K by a closed loop refrigeration system. Topics considered include beamline description, cryosystem description, system characteristics, and operational history. Evaluation of the first beamline was carried out using a 25 L/h liquefier and a unique reliquefaction heat exchanger to permit subatmospheric operation and panel flow rates of 140 L/h. The system was upgraded for three beamline operation by substitution of a 100 L/h liquefier and more cryogen storage capacity. It is concluded that the cryosystem gives stable operation of three beamline cryopanel arrays with little operator intervention

  4. Potassium tetracyanidoaurate(III monohydrate: a redetermination

    Directory of Open Access Journals (Sweden)

    Nobuyuki Matsushita


    Full Text Available The structure of the title metal complex salt, K[Au(CN4]·H2O, has been redetermined using X-ray diffraction data at 173 K in order to improve the precision. The previous determination was based on neutron diffraction data [Bertinotti & Bertinotti (1970. Acta Cryst. B26, 422–428]. The title compound crystallizes in the space group P212121 with one potassium cation, one [Au(CN4]− anion and one water molecule in the asymmetric unit. The AuIII atom lies on a general position and has an almost square-planar coordination sphere defined by four cyanide ligands. Interactions between the potassium cation and N atoms of the complex anion, as well as O—H...N hydrogen bonds, lead to the formation of a three-dimensional framework structure.

  5. Voltage current characteristics of type III superconductors

    International Nuclear Information System (INIS)

    Dorofejev, G.L.; Imenitov, A.B.; Klimenko, E.Y.


    An adequate description of voltage-current characteristics is important in order to understand the nature of high critical current for the electrodynamic construction of type-III superconductors and for commercial superconductor specification. Homogeneous monofilament and multifilament Nb-Ti, Nb-Zr,Nb 3 Sn wires were investigated in different ranges of magnetic field, temperature and current. The shape of the voltage-current characteristics of multifilament wires, and the parameter's dependence on temperature and magnetic field may be explained qualitatively by the longitudinal heterogeneous nature of the filaments. A method of attaining the complete specification of the wire's electro-physical properties is proposed. It includes the traditional description of a critical surface (i.e. the surface corresponding to a certain conventional effective resistivity in T,B,J-space) and a description of any increasing parameter that depends on B and T. (author)

  6. Voltage current characteristics of type III superconductors

    Energy Technology Data Exchange (ETDEWEB)

    Dorofeiev, G L; Imenitov, A B; Klimenko, E Y [Gosudarstvennyi Komitet po Ispol' zovaniyu Atomnoi Ehnergii SSSR, Moscow. Inst. Atomnoi Ehnergii


    An adequate description of voltage-current characteristics is important in order to understand the nature of high critical current for the electrodynamic construction of type-III superconductors and for commercial superconductor specification. Homogeneous monofilament and multifilament Nb-Ti, Nb-Zr,Nb/sub 3/Sn wires were investigated in different ranges of magnetic field, temperature and current. The shape of the voltage-current characteristics of multifilament wires, and the parameter's dependence on temperature and magnetic field may be explained qualitatively by the longitudinal heterogeneous nature of the filaments. A method of attaining the complete specification of the wire's electro-physical properties is proposed. It includes the traditional description of a critical surface (i.e. the surface corresponding to a certain conventional effective resistivity in T,B,J-space) and a description of any increasing parameter that depends on B and T.

  7. Type III apical transportation of root canal

    Directory of Open Access Journals (Sweden)

    Shiv P Mantri


    Full Text Available Procedural accidents leading to complications such as canal transportation have been ascribed to inapt cleaning and shaping concepts. Canal transportation is an undesirable deviation from the natural canal path. Herewith a case of apical transportation of root canal resulting in endodontic retreatment failure and its management is presented. A healthy 21-year-old young male presented discomfort and swelling associated with painful endodontically retreated maxillary incisor. Radiograph revealed periradicular radiolucency involving underfilled 11 and overfilled 12. Insufficiently obturated 11 exhibited apical transportation of canal. This type III transportation was treated by periradicular surgery and repair using white mineral trioxide aggregate (MTA. Comfortable asymptomatic patient presented uneventful healing at third and fourth month recall visits. A decrease in the size of radiolucency in radiograph supported the clinical finding. In the present case, MTA is useful in repairing the transportation defect. The result of these procedures is predictable and successful.

  8. Phagocytosis in phosphate chromium (III) suspensions

    International Nuclear Information System (INIS)

    Cruz-Arencibia, Jorge; Fano Machín, Yoiz; Cruz-Morales, Ahmed; Tamayo Fuente, Radamés; Morín-Zorrilla, José


    Phagocytosis in vivo and in vitro of a suspension of chromic phosphate (III) labeled with 51 Cr and 32 P is studied. The radioactive particles dispersed in a media of 2 % gelatin in acetate buffer pH 4-4.5 have a predominant size of 0.8 μm and 5 μm. According with biodistribution experiments in rats after 30 minutes near the 80 % of radioactivity is registered in the liver, probably associated with phagocytosis of the particles by liver Kupffer cells. Is also showed that the suspension particles are phagocytized in vitro by mouse peritoneal macrophages. This facts indicate that the studied suspension have appropriate characteristics to be used in radiosynoviorthesis according to the principal action mechanism described for this procedure, particles phagocytosis by cells present in the inflamed synovium. (author)

  9. The PISC III programme: 1989 status report

    International Nuclear Information System (INIS)

    Crutzen, S.; Jehenson, P.; McDonald, N.


    The PISC Programme has the general objective of assessing procedures and techniques in use for the inspection of pressure components (in particular the vessel and piping). The Series of projects for the Inspection of Steel Components carried out since 1974 under the auspices of the CEC/JRC and the OECD/NEA is a major international effort to better assess the capability and reliability of Non Destructive Inspection procedures on structural components. The programme is now in its third phase (PISC III project); the activities are concentrated on the validation of the PISC II results (e.g. modification of the ASME Inspection Codes) on real structures containing real service defects and the extension of the PISC methodology on most important structural components made of different materials. Most of the PISC test assemblies and structure pieces are representative of (or are coming from) nuclear reactor components. (author)

  10. Hadron component of families (exp. 'Pamir' III)

    International Nuclear Information System (INIS)



    Possibilities of nuclear interaction investigation at 10 15 - 10 16 ev by means of analysis of family hadron component, registered in carbon and deep lead x-ray emulsion chambers, are discussed. The paper is divided in three parts. General properties of hadron families are discribed and compared in C and Pb chambers (part I). Correlations between gamma and hadron components of families are studied in the part II. It is shown that fluctuations of energies of this component are wider than in usually used models of nuclear interactions. The ratio of single hadron flux to the flux of γ-families is connected with cross-section and energy dissipation of nuclear interactions at about 10 16 ev (part III). (author)

  11. Thermal oxidation of III-V compounds

    International Nuclear Information System (INIS)

    Monteiro, O.R.; Evans, J.W.


    The thermal oxidation of two important III-V compound semiconductor materials, namely GaAs and InP, has been studied between 300 and 600 0 C. In-situ TEM, cross-sectional TEM (XTEM) and SIMS analyses were used to characterize the reaction products. The first technique allows us to access the reactions at the very moment they are occurring. XTEM provides a clearer picture of the distribution of phases in the oxidized samples. SIMS gives us information on the dopant redistribution after oxidation as well as enrichment of group V element at the oxide semiconductor interface. Based on those results, the reaction products were characterized and reaction mechanisms proposed

  12. Paisagem e Património III


    Cardoso, Isabel; Carapinha, Aurora; Rodrigues, Paulo; Matos, Rute; Santos, Ilda


    Com Paisagem e Património III (2013-2014) abordamos agora o Som, elemento frequentemente relegado para segundo plano, o que está em manifesta contradição com o impacto que tem na nossa apreciação da paisagem, mas também do património. Capacidade auditiva e sentido de equilíbrio são as duas funções do ouvido, que fazem dele um órgão do espaço tridimensional. A propagação relativamente lenta do som (330m p/ segundo) permite-nos uma avaliação bastante fiável da profundidade do espaço. Por sua ve...

  13. Cranial nerves III, IV and VI

    International Nuclear Information System (INIS)

    Laine, I.J.; Smoker, W.R.; Kuta, A.J.; Felton, W.L.


    Because of advances in CT and MR imaging, accurate identification and evaluation of cranial nerve lesions is now possible. Cranial nerves III, IV, and VI, providing motor and sensory control of the eye, can be evaluated as a unit. In this paper, the authors present an overview of the anatomy and pathology of these cranial nerves. We first illustrate their normal anatomic pathways from the brain stem to the orbit. This is followed by clinical examples of patients with a variety of isolated and complex palsies of these three cranial nerves. This is accomplished by inclusion of ocular photographs, correlative imaging studies, and the use of diagrams. Knowledge of the gross and imaging anatomy and the ophthalmologic manifestations of pathology affecting these three cranial nerves permits a tailored approach to their evaluation

  14. MAQARIN natural analogue study: phase III

    Energy Technology Data Exchange (ETDEWEB)

    Alexander, W R; Mazurek, M; Waber, H N [Univ. of Berne (Switzerland). Institutes of Geology, Mineralogy and Petrology, Rock-Water Interaction Group (GGWW); Arlinger, J; Erlandson, A C; Hallbeck, L; Pedersen, K [Goeteborg University (Sweden). Dept. of General and Marine Microbiology; Boehlmann, W; Fritz, P; Geyer, S; Geyer, W; Hanschman, G; Kopinke, F D; Poerschmann, J [Umweltforschungszentrum Leipzig-Halle (Germany); Chambers, A V; Haworth, A; Ilett, D; Linklater, C M; Tweed, C J [AEA Technology plc, Harwell (United Kingdom); Chenery, S R.N.; Kemp, S J; Milodowski, A E; Pearce, J M; Reeder, S; Rochelle, C A; Smith, B; Wetton, P D; Wragg, J [British Geological Survey, Keyworth (United Kingdom); Clark, I D [Univ. of Ottawa (Canada). Dept. of Geology; Hodginson, E; Hughes, C R [Univ. of Manchester (United Kingdom). Dept. of Earth Sciences; Hyslop, E K [British Geological Survey, Edinburgh (United Kingdom); Karlsson, F [Swedish Nuclear Fuel and Waste Management Co., Stockholm (Sweden); Khoury, H N; Salameh, E [Univ. of Jordan, Amman (Jordan); Lagerblad, B [Cement Institute, Stockholm (Sweden); Longworth, G [Univ. of Manchester (United Kingdom). Dept. of Geology; Pitty, A F [Private consultant, Norwich (United Kingdom); Savage, D [QuantiSci Ltd, Melton Mowbray (United Kingdom); Smellie, J A.T. [ed.; Conterra AB, Uppsala (Sweden)


    This report represents the conclusion to Phase III of the Maqarin Natural Analogue Study. The main thrust was to establish the origin and chemistry of the Western Springs hyper alkaline groundwaters (Na/K enriched Ca(OH){sub 2} type) and to study their interaction with rocks of different compositions, as natural analogues to key processes that might occur at an early stage within the `alkali disturbed zone` of cementitious repositories in different host rocks. Whilst earlier studies at Maqarin were very much site-specific and process-oriented, Phase III provided a regional perspective to the geological evolution of the Maqarin region. This was made possible by greater field access which allowed a more systematic structural and geomorphological study of the area. This has resulted in a greater understanding of the age and spatial relationships concerning formation of the cement zones through spontaneous combustion of the Bituminous Marls, and the subsequent formation of high pH groundwaters at the Eastern and Western Springs locations. At the Western Springs locality, hydrochemical and hydrogeological evaluation of new and published data (plus access to unpublished data), together with detailed mineralogical and geochemical studies, helped to clarify the very earliest stage of cement leachate/host rock interaction. The data were used also to test coupled flow/transport codes developed to assess the long-term evolution of a cementitious repository. Additional objectives addressed include: a) rock matrix diffusion, b) the occurrence and chemical controls on zeolite composition, e) the occurrence and chemical controls on clay stability, and d) the role of microbes, organics and colloids in trace element transport. The Maqarin site now provides a consistent picture explaining the origin of the hyperalkaline groundwaters, and is therefore a unique location for the examination of the mechanisms and processes associated with cementitious repositories. Application of these

  15. MAQARIN natural analogue study: phase III

    International Nuclear Information System (INIS)

    Alexander, W.R.; Mazurek, M.; Waber, H.N.; Arlinger, J.; Erlandson, A.C.; Hallbeck, L.; Pedersen, K.; Chambers, A.V.; Haworth, A.; Ilett, D.; Linklater, C.M.; Tweed, C.J.; Chenery, S.R.N.; Kemp, S.J.; Milodowski, A.E.; Pearce, J.M.; Reeder, S.; Rochelle, C.A.; Smith, B.; Wetton, P.D.; Wragg, J.; Clark, I.D.; Karlsson, F.; Khoury, H.N.; Salameh, E.; Lagerblad, B.; Longworth, G.; Savage, D.; Smellie, J.A.T.


    This report represents the conclusion to Phase III of the Maqarin Natural Analogue Study. The main thrust was to establish the origin and chemistry of the Western Springs hyper alkaline groundwaters (Na/K enriched Ca(OH) 2 type) and to study their interaction with rocks of different compositions, as natural analogues to key processes that might occur at an early stage within the 'alkali disturbed zone' of cementitious repositories in different host rocks. Whilst earlier studies at Maqarin were very much site-specific and process-oriented, Phase III provided a regional perspective to the geological evolution of the Maqarin region. This was made possible by greater field access which allowed a more systematic structural and geomorphological study of the area. This has resulted in a greater understanding of the age and spatial relationships concerning formation of the cement zones through spontaneous combustion of the Bituminous Marls, and the subsequent formation of high pH groundwaters at the Eastern and Western Springs locations. At the Western Springs locality, hydrochemical and hydrogeological evaluation of new and published data (plus access to unpublished data), together with detailed mineralogical and geochemical studies, helped to clarify the very earliest stage of cement leachate/host rock interaction. The data were used also to test coupled flow/transport codes developed to assess the long-term evolution of a cementitious repository. Additional objectives addressed include: a) rock matrix diffusion, b) the occurrence and chemical controls on zeolite composition, e) the occurrence and chemical controls on clay stability, and d) the role of microbes, organics and colloids in trace element transport. The Maqarin site now provides a consistent picture explaining the origin of the hyperalkaline groundwaters, and is therefore a unique location for the examination of the mechanisms and processes associated with cementitious repositories. Application of these

  16. Class III malocclusion with severe anteroposterior discrepancy

    Directory of Open Access Journals (Sweden)

    Susana Maria Deon Rizzatto


    Full Text Available This study aims at reporting the clinical case of a patient with Class III skeletal malocclusion with severe maxillary deficiency, producing a reduced midface associated with severe mandibular prognathism. The pre-surgical orthodontic preparation was composed mainly by dentoalveolar expansion and repositioning of the incisors in the lower arch. Then, a combined maxillary and mandibular orthognathic surgery was performed. The treatment objectives were achieved, with significant improvement in facial esthetics and occlusion, followed by post-treatment stability. This case was presented to the Brazilian Board of Orthodontics and Facial Orthopedics (BBO, as part of the requirements for obtaining the title of Diplomate by BBO.O objetivo deste artigo é relatar o caso clínico de um paciente portador de má oclusão de Classe III esquelética com acentuada deficiência maxilar, causando redução do terço médio da face, associada a severo prognatismo mandibular. O preparo ortodôntico pré-cirúrgico foi composto, principalmente, pela expansão dentoalveolar da maxila e o reposicionamento dos incisivos na arcada inferior. Depois, foi realizada a cirurgia ortognática combinada maxilomandibular. Os objetivos do tratamento foram atingidos, com significativa melhora da oclusão e da estética facial, seguida de estabilidade pós-tratamento. Esse caso foi apresentado à Diretoria do Board Brasileiro de Ortodontia e Ortopedia Facial (BBO, como parte dos requisitos para obtenção do título de Diplomado pelo BBO.

  17. MAQARIN natural analogue study: phase III

    Energy Technology Data Exchange (ETDEWEB)

    Alexander, W R; Mazurek, M; Waber, H N [Univ. of Berne (Switzerland). Institutes of Geology, Mineralogy and Petrology, Rock-Water Interaction Group (GGWW); Arlinger, J; Erlandson, A C; Hallbeck, L; Pedersen, K [Goeteborg Univ. (Sweden). Dept. of General and Marine Microbiology; Boehlmann, W; Fritz, P; Geyer, S; Geyer, W; Hanschman, G; Kopinke, F D; Poerschmann, J [Umweltforschungszentrum Leipzig-Halle (Germany); Chambers, A V; Haworth, A; Ilett, D; Linklater, C M; Tweed, C J [AEA Technology plc, Harwell (United Kingdom); Chenery, S R.N.; Kemp, S J; Milodowski, A E; Pearce, J M; Reeder, S; Rochelle, C A; Smith, B; Wetton, P D; Wragg, J [British Geological Survey, Keyworth (United Kingdom); Clark, I D [Univ. of Ottawa (Canada). Dept. of Geology; Hodginson, E; Hughes, C R [Univ. of Manchester (United Kingdom). Dept. of Earth Sciences; Hyslop, E K [British Geological Survey, Edinburgh (United Kingdom); Karlsson, F [Swedish Nuclear Fuel and Waste Management Co., Stockholm (Sweden); Khoury, H N; Salameh, E [Univ. of Jordan, Amman (Jordan); Lagerblad, B [Cement Inst., Stockholm (Sweden); Longworth, G [Univ. of Manchester (United Kingdom). Dept. of Geology; Pitty, A F [Private consultant, Norwich (United Kingdom); Savage, D [QuantiSci Ltd, Melton Mowbray (United Kingdom); Smellie, J A.T. [ed.; Conterra AB, Uppsala (Sweden)


    This report represents the conclusion to Phase III of the Maqarin Natural Analogue Study. The main thrust was to establish the origin and chemistry of the Western Springs hyper alkaline groundwaters (Na/K enriched Ca(OH){sub 2} type) and to study their interaction with rocks of different compositions, as natural analogues to key processes that might occur at an early stage within the `alkali disturbed zone` of cementitious repositories in different host rocks. Whilst earlier studies at Maqarin were very much site-specific and process-oriented, Phase III provided a regional perspective to the geological evolution of the Maqarin region. This was made possible by greater field access which allowed a more systematic structural and geomorphological study of the area. This has resulted in a greater understanding of the age and spatial relationships concerning formation of the cement zones through spontaneous combustion of the Bituminous Marls, and the subsequent formation of high pH groundwaters at the Eastern and Western Springs locations. At the Western Springs locality, hydrochemical and hydrogeological evaluation of new and published data (plus access to unpublished data), together with detailed mineralogical and geochemical studies, helped to clarify the very earliest stage of cement leachate/host rock interaction. The data were used also to test coupled flow/transport codes developed to assess the long-term evolution of a cementitious repository. Additional objectives addressed include: a) rock matrix diffusion, b) the occurrence and chemical controls on zeolite composition, e) the occurrence and chemical controls on clay stability, and d) the role of microbes, organics and colloids in trace element transport. The Maqarin site now provides a consistent picture explaining the origin of the hyperalkaline groundwaters, and is therefore a unique location for the examination of the mechanisms and processes associated with cementitious repositories. Application of these

  18. Variation in plasmonic (electronic) spectral parameters of Pr (III) and Nd (III) with varied concentration of moderators

    Energy Technology Data Exchange (ETDEWEB)

    Mishra, Shubha, E-mail: [School of Studies in Physics, Vikram University, Ujjain (M. P.) (India); Limaye, S. N., E-mail: [Department of Chemistry, Dr. H.S. Gour University, A Central University, Sagar (M.P.) (India)


    It is said that the -4f shells behave as core and are least perturbed by changes around metal ion surrounding. However, there are evidences that-4f shells partially involved in direct moderator interaction. A systematic investigation on the plasmonic (electronic) spectral studies of some Rare Earths[RE(III).Mod] where, RE(III) = Pr(III),Nd(III) and Mod(moderator) = Y(III),La(III),Gd(III) and Lu(III), increased moderator concentration from 0.01 mol dm{sup −3} to 0.025 mol dm{sup −3} keeping the metal ion concentration at 0.01mol dm{sup −3} have been carried out. Variations in oscillator strengths (f), Judd-Ofelt parameters (T{sub λ}),inter-electronic repulsion Racah parameters (δE{sup k}),nephelauxetic ratio (β), radiative parameters (S{sub ED},A{sub T},β{sub R},T{sub R}). The values of oscillator strengths and Judd-Ofelt parameters have been discussed in the light of coordination number of RE(III) metal ions, denticity and basicity of the moderators. The [RE(III).Mod] bonding pattern has been studies in the light of the change in Racah parameters and nephelauxetic ratio.

  19. Adsorption behavior of Am(III) on granite

    International Nuclear Information System (INIS)

    Zhang Yingjie; Feng Xiaogui; Liang Junfu; Chen Jing; Su Rui; Wang Ju; Liu Chunli


    The adsorption behavior of Am(III) on granite (sampled from drilling well BS01 at Beishan (BS) area--a potential candidate site for China's high-level radioactive waste repository, the granite sample's depth about 300 m) was studied in BS03 well groundwater by a batch technique at (25±1) degree C. The influences of pH, sulphate ion, total carbonate ion, humic acid, and concentration of the Am(III) on the adsorption behavior were also studied, and the possible adsorption mechanism was discussed. Experimental results show that the adsorption distribution rate of Am(III) on granite increases with increasing pH of aqueous phase. The chemical composition of the groundwater is the main factor which influences the species of Am(III) and adsorption behavior. The adsorption mechanism of Am(III) on granite is surface complexation. The adsorption isotherm of Am(III) on granite can be described by Freundlich's equation. (authors)

  20. Detection of COL III in Parchment by Amino Acid Analysis

    DEFF Research Database (Denmark)

    Vestergaard Poulsen Sommer, Dorte; Larsen, René


    Cultural heritage parchments made from the reticular dermis of animals have been subject to studies of deterioration and conservation by amino acid analysis. The reticular dermis contains a varying mixture of collagen I and III (COL I and III). When dealing with the results of the amino acid...... analyses, till now the COL III content has not been taken into account. Based on the available amino acid sequences we present a method for determining the amount of COL III in the reticular dermis of new and historical parchments calculated from the ratio of Ile/Val. We find COL III contents between 7...... and 32 % in new parchments and between 0.2 and 40 % in the historical parchments. This is consistent with results in the literature. The varying content of COL III has a significant influence on the uncertainty of the amino acid analysis. Although we have not found a simple correlation between the COL...

  1. Distribution and Translocation of 141Ce (III) in Horseradish (United States)

    Guo, Xiaoshan; Zhou, Qing; Lu, Tianhong; Fang, Min; Huang, Xiaohua


    Background and Aims Rare earth elements (REEs) are used in agriculture and a large amount of them contaminate the environment and enter foods. The distribution and translocation of 141Ce (III) in horseradish was investigated in order to help understand the biochemical behaviour and toxic mechanism of REEs in plants. Method The distribution and translocation of 141Ce (III) in horseradish were investigated using autoradiography, liquid scintillation counting (LSC) and electron microscopic autoradiography (EMARG) techniques. The contents of 141Ce (III) and nutrient elements were analysed using an inductively coupled plasma-atomic emission spectrometer (ICP-AES). Results The results from autoradiography and LSC indicated that 141Ce (III) could be absorbed by horseradish and transferred from the leaf to the leaf-stalk and then to the root. The content of 141Ce (III) in different parts of horseradish was as follows: root > leaf-stalk > leaf. The uptake rates of 141Ce (III) in horseradish changed with the different organs and time. The content of 141Ce (III) in developing leaves was greater than that in mature leaves. The results from EMARG indicated that 141Ce (III) could penetrate through the cell membrane and enter the mesophyll cells, being present in both extra- and intra-cellular deposits. The contents of macronutrients in horseradish were decreased by 141Ce (III) treatment. Conclusions 141Ce (III) can be absorbed and transferred between organs of horseradish with time, and the distribution was found to be different at different growth stages. 141Ce (III) can enter the mesophyll cells via apoplast and symplast channels or via plasmodesmata. 141Ce (III) can disturb the metabolism of macronutrients in horseradish. PMID:17921527

  2. Use of COMCAN III in system design and reliability analysis

    International Nuclear Information System (INIS)

    Rasmuson, D.M.; Shepherd, J.C.; Marshall, N.H.; Fitch, L.R.


    This manual describes the COMCAN III computer program and its use. COMCAN III is a tool that can be used by the reliability analyst performing a probabilistic risk assessment or by the designer of a system desiring improved performance and efficiency. COMCAN III can be used to determine minimal cut sets of a fault tree, to calculate system reliability characteristics, and to perform qualitative common cause failure analysis

  3. Analogues of Cucurbita maxima trypsin inhibitor III (CMTI-III) with elastase inhibitory activity. (United States)

    Rózycki, J; Kupryszewski, G; Rolka, K; Ragnarsson, U; Zbyryt, T; Krokoszyńska, I; Wilusz, T


    Three new CMTI-III analogues containing the Val residue in the reactive site (position 5) were synthesized by the solid-phase method. The analogues displayed an elastase inhibitory activity. It is shown that the removal of the N-terminal Arg residue and the introduction of the Gly-Pro-Gln tripeptide in the region 23-25 decreases the antielastase activity by two orders of magnitude. The removal of the disulfide bridge in positions 16-28 and the substitution of Ala for Cys16 and Gly for Cys28 decreases the activity (measured as Ka with HLE) by five orders of magnitude as compared with [Val5]CMTI-III.

  4. Extraction of Am (III) and Nd (III): comparison of TODGA and TEHDGA

    International Nuclear Information System (INIS)

    Gujar, R.B.; Murali, M.S.; Ansari, S.A.; Manchanda, V.K.


    Belonging to the class of extractants, diglycolamides which are recently explored and promising for actinide partitioning, two reagents (N, N, N', N'-tetraoctyl diglycolamide) TODGA and its isomerically substituted counterpart, (N, N, N', N'- tetraethylhexyl diglycolamide) TEHDGA after addition of suitable phase modifiers, Dihexyoctanamide and isodecanol respectively in dodecane have been compared in their extraction abilities for Am (III) and Nd (III) from nitric acid as well as simulated high-level waste solutions (SHLW) equivalent to HLW arising from PHWR fuel reprocessing. Both 0.1M TODGA + 0.5M DHOA and 0.2M TEHDGA + 30% isodecanol in dodecane display high distribution ratios for the trivalent metal ions of f-elements. Similarities and differences in their extraction are discussed. (author)

  5. Aqueous phase complexation of Cm(III) and Cf(III) with ionizable macrocyclic ligands

    International Nuclear Information System (INIS)

    Manchanda, V.K.; Mohapatra, P.K.


    Complexation behaviour of Cm(III) and Cf(III) with 1,7-diaza-4,10,13-trioxacyclopentadecane-N,N'-diacetic acid (K21DA), 1,10-diaza-4,7,13,16-tetraoxacyclooctadecane-N,N'-diacetic acid (K22DA) and ethylene diamine N,N'- diacetic acid (EDDA) has been investigated using dinonyl naphthalene sulphonic acid (DNNS), in tetramethyl ammonium form as liquid cation exchanger. The aqueous phase complex formation constants are computed from the distribution data. Though larger complex formation constants are observed with K21DA as well as K22DA compared to those with the acyclic analog EDDA, no size correlation is observed. (author). 5 refs., 1 tab

  6. Rhodium(III)- and iridium(III)-catalyzed C7 alkylation of indolines with diazo compounds. (United States)

    Ai, Wen; Yang, Xueyan; Wu, Yunxiang; Wang, Xuan; Li, Yuanchao; Yang, Yaxi; Zhou, Bing


    A Rh(III)-catalyzed procedure for the C7-selective C-H alkylation of various indolines with α-diazo compounds at room temperature is reported. The advantages of this process are: 1) simple, mild, and pH-neutral reaction conditions, 2) broad substrate scope, 3) complete regioselectivity, 4) no need for an external oxidant, and 5) N2 as the sole byproduct. Furthermore, alkylation and bis-alkylation of carbazoles at the C1 and C8 positions have also been developed. More significantly, for the first time, a successful Ir(III)-catalyzed intermolecular insertion of arene C-H bonds into α-diazo compounds is reported. © 2014 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

  7. Solar neutrino oscillation parameters after SNO Phase-III and SAGE Part-III

    International Nuclear Information System (INIS)

    Yang Ping; Liu Qiuyu


    We analyse the recently published results from solar neutrino experiments SNO Phase-III and SAGE Part-III and show their constraints on solar neutrino oscillation parameters, especially for the mixing angle θ 12 . Through a global analysis using all existing data from SK, SNO, Ga and Cl radiochemical experiments and long base line reactor experiment KamLAND , we obtain the parameters Δm 12 2 =7.684 -0.208 +0.212 x 10 -5 eV 2 , tan 2 θ 12 =0.440 -0.057 +0.059 . We also find that the discrepancy between the KamLAND and solar neutrino results can be reduced by choosing a small non-zero value for the mixing angle θ 13 . (authors)

  8. Uranium (III) precipitation in molten chloride by wet argon sparging

    Energy Technology Data Exchange (ETDEWEB)

    Vigier, Jean-François, E-mail: [CEA, Nuclear Energy Division, Radiochemistry & Processes Department, F-30207 Bagnols sur Cèze (France); Unité de Catalyse et de Chimie du Solide, UCCS UMR CNRS 8181, Univ. Lille Nord de France, ENSCL-USTL, B.P. 90108, 59652 Villeneuve d' Ascq Cedex (France); Laplace, Annabelle [CEA, Nuclear Energy Division, Radiochemistry & Processes Department, F-30207 Bagnols sur Cèze (France); Renard, Catherine [Unité de Catalyse et de Chimie du Solide, UCCS UMR CNRS 8181, Univ. Lille Nord de France, ENSCL-USTL, B.P. 90108, 59652 Villeneuve d' Ascq Cedex (France); Miguirditchian, Manuel [CEA, Nuclear Energy Division, Radiochemistry & Processes Department, F-30207 Bagnols sur Cèze (France); Abraham, Francis [Unité de Catalyse et de Chimie du Solide, UCCS UMR CNRS 8181, Univ. Lille Nord de France, ENSCL-USTL, B.P. 90108, 59652 Villeneuve d' Ascq Cedex (France)


    In the context of pyrochemical processes for nuclear fuel treatment, the precipitation of uranium (III) in molten salt LiCl-CaCl{sub 2} (30–70 mol%) at 705 °C is studied. First, this molten chloride is characterized with the determination of the water dissociation constant. With a value of 10{sup −4.0}, the salt has oxoacid properties. Then, the uranium (III) precipitation using wet argon sparging is studied. The salt is prepared using UCl{sub 3} precursor. At the end of the precipitation, the salt is totally free of solubilized uranium. The main part is converted into UO{sub 2} powder but some uranium is lost during the process due to the volatility of uranium chloride. The main impurity of the resulting powder is calcium. The consequences of oxidative and reductive conditions on precipitation are studied. Finally, coprecipitation of uranium (III) and neodymium (III) is studied, showing a higher sensitivity of uranium (III) than neodymium (III) to precipitation. - Highlights: • Precipitation of Uranium (III) is quantitative in molten salt LiCl-CaCl{sub 2} (30–70 mol%). • The salt is oxoacid with a water dissociation constant of 10{sup −4.0} at 705 °C. • Volatility of uranium chloride is strongly reduced in reductive conditions. • Coprecipitation of U(III) and Nd(III) leads to a consecutive precipitation of the two elements.

  9. Finishing occlusion in Class II or Class III molar relation: therapeutic Class II and III. (United States)

    Nangia, A; Darendeliler, M A


    The most frequent extraction regime consists of the removal of upper and lower premolars. Depending on anchorage requirements, camouflage treatment options, surgical intervention, or the absence of teeth in only one arch, it may become necessary to finalize the occlusion with a one-dental-unit discrepancy between the upper and lower dental arches. Guidelines are presented for finishing occlusions in Class II or Class III molar relation.

  10. Syntheses, structures, and magnetic properties of a family of heterometallic heptanuclear [Cu5Ln2] (Ln = Y(III), Lu(III), Dy(III), Ho(III), Er(III), and Yb(III)) complexes: observation of SMM behavior for the Dy(III) and Ho(III) analogues. (United States)

    Chandrasekhar, Vadapalli; Dey, Atanu; Das, Sourav; Rouzières, Mathieu; Clérac, Rodolphe


    Sequential reaction of the multisite coordination ligand (LH3) with Cu(OAc)2·H2O, followed by the addition of a rare-earth(III) nitrate salt in the presence of triethylamine, afforded a series of heterometallic heptanuclear complexes containing a [Cu5Ln2] core {Ln = Y(1), Lu(2), Dy(3), Ho(4), Er(5), and Yb(6)}. Single-crystal X-ray crystallography reveals that all the complexes are dicationic species that crystallize with two nitrate anions to compensate the charge. The heptanuclear aggregates in 1-6 are centrosymmetrical complexes, with a hexagonal-like arrangement of six peripheral metal ions (two rare-earth and four copper) around a central Cu(II) situated on a crystallographic inversion center. An all-oxygen environment is found to be present around the rare-earth metal ions, which adopt a distorted square-antiprismatic geometry. Three different Cu(II) sites are present in the heptanuclear complexes: two possess a distorted octahedral coordination sphere while the remaining one displays a distorted square-pyramidal geometry. Detailed static and dynamic magnetic properties of all the complexes have been studied and revealed the single-molecule magnet behavior of the Dy(III) and Ho(III) derivatives.

  11. Control Analysis of Hazards Potential in Crude Distiller Unit III PT. Pertamina (Persero) Refinery Unit III Plaju Tahun 2011


    Matariani, Ade; Hasyim, Hamzah; Faisya, Achmad Fickry


    Background: Activities in CDU III are very risk to any hazards potential; because of that hazards potential is much needed in controlling the hazards potential to decrease the accidents and occupational diseases. The aim of this study was to analyze the controlling of hazards potential in CDU III PT. Pertamina (Persero) RU III Plaju in 2011. Method: This study was a qualitative study. The methods of data collection were using in-depth interview and observation. The total of informants in this...


    Energy Technology Data Exchange (ETDEWEB)

    James Boltz


    This project was undertaken to refine the Conversion Extraction Desulfurization (CED) technology to efficiently and economically remove sulfur from diesel fuel to levels below 15-ppm. CED is considered a generic term covering all desulfurization processes that involve oxidation and extraction. The CED process first extracts a fraction of the sulfur from the diesel, then selectively oxidizes the remaining sulfur compounds, and finally extracts these oxidized materials. The Department of Energy (DOE) awarded Petro Star Inc. a contract to fund Phase III of the CED process development. Phase III consisted of testing a continuous-flow process, optimization of the process steps, design of a pilot plant, and completion of a market study for licensing the process. Petro Star and the Degussa Corporation in coordination with Koch Modular Process Systems (KMPS) tested six key process steps in a 7.6-centimeter (cm) (3.0-inch) inside diameter (ID) column at gas oil feed rates of 7.8 to 93.3 liters per hour (l/h) (2.1 to 24.6 gallons per hour). The team verified the technical feasibility with respect to hydraulics for each unit operation tested and successfully demonstrated pre-extraction and solvent recovery distillation. Test operations conducted at KMPS demonstrated that the oxidation reaction converted a maximum of 97% of the thiophenes. The CED Process Development Team demonstrated that CED technology is capable of reducing the sulfur content of light atmospheric gas oil from 5,000-ppm to less than 15-ppm within the laboratory scale. In continuous flow trials, the CED process consistently produced fuel with approximately 20-ppm of sulfur. The process economics study calculated an estimated process cost of $5.70 per product barrel. The Kline Company performed a marketing study to evaluate the possibility of licensing the CED technology. Kline concluded that only 13 refineries harbored opportunity for the CED process. The Kline study and the research team's discussions

  13. Separation of valence forms of chromium(III) and chromium(VI) by coprecipitation with iron(III) hydroxide

    International Nuclear Information System (INIS)

    Nazirmadov, B.; Khamidov, B.O.; Egorova, L.A.


    The sorption of 9.62·10 -5 M of Cr (III) and Cr (VI) with iron hydroxide in 1 M potassium nitrate and potassium chloride was investigated in relation to the pH of the medium. Experimental data on the sorption of chromium(III) and chromium(VI) with iron(III) hydroxide made it possible to determine the region of practically complete concentration of Cr (III) and Cr (VI) (pH = 3-6.5). The results from spectrophotometric investigations, calculated data on the distribution of the hydroxocationic forms of chromium(III) and the anions of chromium(IV), and their sorption by iron-(III) hydroxide made it possible to characterize the sorbability of the cationic and anionic forms of chromium in various degrees of oxidation. On this basis a method was developed for the separation of chromium(III) and chromium(VI) by coprecipitation on iron(III) hydroxide and their separation from the iron(III) hydroxide support

  14. Determination of stability constants of iron(III and chromium(III-nitrilotriacetate-methyl cysteine mixed complexes by electrophoretic technique

    Directory of Open Access Journals (Sweden)

    Brij Bhushan Tewari


    Full Text Available The stability constants of Fe(III and Cr(III with methyl cysteine and nitrilotriacetate (NTA were determined by paper electrophoretic technique. Beside binary ternary complexes have also been studied, in which nitrilotriacetate and methyl cysteine acts as primary and secondary ligand, respectively. The stability constants of mixed ligand complexes metal (M-nitrilotriacetate-methyl cysteine have been found to be 5.72 plus or minus 0.09 and 5.54 plus or minus 0.11 (log K values for Fe(III and Cr(III complexes, respectively, at 35 oC and ionic strength 0.1 M.

  15. Biochemical and Structural Properties of Mouse Kynurenine Aminotransferase III

    Energy Technology Data Exchange (ETDEWEB)

    Han, Q.; Robinson, H; Cai, T; Tagle, D; Li, J


    Kynurenine aminotransferase III (KAT III) has been considered to be involved in the production of mammalian brain kynurenic acid (KYNA), which plays an important role in protecting neurons from overstimulation by excitatory neurotransmitters. The enzyme was identified based on its high sequence identity with mammalian KAT I, but its activity toward kynurenine and its structural characteristics have not been established. In this study, the biochemical and structural properties of mouse KAT III (mKAT III) were determined. Specifically, mKAT III cDNA was amplified from a mouse brain cDNA library, and its recombinant protein was expressed in an insect cell protein expression system. We established that mKAT III is able to efficiently catalyze the transamination of kynurenine to KYNA and has optimum activity at relatively basic conditions of around pH 9.0 and at relatively high temperatures of 50 to 60C. In addition, mKAT III is active toward a number of other amino acids. Its activity toward kynurenine is significantly decreased in the presence of methionine, histidine, glutamine, leucine, cysteine, and 3-hydroxykynurenine. Through macromolecular crystallography, we determined the mKAT III crystal structure and its structures in complex with kynurenine and glutamine. Structural analysis revealed the overall architecture of mKAT III and its cofactor binding site and active center residues. This is the first report concerning the biochemical characteristics and crystal structures of KAT III enzymes and provides a basis toward understanding the overall physiological role of mammalian KAT III in vivo and insight into regulating the levels of endogenous KYNA through modulation of the enzyme in the mouse brain.

  16. The Evolution of Population III Objects (United States)

    de Araujo, J. C. N.; Opher, R.


    RESUMEN. Estudiamos el enfriamiento y colapso de las perturbaciones iso- termicas de masa M % Mj (masa de Jeans en la era de recombinaci6n) y M « Mj tomando en consideraci5n la expansi6n del Universo, presi6n, arrastre de fotones, enfriamiento de fotones (calentamiento), fotoioni- zaci6n, ionizaci5n por colisiones y la formaci6n y enfriamiento de mo- leculas de hidr6geno. Tambien estudiamos el efecto de no-esfericidad, rotaci6n y campos magneticos en el colapso de M % Mj debido a perturbaciones residuales que sobreviven para N « Mj. ABSTRACT. We study the cooling and collapse of isothermal perturbations of mass N % Nj (Jeans mass at recombination era) and N « NJ taking into account the expansion of the Universe, pressure, photon-drag, photon -cooling (heating), photoionization, collisional ionization and the formation and cooling of hydrogen molecules. We also study the effect of the nonsphericity, rotation and magnetic fields in the collapse of N % NJ. The formation of protostars from the fragmentation of clouds of mass M % MJ due to the residual perturbations that survive for N « NJ is also investigated. K ok : HYDRODYNANICS - STARS-POPULATION III

  17. Voltage current characteristics of type III superconductors (United States)

    Dorofejev, G. L.; Imenitov, A. B.; Klimenko, E. Yu.


    An adequate description of voltage-current characteristics is important in order to understand the nature of high critical current for the electrodynamic construction of type-III superconductors and for commercial superconductor specification. Homogenious monofilament and multifilament Nb-Ti, Nb-Zr, Nb 3Sn wires were investigated in different ranges of magnetic field, temperature and current. The longitudinal electric field for homogenious wires may be described by E=J ρnexp- T c/T 0+ T/T 0+ B/B 0+ J/J 0, where To, Bo, Jo are the increasing parameters, which depend weakly on B and T, of the electric field. The shape of the voltage-current characteristics of multifilament wires, and the parameter's dependence on temperature and magnetic field may be explained qualitatively by the longitudinal heterogeneous nature of the filaments. A method of attaining the complete specification of the wire's electro-physical properties is proposed. It includes the traditional description of a critical surface (ie the surface corresponding to a certain conventional effective resistivity in T, B, J - space) and a description of any increasing parameter that depends on B and T.

  18. Class III Malocclusion Surgical-Orthodontic Treatment

    Directory of Open Access Journals (Sweden)

    Bruna Alves Furquim


    Full Text Available The aim of the present case report is to describe the orthodontic-surgical treatment of a 17-year-and-9-month-old female patient with a Class III malocclusion, poor facial esthetics, and mandibular and chin protrusion. She had significant anteroposterior and transverse discrepancies, a concave profile, and strained lip closure. Intraorally, she had a negative overjet of 5 mm and an overbite of 5 mm. The treatment objectives were to correct the malocclusion, and facial esthetic and also return the correct function. The surgical procedures included a Le Fort I osteotomy for expansion, advancement, impaction, and rotation of the maxilla to correct the occlusal plane inclination. There was 2 mm of impaction of the anterior portion of the maxilla and 5 mm of extrusion in the posterior region. A bilateral sagittal split osteotomy was performed in order to allow counterclockwise rotation of the mandible and anterior projection of the chin, accompanying the maxillary occlusal plane. Rigid internal fixation was used without any intermaxillary fixation. It was concluded that these procedures were very effective in producing a pleasing facial esthetic result, showing stability 7 years posttreatment.

  19. Progress in III-V materials technology (United States)

    Grant, Ian R.


    Compound semiconductors, in the form of GaAs and InP have achieved major commercial significance in areas of application such as mobile communications, displays and telecoms and offer a versatility of function beyond the capabilities of Si. III-V compounds, and in particular GaAs, have since their early development been the subject of defence related interest. Support from this sector established the basic materials technologies and nurtured development up until their commercial breakthrough into consumer products. GaAs, for example, now provides essential components for mobile phones and CD / DVD players. An overview is presented of the crystal growth and processing methods used in the manufacture of these materials. Current state of the art characteristics on crystal form and quality are discussed, together with the evolution of single crystal growth techniques. Consideration is given to how these principal compounds together with the minor materials, InSb, GaSb and InAs are employed in diverse applications over a broad spectral range, together with information on markets and future perspectives.

  20. Infinite Particle Systems: Complex Systems III

    Directory of Open Access Journals (Sweden)

    Editorial Board


    Full Text Available In the years 2002-2005, a group of German and Polish mathematicians worked under a DFG research project No 436 POL 113/98/0-1 entitled "Methods of stochastic analysis in the theory of collective phenomena: Gibbs states and statistical hydrodynamics". The results of their study were summarized at the German-Polish conference, which took place in Poland in October 2005. The venue of the conference was Kazimierz Dolny upon Vistula - a lovely town and a popular place for various cultural, scientific, and even political events of an international significance. The conference was also attended by scientists from France, Italy, Portugal, UK, Ukraine, and USA, which predetermined its international character. Since that time, the conference, entitled "Infinite Particle Systems: Complex Systems" has become an annual international event, attended by leading scientists from Germany, Poland and many other countries. The present volume of the "Condensed Matter Physics" contains proceedings of the conference "Infinite Particle Systems: Complex Systems III", which took place in June 2007.

  1. The evolution of supermassive Population III stars (United States)

    Haemmerlé, Lionel; Woods, T. E.; Klessen, Ralf S.; Heger, Alexander; Whalen, Daniel J.


    Supermassive primordial stars forming in atomically cooled haloes at z ˜ 15-20 are currently thought to be the progenitors of the earliest quasars in the Universe. In this picture, the star evolves under accretion rates of 0.1-1 M⊙ yr-1 until the general relativistic instability triggers its collapse to a black hole at masses of ˜105 M⊙. However, the ability of the accretion flow to sustain such high rates depends crucially on the photospheric properties of the accreting star, because its ionizing radiation could reduce or even halt accretion. Here we present new models of supermassive Population III protostars accreting at rates 0.001-10 M⊙ yr-1, computed with the GENEVA stellar evolution code including general relativistic corrections to the internal structure. We compute for the first time evolutionary tracks in the mass range M > 105 M⊙. We use the polytropic stability criterion to estimate the mass at which the collapse occurs, which has been shown to give a lower limit of the actual mass at collapse in recent hydrodynamic simulations. We find that at accretion rates higher than 0.01 M⊙ yr-1, the stars evolve as red, cool supergiants with surface temperatures below 104 K towards masses >105 M⊙. Moreover, even with the lower rates 0.001 M_{⊙} yr{^{-1}}feedback remains weak, reinforcing the case for direct collapse as the origin of the first quasars. We provide numerical tables for the surface properties of our models.

  2. Perceived Benefits of National Fadama Development Project III ...

    African Journals Online (AJOL)

    The study was conducted to appraise the perceived benefits of third national fadama development project III among rural farmers in Kwara state, Nigeria. A multi-stage random sampling technique was employed in selecting 225 Fadama III users as respondents. Data were collected by well trained fadama community ...

  3. Prolonged Survival in Stage III Melanoma with Ipilimumab Adjuvant Therapy

    DEFF Research Database (Denmark)

    Eggermont, Alexander M M; Chiarion-Sileni, Vanna; Grob, Jean-Jacques


    undergone complete resection of stage III melanoma. Methods After patients had undergone complete resection of stage III cutaneous melanoma, we randomly assigned them to receive ipilimumab at a dose of 10 mg per kilogram (475 patients) or placebo (476) every 3 weeks for four doses, then every 3 months...

  4. Determination of antithrombin III by radioimmunoassay and its clinical application

    Energy Technology Data Exchange (ETDEWEB)

    Chan, V; Chan, T K; Wong, V; Tso, S G; Todd, D [Queen Mary Hospital, Hong Kong


    A radioimmunoassay (RIA) has been developed for the determination of antithrombin III (AT III) in man. The detection limit was 25 At III-RIA level and biological activity (anti-Xa) was significantly correlated (r = 0.737, P < 0.0001). Plasma levels in 36 healthy males (mean +- SD, 19.9 +- 2.5 mg/dl) and 21 healthy females (19.1 +- 2.4 mg/dl) were similiar. Serial AT III measurements in normal menstruating females showed lower levels during midcycle and higher concentrations during menstruation. In carcinomas, the AT III levels were lower than normal, particularly in hepatocellular carcinoma. In cirrhosis of liver, the levels were markedly decreased and in some patients were below that found in congenital AT III deficiency. Patients with deep vein thrombosis and patients with heart valve replacement had lower levels than normal, while patients with cerebral vascular occlusion had normal levels. The possible use of AT III as a diagnostic tool of post-operative deep vein thrombosis was demonstrated in one patient after hysterectomy. The increased sensitivity, specificity and precision of this type of assay offer distinct advantages over existing methods of AT III estimation.

  5. Interdisciplinary orthognathic treatment of high angle class III ...

    African Journals Online (AJOL)

    For Class III adult patients, combined treatment strategy must be followed which includes either further dentoalveolar compensation or orthognathic surgery following decompensation of the teeth. This case report presents the interdisciplinary approach of a skeletal Class III malocclusion with increased vertical facial ...

  6. Introduction to Part III: Application of LCA in Practice

    DEFF Research Database (Denmark)

    Rosenbaum, Ralph K.


    While Part II of this book presents the theoretical foundation and methodology of LCA, Part III is dedicated to a comprehensive discussion of how this methodology has been adapted and applied in practice. The chapters of Part III provide an easily readable and accessible introduction to different...

  7. Interaction mode between methylene blue-Sm(III) complex and ...

    African Journals Online (AJOL)

    Spectroscopic and viscosity methods were applied to investigate the interaction between methylene blue (MB)-Sm(III) complex and herring sperm DNA by using acridine orange as a spectral probe in Tris-HCl buffer (pH 7.40). By means of molar ratio method, the binding ratios between MB-Sm(III)and DNA were determined ...

  8. Recent advances on biological production of difructose dianhydride III. (United States)

    Zhu, Yingying; Yu, Shuhuai; Zhang, Wenli; Zhang, Tao; Guang, Cuie; Mu, Wanmeng


    Difructose dianhydride III (DFA III) is a cyclic difructose containing two reciprocal glycosidic linkages. It is easily generated with a small amount by sucrose caramelization and thus occurs in a wide range of food-stuffs during food processing. DFA III has half sweetness but only 1/15 energy of sucrose, showing potential industrial application as low-calorie sucrose substitute. In addition, it displays many benefits including prebiotic effect, low cariogenicity property, and hypocholesterolemic effect, and improves absorption of minerals, flavonoids, and immunoglobulin G. DFA III is biologically produced from inulin by inulin fructotransferase (IFTase, EC Plenty of DFA III-producing enzymes have been identified. The crystal structure of inulin fructotransferase has been determined, and its molecular modification has been performed to improve the catalytic activity and structural stability. Large-scale production of DFA III has been studied by various IFTases, especially using an ultrafiltration membrane bioreactor. In this article, the recent findings on physiological effects of DFA III are briefly summarized; the research progresses on identification, expression, and molecular modification of IFTase and large-scale biological production of DFA III by IFTase are reviewed in detail.

  9. Antisites in III-V semiconductors: Density functional theory calculations

    KAUST Repository

    Chroneos, A.


    Density functional based simulation, corrected for finite size effects, is used to investigate systematically the formation of antisite defects in III-V semiconductors (III=Al, Ga, and In and V=P, As, and Sb). Different charge states are modelled as a function of the Fermi level and under different growth conditions. The formation energies of group III antisites (III V q) decrease with increasing covalent radius of the group V atom though not group III radius, whereas group V antisites (V I I I q) show a consistent decrease in formation energies with increase in group III and group V covalent radii. In general, III V q defects dominate under III-rich conditions and V I I I q under V-rich conditions. Comparison with equivalent vacancy formation energy simulations shows that while antisite concentrations are always dominant under stoichiometric conditions, modest variation in growth or doping conditions can lead to a significantly higher concentration of vacancies. © 2014 AIP Publishing LLC.

  10. Position-controlled epitaxial III-V nanowires on silicon

    NARCIS (Netherlands)

    Roest, A.L.; Verheijen, M.A.; Wunnicke, O.; Serafin, S.N.; Wondergem, H.J.; Bakkers, E.P.A.M.


    We show the epitaxial integration of III-V semiconductor nanowires with silicon technology. The wires are grown by the VLS mechanism with laser ablation as well as metal-organic vapour phase epitaxy. The hetero-epitaxial growth of the III-V nanowires on silicon was confirmed with x-ray diffraction

  11. Toxicological studies and antimicrobial properties of some Iron(III ...

    African Journals Online (AJOL)

    Two iron(III) complexes of Ciprofloxacin were synthesized by reaction of the ligand with iron(III) chloride hexahydrate in different solutions. The nature of bonding of the ligands and the structure of the isolated metal complexes were elucidated on the basis of their physical and spectroscopic studies. The infrared spectra ...

  12. A Simple and Rapid Complexometric Determination of Thallium(III ...

    African Journals Online (AJOL)

    A simple, rapid and selective complexometric method is proposed for the determination of thallium(III), using mercaptoethane(EtSH) as demasking agent. The sample solution containing Tl(III) is first complexed with excess EDTA and the surplus EDTA is removed by titration at pH 5–6 with zinc sulphate solution using ...

  13. 21 CFR 864.7060 - Antithrombin III assay. (United States)


    ... 21 Food and Drugs 8 2010-04-01 2010-04-01 false Antithrombin III assay. 864.7060 Section 864.7060 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) MEDICAL DEVICES HEMATOLOGY AND PATHOLOGY DEVICES Hematology Kits and Packages § 864.7060 Antithrombin III...

  14. Cloning and functional characterization of a class III chitinase gene ...

    African Journals Online (AJOL)

    Analysis of the VvChiF III amino acid sequence showed that this gene corresponds to the Glyco-hydro-18 super family that consisting of a signal peptide with the length of 25 amino acids. Purified VvChiF III showed chitinase activity toward the soluble substrate, glycolchitin and antifungal activity against Botrytis cinerea.

  15. induced Oxidation of Chromium(iii) by Peroxodisulphate

    African Journals Online (AJOL)

    formation of Cr(VI) was observed as a first-order process at high [Cr(III)] and as a zero-order process at low [Cr(III)]. ..... thermodynamic equations, adapted to transition state theory. .... A theoretical rate law for the above-mentioned reaction.

  16. Moessbauer study of Fe(III)-reducing sugar complexes

    International Nuclear Information System (INIS)

    Wolowiec, S.; Drabent, K.


    Iron(III) complexes with glucose, galactose, mannose and lactose were prepared. The Moessbauer and magnetic susceptibility data demonstrate the polymeric structure of the complexes. The thermal behaviour of the Fe(III)-glucose complex was monitored by Moessbauer spectroscopy. (author)

  17. 14 CFR 61.68 - Category III pilot authorization requirements. (United States)


    ...) The addition of another type of aircraft to the applicant's Category III pilot authorization. (2) To... height, as applicable, including use of a radar altimeter; (iii) Recognition of and proper reaction to... an aircraft of the same category and class, and type, as applicable, as the aircraft for which the...

  18. Development of an EGFRvIII specific recombinant antibody

    Directory of Open Access Journals (Sweden)

    Li Gordon


    Full Text Available Abstract Background EGF receptor variant III (EGFRvIII is the most common variant of the EGF receptor observed in human tumors. It results from the in frame deletion of exons 2-7 and the generation of a novel glycine residue at the junction of exons 1 and 8. This novel juxtaposition of amino acids within the extra-cellular domain of the EGF receptor creates a tumor specific and immunogenic epitope. EGFRvIII expression has been seen in many tumor types including glioblastoma multiforme (GBM, breast adenocarcinoma, non-small cell lung carcinoma, ovarian adenocarcinoma and prostate cancer, but has been rarely observed in normal tissue. Because this variant is tumor specific and highly immunogenic, it can be used for both a diagnostic marker as well as a target for immunotherapy. Unfortunately many of the monoclonal and polyclonal antibodies directed against EGFRvIII have cross reactivity to wild type EGFR or other non-specific proteins. Furthermore, a monoclonal antibody to EGFRvIII is not readily available to the scientific community. Results In this study, we have developed a recombinant antibody that is specific for EGFRvIII, has little cross reactivity for the wild type receptor, and which can be easily produced. We initially designed a recombinant antibody with two anti-EGFRvIII single chain Fv's linked together and a human IgG1 Fc component. To enhance the specificity of this antibody for EGFRvIII, we mutated tyrosine H59 of the CDRH2 domain and tyrosine H105 of the CDRH3 domain to phenylalanine for both the anti-EGFRvIII sequence inserts. This mutated recombinant antibody, called RAbDMvIII, specifically detects EGFRvIII expression in EGFRvIII expressing cell lines as well as in EGFRvIII expressing GBM primary tissue by western blot, immunohistochemistry (IHC and immunofluorescence (IF and FACS analysis. It does not recognize wild type EGFR in any of these assays. The affinity of this antibody for EGFRvIII peptide is 1.7 × 107 M-1 as

  19. Expansion/Facemask Treatment of an Adult Class III Malocclusion. (United States)

    Jackson, Gregory W; Kravitz, Neal D


    The orthodontic treatment of class III malocclusion with a maxillary deficiency is often treated with maxillary protraction with or without expansion. Skeletal and dental changes have been documented which have combined for the protraction of the maxilla and the correction of the class III malocclusion. Concerning the ideal time to treat a developing class III malocclusion, studies have reported that, although early treatment may be the most effective, face mask therapy can provide a viable option for older children as well. But what about young adults? Can the skeletal and dental changes seen in expansion/facemask therapy in children and adolescents be demonstrated in this age group as well, possibly eliminating the need for orthodontic dental camouflage treatment or orthognathic surgery? A case report is presented of an adult class III malocclusion with a Class III skeletal pattern and maxillary retrusion. Treatment was with nonextraction, comprehensive edgewise mechanics with slow maxillary expansion with a bonded expander and protraction facemask.

  20. Studies in the solubility of Pu(III) oxalate

    Energy Technology Data Exchange (ETDEWEB)

    Hasilkar, S P; Khedekar, N B; Chander, K; Jadhav, V; Jain, H C [Bhabha Atomic Research Centre, Bombay (India). Fuel Reprocessing Div.


    Studies have been carried out on the solubility of Pu(III) oxalate by precipitation of Pu(III) oxalate from varying concentrations of HNO[sub 3]/HCl (0.5-2.0M) solutions and also by equilibrating freshly prepared Pu(III) oxalate with solutions containing varying concentrations of HNO[sub 3]/HCl, oxalic acid and ascorbic acid. Pu(III) solutions in HNO[sub 3] and HCl media were prepared by reduction of Pu(IV) with ascorbic acid. 0.01-0.10M ascorbic acid concentration in the aqueous solution was maintained as holding reductant. The solubility of Pu(III) oxalate was found to be a minimum in 0.5M-1M HNO[sub 3]/HCl solutions containing 0.05M ascorbic acid and 0.2M excess oxalic acid in the supernatant. (author) 6 refs.; 6 tabs.

  1. Thermometric studies on the Fe(III)-EDTA chelate. (United States)

    Dot, K


    A DeltaH of -11.5 +/- 0.5 kJ/mole has been determined for the formation of the Fe(III)-EDTA chelate at 25.0 degrees and mu = 0.1(= [HClO(4)] + [NaClO(4)]) by a direct thermometric titration procedure. The entropy change, DeltaS, has been calculated to be 440 J.mole(-1) .deg(-1) by combining the result of the heat measurements with the free energy change obtained from the stability constant previously determined. A relationship between the DeltaS values and the standard partial molal entropies of the tervalent metal ions is discussed. In addition, conditions for the thermometric titration of Fe(III) with NA(4)EDTA at room temperature have been investigated. Iron(III) can be determined in the presence of fairly large amounts of phosphate, Cr(III), Mn(II) and Al(III).

  2. Expansion/Facemask Treatment of an Adult Class III Malocclusion

    Directory of Open Access Journals (Sweden)

    Gregory W. Jackson


    Full Text Available The orthodontic treatment of class III malocclusion with a maxillary deficiency is often treated with maxillary protraction with or without expansion. Skeletal and dental changes have been documented which have combined for the protraction of the maxilla and the correction of the class III malocclusion. Concerning the ideal time to treat a developing class III malocclusion, studies have reported that, although early treatment may be the most effective, face mask therapy can provide a viable option for older children as well. But what about young adults? Can the skeletal and dental changes seen in expansion/facemask therapy in children and adolescents be demonstrated in this age group as well, possibly eliminating the need for orthodontic dental camouflage treatment or orthognathic surgery? A case report is presented of an adult class III malocclusion with a Class III skeletal pattern and maxillary retrusion. Treatment was with nonextraction, comprehensive edgewise mechanics with slow maxillary expansion with a bonded expander and protraction facemask.

  3. Magnetooptical investigations on ferromagnetic III-V-semiconductors; Magnetooptische Untersuchungen an ferromagnetischen III-V-Halbleitern

    Energy Technology Data Exchange (ETDEWEB)

    Winter, Andreas


    Magnetooptical Kerr effect (MOKE) and Magnetic Circular Dichroism (MCD) have been used to investigate magnetic as well as bandstructure properties of diluted magnetic III-V-semiconductors containing Mn. In these ferromagnetic systems it has been found that the strength of the observed effects depends linearly on the magnetization of the samples with no influence of the external magnetic field. The magnetooptical effects allowed the recording of hysteresis loops of GaMnAs, GaMnSb, InMnAs and InMnSb samples for different temperatures and in the case of GaMnAs also for different alignments of the external magnetic field with respect to the easy axis of magnetization. The Stoner-Wohlfahrt-Model has been used to describe the resulting shapes of the loops yielding the magnetic anisotropy parameters of the samples. For magnetically saturated samples, spectra of MOKE and MCD have been recorded. Contrary to pure III-V-semiconductors, which exhibit lots of sharp resonances due to interband transitions between Landau levels, III-Mn-V-semi-conductors how only very few (or just one) considerably broad resonance(s). Their spectral position(s) do(es) neither depend upon the magnetic field as it would be the case for pure III-V-semiconductors nor the magnetization. Only the amplitude increases linearly with the magnetization. Utilizing a kp-theory it has been possible to describe the observed dependencies. Valence- and conduction-band are split into Landau levels by the external magnetic field and, in addition to the Zeeman-effect, the spin-levels are split by the exchange interaction between the localized electrons of the Mn ions and the free carriers which is proportional to the magnetization of the samples. This splitting is much bigger than the Landau level splitting. Due to an inhomogeneous distribution of the Mn ions and due to the high carrier density the Landau levels are strongly broadened and their structure is not observable. Owing to the high carrier-concentration in

  4. Clinical management of grade III oligodendroglioma

    Directory of Open Access Journals (Sweden)

    Simonetti G


    Full Text Available G Simonetti, P Gaviani, A Botturi, A Innocenti, E Lamperti, A Silvani Neurooncology Unit, Fondazione IRCCS Istituto Neurologico Carlo Besta, Milan, Italy Abstract: Oligodendrogliomas represent the third most common type of glioma, comprising 4%–15% of all gliomas and can be classified by degree of malignancy into grade II and grade III, according to WHO classification. Only 30% of oligodendroglial tumors have anaplastic characteristics. Anaplastic oligodendroglioma (AO is often localized as a single lesion in the white matter and in the cortex, rarely in brainstem or spinal cord. The management of AO is deeply changed in the recent years. Maximal safe surgical resection followed by radiotherapy (RT was considered as the standard of care since paramount findings regarding molecular aspects, in particular co-deletion of the short arm of chromosome 1 and the long arm of chromosome 19, revealed that these subsets of AO, benefit in terms of overall survival (OS and progression-free survival (PFS, from the addition of chemotherapy to RT. Allelic losses of chromosomes 1p and 19q occur in 50%–70% of both low-grade and anaplastic tumors, representing a strong prognostic factor and a powerful predictor of prolonged survival. Several other molecular markers have potential clinical significance as IDH1 mutations, confirming the strong prognostic role for OS. Malignant brain tumors negatively impacts on patients' quality of life. Seizures, visual impairment, headache, and cognitive disorders can be present. Moreover, chemotherapy and RT have important side effects. For these reasons, “health-related quality of life” is becoming a topic of growing interest, investigating on physical, mental, emotional, and social well-being. Understanding the impact of medical treatment on health-related quality of life will probably have a growing effect both on health care strategies and on patients. Keywords: anaplastic oligodendroglioma, radiotherapy, chemotherapy

  5. Clinical management of grade III oligodendroglioma

    International Nuclear Information System (INIS)

    Simonetti, G; Gaviani, P; Botturi, A; Innocenti, A; Lamperti, E; Silvani, A


    Oligodendrogliomas represent the third most common type of glioma, comprising 4%–15% of all gliomas and can be classified by degree of malignancy into grade II and grade III, according to WHO classification. Only 30% of oligodendroglial tumors have anaplastic characteristics. Anaplastic oligodendroglioma (AO) is often localized as a single lesion in the white matter and in the cortex, rarely in brainstem or spinal cord. The management of AO is deeply changed in the recent years. Maximal safe surgical resection followed by radiotherapy (RT) was considered as the standard of care since paramount findings regarding molecular aspects, in particular co-deletion of the short arm of chromosome 1 and the long arm of chromosome 19, revealed that these subsets of AO, benefit in terms of overall survival (OS) and progression-free survival (PFS), from the addition of chemotherapy to RT. Allelic losses of chromosomes 1p and 19q occur in 50%–70% of both low-grade and anaplastic tumors, representing a strong prognostic factor and a powerful predictor of prolonged survival. Several other molecular markers have potential clinical significance as IDH1 mutations, confirming the strong prognostic role for OS. Malignant brain tumors negatively impacts on patients’ quality of life. Seizures, visual impairment, headache, and cognitive disorders can be present. Moreover, chemotherapy and RT have important side effects. For these reasons, “health-related quality of life” is becoming a topic of growing interest, investigating on physical, mental, emotional, and social well-being. Understanding the impact of medical treatment on health-related quality of life will probably have a growing effect both on health care strategies and on patients

  6. VAK III. Seals and sealing system

    International Nuclear Information System (INIS)

    d'Agraives, B.C.; Dal Cero, G.; Debeir, R.; Mascetti, E.; Toornvliet, J.; Volcan, A.


    This report presents the VAK III seals and sealing system, which have been used over a period of two years at the Kahl nuclear facility (Federal Republic of Germany), where field tests and feasibility studies were conducted in order to offer a possible solution for the sealing of LWR fuel assemblies. It has been prepared with the aim of an assessment study to be done at the IAEA. It gives all characteristics and technical descriptions for: the sealing principle, the seal construction, the operating tools, the data processing, the drawings, the publications related to that seal. The main points of progress are: the Strong Random Internal Defects (STRID) incorporated in the seals, allowing the obtention of a good signature stability; the Integrity Check on the Seal Status (broken or not) obtained through a decisive mechanical improvement: the Double Breakage Integrity Check (DOBRIC) and with a better ultrasonic evidence of that status; the provision of new function tools, allowing the performance of Identity Measurements in dry conditions (which means also at the manufacturer plant) or in deeper water (wet storage); the study and development of a new JRC VAK 45 Compact Instrument Box, in which all the measuring functions can be grouped and incorporating an autonomous Minicomputer offering to the Inspection the possibility of performing, on the spot, Correlation and Decision processes. The general benefit of such a feasibility study should be to convince the potential users that such a Safeguards Sealing System can be studied for slightly - or largely - different other applications, provided that the Basic and Operating Functions required to the system be clearly defined, possibly after a common agreement would be stated

  7. Articulación de fones en individuos clase esqueletal I,II y III Speech patterns in skeletal class I, II and III subjects

    Directory of Open Access Journals (Sweden)

    Pía Villanueva


    Full Text Available OBJETIVO: determinar los patrones de articulación de fones consonánticos en sujetos de habla española chilena clases I, II y III esqueletal; comparar las diferencias fonéticas que existan entre clases esqueletales. MÉTODOS: se seleccionaron 54 individuos que cumplían con los criterios de inclusión determinados mediante un examen clínico intraoral y a través del análisis de Ricketts, y se conformaron los grupos de estudio de pacientes clases esqueletales I, II y III. Se les realizó un examen fonoarticulatorio estandarizado para determinar los fones modificados y el patrón articulatorio compensatorio realizado. RESULTADOS: se observaron cambios en el punto de articulación de fones consonánticos en las tres clases esqueletales, con diferencias significativas en los grupos de fones anteriores y medios entre pacientes clases I y II, sólo en el grupo de los fones anteriores entre pacientes I y III. Entre pacientes clases II y III no se observaron diferencias significativas. Se reportan modificaciones y compensaciones cualitativamente distintas entre las clases esqueletales. CONCLUSIONES: en relación a pacientes clase I, los pacientes clase II o III, presentan distinto grado de modificación en el punto de articulación de fones consonánticos. Las diferencias observadas se relacionan con los patrones esqueletales propios de cada clase.PURPOSE: to determine the consonant phonemes articulation patterns in Chilean skeletal class I, II and III Spanish speakers and compare their phonetic differences. METHODS: fifty-four skeletal class I, II and III subjects were selected, based on intraoral clinical examination and Ricketts cephalometric analysis, constituting the study groups. A standardized phonoarticulatory test was applied to each patient to determine the modified phonemes and their compensatory patterns. RESULTS: the findings indicate changes in articulation in all three groups. Significant differences were found in anterior and medium

  8. Separation of 248Cm (III) from 252Cf (III) and its use in time resolved fluorescence spectroscopic (TRFS) studies

    International Nuclear Information System (INIS)

    Murali, M.S.; Nair, A.G.C.; Gujar, R.B.; Jain, A.; Tomar, B.S.; Godbole, S.V.; Reddy, A.V.R.; Manchanda, V.K.


    The present report gives a description of the methodology for the separation of 248 Cm(III) from decayed 252 Cf (III) waste solution. The waste solution was first assayed for 252 Cf content by neutron counting using a neutron well coincidence counter. The sample was subjected to the chemical separation of 248 Cm (III) from 252 Cf (III) following anion and cation exchange chromatography. The alpha spectrum of the separated curium fraction showed peaks due to 246 Cm and 248 Cm while the corresponding alpha spectrum of californium fraction showed 249,250,251,252 Cf. The gamma ray abundances of 249 Cf were determined with respect to its gamma rays of 387 keV and the data agreed well with that in literature. Separated Cm(III) was further characterized by recording its time resolved fluorescence spectrum (TRFS) in aqueous medium. (author)

  9. Synthesis of Er(III)/Yb(III)-doped BiF3 upconversion nanoparticles for use in optical thermometry. (United States)

    Du, Peng; Yu, Jae Su


    The authors describe an ethylene glycol assisted precipitation method for synthesis of Er(III)/Yb(III)-doped BiF 3 nanoparticles (NPs) at room temperature. Under 980-nm light irradiation, the NPs emit upconversion (UC) emission of Er(III) ions as a result of a two-photon absorption process. The temperature-dependent green emissions (peaking at 525 and 545 nm) are used to establish an unambiguous relationship between the ratio of fluorescence intensities and temperature. The NPs have a maximum sensitivity of 6.5 × 10 -3  K -1 at 619 K and can be applied over the 291-691 K temperature range. The results indicate that these NPs are a promising candidate for optical thermometry. Graphical abstract Schematic of the room-temperature preparation of Er(III)/Yb(III)-doped BiF 3 nanoparticles with strongly temperature-dependent upconversion emission.

  10. Specific Reagent for Cr(III): Imaging Cellular Uptake of Cr(III) in Hct116 Cells and Theoretical Rationalization. (United States)

    Ali, Firoj; Saha, Sukdeb; Maity, Arunava; Taye, Nandaraj; Si, Mrinal Kanti; Suresh, E; Ganguly, Bishwajit; Chattopadhyay, Samit; Das, Amitava


    A new rhodamine-based reagent (L1), trapped inside the micellar structure of biologically benign Triton-X 100, could be used for specific recognition of Cr(III) in aqueous buffer medium having physiological pH. This visible light excitable reagent on selective binding to Cr(III) resulted in a strong fluorescence turn-on response with a maximum at ∼583 nm and tail of that luminescence band extended until 650 nm, an optical response that is desired for avoiding the cellular autofluorescence. Interference studies confirm that other metal ions do not interfere with the detection process of Cr(III) in aqueous buffer medium having pH 7.2. To examine the nature of binding of Cr(III) to L1, various spectroscopic studies are performed with the model reagent L2, which tend to support Cr(III)-η(2)-olefin π-interactions involving two olefin bonds in molecular probe L1. Computational studies are also performed with another model reagent LM to examine the possibility of such Cr(III)-η(2)-olefin π-interactions. Presumably, polar functional groups of the model reagent LM upon coordination to the Cr(III) center effectively reduce the formal charge on the metal ion and this is further substantiated by results of the theoretical studies. This assembly is found to be cell membrane permeable and shows insignificant toxicity toward live colon cancer cells (Hct116). Confocal laser scanning microscopic studies further revealed that the reagent L1 could be used as an imaging reagent for detection of cellular uptake of Cr(III) in pure aqueous buffer medium by Hct116 cells. Examples of a specific reagent for paramagnetic Cr(III) with luminescence ON response are scanty in the contemporary literature. This ligand design helped us in achieving the turn on response by utilizing the conversion from spirolactam to an acyclic xanthene form on coordination to Cr(III).

  11. CERN Technical Training 2004: New Short Course III (SC III) on Microsoft Outlook - Meetings and Delegation

    CERN Multimedia

    Monique Duval


    The CERN Technical Training programme is now proposing a new format for courses on Microsoft Outlook. Three two-hours Short Courses (SC) cover basic and advanced functionalities of the recommended mail client for email at CERN. Each module can be followed independently. The next scheduled session of the 3rd module will take place as follows: Outlook (SC III): Meetings and Delegation. Next session: 9.11.2004 (14:00-16:00) SC III will cover how to organise and manage meetings, work with meeting requests, share tasks, and use email and calendar delegation. The number of participants to each session is limited to 8. The instructor is English-French bilingual, and she will be available some time after each session to answer specific questions, or provide further explanations following demand. The cost of attending any SC module on Outlook is 70.- CHF. The above session will be confirmed if there are enough participants, and the attendance costs will be lower in case of a full class. If you are interested in...

  12. Bromopyrogallol red: a new microanalytical reagent for amperometric estimation of Dy (III) and Gd (III)

    International Nuclear Information System (INIS)

    Sahu, G.P.; Lavale, S.C.


    Bromopyrogallol red (BPR) has been extensively used as an indicator but its electro-reducibility has proved it to be a very useful amperometric reagent. BPR reduces on a DME in KNO 3 in the entire pH range 2.4 to 9.5. It produces single stage reduction wave below pH 4, but a two stage reduction wave in the basic range. Progressive ionization of hydroxyl group and distinct colour species of BPR, have also been studied using a Bausch and Lomb spectronic-20 spectrophotometer in order to support electroanalytical studies. On performing amperometric titrations of Dy(III) and Gd(III) with BPR at its plateau potential 1.0 V at pH 2.6 and μ = 0.4, reversed L-shaped titration curves have been observed indicating metal to BPR ratio 1:1 and the colour changes from claret red to orange yellow. The reagents have been tested in presence of various diverse ions and tolerance limits have been computed. Na + , K + , Li + , Cl - , ClO 4 - , CH 3 COO - , Pd 2+ , Fe 3+ ions did not interfere in the titrimetric procedure. However, small amounts of Bi 3+ , Pb 2+ , Ni 2+ , Co 2+ , Cd 2+ , Mg 2+ and rare earth metals have hampered the titrimetric estimations. (author)

  13. SORPTION OF Au(III BY Saccharomyces cerevisiae BIOMASS

    Directory of Open Access Journals (Sweden)

    Amaria Amaria


    Full Text Available Au(III sorption by S. cerevisiae biomass extracted from beer waste industry was investigated. Experimentally, the sorption was conducted in batch method. This research involved five steps: 1 identification the functional groups present in the S. cerevisiae biomass by infrared spectroscopic technique, 2 determination of optimum pH, 3 determination of the sorption capacity and energy, 4 determination of the sorption type by conducting desorption of sorbed Au(III using specific eluents having different desorption capacity such as H2O (van der Waals, KNO3 (ion exchange, HNO3 (hydrogen bond, and tiourea (coordination bond, 5 determination of effective eluents in Au(III desorption by partial desorption of sorbed Au(III using thiourea, NaCN and KI. The remaining Au(III concentrations in filtrate were analyzed using Atomic Absorption Spectrophotometer. The results showed that: 1 Functional groups of S. cerevisiae biomass that involved in the sorption processes were hydroxyl (-OH, carboxylate (-COO- and amine (-NH2, 2 maximum sorption was occurred at pH 4, equal to 98.19% of total sorption, 3 The sorption capacity of biomass was 133.33 mg/g (6.7682E-04 mol/g and was involved sorption energy 23.03 kJ mol-1, 4 Sorption type was dominated by coordination bond, 5 NaCN was effective eluent to strip Au(III close to 100%.   Keywords: sorption, desorption, S. cerevisiae biomass, Au(III

  14. Separation by liquid-liquid extraction of actinides(III) from lanthanides(III) using new molecules: the picolinamides; Separation par extraction liquide-liquide des actinides(III) des lanthanides(III) par de nouvelles molecules: les picolinamides

    Energy Technology Data Exchange (ETDEWEB)

    Cordier, P Y [CEA Marcoule, Departement de Recherche en Retraitement et en Vitrification, 30 - Bagnols-sur-Ceze (France); [Clermont-Ferrand-2 Univ., 63 - Aubiere (France)


    In the field of long-lived radionuclides separation from waste generated during spent fuel reprocessing, the picolinamides have been chosen as potential extractants for the selective extraction of actinides (III) from lanthanides (III). The first studies initiated on the most simple molecule of the picolinamide family, namely 2-pyridinecarboxamide, pointed out that in an aqueous media the complexation stability constant between this ligand and Am(III) is roughly 10 times higher than the ones corresponding to Ln(III). The synthesis of lipophilic derivatives of 2-pyridinecarboxamide leaded to extraction experiments. The extraction of metallic cation by lipophilic picolinamides, according to a solvatation mechanism, is strongly dependent on the nature of the amide function: a primary amide function (group I) leads to a good extraction; on the contrary, there is a decrease for secondary (group II) and tertiary (group III) amide functions. From a theoretical point of view, this work leads finally to the following conclusions: confirmation of the importance of the presence of soft donor atoms within the extractants (nitrogen in our case) for An(III)/Ln(III). Also, sensitivity of this soft donor atom regarding the protonation reaction; prevalence in our case of the affinity of the extractant for the metallic cation over the lipophilia of the extractant to ensure good distribution coefficients. The extraction and Am(III)/Ln(III) separation performances of the picolinamides from pertechnetic media leads to the design of a possible flowsheet for the reprocessing of high level liquid waste, with the new idea of an integrated technetium reflux. (author) 105 refs.

  15. Dissimilatory Fe(III) and Mn(IV) reduction. (United States)

    Lovley, D R


    The oxidation of organic matter coupled to the reduction of Fe(III) or Mn(IV) is one of the most important biogeochemical reactions in aquatic sediments, soils, and groundwater. This process, which may have been the first globally significant mechanism for the oxidation of organic matter to carbon dioxide, plays an important role in the oxidation of natural and contaminant organic compounds in a variety of environments and contributes to other phenomena of widespread significance such as the release of metals and nutrients into water supplies, the magnetization of sediments, and the corrosion of metal. Until recently, much of the Fe(III) and Mn(IV) reduction in sedimentary environments was considered to be the result of nonenzymatic processes. However, microorganisms which can effectively couple the oxidation of organic compounds to the reduction of Fe(III) or Mn(IV) have recently been discovered. With Fe(III) or Mn(IV) as the sole electron acceptor, these organisms can completely oxidize fatty acids, hydrogen, or a variety of monoaromatic compounds. This metabolism provides energy to support growth. Sugars and amino acids can be completely oxidized by the cooperative activity of fermentative microorganisms and hydrogen- and fatty-acid-oxidizing Fe(III) and Mn(IV) reducers. This provides a microbial mechanism for the oxidation of the complex assemblage of sedimentary organic matter in Fe(III)- or Mn(IV)-reducing environments. The available evidence indicates that this enzymatic reduction of Fe(III) or Mn(IV) accounts for most of the oxidation of organic matter coupled to reduction of Fe(III) and Mn(IV) in sedimentary environments. Little is known about the diversity and ecology of the microorganisms responsible for Fe(III) and Mn(IV) reduction, and only preliminary studies have been conducted on the physiology and biochemistry of this process.

  16. Chemical Properties And Toxicity of Chromium(III) Nutritional Supplements

    Energy Technology Data Exchange (ETDEWEB)

    Levina, A.; Lay, P.A.


    The status of Cr(III) as an essential micronutrient for humans is currently under question. No functional Cr(III)-containing biomolecules have been definitively described as yet, and accumulated experience in the use of Cr(III) nutritional supplements (such as [Cr(pic){sub 3}], where pic = 2-pyridinecarboxylato) has shown no measurable benefits for nondiabetic people. Although the use of large doses of Cr(III) supplements may lead to improvements in glucose metabolism for type 2 diabetics, there is a growing concern over the possible genotoxicity of these compounds, particularly of [Cr(pic){sub 3}]. The current perspective discusses chemical transformations of Cr(III) nutritional supplements in biological media, with implications for both beneficial and toxic actions of Cr(III) complexes, which are likely to arise from the same biochemical mechanisms, dependent on concentrations of the reactive species. These species include: (1) partial hydrolysis products of Cr(III) nutritional supplements, which are capable of binding to biological macromolecules and altering their functions; and (2) highly reactive Cr(VI/V/IV) species and organic radicals, formed in reactions of Cr(III) with biological oxidants. Low concentrations of these species are likely to cause alterations in cell signaling (including enhancement of insulin signaling) through interactions with the active centers of regulatory enzymes in the cell membrane or in the cytoplasm, while higher concentrations are likely to produce genotoxic DNA lesions in the cell nucleus. These data suggest that the potential for genotoxic side-effects of Cr(III) complexes may outweigh their possible benefits as insulin enhancers, and that recommendations for their use as either nutritional supplements or antidiabetic drugs need to be reconsidered in light of these recent findings.

  17. Purification of chicken carbonic anhydrase isozyme-III (CA-III and its measurement in White Leghorn chickens

    Directory of Open Access Journals (Sweden)

    Nishita Toshiho


    Full Text Available Abstract Background The developmental profile of chicken carbonic anhydrase-III (CA-III blood levels has not been previously determined or reported. We isolated CA-III from chicken muscle and investigated age-related changes in the levels of CA-III in blood. Methods CA-III was purified from chicken muscle. The levels of CA-III in plasma and erythrocytes from 278 female chickens (aged 1-93 weeks and 68 male chickens (aged 3-59 weeks were determined by ELISA. Results The mean level of CA-III in female chicken erythrocytes (1 week old was 4.6 μg/g of Hb, and the CA-III level did not change until 16 weeks of age. The level then increased until 63 weeks of age (11.8 μg/g of Hb, decreased to 4.7 μg/g of Hb at 73 weeks of age, and increased again until 93 weeks of age (8.6 μg/g of Hb. The mean level of CA-III in erythrocytes from male chickens (3 weeks old was 2.4 μg/g of Hb, and this level remained steady until 59 weeks of age. The mean plasma level of CA-III in 1-week-old female chickens was 60 ng/mL, and this level was increased at 3 weeks of age (141 ng/mL and then remained steady until 80 weeks of age (122 ng/mL. The mean plasma level of CA-III in 3-week-old male chickens was 58 ng/mL, and this level remained steady until 59 weeks of age. Conclusion We observed both developmental changes and sex differences in CA-III concentrations in White Leghorn (WL chicken erythrocytes and plasma. Simple linear regression analysis showed a significant association between the erythrocyte CA-III level and egg-laying rate in WL-chickens 16-63 weeks of age (p

  18. Purification of chicken carbonic anhydrase isozyme-III (CA-III) and its measurement in White Leghorn chickens. (United States)

    Nishita, Toshiho; Tomita, Yuichiro; Yorifuji, Daisuke; Orito, Kensuke; Ochiai, Hideharu; Arishima, Kazuyosi


    The developmental profile of chicken carbonic anhydrase-III (CA-III) blood levels has not been previously determined or reported. We isolated CA-III from chicken muscle and investigated age-related changes in the levels of CA-III in blood. CA-III was purified from chicken muscle. The levels of CA-III in plasma and erythrocytes from 278 female chickens (aged 1-93 weeks) and 68 male chickens (aged 3-59 weeks) were determined by ELISA. The mean level of CA-III in female chicken erythrocytes (1 week old) was 4.6 μg/g of Hb, and the CA-III level did not change until 16 weeks of age. The level then increased until 63 weeks of age (11.8 μg/g of Hb), decreased to 4.7 μg/g of Hb at 73 weeks of age, and increased again until 93 weeks of age (8.6 μg/g of Hb). The mean level of CA-III in erythrocytes from male chickens (3 weeks old) was 2.4 μg/g of Hb, and this level remained steady until 59 weeks of age. The mean plasma level of CA-III in 1-week-old female chickens was 60 ng/mL, and this level was increased at 3 weeks of age (141 ng/mL) and then remained steady until 80 weeks of age (122 ng/mL). The mean plasma level of CA-III in 3-week-old male chickens was 58 ng/mL, and this level remained steady until 59 weeks of age. We observed both developmental changes and sex differences in CA-III concentrations in White Leghorn (WL) chicken erythrocytes and plasma. Simple linear regression analysis showed a significant association between the erythrocyte CA-III level and egg-laying rate in WL-chickens 16-63 weeks of age (p < 0.01).

  19. Position-controlled epitaxial III-V nanowires on silicon

    Energy Technology Data Exchange (ETDEWEB)

    Roest, Aarnoud L; Verheijen, Marcel A; Wunnicke, Olaf; Serafin, Stacey; Wondergem, Harry; Bakkers, Erik P A M [Philips Research Laboratories, Professor Holstlaan 4, 5656 AA Eindhoven (Netherlands); Kavli Institute of NanoScience, Delft University of Technology, PO Box 5046, 2600 GA Delft (Netherlands)


    We show the epitaxial integration of III-V semiconductor nanowires with silicon technology. The wires are grown by the VLS mechanism with laser ablation as well as metal-organic vapour phase epitaxy. The hetero-epitaxial growth of the III-V nanowires on silicon was confirmed with x-ray diffraction pole figures and cross-sectional transmission electron microscopy. We show preliminary results of two-terminal electrical measurements of III-V nanowires grown on silicon. E-beam lithography was used to predefine the position of the nanowires.

  20. Position-controlled epitaxial III-V nanowires on silicon

    International Nuclear Information System (INIS)

    Roest, Aarnoud L; Verheijen, Marcel A; Wunnicke, Olaf; Serafin, Stacey; Wondergem, Harry; Bakkers, Erik P A M


    We show the epitaxial integration of III-V semiconductor nanowires with silicon technology. The wires are grown by the VLS mechanism with laser ablation as well as metal-organic vapour phase epitaxy. The hetero-epitaxial growth of the III-V nanowires on silicon was confirmed with x-ray diffraction pole figures and cross-sectional transmission electron microscopy. We show preliminary results of two-terminal electrical measurements of III-V nanowires grown on silicon. E-beam lithography was used to predefine the position of the nanowires

  1. SGN III code conversion from Apollo to HP

    International Nuclear Information System (INIS)

    Lee, Hae Cho


    SGN III computer code is used to analyze transient behavior of reactor coolant system, pressurizer and steam generators in the event of main steam line break (MSLB), and to calculate mass and energy release for containment design. This report firstly describes detailed work carried out for installation of SFN III on Apollo DN 10000 and code validation results after installation. Secondly, a series of work is also describes in relation to installation of SGN III on HP 9000/700 series as well as relevant code validation results. Attached is a report on software verification and validation results. 8 refs. (Author) .new

  2. Inductrack III configuration--a maglev system for high loads (United States)

    Post, Richard F


    Inductrack III configurations are suited for use in transporting heavy freight loads. Inductrack III addresses a problem associated with the cantilevered track of the Inductrack II configuration. The use of a cantilevered track could present mechanical design problems in attempting to achieve a strong enough track system such that it would be capable of supporting very heavy loads. In Inductrack III, the levitating portion of the track can be supported uniformly from below, as the levitating Halbach array used on the moving vehicle is a single-sided one, thus does not require the cantilevered track as employed in Inductrack II.

  3. Glass composition and solution speciation effects on stage III dissolution

    Energy Technology Data Exchange (ETDEWEB)

    Trivelpiece, Cory L. [Pennsylvania State Univ., University Park, PA (United States); Rice, Jarret A. [Pennsylvania State Univ., University Park, PA (United States); Pantano, Carlo G. [Pennsylvania State Univ., University Park, PA (United States)


    To understand and mitigate the onset of Stage III corrosion of multicomponent oxides waste glasses. Stage III refers to a resumption of the high initial rate of glass dissolution in some glass samples that have otherwise exhibited dissolution at the much lower residual rate for a long time (Stage II). Although the onset of Stage III is known to occur concurrently with the precipitation of particular alteration products, the root cause of the transition is still unknown. Certain glass compositions (notably AFCI) and high pH environmental conditions are also associated with this observed transition.

  4. Glass composition and solution speciation effects on stage III dissolution

    International Nuclear Information System (INIS)

    Trivelpiece, Cory L.; Rice, Jarret A.; Pantano, Carlo G.


    To understand and mitigate the onset of Stage III corrosion of multicomponent oxides waste glasses. Stage III refers to a resumption of the high initial rate of glass dissolution in some glass samples that have otherwise exhibited dissolution at the much lower residual rate for a long time (Stage II). Although the onset of Stage III is known to occur concurrently with the precipitation of particular alteration products, the root cause of the transition is still unknown. Certain glass compositions (notably AFCI) and high pH environmental conditions are also associated with this observed transition.

  5. Considerations Related to LTO for Gen II/III NPP

    International Nuclear Information System (INIS)

    Cojan, Mihail


    Today there are some 435 nuclear power reactors operating in 30 countries with a combined capacity of over 372 GWe. In 2011 these provided 2518 billion kWh, about 14% of the world's electricity [1]. The next evolutionary design of Generation III reactors to be deployed over many decades will represent a large part of the worldwide fleet throughout the 21st century. Generation III reactors are the future NPPs with improved safety and reliability, with passive safety systems and with a very low probability for core melt. The objective of this paper is to present the R and D activities that support LTO for Generation II / III Nuclear Reactors. (author)

  6. Network monitoring module of BES III system environment

    International Nuclear Information System (INIS)

    Song Liwen; Zhao Jingwei; Zhang Bingyun


    In order to meet the needs of the complicated network architecture of BES III (Beijing Spectrometer III) and make sure normal online running in the future, it is necessary to develop a multi-platforms Network Monitoring Tool which can help system administrator monitor and manage BES III network. The author provides a module that can monitor not only the traffic of switch-router's ports but also the performance status of key devices in the network environment, meanwhile it can also give warning to manager and submit the related reports. the great sense, the theory basis, the implementing method and the graph in formation of this tool will be discussed

  7. Basel III implementation: Issues and challenges for Indian banks

    Directory of Open Access Journals (Sweden)

    M. Jayadev


    Full Text Available The Basel III framework, whose main thrust has been enhancing the banking sector's safety and stability, emphasises the need to improve the quality and quantity of capital components, leverage ratio, liquidity standards, and enhanced disclosures. This article first lays the context of Basel III and then incorporates the views of senior executives of Indian banks and risk management experts on addressing the challenges of implementing the Basel III framework, especially in areas such as augmentation of capital resources, growth versus financial stability, challenges for enhanced profitability, deposit pricing, cost of credit, maintenance of liquidity standards, and strengthening of risk architecture.

  8. Electrode kinetics of ytterbium (III) in acrylate and crotonate media

    Energy Technology Data Exchange (ETDEWEB)

    Rao, A L.J.; Singh, M


    The polarographic reduction of Yb(III) in acrylate and crotonate media gives well-defined, diffusion-controlled irreversible waves. The forward rate constant (sub(f,h)Ksup(0)) and transfer coefficient (..cap alpha..) have been calculated by Koutecky's theoretical treatment as extended by Meites and Israel. This has also been made the basis of a method for the determination of Yb(III) in the presence of diverse ions and rare earth ions. Under optimum conditions. Yb(III) in the range 4 x 10/sup -4/ M to 1.6 x 10/sup -3/ M could be successfully determined in various mixtures, using any of the two acids.

  9. The Nature of the intermediates in the reactions of Fe(III)- and Mn(III)-microperoxidase-8 with H2O2 : a rapid kinetic study

    NARCIS (Netherlands)

    Primus, J.L.; Grunenwald, S.; Hagedoorn, P.L.; Albrecht-Gary, A.M.; Mandon, D.; Veeger, C.


    Kinetic studies were performed with microperoxidase-8 (Fe(III)MP-8), the proteolytic breakdown product of horse heart cytochrome c containing an octapeptide linked to an iron protoporphyrin IX. Mn(III) was substituted for Fe(III) in Mn(III)MP-8.The mechanism of formation of the reactive metal-oxo

  10. Electrochemical behavior of ruthenium (III), rhodium (III) and palladium (II) in 1-butyl-3-methylimidazolium chloride ionic liquid

    Energy Technology Data Exchange (ETDEWEB)

    Jayakumar, M.; Venkatesan, K.A. [Fuel Chemistry Division, Indira Gandhi Centre for Atomic Research, Kalpakkam 603102 (India); Srinivasan, T.G. [Fuel Chemistry Division, Indira Gandhi Centre for Atomic Research, Kalpakkam 603102 (India)], E-mail:; Vasudeva Rao, P.R. [Fuel Chemistry Division, Indira Gandhi Centre for Atomic Research, Kalpakkam 603102 (India)


    Electrochemical behavior of ruthenium (III), rhodium (III) and palladium (II) in 1-butyl-3-methylimidazolium chloride (bmimCl) and their ternary and binary solutions in bmimCl was studied at various working electrodes at 373 K by cyclic voltammetry and chronoamperometry. Ruthenium (III) chloride forms a stable solution with bmimCl and the cyclic voltammogram of ruthenium (III) in bmimCl recorded at glassy carbon electrode consisted of several redox waves due to the complex nature of ruthenium to exist in several oxidation states. Electrolysis of ruthenium (III) chloride in bmimCl at the cathodic limit of bmimCl (-1.8 V (vs. Pd)) did not result in ruthenium metal deposition. However, it was deposited from bmimPF{sub 6} and bmimNTf{sub 2} room temperature ionic liquids at -0.8 V (vs. Pd). The electrochemical behavior of ruthenium (III) in bmimCl in the presence of palladium (II) and rhodium (III) was studied by cyclic voltammetry. The presence of palladium (II) in bmimCl favors underpotential deposition of ruthenium metal. The nuclear loop at -0.5 V (vs. Pd) was observed in all solutions when palladium (II) co-existed with other two metal ions. Nucleation and growth of the metal on glassy carbon working electrode was investigated by chronoamperometry. The growth and decay of chronocurrents has been found to follow the instantaneous nucleation model with three-dimensional growth of nuclei.

  11. Characterization of the lanthanum(III) and europium(III) trichloroacetate complexes extracted with 18-crown-6

    International Nuclear Information System (INIS)

    Imura, H.; Saito, Y.; Ohashi, K.; Meguro, Y.; Yoshida, Z.; Choppin, G.R.


    Extraction of lanthanide(III) ions with 18-crown-6 (18C6) and trichloroacetate (tca) has been studied. The composition, hydration, and structure of the La(III) and Eu(III) complexes extracted into 1,2-dichloroethane were investigated by using several methods such as the liquid-liquid distribution technique, conductimetry, Karl Fisher titration, laser luminescence spectroscopy, and 1 H NMR. The La(III) complex was found to be a monohydrate, La(tca) 3 (18C6)(H 2 O), while that of Eu(III) was a mixture of a monohydrate and a dihydrate, i.e., Eu(tca) 3 (18C6)(H 2 O) and Eu(tca) 3 (18C6)(H 2 O) 2 . The origin of the selectivity by 18C6 which gives much higher extractability of La(III) than of Eu(III) is explained by considering the hydration and probable structure of their complexes. 12 refs., 5 figs., 4 tabs

  12. Removal of arsenic from water using manganese (III) oxide: Adsorption of As(III) and As(V). (United States)

    Babaeivelni, Kamel; Khodadoust, Amid P


    Removal of arsenic from water was evaluated with manganese (III) oxide (Mn2O3) as adsorbent. Adsorption of As(III) and As(V) onto Mn2O3 was favorable according to the Langmuir and Freundlich adsorption equilibrium equations, while chemisorption of arsenic occurred according to the Dubinin-Radushkevich equation. Adsorption parameters from the Langmuir, Freundlich, and Temkin equations showed a greater adsorption and removal of As(III) than As(V) by Mn2O3. Maximum removal of As(III) and As(V) occurred at pH 3-9 and at pH 2, respectively, while removal of As(V) in the pH range of 6-9 was 93% (pH 6) to 61% (pH 9) of the maximum removal. Zeta potential measurements for Mn2O3 in As(III) was likely converted to As(V) solutions indicated that As(III) was likely converted to As(V) on the Mn2O3 surface at pH 3-9. Overall, the effective Mn2O3 sorbent rapidly removed As(III) and As(V) from water in the pH range of 6-9 for natural waters.

  13. Extraction Separation of Am(III) and Eu(III) with Thermo-sensitive Gel introducing TPEN Derivatives

    International Nuclear Information System (INIS)

    Kenji Takeshita; Yoshio Nakano; Tatsuro Matsumura; Atsunori Mori


    A thermal-swing chromatographic process using a thermo-sensitive gel co-polymerized with NIPA (N-isopropyl-acrylamide) and TPPEN (N,N,N',N'-tetrakis(4-propenyl-oxy-2-pyridyl-methyl)ethylenediamine) was studied for the separation of Am(III) from Eu(III). First, the radiolysis of the TPPEN-NIPA gel was tested by the γ-ray irradiation and the α nuclide adsorption. The extraction separation of Am(III) was not influenced in the radioactive environment of the proposed process. Next, the TPPEN-NIPA gel was immobilized in porous silica particles and the applicability of the gel-immobilized silica to the proposed process was tested. Am(III) was extracted selectively in the gel-immobilized silica at 5 deg. C and the separation factor of Am(III) over Eu(III) was evaluated to be 3.7. The distribution ratio of Am(III) was reduced to less than 1/20 by increasing temperature from 5 deg. C to 40 deg. C. These results indicate that the TPPEN-NIPA gel is applicable to the thermal-swing chromatographic process for the minor actinide recovery. (authors)

  14. Experimental studies and tests on An(III)/Ln(III) separation using the TODGA extractant

    Energy Technology Data Exchange (ETDEWEB)

    Heres, Xavier; Sorel, Christian; Miguirditchian, Manuel; Cames, Beatrice; Hill, Clement; Bisel, Isabelle; Espinoux, Denis; Viallesoubranne, Carole; Baron, Pascal; Lorrain, Brigitte [CEA/DEN/MAR/DRCP, Marcoule, BP17171, 30207 Bagnols/Ceze (France)


    Minor actinide recycling by separation and transmutation is worldwide considered as one of the most promising strategies to reduce the inventory of radioactive waste, thus contributing to make nuclear energy more sustainable. One of the different options investigated at the CEA Marcoule and within the ACSEPT project (a European collaborative project partly funded by the 7. EURATOM Framework Program) to separate trivalent minor actinide (Am(III)-Cf(III)) from the fission and activation products contained in PUREX raffinates is the TODGA process, which consists in: 1. Co-extracting trivalent 4f and 5f elements from highly acidic PUREX raffinates by a mixture of TODGA (tetraoctyl-diglycolamide) and TBP (tributyl-phosphate), dissolved in HTP (hydrogenated tetra-propene). 2. Selectively stripping the trivalent minor actinides by a hydrophilic poly-aminocarboxylic acid used as a complexing agent in a buffered aqueous solution, while the trivalent lanthanides are kept in the organic solvent thanks to a sodium nitrate salting-out effect. 3. Stripping the lanthanides in a diluted nitric acid solution. The major difficulty of this TODGA separation process is to tune the pH in a very narrow range of operating conditions in the second step, because of the high sensitivity of the performances of the flow-sheet vs pH. This difficulty was however overcome. This paper describes the development of the TODGA process from experimental studies to hot test implementation in shielded cells of the ATALANTE facility, including (i) the optimization of the extraction system (both the formulation of the organic solvent and those of the aqueous scrubbing and stripping solutions), (ii) the implementation of a cold test in small scale mixer-settlers in the G1 facility (MARCEL loop), using a surrogate feed composed of major fission products, (iii) the validation of some steps of the process, using a surrogate feed, spiked with Am-241 and Eu-152, and similar laboratory contactors (medium activity

  15. Separation by liquid-liquid extraction of actinides(III) from lanthanides(III) using new molecules: the picolinamides

    International Nuclear Information System (INIS)

    Cordier, P.Y.


    In the field of long-lived radionuclides separation from waste generated during spent fuel reprocessing, the picolinamides have been chosen as potential extractants for the selective extraction of actinides (III) from lanthanides (III). The first studies initiated on the most simple molecule of the picolinamide family, namely 2-pyridinecarboxamide, pointed out that in an aqueous media the complexation stability constant between this ligand and Am(III) is roughly 10 times higher than the ones corresponding to Ln(III). The synthesis of lipophilic derivatives of 2-pyridinecarboxamide leaded to extraction experiments. The extraction of metallic cation by lipophilic picolinamides, according to a solvatation mechanism, is strongly dependent on the nature of the amide function: a primary amide function (group I) leads to a good extraction; on the contrary, there is a decrease for secondary (group II) and tertiary (group III) amide functions. From a theoretical point of view, this work leads finally to the following conclusions: confirmation of the importance of the presence of soft donor atoms within the extractants (nitrogen in our case) for An(III)/Ln(III). Also, sensitivity of this soft donor atom regarding the protonation reaction; prevalence in our case of the affinity of the extractant for the metallic cation over the lipophilia of the extractant to ensure good distribution coefficients. The extraction and Am(III)/Ln(III) separation performances of the picolinamides from pertechnetic media leads to the design of a possible flowsheet for the reprocessing of high level liquid waste, with the new idea of an integrated technetium reflux. (author)

  16. Separation of yttrium (III) from lanthanoids (III) by solvent extraction with substituted N-Alkylcarbonyl-N-phenylhydroxylamines

    International Nuclear Information System (INIS)

    Haraguchi, K.; Ogata, T.; Nakagawa, K.; Saitoh, T.; Kamidate, T.; Watanabe, H.


    A series of substituted N-alkylcarbonyl-N-phenylhydroxylamines(R-PHAs) were synthesized and utilized for the extraction of yttrium(III) and lanthanoids(III) in order to obtain effective extractants for the separation of yttrium(III) from the lanthanoids(III) and the mutual separation of the lanthanoids(III). The distribution ratio of yttrium(III) and the lanthanoids(III) between the carbon tetrachloride and the aqueous phases was measured as functions of the pH and the extractant concentration at 298 K at an ionic strength of 0.1 (NaNO 3 ). Yttrium(III) and the lanthanoids(III) were extracted with R-PHAs(HL) as self-adducted chelates of the form, ML 3 (HL) x , where 'x' is 1, 2 or 3 depending on the extraction system. The extractability of the metal ions decreased in the order of R-PHA having a primary, a secondary and a tertiary alkyl substituent attached to the carbonyl group because of the steric hindrance of the alkyl group. The separation factors for both Yb/Eu and Yb/Y pairs increased with increasing branching of the alkyl group of R-PHA. The excellent selectivity of R-PHAs having a tertiary alkyl group was attributable to a greater inductive effect of the tertiary alkyl group than those of the primary and secondary alkyl groups. The substituents at the phenyl group of R-PHAs gave no significant effect on the selectivity, while the extractability was enhanced considerably by introduction of electron withdrawing substituents at appropriate positions of the phenyl group of R-PHAs. (authors)

  17. Structural Properties of the Cr(III)-Fe(III) (Oxy)Hydroxide Compositional Series: Insights for a Nanomaterial 'Solid Solution'

    International Nuclear Information System (INIS)

    Tang, Y.; Zhang, L.; Michel, F.M.; Harrington, R.; Parise, J.B.; Reeder, R.J.


    Chromium(III) (oxy)hydroxide and mixed Cr(III)-Fe(III) (oxy)hydroxides are environmentally important compounds for controlling chromium speciation and bioaccessibility in soils and aquatic systems and are also industrially important as precursors for materials and catalyst synthesis. However, direct characterization of the atomic arrangements of these materials is complicated because of their amorphous X-ray properties. This study involves synthesis of the complete Cr(III)-Fe(III) (oxy)hydroxide compositional series, and the use of complementary thermal, microscopic, spectroscopic, and scattering techniques for the evaluation of their structural properties. Thermal analysis results show that the Cr end member has a higher hydration state than the Fe end member, likely associated with the difference in water exchange rates in the first hydration spheres of Cr(III) and Fe(III). Three stages of weight loss are observed and are likely related to the loss of surface/structural water and hydroxyl groups. As compared to the Cr end member, the intermediate composition sample shows lower dehydration temperatures and a higher exothermic transition temperature. XANES analysis shows Cr(III) and Fe(III) to be the dominant oxidation states. XANES spectra also show progressive changes in the local structure around Cr and Fe atoms over the series. Pair distribution function (PDF) analysis of synchrotron X-ray total scattering data shows that the Fe end member is nanocrystalline ferrihydrite with an intermediate-range order and average coherent domain size of ∼27 (angstrom). The Cr end member, with a coherent domain size of ∼10 (angstrom), has only short-range order. The PDFs show progressive structural changes across the compositional series. High-resolution transmission electron microscopy (HRTEM) results also show the loss of structural order with increasing Cr content. These observations provide strong structural evidence of chemical substitution and progressive structural

  18. Development of a C3-symmetric benzohydroxamate tripod: Trimetallic complexation with Fe(III), Cr(III) and Al(III) (United States)

    Baral, Minati; Gupta, Amit; Kanungo, B. K.


    The design, synthesis and physicochemical characterization of a C3-symmetry Benzene-1,3,5-tricarbonylhydroxamate tripod, noted here as BTHA, are described. The chelator was built from a benzene as an anchor, symmetrically extended by three hydroxamate as ligating moieties, each bearing O, O donor sites. A combination of absorption spectrophotometry, potentiometry and theoretical investigations are used to explore the complexation behavior of the ligand with some trivalent metal ions: Fe(III), Cr(III), and Al(III). Three protonation constants were calculated for the ligand in a pH range of 2-11 in a highly aqueous medium (9:1 H2O: DMSO). A high rigidity in the molecular structure restricts the formation of 1:1 (M/L) metal encapsulation but shows a high binding efficiency for a 3:1 metal ligand stoichiometry giving formation constant (in β unit) 28.73, 26.13 and 19.69 for [M3L]; Mdbnd Fe(III), Al(III) and Cr(III) respectively, and may be considered as an efficient Fe-carrier. The spectrophotometric study reveals of interesting electronic transitions occurred during the complexation. BTHA exhibits a peak at 238 nm in acidic pH and with the increase of pH, a new peak appeared at 270 nm. A substantial shifting in both of the peaks in presence of the metal ions implicates a s coordination between ligand and metal ions. Moreover, complexation of BTHA with iron shows three distinct colors, violet, reddish orange and yellow in different pH, enables the ligand to be considered for the use as colorimetric sensor.

  19. Level III and IV Ecoregions of the Continental United States (United States)

    Information and downloadable maps and datasets for Level III and IV ecoregions of the continental United States. Ecoregions are areas of general similarity in the type, quality, and quantity of environmental resources.

  20. Most Recent Sampling Results for Annex III Building (United States)

    Contains email from Scott Miller, US EPA to Scott Kramer. Subject: Most Recent Sampling Results for Annex III Building. (2:52 PM) and Gore(TM) Surveys Analytical Results U.S. Geological Survey, Montgomery, AL.

  1. Type III Radio Burst Duration and SEP Events (United States)

    Gopalswamy, N.; Makela, P.; Xie, H.


    Long-duration (>15 min), low-frequency (25 MeV. The 1-MHz duration of the type III burst (28 rein) is near the median value of type III durations found for gradual SEP events and ground level enhancement (GLE) events. Yet, there was no sign of SEP events. On the other hand, two other type III bursts from the same active region had similar duration but accompanied by WAVES type 11 bursts; these bursts were also accompanied by SEP events detected by SOHO/ERNE. This study suggests that the type III burst duration may not be a good indicator of an SEP event, consistent with the statistical study of Cliver and Ling (2009, ApJ ).

  2. LASIP-III, a generalized processor for standard interface files

    International Nuclear Information System (INIS)

    Bosler, G.E.; O'Dell, R.D.; Resnik, W.M.


    The LASIP-III code was developed for processing Version III standard interface data files which have been specified by the Committee on Computer Code Coordination. This processor performs two distinct tasks, namely, transforming free-field format, BCD data into well-defined binary files and providing for printing and punching data in the binary files. While LASIP-III is exported as a complete free-standing code package, techniques are described for easily separating the processor into two modules, viz., one for creating the binary files and one for printing the files. The two modules can be separated into free-standing codes or they can be incorporated into other codes. Also, the LASIP-III code can be easily expanded for processing additional files, and procedures are described for such an expansion. 2 figures, 8 tables

  3. Interpretation of recovery stage III in gold. [Electron irradiation

    Energy Technology Data Exchange (ETDEWEB)

    Seeger, A.; Frank, W. (Max-Planck-Institut fuer Metallforschung, Stuttgart (Germany, F.R.). Inst. fuer Physik; Stuttgart Univ. (Germany, F.R.). Inst. fuer Theoretische und Angewandte Physik)


    The paper compares a recent investigation of Stage-III recovery on electron-irradiated gold by Sonnenberg and Dedek with earlier work on cold-worked or quenched gold. The experimental results of Sonnenberg and Dedek are found to be in excellent agreement with those of Schuele, Seeger, Schumacher, and King, who showed that in Au Stage III is due to the migration of an elementary intrinsic point defect with migration enthalpy Hsup(III) = (0.71 +- 0.02)eV. Since the monovacancy migration enthalpy Hsub(IVsup(M)) = (0.83 +- 0.02)eV obtained by Schuele et al. has been confirmed by other workers and independent techniques, it is concluded that Hsup(III) represents the migration enthalpy of isolated self-interstitials.

  4. ACRIM III Level 2 Daily Mean Data V001 (United States)

    National Aeronautics and Space Administration — Active Cavity Radiometer Irradiance Monitor (ACRIM) III Level 2 Daily Mean Data product consists of Level 2 total solar irradiance in the form of daily means...

  5. Jaan Jung. Muinasaja teadus eestlaste maalt III / Villem Reiman

    Index Scriptorium Estoniae

    Reiman, Villem, 1861-1917


    Jaan Jungi elust ja tegevusest ning tema raamatust: Muinasajateadus eestlaste maalt : III, Kohalised muinasaja kirjeldused Tallinnamaalt / Kogunud ja välja annud J. Jung. Tallinn : A. Busch'i rmtkpl., 1910

  6. Luminescent amine sensor based on europium(III) chelate. (United States)

    Petrochenkova, Nataliya V; Mirochnik, Anatolii G; Emelina, Tatyana B; Sergeev, Alexander A; Leonov, Andrei A; Voznesenskii, Sergey S


    The effect of methylamine vapor on luminescence of Eu(III) tris-benzoylacetonate (I) immobilized in thin-layer chromatography plates has been investigated. It has been revealed that interaction of I with analyte vapor results in increase of the intensity of Eu(III) luminescence. The mechanism of the effect of methylamine vapors on intensification of the Eu(III) luminescence has been suggested using the data of IR spectroscopy and quantum chemistry calculations. The mechanism of luminescence sensitization consists in bonding of an analyte molecule with a water molecule into the coordination sphere of Eu(III). As a result, the bond of a water molecule with the luminescence centre weakens, rigid structural fragment including europium ion, water and methylamine molecules forms. The presence of such fragment must naturally promote decrease of influence of OH-vibrations on luminescence of the complex I. Copyright © 2018 Elsevier B.V. All rights reserved.

  7. Qinshan Phase III (CANDU) nuclear power project quality assurance

    International Nuclear Information System (INIS)

    Wang Lingen; Du Jinxiang


    The completion and implementation of quality assurance system of Qinshan Phase III (CANDU) nuclear power project are presented. Some comments and understanding with consideration of the project characteristics are put forward

  8. Synthesis and spectral properties of Chromium(III) complex of ...

    African Journals Online (AJOL)

    ISSCH) with chromium(III) chloride. The complex was characterized by molar conductance, magnetic moment, infrared, far-infrared and electronic spectra and elemental analysis. The ligand exists in keto tantomeric form and it coordinates through ...

  9. Dextran solution optical activity in Tb (III) ion presence

    International Nuclear Information System (INIS)

    Vasconcellos, Sandra S.; Rodrigues, J.F.; Faljoni-Alario, A.


    Optical activity studies of aqueous solutions of dextrana in presence of Tb (III) or without it shows the complex with the hidroxyl groups of C 2 and C 3 of monomeric unit participation is formed. (L.M.J.) [pt

  10. TABLE III. Deaths in 122 U.S. cities (United States)

    U.S. Department of Health & Human Services — TABLE III. Deaths in 122 U.S. cities - 2014. 122 Cities Mortality Reporting System — Each week, the vital statistics offices of 122 cities across the United States...

  11. Radiation protection in category III large gamma irradiators

    International Nuclear Information System (INIS)

    Costa, Neivaldo; Furlan, Gilberto Ribeiro; Itepan, Natanael Marcio


    This article discusses the advantages of category III large gamma irradiator compared to the others, with emphasis on aspects of radiological protection, in the industrial sector. This category is a kind of irradiators almost unknown to the regulators authorities and the industrial community, despite its simple construction and greater radiation safety intrinsic to the model, able to maintain an efficiency of productivity comparable to those of category IV. Worldwide, there are installed more than 200 category IV irradiators and there is none of a category III irradiator in operation. In a category III gamma irradiator, the source remains fixed in the bottom of the tank, always shielded by water, negating the exposition risk. Taking into account the benefits in relation to radiation safety, the category III large irradiators are highly recommended for industrial, commercial purposes or scientific research. (author)

  12. TABLE III. Deaths in 122 U.S. cities (United States)

    U.S. Department of Health & Human Services — TABLE III. Deaths in 122 U.S. cities – 2016. 122 Cities Mortality Reporting System — Each week, the vital statistics offices of 122 cities across the United States...

  13. Development of III-V/Si Multijunction Space Photovoltaics (United States)

    National Aeronautics and Space Administration — High substrate costs, as well as weight, typically play a major role in the high costs of multijunction space solar cell production and deployment. III-V/Si...

  14. catalyzed oxidation of formamidine derivative by hexacyanoferrate(III

    Indian Academy of Sciences (India)

    triazol-3-yl) formamidine (ATF) by hexacyanoferrate(III) (HCF) was studied spectrophotometrically in aqueous alkalinemedium. Both uncatalyzed and catalyzed reactions showed first order kinetics with respect to [HCF],whereas the reaction ...

  15. Kinetic determination of As(III in solution

    Directory of Open Access Journals (Sweden)



    Full Text Available A new reaction is suggested and a new kinetic method is elaborated for the As(III traces determination in solution, on the basis of their catalyzing effect on komplexon III (EDTA oxidation by KMnO4 in a strong acid solution (H2SO4. Using a spectrophotometric technique, a sensitivity of 72 ng/cm3 As(III was achieved. The relative error of method varies from 5.5 to 13.9 % for As(III concentration range from 83 to 140 ng/cm3. Appropriate kinetic equations are formulated and the influence of some other ions, including the As(V, upon the reaction rate is tested.

  16. Synthesis and infrared spectra of Vanadium (III) prussian blue complexes

    International Nuclear Information System (INIS)

    Toma, H.E.; Lellis, F.T.P.


    The synthesis and characterization of a series of polymeric pigments containing vanadium (III) and hexacryano or substituted pentacyanoferrate (II) complexes are studied. The role of the intervalence transfer interactions in the complexes is discussed. (M.J.C.) [pt

  17. COMPBRN III: a computer code for modeling compartment fires

    International Nuclear Information System (INIS)

    Ho, V.; Siu, N.; Apostolakis, G.; Flanagan, G.F.


    The computer code COMPBRN III deterministically models the behavior of compartment fires. This code is an improvement of the original COMPBRN codes. It employs a different air entrainment model and numerical scheme to estimate properties of the ceiling hot gas layer model. Moreover, COMPBRN III incorporates a number of improvements in shape factor calculations and error checking, which distinguish it from the COMPBRN II code. This report presents the ceiling hot gas layer model employed by COMPBRN III as well as several other modifications. Information necessary to run COMPBRN III, including descriptions of required input and resulting output, are also presented. Simulation of experiments and a sample problem are included to demonstrate the usage of the code. 37 figs., 46 refs

  18. 26. III avati Tartu Y-galerii E-saalis...

    Index Scriptorium Estoniae


    MTÜ loovkeskuse ja Anne noortekeskuse multimeedialabori interdistsiplinaarse Art-Merge õpikoja näitus. 20.-26. III toimunud õpikoja tegevuskunsti osa juhtis inglise kunstnik Natalie Waldbaum, multimeedia sektorit Jane Remm, kaasaegse tantsu ja teatri osa Kaia Kapsta

  19. Reactions of sigma-bonded organochromium(III)complexes

    International Nuclear Information System (INIS)

    Leslie, J.P. II.


    Three projects were carried out, each dealing with the kinetics and mechanism of reactions of sigma-bonded organochromium(III) complexes of the form (H 2 O) 5 CrR 2+ . Part I describes the kinetics of the reaction of dichloromethylchromium(III) ion with chromium(II) ion in aqueous acid. Part II deals with the radioexchange of 4-pyridinomethylchromium(III) ion with 51 Cr 2+ and the kinetics of formation of the organochromium species at 55 0 in 1 M H + . Part III deals with the reactions of Hg 2+ and CH 3 Hg + with a series of (H 2 O) 5 CrR 2+ complexes, in which R is an aliphatic alkyl group, a haloalkyl group, or an aralkyl group


    African Journals Online (AJOL)


    adsorption was best described using Freundlich model while Langmuir model best fit Cr (III) adsorption. ... different health disorders in human depending on the exposure rate ... process include clay, activated carbon, zeolite and silica gel [4].

  1. TABLE III. Deaths in 122 U.S. cities (United States)

    U.S. Department of Health & Human Services — TABLE III. Deaths in 122 U.S. cities - 2015122 Cities Mortality Reporting System ��� Each week, the vital statistics offices of 122 cities across the United States...


    African Journals Online (AJOL)

    Preferred Customer

    between methylene blue (MB)-Sm(III) complex and herring sperm DNA by using acridine orange .... the complex was recorded as KBr pellets on Spectrum One FTIR system (PE Company, USA), ..... mechanism of drugs and drug design.

  3. Sample exchange/evaluation (SEE) report - Phase III

    International Nuclear Information System (INIS)

    Winters, W.I.


    This report describes the results from Phase III of the Sample Exchange Evaluation (SEE) program. The SEE program is used to compare analytical laboratory performance on samples from the Hanford Site's high level waste tanks

  4. Revisiting The First Galaxies: The epoch of Population III stars

    Energy Technology Data Exchange (ETDEWEB)

    Muratov, Alexander L. [U. Michigan, Dept. Astron.; Gnedin, Oleg Y. [U. Michigan, Dept. Astron.; Gnedin, Nickolay Y. [Chicago U., Astron. Astrophys. Ctr.; Zemp, Marcel [Beijing, KITPC


    We investigate the transition from primordial Population III (Pop III) star formation to normal Pop II star formation in the first galaxies using new cosmological hydrodynamic simulations. We find that while the first stars seed their host galaxies with metals, they cannot sustain significant outflows to enrich the intergalactic medium, even assuming a top-heavy initial mass function. This means that Pop III star formation could potentially continue until z 6 in different unenriched regions of the universe, before being ultimately shut off by cosmic reionization. Within an individual galaxy, the metal production and stellar feedback from Pop II stars overtake Pop III stars in 20-200 Myr, depending on galaxy mass.

  5. Thermal decomposition of lanthanides (III) and yttrium (III) solid complexes from ethyl ene diamine tetraacetic acid

    International Nuclear Information System (INIS)

    Mercadante, A.


    Solid state compounds of lanthanides (III) and yttrium derived from ethyl ene diamine tetraacetic acid were prepared from respective basic carbonates, that were neutralized with EDTA stoichiometry quantities. Complexometry with EDTA, thermogravimetry (TG), differential thermal analysis (DTA) and X-ray diffraction have been used in the study of these compounds. The results of complexometry with EDTA as well as TG and DTA curves bed to the stoichiometry of these compounds the following general formula is obeyed: H[Ln(EDTA]. n H 2 O. X-ray powder patterns of these compounds permitted to establish two isomorphous series. The DTA ant TG curves allowed us to study the dehydration process, the thermal stability and thermal decomposition of these compounds. (C.G.C.)

  6. Canine Antithrombin-III: Some Biochemical and Biologic Properties (United States)


    and renal diseases, sepsis, DIC, burns, and shock of various etiology (1,2,11,45,46,47 ,48). It is assumed that this decrease is due to "intra...severe preeclampsia and DIC (52), postpartum hemolytic uremic syndrome (53), and in infants with respiratory distress syndrome (54). Also, patients with...again after AT-III infusions (55). In another series of studies, patients with DIC of various etiology were treated with purified AT-III (47 ,56-59

  7. Oxidation of Ce(III) in Foam Decontaminant by Ozone

    International Nuclear Information System (INIS)

    Jung, Chong Hun; Yoon, I. H.; Choi, W. K.; Moon, J. K.; Yang, H. B.; Lee, J. S.


    A nanoparticle-based foam decontaminant is composed of a surfactant and nanoparticles for the generation and maintenance of foam, and a chemical decontamination agent made of Ce(IV) dissolved in nitric acid. Ce(IV) will be reduced to Ce(III) through the decontamination process. Oxidizing cerium(III) can be reused as a decontamination agent, Ce(IV). Oxidation treatment technology by ozone uses its strong oxidizing power. It can be regarded as an environmentally friendly process, because ozone cannot be stored and transported like other industrial gases (because it quickly decays into diatomic oxygen) and must therefore be produced on site, and used ozone can decompose immediately. The ozonation treatment of Ce(III) in foam decontaminant containing a surfactant is necessary for the effective regeneration of Ce(III). Thus, the present study was undertaken to determine the optimal conditions for ozonation treatment in the regeneration of Ce(III) into Ce(IV) in the nanoparticle-based foam decontaminant containing surfactant. This study was undertaken to determine the optimal conditions for ozonation treatment in the regeneration of Ce(III) to Ce(IV) in nanoparticle-based foam decontaminant containing a TBS surfactant. The oxidation conversion rate of Ce(III) was increased with an increase in the flow rate of the gas mixture and ozone injection amount. The oxidation time required for the 100% oxidation conversion of Ce(III) to Ce(IV) at a specific ozone injection amount can be predicted from these experimental data

  8. The Challenges of Basel III for Romanian Banking System


    Anca Elena NUCU


    Basel III represents a fundamental review of the regulatory and supervision framework of the banking industry in the future, the aim being to strengthen the stability of the financial system. The purpose of this paper is to analyze the impact of Basel III introduction upon the banking system at European level, respectively, upon the Romanian banking system. If at European level it is estimated a substantial deficit in capital and liquidity, with major impact on profitability indicators, the i...

  9. Hybrid III-V/SOI Resonant Cavity Photodetector

    DEFF Research Database (Denmark)

    Learkthanakhachon, Supannee; Taghizadeh, Alireza; Park, Gyeong Cheol


    A hybrid III-V/SOI resonant cavity photo detector has been demonstrated, which comprises an InP grating reflectorand a Si grating reflector. It can selectively detects an incident light with 1.54-µm wavelength and TM polarization.......A hybrid III-V/SOI resonant cavity photo detector has been demonstrated, which comprises an InP grating reflectorand a Si grating reflector. It can selectively detects an incident light with 1.54-µm wavelength and TM polarization....


    Energy Technology Data Exchange (ETDEWEB)

    Croxall, Kevin V.; Pogge, Richard W. [Department of Astronomy, The Ohio State University, 140 West 18th Avenue, Columbus, OH 43210 (United States); Berg, Danielle A. [Center for Gravitation, Cosmology and Astrophysics, Department of Physics, University of Wisconsin Milwaukee, 1900 East Kenwood Boulevard, Milwaukee, WI 53211 (United States); Skillman, Evan D. [Minnesota Institute for Astrophysics, University of Minnesota, 116 Church Street SE, Minneapolis, MN 55455 (United States); Moustakas, John [Department of Physics and Astronomy, Siena College, 515 Loudon Road, Loudonville, NY 12211 (United States)


    We present Large Binocular Telescope observations of 109 H ii regions in NGC 5457 (M101) obtained with the Multi-Object Double Spectrograph. We have robust measurements of one or more temperature-sensitive auroral emission lines for 74 H ii regions, permitting the measurement of “direct” gas-phase abundances. Comparing the temperatures derived from the different ionic species, we find: (1) strong correlations of T [N ii] with T [S iii] and T [O iii], consistent with little or no intrinsic scatter; (2) a correlation of T [S iii] with T [O iii], but with significant intrinsic dispersion; (3) overall agreement between T [N ii], T [S ii], and T [O ii], as expected, but with significant outliers; (4) the correlations of T [N ii] with T [S iii] and T [O iii] match the predictions of photoionization modeling while the correlation of T [S iii] with T [O iii] is offset from the prediction of photoionization modeling. Based on these observations, which include significantly more observations of lower excitation H ii regions, missing in many analyses, we inspect the commonly used ionization correction factors (ICFs) for unobserved ionic species and propose new empirical ICFs for S and Ar. We have discovered an unexpected population of H ii regions with a significant offset to low values in Ne/O, which defies explanation. We derive radial gradients in O/H and N/O which agree with previous studies. Our large observational database allows us to examine the dispersion in abundances, and we find intrinsic dispersions of 0.074 ± 0.009 in O/H and 0.095 ± 0.009 in N/O (at a given radius). We stress that this measurement of the intrinsic dispersion comes exclusively from direct abundance measurements of H ii regions in NGC 5457.

  11. Evidence for vacancy migration in stage III for copper

    International Nuclear Information System (INIS)

    Antesberger, G.; Sonnenberg, K.; Wienhold, P.; Coltman, R.R.; Klabunde, C.E.; Williams, J.M.


    Specimens doped with interstitial clusters and single vacancies have been annealed isochronally through the temperature range of stage III. Combining this annealing with a test irradiation after each annealing step reactions of mobile single test interstitials with the doping defects were studied. These reactions provide information about the variation of the doping defect structure during annealing. The experimental results suggest that vacancy clusters are formed in stage III

  12. Oxidation of Ce(III) in Foam Decontaminant by Ozone

    Energy Technology Data Exchange (ETDEWEB)

    Jung, Chong Hun; Yoon, I. H.; Choi, W. K.; Moon, J. K.; Yang, H. B. [Korea Atomic Energy Research Institute, Daejeon (Korea, Republic of); Lee, J. S. [Gachon University, Seongnam (Korea, Republic of)


    A nanoparticle-based foam decontaminant is composed of a surfactant and nanoparticles for the generation and maintenance of foam, and a chemical decontamination agent made of Ce(IV) dissolved in nitric acid. Ce(IV) will be reduced to Ce(III) through the decontamination process. Oxidizing cerium(III) can be reused as a decontamination agent, Ce(IV). Oxidation treatment technology by ozone uses its strong oxidizing power. It can be regarded as an environmentally friendly process, because ozone cannot be stored and transported like other industrial gases (because it quickly decays into diatomic oxygen) and must therefore be produced on site, and used ozone can decompose immediately. The ozonation treatment of Ce(III) in foam decontaminant containing a surfactant is necessary for the effective regeneration of Ce(III). Thus, the present study was undertaken to determine the optimal conditions for ozonation treatment in the regeneration of Ce(III) into Ce(IV) in the nanoparticle-based foam decontaminant containing surfactant. This study was undertaken to determine the optimal conditions for ozonation treatment in the regeneration of Ce(III) to Ce(IV) in nanoparticle-based foam decontaminant containing a TBS surfactant. The oxidation conversion rate of Ce(III) was increased with an increase in the flow rate of the gas mixture and ozone injection amount. The oxidation time required for the 100% oxidation conversion of Ce(III) to Ce(IV) at a specific ozone injection amount can be predicted from these experimental data.

  13. Thermal decomposition of yttrium(III) propionate and butyrate

    DEFF Research Database (Denmark)

    Grivel, Jean-Claude


    The thermal decompositions of yttrium(III) propionate monohydrate (Y(C2H5CO2)3·H2O) and yttrium(III) butyrate dihydrate (Y(C3H7CO2)3·2H2O) were studied in argon by means of thermogravimetry, differential thermal analysis, IR-spectroscopy, X-ray diffraction and hot-stage microscopy. These two...

  14. Thallium (III) salts utilization in organic synthesis. Part II

    International Nuclear Information System (INIS)

    Ferraz, H.M.C.


    The utilizations of thallium (III) salts in organic synthesis with carbonylic and acitylenic substrates are presented. The reactions of carbonylic substra3ts with kitones and the oxidation reactions of acetylenic substrates are shown. Others reactions including thallium (III) salts and non aromatic unsatured substracts, as cleasage of ethers and epoxide using thallium trinitrate, hydrazones treatments with thallium triacetates, etc, are also mentioned. (C.G.C.) [pt

  15. Role of metallothionein-III following central nervous system damage

    DEFF Research Database (Denmark)

    Carrasco, Javier; Penkowa, Milena; Giralt, Mercedes


    We evaluated the physiological relevance of metallothionein-III (MT-III) in the central nervous system following damage caused by a focal cryolesion onto the cortex by studying Mt3-null mice. In normal mice, dramatic astrogliosis and microgliosis and T-cell infiltration were observed in the area...... the inflammatory response elicited in the central nervous system by a cryoinjury, nor does it serve an important antioxidant role, but it may influence neuronal regeneration during the recovery process....

  16. Application of the extended TRANSURANUS code in FUMEX-III

    International Nuclear Information System (INIS)

    Schubert, A.; Di Marcello, V.; Van Uffelen van de Laar, P.J.; Botazzoli, P.; Pastore, G.; Boneva, S.


    This paper focuses on the application of the TRANSURANUS code to the LWR priority cases of FUMEX-III. In the 2-nd section the present situation for the main topics of interest is illustrated on examples. The 3-rd section outlines the ongoing code developments and discusses their impact on the simulation of further specific cases of FUMEX-III. In the last section conclusions are drawn from the current status of the analysis

  17. Imaging assessment of isolated lesions affecting cranial nerve III

    International Nuclear Information System (INIS)

    Garcia, Marcelo de Mattos; Martins, Jose Carlos Tadeu


    The aim of this study is to review the anatomy and main pathologic conditions affecting cranial nerve III using imaging studies, particularly magnetic resonance imaging. Imaging methods are essential in the evaluation of patients with suspected lesions of the oculomotor nerve once signs and symptoms are unspecific and a large number of diseases can affect cranial nerve III. A brief review of the literature is also presented. (author)

  18. Unusual case of failure to thrive: Type III Bartter syndrome. (United States)

    Agrawal, S; Subedi, K; Ray, P; Rayamajhi, A


    Bartter syndrome Type III is a rare autosomal recessive disorder resulting from an inherited defect in the thick ascending limb of the loop of henle of the nephrons in kidney. The typical clinical manifestations in childhood are failure to thrive and recurrent episodes of vomiting. Typical laboratory findings which help in the diagnosis are hypokalemic metabolic alkalosis, hypomagnesemia and hypercalciuria. We report a case of Type III Bartter syndrome not responding to repeated conventional treatment of failure to thrive.

  19. Procykličnost v Basel II a Basel III


    Šobotníková, Petra


    The term procyclicality refers to the ability of a system to amplify business cycles. The recent financial crisis has revealed that the current regulatory framework, Basel II, affects the business cycle in exactly that manner. The newly published Basel III therefore sought to include tools that would mitigate the procyclical nature of regulatory framework. The aim of the thesis is to analyze whether such tools are effective and whether the procyclicality under Basel III has been mitigated whe...

  20. Bayley-III Cognitive and Language Scales in Preterm Children. (United States)

    Spencer-Smith, Megan M; Spittle, Alicia J; Lee, Katherine J; Doyle, Lex W; Anderson, Peter J


    This study aimed to assess the sensitivity and specificity of the Bayley Scales of Infant and Toddler Development, Third Edition (Bayley-III), Cognitive and Language scales at 24 months for predicting cognitive impairments in preterm children at 4 years. Children born cognitive functioning. Test norms and local term-born reference data were used to classify delay on the Bayley-III Cognitive and Language scales. Impairment on the DAS-II Global Conceptual Ability, Verbal, and Nonverbal Reasoning indices was classified relative to test norms. Scores cognitive delay on the Bayley-III for predicting impairment on DAS-II indices ranged from 29.4% to 38.5% and specificity ranged from 92.3% to 95.5%. The sensitivity of mild/moderate language delay on the Bayley-III for predicting impairment on DAS-II indices ranged from 40% to 46.7% and specificity ranged from 81.1% to 85.7%. The use of local reference data at 24 months to classify delay increased sensitivity but reduced specificity. Receiver operating curve analysis identified optimum cut-point scores for the Bayley-III that were more consistent with using local reference data than Bayley-III normative data. In our cohort of very preterm children, delay on the Bayley-III Cognitive and Language scales was not strongly predictive of future impairments. More children destined for later cognitive impairment were identified by using cut-points based on local reference data than Bayley-III norms. Copyright © 2015 by the American Academy of Pediatrics.

  1. Effect of Population III Multiplicity on Dark Star Formation (United States)

    Stacy, Athena; Pawlik, Andreas H.; Bromm, Volker; Loeb, Abraham


    We numerically study the mutual interaction between dark matter (DM) and Population III (Pop III) stellar systems in order to explore the possibility of Pop III dark stars within this physical scenario. We perform a cosmological simulation, initialized at z approx. 100, which follows the evolution of gas and DM. We analyze the formation of the first mini halo at z approx. 20 and the subsequent collapse of the gas to densities of 10(exp 12)/cu cm. We then use this simulation to initialize a set of smaller-scale 'cut-out' simulations in which we further refine the DM to have spatial resolution similar to that of the gas. We test multiple DM density profiles, and we employ the sink particle method to represent the accreting star-forming region. We find that, for a range of DM configurations, the motion of the Pop III star-disk system serves to separate the positions of the protostars with respect to the DM density peak, such that there is insufficient DM to influence the formation and evolution of the protostars for more than approx. 5000 years. In addition, the star-disk system causes gravitational scattering of the central DM to lower densities, further decreasing the influence of DM over time. Any DM-powered phase of Pop III stars will thus be very short-lived for the typical multiple system, and DM will not serve to significantly prolong the life of Pop III stars.

  2. Human resources managers as custodians of the King III code

    Directory of Open Access Journals (Sweden)

    Frank de Beer


    Full Text Available The objective of this research was to perform an exploratory study on the knowledge and understanding of the King III code among Human Resources (HR managers in South African companies. The King III code is a comprehensive international corporate governance regime which addresses the financial, social, ethical and environmental practices of organisations. HR management plays a role in managing corporate governance by using the King III code as a guideline. The main research questions were: Does HR management know, understand, apply, and have the ability to use the King III code in terms of ethical decision-making? What role does HR management play in corporate governance? A random sample of available HR managers, senior HR consultants and HR directors was taken and semi-structured interviews were conducted. The results indicated that the respondents had no in-depth knowledge of the King III code. They did not fully understand the King III code and its implications nor did they use it to ensure ethical management. The themes most emphasised by the participants were: culture, reward and remuneration, policies and procedures and performance management. The participants emphasised the importance of these items  and HR’s role in managing them.

  3. Population III Stars and Remnants in High-redshift Galaxies (United States)

    Xu, Hao; Wise, John H.; Norman, Michael L.


    Recent simulations of Population III star formation have suggested that some fraction form in binary systems, in addition to having a characteristic mass of tens of solar masses. The deaths of metal-free stars result in the initial chemical enrichment of the universe and the production of the first stellar-mass black holes. Here we present a cosmological adaptive mesh refinement simulation of an overdense region that forms a few 109 M ⊙ dark matter halos and over 13,000 Population III stars by redshift 15. We find that most halos do not form Population III stars until they reach M vir ~ 107 M ⊙ because this biased region is quickly enriched from both Population III and galaxies, which also produce high levels of ultraviolet radiation that suppress H2 formation. Nevertheless, Population III stars continue to form, albeit in more massive halos, at a rate of ~10-4 M ⊙ yr-1 Mpc-3 at redshift 15. The most massive starless halo has a mass of 7 × 107 M ⊙, which could host massive black hole formation through the direct gaseous collapse scenario. We show that the multiplicity of the Population III remnants grows with halo mass above 108 M ⊙, culminating in 50 remnants located in 109 M ⊙ halos on average. This has implications that high-mass X-ray binaries and intermediate-mass black holes that originate from metal-free stars may be abundant in high-redshift galaxies.


    Directory of Open Access Journals (Sweden)

    Rinandri Charea Runizar


    Full Text Available Timing of orthodontic treatment for Class III malocclusion has always been somewhat controversial. Many orthodontic pioneers like Angle, Tweed, and Graber have advocated early interception of class II malocclusion because this kind of skeletal discrepancy once established, would usually progress rapidly. What kind of early treatment would be appropriate for this malocclusion? Would this approach be effective and promises a stable result? Early orthodontic treatment is defined as a treatment that is initiated during the primary or mixed dentition stage to enhance skeletal and dental development. It is usually done in two phases. The first phase is intended to correct skeletal discrepancy by taking advantage of growth and development period. The second phase followed to improve occlusal relationship. Early treatment of Class III malocclusion is a possible alternative to improve skeletal discrepancy or at the very east may serve to prevent a worsening malocclusion. Principles of Class III early treatment depend on whether it is dental Class III, functional Class III, or skeletal Class III. Practitioners should consider positive and negative factors of a patient before initiating treatment. Likewise, they should understand factors that affect prognosis and stability of the results.

  5. Binary and ternary chelates of Sc(III), Y(III) and La(III) with ethylenediamine tetraacetic acid as primary ligand and substituted salicylic acids as secondary ligands

    Energy Technology Data Exchange (ETDEWEB)

    Pandey, A K; Chandra, M; Agarwala, B V; Dey, A K [Allahabad Univ. (India). Chemical Labs.


    Study of ternary complex formation of several tripositive metal ions viz. Sc(III), Y(III) and La(III) with ethylenediamine tetraacetic acid (EDTA) as a primary ligand and 5-chlorosalicylic acid (CSA) or 3,5-dibromosalicylic acid (DBSA) as secondary ligands by pH-metric titration technique is reported. The stability order of metal chelates with respect to ligands is observed to be DBSA>CSA and with respect to metal ions Sc(III)>Y(III)>La(III).

  6. Determination of stability constants of lanthanides (III) with amino acids (Preprint No. AL-07)

    International Nuclear Information System (INIS)

    Patel, N.M.; Patel, P.M.; Patel, M.N.; Joshi, J.D.


    The present paper reports the stability constants of La(III), Ce(III), Pr(III), Nd(III), Sm(III) and Gd(III) with amino acids valine, serine, threonine, methionine and aspartic acid. The coordination of valine and aspartic acid have been discussed. The stability constants of trivalent lanthanide amino acid complexes were found to be in the order, La < Ce < Pr < Nd < Sm < Gd. (author). 5 refs

  7. Kinetic of liquid-liquid extraction for uranyl nitrate and actinides (III) and lanthanides (III) nitrates by amide extractants

    International Nuclear Information System (INIS)

    Toulemonde, V.; CEA Centre d'Etudes de la Vallee du Rhone, 30 -Marcoule


    The kinetics of liquid-liquid extraction by amide extractants have been investigated for uranyl nitrate (monoamide extractants), actinides (III) and lanthanides (III) nitrates (diamide extractants). The transfer of the metallic species from the aqueous phase to the organic phase was studied using two experimental devices: ARMOLLEX (Argonne Modified Lewis cell for Liquid Liquid Extraction) and RSC (Rotating Stabilized Cell). The main conclusions are: for the extraction of uranyl nitrate by DEHDMBA monoamide, the rate-controlling step is the complexation of the species at the interface of the two liquids. Thus, an absorption-desorption (according to Langmuir theory) reaction mechanism was proposed; for the extraction of actinides (III) and lanthanides (III) nitrates in nitric acid media by DMDBTDMA diamide, the kinetic is also limited by interfacial reactions. The behavior of Americium and Europium is very similar as fare as their reaction kinetics are concerned. (author)

  8. Radiation protection in category III large gamma irradiators; Radioprotecao em irradiadores de grande porte de categoria III

    Energy Technology Data Exchange (ETDEWEB)

    Costa, Neivaldo; Furlan, Gilberto Ribeiro, E-mail: neivaldo@cena.usp.b, E-mail: gilfurlan@cena.usp.b [Centro de Energia Nuclear na Agricultura (CENA/USP), Piracicaba, SP (Brazil); Itepan, Natanael Marcio, E-mail: [Universidade Anhanguera, Goiania, GO (Brazil)


    This article discusses the advantages of category III large gamma irradiator compared to the others, with emphasis on aspects of radiological protection, in the industrial sector. This category is a kind of irradiators almost unknown to the regulators authorities and the industrial community, despite its simple construction and greater radiation safety intrinsic to the model, able to maintain an efficiency of productivity comparable to those of category IV. Worldwide, there are installed more than 200 category IV irradiators and there is none of a category III irradiator in operation. In a category III gamma irradiator, the source remains fixed in the bottom of the tank, always shielded by water, negating the exposition risk. Taking into account the benefits in relation to radiation safety, the category III large irradiators are highly recommended for industrial, commercial purposes or scientific research. (author)

  9. Determination of dissociation constants for coordination compounds of Cr(III) and Co(III) using potentiometric and spectrophotometric methods

    Energy Technology Data Exchange (ETDEWEB)

    Chylewska, A.; Jacewicz, D.; Zarzeczanska, D. [Department of Chemistry, University of Gdansk, Sobieskiego 18/19, 80-952 Gdansk (Poland); Chmurzynski, L. [Department of Chemistry, University of Gdansk, Sobieskiego 18/19, 80-952 Gdansk (Poland)], E-mail:


    The acid-base properties of analogous complex ions of chromium(III) and cobalt(III) in aqueous solution have been studied. The equilibrium constants for all metal complexes were determined by using potentiometric and spectrophotometric titration methods. First, dissociation constants for the studied complexes of Cr(III) and Co(III) were determined by means of the potentiometric titration method and using the STOICHIO computer programme. Then, pH-spectrophotometric titrations were performed and the OriginPro 7.5 computer programme was used to calculate the same constants. The measurements using both methods were carried out under the same conditions of temperature, T = 298.15 K, and over the same pH range 2.00-10.00, respectively. It turned out that the two methods used enabled us to obtain acidity constants in very good agreement.

  10. Stability constants of mixed ligand complexes of lanthanide(III) and yttrium(III) with complexone and substituted salicylic acids

    International Nuclear Information System (INIS)

    Kolhe, Vishnu; Dwivedi, K.


    Salicylic acid and substituted salicylic acids are potential antimicrobial agents. Binary complexes of salicylic acid and its substituted derivatives with lanthanide(III) and yttrium(III) metal ions have been reported. There are reports on the ternary metal complexing equilibria with some lanthanide(III) and yttrium(III) metal ions involving aminopolycarboxylic acid as one ligand and salicylic acid (SA) and other related compounds as the second ligands. Ethylene glycol bis(2-aminoethylether)- N, N, N', N'-tetraacetic acid (EGTA) is an important member of aminopolycarboxylic acid and finds many applications in medicine and biology. Recently, few ternary complexes have been reported using EGTA as ligand. In view of biological importance of simple and mixed ligand complexes EGTA, SA and DNSA (3,5-dinitrosalicylic acid), a systematic study has been undertaken for the determination of stability constant and the results are reported. (author). 6 refs., 1 fig., 2 tabs

  11. Determination of dissociation constants for coordination compounds of Cr(III) and Co(III) using potentiometric and spectrophotometric methods

    International Nuclear Information System (INIS)

    Chylewska, A.; Jacewicz, D.; Zarzeczanska, D.; Chmurzynski, L.


    The acid-base properties of analogous complex ions of chromium(III) and cobalt(III) in aqueous solution have been studied. The equilibrium constants for all metal complexes were determined by using potentiometric and spectrophotometric titration methods. First, dissociation constants for the studied complexes of Cr(III) and Co(III) were determined by means of the potentiometric titration method and using the STOICHIO computer programme. Then, pH-spectrophotometric titrations were performed and the OriginPro 7.5 computer programme was used to calculate the same constants. The measurements using both methods were carried out under the same conditions of temperature, T = 298.15 K, and over the same pH range 2.00-10.00, respectively. It turned out that the two methods used enabled us to obtain acidity constants in very good agreement

  12. Imaging assessment of isolated lesions affecting cranial nerve III; Avaliacao por imagem das lesoes isoladas do III par craniano

    Energy Technology Data Exchange (ETDEWEB)

    Garcia, Marcelo de Mattos [Colegio Brasileiro de Radiologia e Diagnostico por Imagem (CBR), Sao Paulo, SP (Brazil)]. E-mail:; Martins, Jose Carlos Tadeu [Sociedade Brasileira de Neuroradiologia, Sao Paulo, SP (Brazil)


    The aim of this study is to review the anatomy and main pathologic conditions affecting cranial nerve III using imaging studies, particularly magnetic resonance imaging. Imaging methods are essential in the evaluation of patients with suspected lesions of the oculomotor nerve once signs and symptoms are unspecific and a large number of diseases can affect cranial nerve III. A brief review of the literature is also presented. (author)

  13. Lanthanoplatins: emissive Eu(iii) and Tb(iii) complexes staining nucleoli targeted through Pt-DNA crosslinking. (United States)

    Singh, Khushbu; Singh, Swati; Srivastava, Payal; Sivakumar, Sri; Patra, Ashis K


    Two highly luminescent water-soluble heterometallic LnPt 2 complexes, [{cis-PtCl(NH 3 ) 2 } 2 Ln(L)(H 2 O)](NO 3 ) 2 (Ln = Eu (1), Tb (2)), have been designed for their selective nucleoli staining through formation of Pt-DNA crosslinks. The complexes showed significant cellular uptake and distinctive nucleoli localization through intrinsic emission from Eu III or Tb III observed through confocal fluorescence microscopy.

  14. Use of Fe(III) oxalate for oxidativewastewater treatment; Einsatz von Fe(III)-Oxalat zur chemisch-oxidativen Abwasserbehandlung

    Energy Technology Data Exchange (ETDEWEB)

    Kim, S.M.; Vogelpohl, A. [Clausthal Univ., Clausthal-Zellerfeld (Germany). Inst. fuer Thermische Verfahrenstechnik


    Iron(III)-oxalate was used as an iron catalyst for the Photo Fenton reaction. Iron(III) oxalations ([Fe(C{sub 2}O{sub 4}){sub 3}]{sup 3-}) are reduced to Fe(II) by irradiation using near UV-light ({lambda} = 300 - 400 nm) or visible light ({lambda} > 400 nm). At the same time, CO{sub 2}{sup -} or C{sub 2}O{sub 4}{sup -}-radicals originate, which cause the secondary reduction of Fe(III) to Fe(II). By means of the photolytically regenerated Fe(II) ions, hydroxyl radicals are increasingly formed, so that the degradation of organic substances is accelerated. The work aimed to assess the catalytic effect of Fe(III) oxalate for photochemical oxidation processes and to establish the parameters influencing further treatment of leachate from a municipal waste sanitary landfill by means of technical-scale experiments. (orig.) [Deutsch] In der vorliegenden Arbeit wurde Eisen(III)-Oxalat als Eisenkatalysator fuer die Photo-Fenton-Reaktion eingesetzt. Eisen(III)-Oxalationen ([Fe(C{sub 2}O{sub 4}){sub 3}]{sup 3-}) werden durch Strahlung mit nahem UV-Licht ({lambda}=300 bis 400 nm) oder mit sichtbarem Licht ({lambda}>400 nm) zu Fe(II) reduziert. Gleichzeitig entstehen CO{sub 2}{sup .-} oder C{sub 2}O{sub 4}{sup .-}-Radikale, die eine sekundaere Reduktion von Fe(III) zu Fe(II) bewirken. Mit Hilfe der photolytiisch regenerierten Fe(II)-Ionen werden vermehrt Hydroxylradikale gebildet und damit die Abbaugeschwindigkeit der organischen Substanzen beschleunigt. Ziel der hier vorgestellten Arbeit war es, die katalytische Wirkung von Fe(III)-Oxalat fuer photochemische Oxidationsverfahren abzuschaetzen und die Einflussparameter zur weitergehenden Behandlung eines Deponiesickerwassers aus Hausmuelldeponie anhand von Technikumsversuchen zu ermitteln. (orig.)

  15. CMPO-calix[4]arenes and the influence of structural modifications on the Eu(III), Am(III), Cm(III) separation

    International Nuclear Information System (INIS)

    Peters, C.; Braekers, D.; Desreux, J.F.; Kasyan, O.; Miroshnichenko, S.; Rudzevich, V.; Boehmer, V.


    The syntheses of new calix[4]arenes featuring CMPO groups on the wide rim are reported and the extraction of Am(III) and Eu(III) from concentrated HNO 3 aqueous phases are discussed with reference to the properties of the symmetric tetra-CMPO derivative 1. All extraction studies were conducted in the same experimental conditions which allows to directly compare the dependence of the distribution coefficients of various calixarenes on the acid concentration (0.1 M 3 ] < 5 M). Calix[4]arene 1 becomes a very poor extractant if the length of the aliphatic chain between the amide and phosphine oxide groups of CMPO is increased, if the bridging methylene groups are replaced by sulfur atoms or if the macrocyclic cavity size is increased. By contrast, mixed amide - CMPO calix[4]arenes are nearly as effective than 1. Moreover, Am(III)/Cm(III) separation coefficients between 1.5 and 3 have been obtained with unsymmetrical calix[4]arenes of type 1 with different aliphatic chains grafted on the narrow rim. Guidelines to anticipate the extraction ability of calix[4]arenes remain elusive because of the intricate solution behavior of these compounds. (orig.)


    NARCIS (Netherlands)

    de Wolf, J.M.; Meetsma, A.; Teuben, J.H


    The first structurally characterized monomeric bis(cyclopentadienyl)titanium(III) hydride, (C(5)PhMe(4))(2)TiH (4), was synthesized by hydrogenolysis of (C(5)PhMe(4))(2)TiMe (5). Hydride 4 was found to be a monomeric bent sandwich by X-ray diffraction methods, and the pentamethylcyclopentadienyl

  17. Analysis of gold(I/III)-complexes by HPLC-ICP-MS demonstrates gold(III) stability in surface waters. (United States)

    Ta, Christine; Reith, Frank; Brugger, Joël; Pring, Allan; Lenehan, Claire E


    Understanding the form in which gold is transported in surface- and groundwaters underpins our understanding of gold dispersion and (bio)geochemical cycling. Yet, to date, there are no direct techniques capable of identifying the oxidation state and complexation of gold in natural waters. We present a reversed phase ion-pairing HPLC-ICP-MS method for the separation and determination of aqueous gold(III)-chloro-hydroxyl, gold(III)-bromo-hydroxyl, gold(I)-thiosulfate, and gold(I)-cyanide complexes. Detection limits for the gold species range from 0.05 to 0.30 μg L(-1). The [Au(CN)2](-) gold cyanide complex was detected in five of six waters from tailings and adjacent monitoring bores of working gold mines. Contrary to thermodynamic predictions, evidence was obtained for the existence of Au(III)-complexes in circumneutral, hypersaline waters of a natural lake overlying a gold deposit in Western Australia. This first direct evidence for the existence and stability of Au(III)-complexes in natural surface waters suggests that Au(III)-complexes may be important for the transport and biogeochemical cycling of gold in surface environments. Overall, these results show that near-μg L(-1) enrichments of Au in environmental waters result from metastable ligands (e.g., CN(-)) as well as kinetically controlled redox processes leading to the stability of highly soluble Au(III)-complexes.

  18. Simulated Target Preparation and Separation of Cd (II) - In (III) Matrices Using 8-Hydroxyquinoline Reagent for Producing Indium - III Radioisotope

    International Nuclear Information System (INIS)

    Sunarhadijoso Soenarjo; Swasono R Tamat; Lukiyawati; Lintang Maharani


    The potency of production and application of 111 In in Indonesia is not supported yet by capability in required processing technology. The presented paper is a preliminary study on processing technology of 111 In production from 112 Cd target covering simulated target preparation and separation of Cd(II)-In(III) matrices. The target preparation was performed by means of electroplating of CdSO 4 solution prepared from reaction of CdO and sulphuric acid. The separation of Cd(II)-In(III) matrices was proceeded by means of solvent extraction in the presence of 8-hydroxyquinoline as In(III)-complexing agent. The Cd-electroplating deposit was satisfactorily found by using 40-60 mA currents with an electroplating time of 5-7 hours. Simulated matrix solution containing mixture of Cd(II) and In(III) was extracted into chloroform with the presence of 8-hydroxyquinoline. The chloroform phase being assumed to contain In(III)-8-hydroxyquinoline complex was then re-extracted with 1 M HCl or saline solution. Each extraction fraction was spectrophotometrically identified in the region of 200-400 nm. From the resulting absorption spectra, it can be shown that the In(III) species is selectively separated from the Cd(II)-matrix. The use of saline in the re-extraction process is better then 1 M HCl solution due to solubility of 8-hydroxyquinoline in HCl. (author)


    Jukemura, José; Diniz, Márcio Augusto


    To evaluate the preliminary results related to journals up-grade that was used by Medicine III, through opportunity offered by Capes to all agency areas programs. Were used area document of Medicine I, II and III, besides other relevant topics available online at Capes site, between 2009 and 2013. The research was focused to answer two questions: 1) the stratification of Qualis is similar in the three areas of medicine? and 2) the evolution of Qualis in Medicine III was higher? Medicine III showed an increase in its Qualis classification and is publishing in journals with higher impact factors, virtually the same as the Medicine I and II. The area showed the strongest growth in recent three-year periods. Avaliar os resultados preliminares sobre a Medicina III do up-grade oportunizado pela Capes para todas as áreas. Foram utilizados os documentos de áreas e os relevantes ao tema disponíveis online no site da Capes entre 2009 e 2013. Procurou-se focar a pesquisa em dois aspectos para responder duas perguntas: 1) a estratificação do Qualis é semelhante nas três áreas da medicina? e 2) a evolução do Qualis da Medicina III foi maior? A Medicina III apresentou evolução em sua classificação Qualis e está publicando em revistas com maior fator de impacto e é praticamente igual ao da Medicina I e II. A área foi a que apresentou maior evolução nestes últimos triênios.

  20. Synthesis, Structural and Antibacterial Studies of New Dithiocarbamate Complexes of Sb (III) And Bi (III)

    International Nuclear Information System (INIS)

    Nur Amirah Jamaluddin; Ibrahim Baba; Nazlina Ibrahim


    Six new dithiocarbamate complexes from three different amines, for example N-ethyl ethanol-, N-butylethyl- and N-benzylmethylamine were successfully prepared using in situ method. All complexes were characterized by elemental analysis, IR, UV-Vis, 13 C and 1 H NMR. Elemental analysis data (C, H, N and S) showed an agreement with the general formula of MCl(S 2 CNR ' R '' ) 2 , (M = Sb (III), Bi (III); R ' = ethyl, butyl and benzyl; R '' = ethanol, ethyl and methyl). The complexes had been characterized by infrared spectroscopy that showed a thioureido bands, v(C-N) in the region of 1427 - 1490 cm -1 followed by v(C-S) bands that can be seen in the region of 935 - 1060 cm -1 and v(M-S) bands existed in the region of 350 - 392 cm -1 . Maximum wavelength absorption for ultraviolet-visible spectroscopy for N-C-S group was at 254 nm which indicates π → π * transition. Data from 13 C NMR showed a signal in the region of 198.39 - 199.44 ppm that corresponded to the NCS 2 group. The crystal structure of bis(N,N ' utylethyldithiocarbamato)chloride antimony (III), SbCl (S 2 CN(C 4 H 9 )(C 2 H 5 )) 2 demonstrated a five-coordination geometry, triclinic system, space group P1 with a = 10.0141(8) Armstrong, b = 10.1394(7) Am strong, c = 11.8665(9) Armstrong, α = 67.960(2) degree, β = 87.616(2) degree and γ = 80.172(2) degree. Minimum inhibitory concentration (MIC) and minimum bactericidal concentration (MBC) tests were done using five dithiocarbamate complexes which are Bi Cl[S 2 CN(C 2 H 5 )(C 2 H 4 OH)) 2 , SbCl[S 2 CN(C 2 H 5 )(C 2 H 4 OH)) 2 , Bi Cl(S 2 CN(C 4 H 9 )(C 2 H 5 )) 2 , SbCl(S 2 CN(C 4 H 9 )(C 2 H 5 )) 2 , Bi Cl(S 2 CN(C 7 H 7 )(CH 3 )) 2 towards S. aureus, S. epidermidis, E. aerogenes and E. coli. It was found that all four complexes were active against S. aureus except SbCl(S 2 CN(C 2 H 5 )(C 2 H 4 OH)) 2 while Bi Cl(S 2 CN(C 7 H 7 )(CH 3 )) 2 and Bi Cl(S 2 CN(CH 3 )(C 6 H 11 )) 2 complexes were active against S. epidermidis with MIC value of 5.0 mg/ m

  1. Investigation of the separation of americium(III) and europium(III) by high-speed countercurrent chromatography

    International Nuclear Information System (INIS)

    Wu, J.F.; Jin, Y.R.; Xu, Q.C.; Wang, S.L.; Zhang, L.X.


    The long-lived actinides are the important elements in the radioactive waste ;disposal. Because the ions semi diameter and chemical properties of trivalent actinides(III) and trivalent lanthanides(III) are very similar, the separation between them is very difficult. Yang Yu-Sheng put forward the actinides(III) are softer acid than the lanthanides(III), so the actinides(III) are more easily extracted by the soft extractant contain sulfur or nitrogen than the lanthanides(III). Some research have been done on the separation between actinides(III) and lanthanides(III) using the extractants contain sulfur or nitrogen. The results show that satisfactory separation efficiency was gained. Countercurrent Chromatography (CCC) have many specific advantages, such as free from solid support, permit large sample volume and high flow rate, which is useful in the preconcentration of inorganic solute and inorganic preparation. Some studies were done on the separation of lanthanides or-other inorganic elements by HSCCC, the high-purity reagents prepared by HSCCC or CPC turned out to be successful. In present paper, the investigation of separation between Americium (III) and Euricium (III) by High-Speed Countercurrent Chromatography (HSCCC) were made. The extractant used in the work was prepared by ourselves, which is of the soft extractant contrain sulfur. The effects of separation condition on the separation efficiency of Am and Eu by HSCCC were investigated using dichlorophenyl dithiophosphinic acid in xylene as the stationary phase and 0.1 mol/L NaClO4 as mobile phase, respectively. The results show that mutual separation between Am and Eu can be accomplished. The separation factor increases with the increasing of the concentration of extractant and the pH value of the mobile phase, further more, minishing the flow rate of the mobile phase can also improves the separation efficiency between Am and Eu. The nearly base separation was gained when the flow rate is 0.35 ml/min, the

  2. Effect of pH on stability constants of Am(III)- and Cm(III)- humate complexes

    International Nuclear Information System (INIS)

    Samadfam, Mohammad; Jintoku, Takashi; Sato, Seichi; Ohashi, Hiroshi; Mitsugashira, Toshiaki; Hara, Mitsuo; Suzuki, Yoshimitsu


    The apparent stability constants of Am(III)- and Cm(III)-humate complexes were determined by dialysis method at ionic strength 0.1 in the pH range from 3.3 to 5.7 under N 2 bubbling. The Am(III) and Cm(III) loadings were about 10 -7 and 10 -10 mol/dm 3 . The concentrations of Am-241 and Cm-242 tracers were measured by α-spectrometry. It was found that the apparent stability constants were almost identical for both the Am(III)-humate and Cm(III)-humate complexes. The apparent stability constants showed a small pH-dependence, increasing from 10 4.6 at pH 3.3 to 10 5.1 at pH 5.7. The ionization of acidic functional groups of humic acid is possibly the primary factor. Above pH 6, the dialysis membrane was no langer permeable to Am(III) and Cm(III) ions and the apparent stability constant could not be experimentally obtained. The apparent stability constants between pH 6 and pH 8.5 were evaluated by considering that both binary metal-humate and ternary metal-hydroxo-humate complexes exist at pHs above 6. It was assumed that mono-hydroxo-humate complex Am(OH)HA and Cm(OH)HA are the major ternary complexes that exist below pH 9. The overall stability constants for Am(III)- and Cm(III)-humate complexes increased from 10 5.7 at pH 6 to 10 7.2 at pH 8. This implies that the formation of metal-hydroxo-humate species is preferred over the formation of hydroxide species. The apparent overall stability constants can be easily incorporated into geochemical modeling of trivalent actinide migration. The results of the present study show that the apparent stability constants determined experimentally at pH≤6 do not represent the complexation properties at higher pHs and the formation of ternary complexes should be considered in speciation calculations of radionuclides at terrestrial environment. (J.P.N.)

  3. Speciation of Am(III)/Eu(III) sorbed on γ-alumina. Effect of metal ion concentration

    International Nuclear Information System (INIS)

    Kumar, S.; Tomar, B.S.; Godbole, S.V.


    The present paper describes the speciation of Am(III)/Eu(III) sorbed on γ-alumina, and its evolution with changing metal ion concentration, studied using batch sorption experiment, time resolved fluorescence spectroscopy (TRFS), extended X-ray absorption fine structure (EXAFS) and surface Complexation modeling (SCM). Though numerous studies exist in the literature on the speciation of trivalent actinides and lanthanides on alumina surface, the mechanism of sorption at high metal ion concentrations is not yet fully understood. Batch sorption experiments of Am(III) on γ-alumina under varying condition of pH (3-10), ionic strength (0.005-0.1 M NaClO 4 ) and metal ion concentration (10 -7 -10 -4 M) were performed. Higher metal ion concentration was achieved by the addition of Eu(III) considering it as an analogue of Am(III). Time resolved fluorescence spectroscopy (TRFS) study of Eu(III) sorbed on γ-alumina at the metal ion concentration of 5.0 x 10 -5 M was carried out over pH 4 to 7. TRFS showed the presence of two surface species, with distinctly different fluorescence decay life times. The shorter lifetime value and its changing pattern with pH indicate the surface species corresponding to this component to be monodentate species > AlOAm 2+ and its hydrolyzed forms. The sorbed Eu 3+ species corresponding to the longer lifetime value has 2-3 water molecules in its first coordination sphere and is multidentate in its binding on alumina surface. Extended X-ray absorption fine structure (EXAFS) measurement of Eu:γ-Al 2 O 3 sorption systems at pH 6.18 and 7.15 corroborate the existence of two surface complexes. Further it suggests the edge sharing bidentate binding of Eu on AlO 6 octahedra as the co-ordination mode of the higher lifetime component. Surface Complexation Modeling (SCM) of Am(III)/Eu(III) sorption onto γ-alumina at pH ≤7 has been carried out using these two surface species. 2-pK surface complexation modeling coupled with constant capacitance model

  4. Complexation of Cucurbit(7)uril with Eu(III)

    International Nuclear Information System (INIS)

    Kar, Aishwarya; Rawat, Neetika; Rao, Ankita; Tomar, B.S.; Nayak, S.K.; Ray, Alok


    Cucurbiturils (CBs) CB(n)s are macrocyclic molecules with carbonyl groups at the portals, which bind cations through ion dipole interactions and the cavity which stabilize hydrophobic moieties. The size of the portal and the volume of the interior cavities of CB(n)s are dependent on the number of glycoluril units present in CBs. CBs are widely used as supramolecular host systems in applications, such as formation of supramolecular hydrogels, drug delivery systems. Though the binding of CBs with organic guest molecules have been studied extensively where as metal complexation studies are very few. In the present work, complexation studies of Cucurbit(7)uril (with seven glycouril units, CB7) with Eu(III) were carried out using fluorescence, UV-vis spectrophotometry. The stability constant for 1:1 complex CB7-Eu(III) complex determined by monitoring the change in CB7 UV- vis absorption spectra on addition of Eu(III) was found to be 2.99 ± 0.08. The fluorescence spectra of increasing ligand to metal ratio exhibited the increase in the intensity ratio of peak at 616 and 592 which is the measure of complexation of Eu(III) with CB7 and was used to deduce the stability constant and the value (2.82 ± 0.07) obtained was in good agreement with that obtained from UV vis spectroscopy. Further, the life time of Eu(III) ion, which increased with CB7 to Eu(III) ratio, was used to deduce number of water molecules around Eu(III) metal ion which were found to decrease from 9 to 3 thereby suggesting inner sphere complexation. The stability constant of CB7 with Eu(III) is one order of magnitude less than CB5, derived in separate study by authors. The smaller cavity of CB5 (2.4 A 0 ) favors its interactions with Eu(III) ion of comparable diameter (2.16 A 0 ) leading to higher stability constant compared to CB7 (5.4 A 0 ) having larger cavity

  5. Defects and oxidation of group-III monochalcogenide monolayers (United States)

    Guo, Yu; Zhou, Si; Bai, Yizhen; Zhao, Jijun


    Among various two-dimensional (2D) materials, monolayer group-III monochalcogenides (GaS, GaSe, InS, and InSe) stand out owing to their potential applications in microelectronics and optoelectronics. Devices made of these novel 2D materials are sensitive to environmental gases, especially O2 molecules. To address this critical issue, here we systematically investigate the oxidization behaviors of perfect and defective group-III monochalcogenide monolayers by first-principles calculations. The perfect monolayers show superior oxidation resistance with large barriers of 3.02-3.20 eV for the dissociation and chemisorption of O2 molecules. In contrast, the defective monolayers with single chalcogen vacancy are vulnerable to O2, showing small barriers of only 0.26-0.36 eV for the chemisorption of an O2 molecule. Interestingly, filling an O2 molecule to the chalcogen vacancy of group-III monochalcogenide monolayers could preserve the electronic band structure of the perfect system—the bandgaps are almost intact and the carrier effective masses are only moderately disturbed. On the other hand, the defective monolayers with single vacancies of group-III atoms carry local magnetic moments of 1-2 μB. These results help experimental design and synthesis of group-III monochalcogenides based 2D devices with high performance and stability.

  6. Adsorption of gold (III) from aqueous solutions on bagasse ash

    International Nuclear Information System (INIS)

    Hussain, G.; Khan, M.A.


    To assess the potential of cheap biomass materials for the recovery of gold from industrial, and electroplating waste water effluents, adsorption of gold (III) from dilute solutions of hydrochloric acid on bagasse ash has been studied under various experimental conditions by using batch technique. Percentage extraction of gold (III) on bagasse ash was determined from its distribution coefficients as a function of contact time, pH, adsorbent, adsorbate concentrations, and temperature. The uptake of gold (III) by bagasse ash is time, pH, metal concentration, amount of adsorbate, and temperature dependent. Adsorption data have been interpreted in terms of Langmuir, and the Freundlich equations. Thermodynamic parameters for the adsorption of gold (III) on bagasse ash have been determined at three different temperatures. The positive value of heat of adsorption; delta H 44.52 kJ/mol shows that the adsorption of gold (III) on bagasse ash is endothermic where as the negative value of delta G = -0.5303 kJ/mol at 318 K shows the spontaneity of the process. Delta G becomes more negative with increase in temperature which shows that the adsorption is more favorable at higher temperatures. Under the optimal adsorption conditions the adsorption capacity of gold is 0.70 mg /g of the adsorbent out of which 0.65 mg of gold gets desorbed with 0.1 % thiourea solution. (author)

  7. Microbiological evidence for Fe(III) reduction on early Earth (United States)

    Vargas, Madeline; Kashefi, Kazem; Blunt-Harris, Elizabeth L.; Lovley, Derek R.


    It is generally considered that sulphur reduction was one of the earliest forms of microbial respiration, because the known microorganisms that are most closely related to the last common ancestor of modern life are primarily anaerobic, sulphur-reducing hyperthermophiles. However, geochemical evidence indicates that Fe(III) is more likely than sulphur to have been the first external electron acceptor of global significance in microbial metabolism. Here we show that Archaea and Bacteria that are most closely related to the last common ancestor can reduce Fe(III) to Fe(II) and conserve energy to support growth from this respiration. Surprisingly, even Thermotoga maritima, previously considered to have only a fermentative metabolism, could grow as a respiratory organism when Fe(III) was provided as an electron acceptor. These results provide microbiological evidence that Fe(III) reduction could have been an important process on early Earth and suggest that microorganisms might contribute to Fe(III) reduction in modern hot biospheres. Furthermore, our discovery that hyperthermophiles that had previously been thought to require sulphur for cultivation can instead be grown without the production of toxic and corrosive sulphide, should aid biochemical investigations of these poorly understood organisms.

  8. Investigation of Clostridium botulinum group III's mobilome content. (United States)

    Woudstra, Cédric; Le Maréchal, Caroline; Souillard, Rozenn; Anniballi, Fabrizio; Auricchio, Bruna; Bano, Luca; Bayon-Auboyer, Marie-Hélène; Koene, Miriam; Mermoud, Isabelle; Brito, Roseane B; Lobato, Francisco C F; Silva, Rodrigo O S; Dorner, Martin B; Fach, Patrick


    Clostridium botulinum group III is mainly responsible for botulism in animals. It could lead to high animal mortality rates and, therefore, represents a major environmental and economic concern. Strains of this group harbor the botulinum toxin locus on an unstable bacteriophage. Since the release of the first complete C. botulinum group III genome sequence (strain BKT015925), strains have been found to contain others mobile elements encoding for toxin components. In this study, seven assays targeting toxin genes present on the genetic mobile elements of C. botulinum group III were developed with the objective to better characterize C. botulinum group III strains. The investigation of 110 C. botulinum group III strains and 519 naturally contaminated samples collected during botulism outbreaks in Europe showed alpha-toxin and C2-I/C2-II markers to be systematically associated with type C/D bont-positive samples, which may indicate an important role of these elements in the pathogenicity mechanisms. On the contrary, bont type D/C strains and the related positive samples appeared to contain almost none of the markers tested. Interestingly, 31 bont-negative samples collected on farms after a botulism outbreak revealed to be positive for some of the genetic mobile elements tested. This suggests loss of the bont phage, either in farm environment after the outbreak or during laboratory handling. Copyright © 2017 Elsevier Ltd. All rights reserved.

  9. COPMA-III - Intelligent handling of existing procedures

    International Nuclear Information System (INIS)

    Hulsund, John-Einar; Jung, Yeonsub; Nilsen, Svein


    This report describes how COPMA-III makes it possible to enhance old procedures without having to change much of their original layout. By means of COPMA-III one can insert into the old procedure text tags that describe the 'meaning' of the various textual elements in the procedure. Those tags can be made invisible to the person using the procedure, but the computer is able to inspect the tags and give appropriate assistance in carrying through the procedure. Previous versions of COPMA required a reformulation and most often a re-structuring of the procedures before taking them into use. A fixed set of instructions and a fixed procedure structure made the computerised procedure different from the original procedure (in most cases). This is no more so in COPMA-III. By means of small procedural elements (microelements), it is possible to configure the COPMA-III system to fit the set of instructions and the procedure structure that is being used in the old procedure system. This report describes an example case, starting with an old procedure, goes through a set of working steps and ends up with a procedure having exactly the same appearance as the old procedure, but having assistance from the COPMA-III system in executing the procedure (author) (ml)

  10. Process mining in oncology using the MIMIC-III dataset (United States)

    Prima Kurniati, Angelina; Hall, Geoff; Hogg, David; Johnson, Owen


    Process mining is a data analytics approach to discover and analyse process models based on the real activities captured in information systems. There is a growing body of literature on process mining in healthcare, including oncology, the study of cancer. In earlier work we found 37 peer-reviewed papers describing process mining research in oncology with a regular complaint being the limited availability and accessibility of datasets with suitable information for process mining. Publicly available datasets are one option and this paper describes the potential to use MIMIC-III, for process mining in oncology. MIMIC-III is a large open access dataset of de-identified patient records. There are 134 publications listed as using the MIMIC dataset, but none of them have used process mining. The MIMIC-III dataset has 16 event tables which are potentially useful for process mining and this paper demonstrates the opportunities to use MIMIC-III for process mining in oncology. Our research applied the L* lifecycle method to provide a worked example showing how process mining can be used to analyse cancer pathways. The results and data quality limitations are discussed along with opportunities for further work and reflection on the value of MIMIC-III for reproducible process mining research.

  11. Octachloro- And Octabromoditechnetate(III) And Their Rhenium(III) Congeners

    International Nuclear Information System (INIS)

    Poineau, F.; Sattelberger, A.P.; Conradson, S.D.; Czerwinski, K.R.


    The compound (n-Bu 4 N) 2 Tc 2 Br 8 was prepared by the metathesis of (n-Bu 4 N) 2 Tc 2 Cl 8 with HBr (g) in dichloromethane and characterized by X-ray absorption fine structure spectroscopy and UV-vis spectroscopy. Analysis of the data gives a Tc-Tc distance of 2.16(1) (angstrom) and a Tc-Br distance of 2.48(1) (angstrom). The Tc(III) oxidation state was inferred by the position of the edge absorption, which reveals a shift of 12 eV between (n-Bu 4 N) 2 Tc 2 Br 8 and NH 4 TcO 4 . The analogous shift between (n-Bu 4 N) 2 Tc 2 Cl 8 and NH 4 TcO 4 is 11 eV. The UV-vis spectrum of Tc 2 Br 8 2- in dichloromethane exhibits the characteristic (delta) → (delta)* transition at 13717 cm -1 . The M 2 X 8 2- (M = Re, Tc; X = Cl, Br) UV-vis spectra are compared, and the position of the (delta) → (delta)* transition discussed

  12. Thermal spectra of the TRIGA Mark III reactor; El espectro termico del reactor TRIGA Mark III

    Energy Technology Data Exchange (ETDEWEB)

    Macias B, L.R.; Palacios G, J. [Instituto Nacional de Investigaciones Nucleares, A.P. 18-1027, 11801 Mexico D.F. (Mexico)


    The diffraction phenomenon is gave in observance of the well known Bragg law in crystalline materials and this can be performance by mean of X-rays, electrons and neutrons among others, which allows to do inside the field of each one of these techniques the obtaining of measurements focussed at each one of them. For the present work, it will be mentioned only the referring to X-ray and neutron techniques. The X-ray diffraction due to its properties just it does measurements which are known in general as superficial measurements of the sample material but for the properties of the neutrons, this diffraction it explores in volumetric form the sample material. Since the neutron diffraction process depends lots of its intensity, then it is important to know the neutron source spectra that in this case is supplied by the TRIGA Mark III reactor. Within of diffraction techniques a great number of them can be found, however some of the traditional will be mentioned such as the identification of crystalline samples, phases identification and the textures measurement. At present this last technique is founded on the dot of a minimum error and the technique of phases identification performs but not compete with that which is obtained by mean of X-rays due to this last one has a major resolution. (Author)

  13. Epidermal Growth Factor Receptor Variant III (EGFRvIII) Positivity in EGFR-Amplified Glioblastomas: Prognostic Role and Comparison between Primary and Recurrent Tumors. (United States)

    Felsberg, Jörg; Hentschel, Bettina; Kaulich, Kerstin; Gramatzki, Dorothee; Zacher, Angela; Malzkorn, Bastian; Kamp, Marcel; Sabel, Michael; Simon, Matthias; Westphal, Manfred; Schackert, Gabriele; Tonn, Jörg C; Pietsch, Torsten; von Deimling, Andreas; Loeffler, Markus; Reifenberger, Guido; Weller, Michael


    Purpose: Approximately 40% of all glioblastomas have amplified the EGFR gene, and about half of these tumors express the EGFRvIII variant. The prognostic role of EGFRvIII in EGFR -amplified glioblastoma patients and changes in EGFRvIII expression in recurrent versus primary glioblastomas remain controversial, but such data are highly relevant for EGFRvIII-targeted therapies. Experimental Design: EGFR -amplified glioblastomas from 106 patients were assessed for EGFRvIII positivity. Changes in EGFR amplification and EGFRvIII status from primary to recurrent glioblastomas were evaluated in 40 patients with EGFR -amplified tumors and 33 patients with EGFR -nonamplified tumors. EGFR single-nucleotide variants (SNV) were assessed in 27 patients. Data were correlated with outcome and validated in 150 glioblastoma patients from The Cancer Genome Atlas (TCGA) consortium. Results: Sixty of 106 EGFR -amplified glioblastomas were EGFRvIII-positive (56.6%). EGFRvIII positivity was not associated with different progression-free or overall survival. EGFRvIII status was unchanged at recurrence in 35 of 40 patients with EGFR -amplified primary tumors (87.5%). Four patients lost and one patient gained EGFRvIII positivity at recurrence. None of 33 EGFR- nonamplified glioblastomas acquired EGFR amplification or EGFRvIII at recurrence. EGFR SNVs were frequent in EGFR -amplified tumors, but were not linked to survival. Conclusions: EGFRvIII and EGFR SNVs are not prognostic in EGFR -amplified glioblastoma patients. EGFR amplification is retained in recurrent glioblastomas. Most EGFRvIII-positive glioblastomas maintain EGFRvIII positivity at recurrence. However, EGFRvIII expression may change in a subset of patients at recurrence, thus repeated biopsy with reassessment of EGFRvIII status is recommended for patients with recurrent glioblastoma to receive EGFRvIII-targeting agents. Clin Cancer Res; 23(22); 6846-55. ©2017 AACR . ©2017 American Association for Cancer Research.

  14. SIMMER-III applications to fuel-coolant interactions

    Energy Technology Data Exchange (ETDEWEB)

    Morita, K.; Kondo, Sa.; Tobita, Y.; Brear, D.J. [Power Reactor and Nuclear Fuel Development Corp., Oarai, Ibaraki (Japan). Oarai Engineering Center


    The main purpose of the SIMMER-III code is to provide a numerical simulation of complex multiphase, multicomponent flow problems essential to investigate core disruptive accidents in liquid-metal fast reactors (LMFRs). However, the code is designed to be sufficiently flexible to be applied to a variety of multiphase flows, in addition to LMFR safety issues. In the present study, some typical experiments relating to fuel-coolant interactions (FCIs) have been analyzed by SIMMER-III to demonstrate that the code is applicable to such complex and highly transient multiphase flow situations. It is shown that SIMMER-III can reproduce the premixing phase both in water and sodium systems as well as the propagation of steam explosion. It is thus demonstrated the code is basically capable of simulating integral multiphase thermal-hydraulic problems included in FCI experiments. (author)

  15. Quantitation of heparosan with heparin lyase III and spectrophotometry. (United States)

    Huang, Haichan; Zhao, Yingying; Lv, Shencong; Zhong, Weihong; Zhang, Fuming; Linhardt, Robert J


    Heparosan is Escherichia coli K5 capsule polysaccharide, which is the key precursor for preparing bioengineered heparin. A rapid and effective quantitative method for detecting heparosan is important in the large-scale production of heparosan. Heparin lyase III (Hep III) effectively catalyzes the heparosan depolymerization, forming unsaturated disaccharides that are measurable using a spectrophotometer at 232 nm. We report a new method for the quantitative detection of heparosan with heparin lyase III and spectrophotometry that is safer and more specific than the traditional carbazole assay. In an optimized detection system, heparosan at a minimum concentration of 0.60 g/L in fermentation broth can be detected. Copyright © 2013 Elsevier Inc. All rights reserved.

  16. Gene expression profiles in stages II and III colon cancers

    DEFF Research Database (Denmark)

    Thorsteinsson, Morten; Kirkeby, Lene T; Hansen, Raino


    PURPOSE: A 128-gene signature has been proposed to predict outcome in patients with stages II and III colorectal cancers. In the present study, we aimed to reproduce and validate the 128-gene signature in external and independent material. METHODS: Gene expression data from the original material...... were retrieved from the Gene Expression Omnibus (GEO) (n¿=¿111) in addition to a Danish data set (n¿=¿37). All patients had stages II and III colon cancers. A Prediction Analysis of Microarray classifier, based on the 128-gene signature and the original training set of stage I (n¿=¿65) and stage IV (n...... correctly predicted as stage IV-like, and the remaining patients were predicted as stage I-like and unclassifiable, respectively. Stage II patients could not be stratified. CONCLUSIONS: The 128-gene signature showed reproducibility in stage III colon cancer, but could not predict recurrence in stage II...

  17. The Challenges of Basel III for Romanian Banking System

    Directory of Open Access Journals (Sweden)

    Anca Elena NUCU


    Full Text Available Basel III represents a fundamental review of the regulatory and supervision framework of the banking industry in the future, the aim being to strengthen the stability of the financial system. The purpose of this paper is to analyze the impact of Basel III introduction upon the banking system at European level, respectively, upon the Romanian banking system. If at European level it is estimated a substantial deficit in capital and liquidity, with major impact on profitability indicators, the impact of Basel III upon banking system in Romania is considered to be limited. The measures which credit institutions could take to mitigate the impact of alignment with the new standards are business model adjustment and balance sheet restructuring.

  18. Making a robust carbon-cobalt(III) bond

    DEFF Research Database (Denmark)

    Larsen, Erik; Madsen, Anders Østergaard; Kofod, Pauli


    The coordination ion with a well-characterized carbon-cobalt(III) bond, the (1,4,7-triazacyclononane)(1,6-diamino-3-thia-4-hexanido)cobalt(III) dication, [Co(tacn)(C-aeaps)](2+) (aeaps, for aminoethylaminopropylsulfide), has been reacted with iodomethane, and the S-methyl thionium derivative has...... been isolated. The crystal structure of the resulting [Co(tacn)(C-aeaps-SCH(3))]Br(3) x 3 H(2)O at 122 K has been determined by X-ray diffraction techniques to verify the structure. The crystal structure determination shows that the carbon-cobalt bond length is even shorter (2.001(4) A) than in [Co......(tacn)(C-aeaps)](2+) participates in bonding to cobalt(III), having implications for the transformation between the carbon- and sulfur-bound forms of the aeaps ligand....

  19. Two-phase titration of cerium(III) by permanganate

    International Nuclear Information System (INIS)

    Lazarev, A.I.; Lazareva, V.I.; Gerko, V.V.


    This paper presents a method for the two-phase titrimetric determination of cerium(III) with permanganate which does not require an expenditure of sugar and preliminary removal of chlorides and nitrates. The interaction of cerium(III) with permanganate at room temperature was studied as a function of the pH, the concentration of pyrophosphate, tetraphenylphosphonium (TPP), permanganate, and extraneous compounds, the rate of titration, and the time of stay of the solution in air before titration. The investigations were conducted according to the following methodology: water, solution of cerium(III) pyrophosphate, and TPP were introduced into an Erlenmeyer flask with a side branch near the bottom for clearer observation of the color of the chloroform phase. The authors established the given pH value, poured the water into a volume of 50 ml, and added chloroform. The result was titrated with permanganate solutions of various concentrations until a violet color appeared in the chloroform phase

  20. Semipolar III-nitride laser diodes with zinc oxide cladding. (United States)

    Myzaferi, Anisa; Reading, Arthur H; Farrell, Robert M; Cohen, Daniel A; Nakamura, Shuji; DenBaars, Steven P


    Incorporating transparent conducting oxide (TCO) top cladding layers into III-nitride laser diodes (LDs) improves device design by reducing the growth time and temperature of the p-type layers. We investigate using ZnO instead of ITO as the top cladding TCO of a semipolar (202¯1) III-nitride LD. Numerical modeling indicates that replacing ITO with ZnO reduces the internal loss in a TCO clad LD due to the lower optical absorption in ZnO. Lasing was achieved at 453 nm with a threshold current density of 8.6 kA/cm 2 and a threshold voltage of 10.3 V in a semipolar (202¯1) III-nitride LD with ZnO top cladding.

  1. Surface passivation technology for III-V semiconductor nanoelectronics

    International Nuclear Information System (INIS)

    Hasegawa, Hideki; Akazawa, Masamichi


    The present status and key issues of surface passivation technology for III-V surfaces are discussed in view of applications to emerging novel III-V nanoelectronics. First, necessities of passivation and currently available surface passivation technologies for GaAs, InGaAs and AlGaAs are reviewed. Then, the principle of the Si interface control layer (ICL)-based passivation scheme by the authors' group is introduced and its basic characterization is presented. Ths Si ICL is a molecular beam epitaxy (MBE)-grown ultrathin Si layer inserted between III-V semiconductor and passivation dielectric. Finally, applications of the Si ICL method to passivation of GaAs nanowires and GaAs nanowire transistors and to realization of pinning-free high-k dielectric/GaAs MOS gate stacks are presented

  2. Electronic Biosensors Based on III-Nitride Semiconductors. (United States)

    Kirste, Ronny; Rohrbaugh, Nathaniel; Bryan, Isaac; Bryan, Zachary; Collazo, Ramon; Ivanisevic, Albena


    We review recent advances of AlGaN/GaN high-electron-mobility transistor (HEMT)-based electronic biosensors. We discuss properties and fabrication of III-nitride-based biosensors. Because of their superior biocompatibility and aqueous stability, GaN-based devices are ready to be implemented as next-generation biosensors. We review surface properties, cleaning, and passivation as well as different pathways toward functionalization, and critically analyze III-nitride-based biosensors demonstrated in the literature, including those detecting DNA, bacteria, cancer antibodies, and toxins. We also discuss the high potential of these biosensors for monitoring living cardiac, fibroblast, and nerve cells. Finally, we report on current developments of covalent chemical functionalization of III-nitride devices. Our review concludes with a short outlook on future challenges and projected implementation directions of GaN-based HEMT biosensors.

  3. Particle Aggregation During Fe(III) Bioreduction in Nontronite (United States)

    Jaisi, D. P.; Dong, H.; Hi, Z.; Kim, J.


    This study was performed to evaluate the rate and mechanism of particle aggregation during bacterial Fe (III) reduction in different size fractions of nontronite and to investigate the role of different factors contributing to particle aggregation. To achieve this goal, microbial Fe(III) reduction experiments were performed with lactate as an electron donor, Fe(III) in nontronite as an electron acceptor, and AQDS as an electron shuttle in bicarbonate buffer using Shewanella putrefaceins CN32. These experiments were performed with and without Na- pyrophosphate as a dispersant in four size fractions of nontronite (0.12-0.22, 0.41-0.69, 0.73-0.96 and 1.42-1.8 mm). The rate of nontronite aggregation during the Fe(III) bioreduction was measured by analyzing particle size distribution using photon correlation spectroscopy (PCS) and SEM images analysis. Similarly, the changes in particle morphology during particle aggregation were determined by analyses of SEM images. Changes in particle surface charge were measured with electrophoretic mobility analyzer. The protein and carbohydrate fraction of EPS produced by cells during Fe(III) bioreduction was measured using Bradford and phenol-sulfuric acid extraction method, respectively. In the presence of the dispersant, the extent of Fe(III) bioreduction was 11.5-12.2% within the first 56 hours of the experiment. There was no measurable particle aggregation in control experiments. The PCS measurements showed that the increase in the effective diameter (95% percentile) was by a factor of 3.1 and 1.9 for particle size of 0.12-0.22 mm and 1.42-1.80 mm, respectively. The SEM image analyses also gave the similar magnitude of increase in particle size. In the absence of the dispersant, the extent of Fe(III) bioreduction was 13.4-14.5% in 56 hours of the experiment. The rate of aggregation was higher than that in the presence of the dispersant. The increase in the effective diameter (95% percentile) was by a factor of 13.6 and 4.1 for

  4. Space Shuttle dosimetry measurements with RME-III

    International Nuclear Information System (INIS)

    Hardy, K.A.; Golightly, M.J.; Hardy, A.C.; Atwell, W.; Quam, W.


    A description of the radiation monitoring equipment (RME-III) dosimetry instrument and the results obtained from six Space Shuttle flights are presented. The RME-III is a self-contained, active (real-time), portable dosimeter system developed for the USAF and adapted for utilization in measuring the ionizing radiation environment on the Space Shuttle. This instrument was developed to incorporate the capabilities of two earlier radiation instruments into a single unit and to minimize crew interaction times with longer battery life and expanded memory capacity. Flight data has demonstrated that the RME-III can be used to accurately assess dose from various sources of exposure, such as that encountered in the complex radiation environment of space

  5. Some Considerations Regarding the Implementation of Basel III

    Directory of Open Access Journals (Sweden)

    Mihai Dorel Vlad


    Full Text Available Basel III represents a basic revision of the banking industry regulatory and supervisory framework for the future, the objective being the stability consolidation of the financial system. The objective of this article is to analyze the impact of the Basel III implementation upon the banking system at the European level, and respectively, upon the banking system of Romania. Basel III standards have been elaborated as a response of the 2008 financial crisis and are considered as vital for the assurance of financial institution capitalization against future financial shocks. The new standards have as an object the improvement of risk management, increased requirements of transparency and publication of credit institutions, as well as solving the banks problems of systemical importance. The measures that the credit institutions could adopt in order to mitigate the impact of alignment to the new standards are adjusting the business model and restructuring bank balance sheets.

  6. Antagonizing STAT3 dimerization with a rhodium(III) complex. (United States)

    Ma, Dik-Lung; Liu, Li-Juan; Leung, Ka-Ho; Chen, Yen-Ting; Zhong, Hai-Jing; Chan, Daniel Shiu-Hin; Wang, Hui-Min David; Leung, Chung-Hang


    Kinetically inert metal complexes have arisen as promising alternatives to existing platinum and ruthenium chemotherapeutics. Reported herein, to our knowledge, is the first example of a substitutionally inert, Group 9 organometallic compound as a direct inhibitor of signal transducer and activator of transcription 3 (STAT3) dimerization. From a series of cyclometalated rhodium(III) and iridium(III) complexes, a rhodium(III) complex emerged as a potent inhibitor of STAT3 that targeted the SH2 domain and inhibited STAT3 phosphorylation and dimerization. Significantly, the complex exhibited potent anti-tumor activities in an in vivo mouse xenograft model of melanoma. This study demonstrates that rhodium complexes may be developed as effective STAT3 inhibitors with potent anti-tumor activity. © 2014 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

  7. Persistence of oxidation state III of gold in thione coordination (United States)

    Jääskeläinen, Sirpa; Koskinen, Laura; Kultamaa, Matti; Haukka, Matti; Hirva, Pipsa


    Ligands N,N'-tetramethylthiourea and 2-mercapto-1-methyl-imidazole form stable Au(III) complexes [AuCl3(N,N'-tetramethylthiourea)] (1) and [AuCl3(2-mercapto-1-methyl-imidazole)] (2) instead of reducing the Au(III) metal center into Au(I), which would be typical for the attachment of sulfur donors. Compounds 1 and 2 were characterized by spectroscopic methods and by X-ray crystallography. The spectroscopic details were explained by simulation of the UV-Vis spectra via the TD-DFT method. Additionally, computational DFT studies were performed in order to find the reason for the unusual oxidation state in the crystalline materials. The preference for Au(III) can be explained via various weak intra- and intermolecular interactions present in the solid state structures. The nature of the interactions was further investigated by topological charge density analysis via the QTAIM method.

  8. Interaction between gold (III) chloride and potassium hexacyanoferrate (II/III)-Does it lead to gold analogue of Prussian blue?

    Energy Technology Data Exchange (ETDEWEB)

    Harish, S. [Electrodics and Electrocatalysis Division, CSIR-Central Electrochemical Research Institute, Karaikudi 630006, Tamilnadu (India); Joseph, James, E-mail: [Electrodics and Electrocatalysis Division, CSIR-Central Electrochemical Research Institute, Karaikudi 630006, Tamilnadu (India); Phani, K.L.N. [Electrodics and Electrocatalysis Division, CSIR-Central Electrochemical Research Institute, Karaikudi 630006, Tamilnadu (India)


    Highlights: > In group IB, Cu and Ag form Prussian blue analogues but similar formation of gold hexacyanoferrate was not found in the literature and non-existence of gold hexacyanoferrate remains a mystery. > Potential cycling of gold chloride and potassium ferro/ferri cyanide was resulted in the formation of Au-PB nano-composite. > Redox reaction between gold chloride and potassium ferrocyanide ion is spontaneous but no reaction occurs when gold chloride and potassium ferricyanide is mixed. > We are proposing the formation of a compound with general formula 'KFe{sub x}[Au(CN){sub 2}]{sub y}' and discussing the formation of gold hexacyanoferrate is not feasible by simple chemical or electrochemical reaction in contrast to other PB analogues. - Abstract: Prussian blue analogues are a class of compounds formed by the reaction between metal salt and potassium hexacyanoferrate (II/III). In our earlier report, the formation of Au-Prussian blue nano-composite was noticed on potential cycling the glassy carbon electrode in a medium containing gold (III) chloride and potassium hexacyanoferrate (III). Hence in this work, the formation of gold hexacyanoferrate was attempted by a simple chemical reaction. The reaction of gold (III) chloride with potassium hexacyanoferrate (II/III) was examined by UV-Vis spectroscopy and found that there is no redox reaction between gold (III) chloride and potassium hexacyanoferrate (III). However, the redox reaction occurs between gold (III) chloride and potassium hexacyanoferrate (II) leading to the formation of charge transfer band and the conversion of hexacyanoferrate (II) to hexacyanoferrate (III) was evidenced by the emergence of new absorption peaks in UV-Vis spectra. The oxidation state of gold in Au-Fe complex was found to be +1 from X-ray photoelectron spectroscopy. The stability of the Au-Fe complex was also studied by cyclic voltammetry. Cyclic voltammetric results indicated the presence of high spin iron in Au

  9. Interaction between gold (III) chloride and potassium hexacyanoferrate (II/III)-Does it lead to gold analogue of Prussian blue?

    International Nuclear Information System (INIS)

    Harish, S.; Joseph, James; Phani, K.L.N.


    Highlights: → In group IB, Cu and Ag form Prussian blue analogues but similar formation of gold hexacyanoferrate was not found in the literature and non-existence of gold hexacyanoferrate remains a mystery. → Potential cycling of gold chloride and potassium ferro/ferri cyanide was resulted in the formation of Au-PB nano-composite. → Redox reaction between gold chloride and potassium ferrocyanide ion is spontaneous but no reaction occurs when gold chloride and potassium ferricyanide is mixed. → We are proposing the formation of a compound with general formula 'KFe x [Au(CN) 2 ] y ' and discussing the formation of gold hexacyanoferrate is not feasible by simple chemical or electrochemical reaction in contrast to other PB analogues. - Abstract: Prussian blue analogues are a class of compounds formed by the reaction between metal salt and potassium hexacyanoferrate (II/III). In our earlier report, the formation of Au-Prussian blue nano-composite was noticed on potential cycling the glassy carbon electrode in a medium containing gold (III) chloride and potassium hexacyanoferrate (III). Hence in this work, the formation of gold hexacyanoferrate was attempted by a simple chemical reaction. The reaction of gold (III) chloride with potassium hexacyanoferrate (II/III) was examined by UV-Vis spectroscopy and found that there is no redox reaction between gold (III) chloride and potassium hexacyanoferrate (III). However, the redox reaction occurs between gold (III) chloride and potassium hexacyanoferrate (II) leading to the formation of charge transfer band and the conversion of hexacyanoferrate (II) to hexacyanoferrate (III) was evidenced by the emergence of new absorption peaks in UV-Vis spectra. The oxidation state of gold in Au-Fe complex was found to be +1 from X-ray photoelectron spectroscopy. The stability of the Au-Fe complex was also studied by cyclic voltammetry. Cyclic voltammetric results indicated the presence of high spin iron in Au-Fe complex. Hence 'as

  10. Impact of Fe(III)-OM complexes and Fe(III) polymerization on SOM pools reactivity under different land uses (United States)

    Giannetta, B.; Plaza, C.; Zaccone, C.; Siebecker, M. G.; Rovira, P.; Vischetti, C.; Sparks, D. L.


    Soil organic matter (SOM) protection and long-term accumulation are controlled by adsorption to mineral surfaces in different ways, depending on its molecular structure and pedo-climatic conditions. Iron (Fe) oxides are known to be key regulators of the soil carbon (C) cycle, and Fe speciation in soils is highly dependent on environmental conditions and chemical interactions with SOM. However, the molecular structure and hydrolysis of Fe species formed in association with SOM is still poorly described. We hypothesize the existence of two pools of Fe which interact with SOM: mononuclear Fe(III)-SOM complexes and precipitated Fe(III) hydroxides. To verify our hypothesis, we investigated the interactions between Fe(III) and physically isolated soil fractions by means of batch experiments at pH 7. Specifically, we examined the fine silt plus clay (FSi+C) fraction, obtained by ultrasonic dispersion and wet sieving. The soil samples spanned several land uses, including coniferous forest (CFS), grassland (GS), technosols (TS) and agricultural (AS) soils. Solid phase products and supernatants were analyzed for C and Fe content. X-ray diffraction (XRD) and Brunauer-Emmett-Teller (BET) analysis were also performed. Attenuated total reflectance Fourier transform infrared spectroscopy (ATR-FTIR) was used to assess the main C functional groups involved in C complexation and desorption experiments. Preliminary linear combination fitting (LCF) of Fe K-edge extended X-ray absorption fine structure (EXAFS) spectra suggested the formation of ferrihydrite-like polymeric Fe(III) oxides in reacted CFS and GS samples, with higher C and Fe concentration. Conversely, mononuclear Fe(III) OM complexes dominated the speciation for TS and AS samples, characterized by lower C and Fe concentration, inhibiting the hydrolysis and polymerization of Fe (III). This approach will help revealing the mechanisms by which SOM pools can control Fe(III) speciation, and will elucidate how both Fe(III

  11. Effect of Class III bone anchor treatment on airway. (United States)

    Nguyen, Tung; De Clerck, Hugo; Wilson, Michael; Golden, Brent


    To compare airway volumes and minimum cross-section area changes of Class III patients treated with bone-anchored maxillary protraction (BAMP) versus untreated Class III controls. Twenty-eight consecutive skeletal Class III patients between the ages of 10 and 14 years (mean age, 11.9 years) were treated using Class III intermaxillary elastics and bilateral miniplates (two in the infra-zygomatic crests of the maxilla and two in the anterior mandible). The subjects had cone beam computed tomographs (CBCTs) taken before initial loading (T1) and 1 year out (T2). Twenty-eight untreated Class III patients (mean age, 12.4 years) had CBCTs taken and cephalograms generated. The airway volumes and minimum cross-sectional area measurements were performed using Dolphin Imaging 11.7 3D software. The superior border of the airway was defined by a plane that passes through the posterior nasal spine and basion, while the inferior border included the base of the epiglottis to the lower border of C3. From T1 to T2, airway volume from BAMP-treated subjects showed a statistically significant increase (1499.64 mm(3)). The area in the most constricted section of the airway (choke point) increased slightly (15.44 mm(2)). The airway volume of BAMP patients at T2 was 14136.61 mm(3), compared with 14432.98 mm(3) in untreated Class III subjects. Intraexaminer correlation coefficients values and 95% confidence interval values were all greater than .90, showing a high degree of reliability of the measurements. BAMP treatment did not hinder the development of the oropharynx.

  12. Research progress of III-V laser bonding to Si (United States)

    Bo, Ren; Yan, Hou; Yanan, Liang


    The vigorous development of silicon photonics makes a silicon-based light source essential for optoelectronics' integration. Bonding of III-V/Si hybrid laser has developed rapidly in the last ten years. In the tireless efforts of researchers, we are privileged to see these bonding methods, such as direct bonding, medium adhesive bonding and low temperature eutectic bonding. They have been developed and applied to the research and fabrication of III-V/Si hybrid lasers. Some research groups have made remarkable progress. Tanabe Katsuaki of Tokyo University successfully implemented a silicon-based InAs/GaAs quantum dot laser with direct bonding method in 2012. They have bonded the InAs/GaAs quantum dot laser to the silicon substrate and the silicon ridge waveguide, respectively. The threshold current of the device is as low as 200 A/cm2. Stevan Stanković and Sui Shaoshuai successfully produced a variety of hybrid III-V/Si laser with the method of BCB bonding, respectively. BCB has high light transmittance and it can provide high bonding strength. Researchers of Tokyo University and Peking University have realized III-V/Si hybrid lasers with metal bonding method. We describe the progress in the fabrication of III-V/Si hybrid lasers with bonding methods by various research groups in recent years. The advantages and disadvantages of these methods are presented. We also introduce the progress of the growth of III-V epitaxial layer on silicon substrate, which is also a promising method to realize silicon-based light source. I hope that readers can have a general understanding of this field from this article and we can attract more researchers to focus on the study in this field.

  13. Archform comparisons between skeletal class II and III malocclusions.

    Directory of Open Access Journals (Sweden)

    Wei Zou

    Full Text Available The purpose of this cross-sectional research was to explore the relationship of the mandibular dental and basal bone archforms between severe Skeletal Class II (SC2 and Skeletal Class III (SC3 malocclusions. We also compared intercanine and intermolar widths in these two malocclusion types. Thirty-three virtual pretreatment mandibular models (Skeletal Class III group and Thirty-five Skeletal Class II group pretreatment models were created with a laser scanning system. FA (the midpoint of the facial axis of the clinical crownand WALA points (the most prominent point on the soft-tissue ridgewere employed to produce dental and basal bone archforms, respectively. Gained scatter diagrams of the samples were processed by nonlinear regression analysis via SPSS 17.0. The mandibular dental and basal bone intercanine and intermolar widths were significantly greater in the Skeletal Class III group compared to the Skeletal Class II group. In both groups, a moderate correlation existed between dental and basal bone arch widths in the canine region, and a high correlation existed between dental and basal bone arch widths in the molar region. The coefficient of correlation of the Skeletal Class III group was greater than the Skeletal Class II group. Fourth degree, even order power functions were used as best-fit functions to fit the scatter plots. The radius of curvature was larger in Skeletal Class III malocclusions compared to Skeletal Class II malocclusions (rWALA3>rWALA2>rFA3>rFA2. In conclusion, mandibular dental and basal intercanine and intermolar widths were significantly different between the two groups. Compared with Skeletal Class II subjects, the mandibular archform was more flat for Skeletal Class III subjects.


    International Nuclear Information System (INIS)

    Xu Hao; Norman, Michael L.; Wise, John H.


    Recent simulations of Population III star formation have suggested that some fraction form in binary systems, in addition to having a characteristic mass of tens of solar masses. The deaths of metal-free stars result in the initial chemical enrichment of the universe and the production of the first stellar-mass black holes. Here we present a cosmological adaptive mesh refinement simulation of an overdense region that forms a few 10 9 M ☉ dark matter halos and over 13,000 Population III stars by redshift 15. We find that most halos do not form Population III stars until they reach M vir ∼ 10 7 M ☉ because this biased region is quickly enriched from both Population III and galaxies, which also produce high levels of ultraviolet radiation that suppress H 2 formation. Nevertheless, Population III stars continue to form, albeit in more massive halos, at a rate of ∼10 –4 M ☉ yr –1 Mpc –3 at redshift 15. The most massive starless halo has a mass of 7 × 10 7 M ☉ , which could host massive black hole formation through the direct gaseous collapse scenario. We show that the multiplicity of the Population III remnants grows with halo mass above 10 8 M ☉ , culminating in 50 remnants located in 10 9 M ☉ halos on average. This has implications that high-mass X-ray binaries and intermediate-mass black holes that originate from metal-free stars may be abundant in high-redshift galaxies

  15. Extraction behaviour of Am(III) and Eu(III) from nitric acid medium in CMPO-HDEHP impregnated resins

    Energy Technology Data Exchange (ETDEWEB)

    Saipriya, K.; Kumar, T. [Bhabha Atomic Research Centre Facilities (India). Kalpakkam Reproscessing Plants; Kumaresan, R.; Nayak, P.K.; Venkatesan, K.A.; Antony, M.P. [Indira Gandhi Center for Atomic Research, Kalpakkam (India). Fuel Chemistry Div.


    Chromatographic resin containing extractants such as octyl(phenyl)-N,N-diisobutylcarbamoylmethylphosphine oxide (CMPO) or bis-(2-ethylhexyl)phosphoric acid (HDEHP) or mixture of extractants (CMPO + HDEHP) in an acrylic polymer matrix was prepared and studied for the extraction of Am(III) and Eu(III) over a range of nitric acid concentration. The effect of various parameters such as concentration of nitric acid in aqueous phase and the concentration of CMPO and HDEHP in the resin phase was studied. The distribution coefficient of Am(III) and Eu(III) in the impregnated resin increased with increased in the concentration of nitric acid for CMPO-impregnated resin, whereas a reverse trend was observed in HDEHP impregnated resin. In case of resin containing both the extractants, synergism was observed at low nitric acid concentration and antagonism at high nitric acid concentration. The mechanism of extraction was probed by slope analysis method at 0.01 and 2 M nitric acid concentrations. Citrate-buffered DTPA was used for the selective separation of Am(III), and a separation factor of 3-4 was obtained at pH 3.

  16. 25 CFR 291.15 - How long do Class III gaming procedures remain in effect? (United States)


    ... 25 Indians 1 2010-04-01 2010-04-01 false How long do Class III gaming procedures remain in effect... ENTERPRISES CLASS III GAMING PROCEDURES § 291.15 How long do Class III gaming procedures remain in effect? Class III gaming procedures remain in effect for the duration specified in the procedures or until...

  17. 12 CFR Appendix III to Part 27 - Fair Housing Lending Inquiry/Application Log Sheet (United States)


    ... 12 Banks and Banking 1 2010-01-01 2010-01-01 false Fair Housing Lending Inquiry/Application Log Sheet III Appendix III to Part 27 Banks and Banking COMPTROLLER OF THE CURRENCY, DEPARTMENT OF THE TREASURY FAIR HOUSING HOME LOAN DATA SYSTEM Pt. 27, App. III Appendix III to Part 27—Fair Housing Lending...

  18. 17 CFR Table III to Subpart E of... - Civil Monetary Penalty Inflation Adjustments (United States)


    ... 17 Commodity and Securities Exchanges 2 2010-04-01 2010-04-01 false Civil Monetary Penalty Inflation Adjustments III Table III to Subpart E of Part 201 Commodity and Securities Exchanges SECURITIES..., Table III Table III to Subpart E of Part 201—Civil Monetary Penalty Inflation Adjustments U.S. Code...

  19. Incremental Validity of the WJ III COG: Limited Predictive Effects beyond the GIA-E (United States)

    McGill, Ryan J.; Busse, R. T.


    This study is an examination of the incremental validity of Cattell-Horn-Carroll (CHC) broad clusters from the Woodcock-Johnson III Tests of Cognitive Abilities (WJ III COG) for predicting scores on the Woodcock-Johnson III Tests of Achievement (WJ III ACH). The participants were children and adolescents, ages 6-18 (n = 4,722), drawn from the WJ…


    Directory of Open Access Journals (Sweden)

    Motocu Marius


    The Basel III criteria entering into force between 2013 and 2018 constitute one of the major challenges to which the banking sector will face. The real impact of the Basel III reform will depend on the attitude of the banks that will have to change in their strategy, their cost structure and policy of remuneration of the shareholders. A reform which will have therefore an impact on the world economy ensuring as estimated by Governors and supervisors, stability and long term economic performance. This paper will present the main adjustments proposed by the Basel Committee.

  1. Observations concerning the COMPBRN III fire growth code

    International Nuclear Information System (INIS)

    Nicolette, V.F.; Nowlen, S.P.; Lambright, J.A.


    Nuclear power plant fire probabilistic risk assessments (PRAs) usually involve application of a fire growth model to calculate fire growth and the time required to damage critical safety equipment. Attempts to use the fire growth model COMPBRN III resulted in the observation of problems and nonphysical behavior in the code. In this paper the causes of these problems and nonphysical behavior are identified and possible modifications suggested. Incorporation of these modifications into COMPBRN III results in some significant differences in the calculated fire damage times, as well as making the code more physically realistic. 12 refs., 6 figs

  2. CESEC III code conversion from Apollo to HP9000

    Energy Technology Data Exchange (ETDEWEB)

    Lee, Hae Cho [Korea Atomic Energy Research Institute, Taejon (Korea, Republic of)


    CESEC code is a computer program used to analyze transient behaviour of reactor coolant systems of nuclear power plants. CESEC III is an extension of original CESEC code in order to apply wide range of accident analysis including ATWS model. Major parameters during the transients are calculated by CESEC. This report firstly describes detailed work carried out for installation of CESEC III on Apollo DN10000 and code validation results after installation. Secondly, A series of work is also described in relation to installation of CESECIII on HP 9000/700 series as well as relevant code validation results. Attached is a report on software verification and validation results. 7 refs. (Author) .new.

  3. CESEC III code conversion from Apollo to HP9000

    International Nuclear Information System (INIS)

    Lee, Hae Cho


    CESEC code is a computer program used to analyze transient behaviour of reactor coolant systems of nuclear power plants. CESEC III is an extension of original CESEC code in order to apply wide range of accident analysis including ATWS model. Major parameters during the transients are calculated by CESEC. This report firstly describes detailed work carried out for installation of CESEC III on Apollo DN10000 and code validation results after installation. Secondly, A series of work is also described in relation to installation of CESECIII on HP 9000/700 series as well as relevant code validation results. Attached is a report on software verification and validation results. 7 refs. (Author) .new

  4. Type III bursts in interplanetary space - Fundamental or harmonic? (United States)

    Dulk, G. A.; Steinberg, J. L.; Hoang, S.


    ISEE-3 spacecraft observation of 120 relatively simple, isolated bursts in the 30-1980 kHz range are the basis of the present study of Type III bursts in the solar wind. Several characteristics are identified for many of these bursts which imply that the mode of emission changes from predominantly fundamental plasma radiation during the rise phase to predominantly second harmonic during decay. The fundamental emission begins in time coincidence with the start of Langmuir waves, confirming the conventional belief in these waves' causation of Type III bursts. Attention is given to the characteristics of fundamental components, by comparison to harmonics, at km-wavelengths.

  5. Subsurface dimerization in III-V semiconductor (001) surfaces

    DEFF Research Database (Denmark)

    Kumpf, C.; Marks, L.D.; Ellis, D.


    We present the atomic structure of the c(8 X 2) reconstructions of InSb-, InAs-, and GaAs-(001) surfaces as determined by surface x-ray diffraction using direct methods. Contrary to common belief, group III dimers are not prominent on the surface, instead subsurface dimerization of group m atoms ...... takes place in the second bilayer, accompanied by a major rearrangement of the surface atoms above the dimers to form linear arrays. By varying the occupancies of four surface sites the (001)-c(8 X 2) reconstructions of III-V semiconductors can be described in a unified model....

  6. Synthesis and reactivity of triscyclopentadienyl uranium (III) and (IV) complexes

    International Nuclear Information System (INIS)

    Berthet, J.C.


    The reactions of (RC 5 H 4 ) 3 U with R=trimethylsilylcyclopentadienyl or tertiobutylcyclopentadienyl are studied for the synthesis of new uranium organometallic compounds. Reactions with sodium hydride are first described uranium (III) anionic hydrides obtained are oxidized for synthesis of stable uranium (IV) organometallic hydrides. Stability of these compounds is discussed. Reactivity of these uranium (III) and (IV) hydrides are studied. Formation of new binuclear compounds with strong U-O and U-N bonds is examined and crystal structure are presented. Monocyclooctatetraenylic uranium complexes are also investigated

  7. Structural characterization of the Actinides (III) and (IV) - DOTA complexes

    International Nuclear Information System (INIS)

    Audras, Matthieu


    The polyamino-carboxylate anions have been identified as compounds of interest in the operations of actinide separation, in actinide migration in the environment and in human radio-toxicology. The structural characterization of complexes formed between actinides and polyamino-carboxylates ligands is essential for a better understanding of actinide-ligands interactions. Among the polyamino-carboxylate anions, the DOTA ligand (1,4,7,10-tetraaza-cyclododecane tetraacetic acid) is described as a very strong complexing agent of the lanthanides(III), but has been little studied with actinides. The objective of this thesis is to describe the complexes formed between the actinides (III) and (IV) and the DOTA ligand, and compare them with the lanthanide complexes. For this, an approach has been introduced to characterize the complexes by complementary analytical techniques (spectrophotometry, electro-spray ionization mass spectrometry, NMR, EXAFS, electrochemistry), but also by calculations of theoretical chemistry to help the interpretation of the experimental data. The formation of a 1:1 complex is observed with the actinides(III) (plutonium and americium) as for lanthanides(III): rapid formation of intermediate species which evolves slowly towards the formation of a limit complex. Within this complex, the cation is located inside the cavity formed by the ligand. Four nitrogen atoms and four oxygen atoms from the carboxylate functions are involved in the coordination sphere of the cation. However, differences were observed in the bond lengths formed between the cation and the nitrogen atoms (the bonds are somewhat shorter in the case of actinide complexes) as well as the complexation kinetics, which is slightly faster for the actinides(III) than for lanthanide(III) ions of equivalent radius. The same behavior was observed in solution upon complexation of actinides(IV) (uranium, plutonium and neptunium): slow formation of a 1:1 complex (actinide(IV):ligand) in wherein the

  8. Conservative treatment of Angle Class III malocclusion with anterior crossbite

    Directory of Open Access Journals (Sweden)

    João Hélder Ferreira de Aguiar


    Full Text Available Angle Class III malocclusion is characterized by anteroposterior dental discrepancy which might be associated or not with skeletal changes. Class III molar relationship is associated with vertical or lingually tipped mandibular incisors and a usually concave profile. These characteristics seriously affect facial esthetics and most frequently are the reason why patients seek orthodontic treatment. This case was presented to the committee of the Brazilian Board of Orthodontics and Facial Orthopedics (BBO as part of the requisites to become a BBO Diplomate.

  9. Aristotle's "De Caelo" III introduction, translation and commentary

    CERN Document Server

    Kouremenos, Theokritos


    This is the first full-scale commentary on Aristotle's de Caelo III to appear in recent decades. de Caelo III can serve as a good introduction to Aristotle's physics and its character. In it he answers some very general questions about the elements of all material things except celestial objects: how many these elements are, why they cannot be infinitely many but must be more than one, whether they are eternal or can be generated and decay, and, if the second, how. His discussion is often framed as a critique of rival theories, and he argues systematically against the geometri

  10. Management of stage III thymoma with postoperative radiation therapy

    International Nuclear Information System (INIS)

    Krueger, J.B.; Sagerman, R.H.; King, G.A.


    The results of postoperative radiation therapy in 12 patients with Stage III thymoma treated during the period 1966-1986 were reviewed. Surgical therapy consisted of total resection in one, subtotal resection in seven, and biopsy only in four. Megavoltage irradiation in the dose range of 3,000-5,600 cGy was employed, with the majority receiving a dose of at least 5,000 cGy. The local control rate was 67%. The actuarial 5-year observed and adjusted survival rates were 57% and 75%, respectively. These results indicate that postoperative radiation therapy is an effective therapeutic modality in the control of Stage III thymoma

  11. Basel III – Between Global Thinking and Local Acting

    Directory of Open Access Journals (Sweden)

    Vasile DEDU


    Full Text Available The financial crisis has demonstrated that self-regulation is not sufficient to markets and financial institutions with systemic importance.Permissive regulatory policies, allowing the development speed of global banking financial system, have played an important role in emphasizing the upward slope of the financial crisis.The new regulations known as Basel III framework aimed the strengthening of prudential capital and liquidity of financial institutions and create a stronger banking and financial system more resilient to shocks.Basel III is trying to eliminate the shortcomings of Basel II, by more extensive rules on integrated risk management in banking and financial environment.

  12. Lanthanide (III) complexes of 2-(N-salicylideneamino)-4-phenylthiazole

    International Nuclear Information System (INIS)

    Sasidharan, G.N.; Mohanan, K.; Lakshmi Prabha, A.N.


    Lanthanide(III) complexes of 2-(N-salicylideneamino)-4- phenylthiazole (HSAT) have been synthesised and characterised by elemental, analytical, thermogravimetric, molar conductance, UV- visible, IR and NMR spectral data. The ligand coordinates to the lanthanide(III) ion in a tridentate fashion without deprotonation, giving complexes of the type [Ln(HSAT) 2 (NO 3 ) 3 ] and [Ln(HSAT) 2 (H 2 0) 3 Cl 3 ]. The spectral data reveal that the ligand is bonded to the lanthanide ion through azomethine nitrogen, ring nitrogen and phenolic oxygen without deprotonation. The nitrate group acts in a bidentate fashion. The ligand and the metal complexes exhibit antibacterial and antifungal activities. (author)

  13. Subtle interactions and electron transfer between U{sup III}, Np{sup III}, or Pu{sup III} and uranyl mediated by the oxo group

    Energy Technology Data Exchange (ETDEWEB)

    Arnold, Polly L.; Zegke, Markus; Hollis, Emmalina; Pecharman, Anne-Frederique; Love, Jason B. [EaStCHEM School of Chemistry, University of Edinburgh (United Kingdom); Dutkiewicz, Michal S. [EaStCHEM School of Chemistry, University of Edinburgh (United Kingdom); European Commission, Directorate for Nuclear Safety and Security, Joint Research Centre, Karlsruhe (Germany); Walter, Olaf; Apostolidis, Christos; Magnani, Nicola; Griveau, Jean-Christophe; Colineau, Eric; Caciuffo, Roberto [European Commission, Directorate for Nuclear Safety and Security, Joint Research Centre, Karlsruhe (Germany); Zhang, Xiaobin; Schreckenbach, Georg [Department of Chemistry, University of Manitoba, Winnipeg, MB (Canada)


    A dramatic difference in the ability of the reducing An{sup III} center in AnCp{sub 3} (An=U, Np, Pu; Cp=C{sub 5}H{sub 5}) to oxo-bind and reduce the uranyl(VI) dication in the complex [(UO{sub 2})(THF)(H{sub 2}L)] (L=''Pacman'' Schiff-base polypyrrolic macrocycle), is found and explained. These are the first selective functionalizations of the uranyl oxo by another actinide cation. At-first contradictory electronic structural data are explained by combining theory and experiment. Complete one-electron transfer from Cp{sub 3}U forms the U{sup IV}-uranyl(V) compound that behaves as a U{sup V}-localized single molecule magnet below 4 K. The extent of reduction by the Cp{sub 3}Np group upon oxo-coordination is much less, with a Np{sup III}-uranyl(VI) dative bond assigned. Solution NMR and NIR spectroscopy suggest Np{sup IV}U{sup V} but single-crystal X-ray diffraction and SQUID magnetometry suggest a Np{sup III}-U{sup VI} assignment. DFT-calculated Hirshfeld charge and spin density analyses suggest half an electron has transferred, and these explain the strongly shifted NMR spectra by spin density contributions at the hydrogen nuclei. The Pu{sup III}-U{sup VI} interaction is too weak to be observed in THF solvent, in agreement with calculated predictions. (copyright 2016 WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim)

  14. Cr(III), Fe(III) and Co(III) complexes of tetradentate (ONNO) Schiff base ligands: Synthesis, characterization, properties and biological activity (United States)

    Keskioğlu, Eren; Gündüzalp, Ayla Balaban; Çete, Servet; Hamurcu, Fatma; Erk, Birgül


    A series of metal complexes were synthesized from equimolar amounts of Schiff bases: 1,4-bis[3-(2-hydroxy-1-naphthaldimine)propyl]piperazine (bappnaf) and 1,8-bis[3-(2-hydroxy-1-naphthaldimine)- p-menthane (damnaf) with metal chlorides. All of synthesized compounds were characterized by elemental analyses, spectral (UV-vis, IR, 1H- 13C NMR, LC-MS) and thermal (TGA-DTA) methods, magnetic and conductance measurements. Schiff base complexes supposed in tetragonal geometry have the general formula [M(bappnaf or damnaf)]Cl· nH 2O, where M = Cr(III), Co(III) and n = 2, 3. But also Fe(III) complexes have octahedral geometry by the coordination of two water molecules and the formula is [Fe(bappnaf or damnaf)(H 2O) 2]Cl. The changes in the selected vibration bands in FT-IR indicate that Schiff bases behave as (ONNO) tetradentate ligands and coordinate to metal ions from two phenolic oxygen atoms and two azomethine nitrogen atoms. Conductance measurements suggest 1:1 electrolytic nature of the metal complexes. The synthesized compounds except bappnaf ligand have the antimicrobial activity against the bacteria: Escherichia coli (ATCC 11230), Yersinia enterocolitica (ATCC 1501), Bacillus magaterium (RSKK 5117), Bacillus subtilis (RSKK 244), Bacillus cereus (RSKK 863) and the fungi: Candida albicans (ATCC 10239). These results have been considerably interest in piperazine derivatives due to their significant applications in antimicrobial studies.

  15. {CoIII2DyIII2} single molecule magnet with two resolved thermal activated magnetization relaxation pathways at zero field. (United States)

    Funes, Alejandro V; Carrella, Luca; Rentschler, Eva; Alborés, Pablo


    The new complex [Co(III)2Dy(III)2(OMe)2(teaH)2(Piv)6] in the {Co(III)2Dy(III)2} family, shows two well resolved thermal activated magnetization relaxation pathways under AC experiments in zero DC field. Fitted crystal field parameters suggest that the origin of these two pathways relies on two different excited mJ sub-levels.

  16. Cloud point extraction: an alternative to traditional liquid-liquid extraction for lanthanides(III) separation. (United States)

    Favre-Réguillon, Alain; Draye, Micheline; Lebuzit, Gérard; Thomas, Sylvie; Foos, Jacques; Cote, Gérard; Guy, Alain


    Cloud point extraction (CPE) was used to extract and separate lanthanum(III) and gadolinium(III) nitrate from an aqueous solution. The methodology used is based on the formation of lanthanide(III)-8-hydroxyquinoline (8-HQ) complexes soluble in a micellar phase of non-ionic surfactant. The lanthanide(III) complexes are then extracted into the surfactant-rich phase at a temperature above the cloud point temperature (CPT). The structure of the non-ionic surfactant, and the chelating agent-metal molar ratio are identified as factors determining the extraction efficiency and selectivity. In an aqueous solution containing equimolar concentrations of La(III) and Gd(III), extraction efficiency for Gd(III) can reach 96% with a Gd(III)/La(III) selectivity higher than 30 using Triton X-114. Under those conditions, a Gd(III) decontamination factor of 50 is obtained.

  17. Spectroscopic studies on the interaction of europium(III) and curium(III) with components of the human mucosa

    Energy Technology Data Exchange (ETDEWEB)

    Wilke, Claudia; Barkleit, Astrid [Helmholtz-Zentrum Dresden-Rossendorf e.V., Dresden (Germany). Div. Chemistry of the F-Elements


    To evaluate the health risks of lanthanides (Ln) and radiotoxic actinides (An) in case of ingestion accidents etc., investigations into the chemical reactions of these metals in the human gastrointestinal tract are necessary. Our previous study revealed that mucin, an important part of the protective mucosa layer in the digestive system, shows a strong interaction with Eu(III). Based on these results, the present study focuses on the components of this glycoprotein and identified N-acetylneuraminic acid (NANA) as the dominant binding carbohydrate of mucin. TRLFS measurements suggest the formation of a 1: 1 complex with log β of 3.2 ± 0.1 for Eu(III) and 3.3 ± 0.1 for Cm(III), respectively.

  18. Studies of. gamma. -ray irradiation effects on tris(. beta. -diketonato)iron(III) and cobalt(III) coordination compounds by means of Moessbauer spectroscopy and magnetic susceptibility measurements

    Energy Technology Data Exchange (ETDEWEB)

    Sakai, Y.; Endo, K.; Sano, H. (Tokyo Metropolitan Univ. (Japan). Faculty of Science)


    Both absorption Moessbauer spectroscopy and magnetic susceptibility measurements on tris(..beta..-diketonato)iron(III) and cobalt(III) compounds indicate that ligands which have phenyl group as a substituent are more stable to ..gamma..-ray radiolysis, in accordance with previous results of emission Moessbauer spectroscopic studies of /sup 57/Co-labelled tris (..beta..-diketonato)cobalt(III) compounds.

  19. An isoelectronic NO dioxygenase reaction using a nonheme iron(III)-peroxo complex and nitrosonium ion. (United States)

    Yokoyama, Atsutoshi; Han, Jung Eun; Karlin, Kenneth D; Nam, Wonwoo


    Reaction of a nonheme iron(III)-peroxo complex, [Fe(III)(14-TMC)(O2)](+), with NO(+), a transformation which is essentially isoelectronic with that for nitric oxide dioxygenases [Fe(III)(O2˙(-)) + NO], affords an iron(IV)-oxo complex, [Fe(IV)(14-TMC)(O)](2+), and nitrogen dioxide (NO2), followed by conversion to an iron(III)-nitrato complex, [Fe(III)(14-TMC)(NO3)(F)](+).

  20. An isoelectronic NO dioxygenase reaction using a nonheme iron(III)-peroxo complex and nitrosonium ion† (United States)

    Yokoyama, Atsutoshi; Han, Jung Eun; Karlin, Kenneth D.; Nam, Wonwoo


    Reaction of a nonheme iron(III)-peroxo complex, [FeIII(14-TMC)(O2)]+, with NO+, a transformation which is essentially isoelectronic with that for nitric oxide dioxygenases [Fe(III)(O2•−) + NO], affords an iron(IV)-oxo complex, [FeIV(14-TMC)(O)]2+, and nitrogen dioxide (NO2), followed by conversion to an iron(III)-nitrato complex, [FeIII(14-TMC)(NO3)(F)]+. PMID:24394960

  1. An isoelectronic NO dioxygenase reaction using a nonheme iron(III)-peroxo complex and nitrosonium ion†


    Yokoyama, Atsutoshi; Han, Jung Eun; Karlin, Kenneth D.; Nam, Wonwoo


    Reaction of a nonheme iron(III)-peroxo complex, [FeIII(14-TMC)(O2)]+, with NO+, a transformation which is essentially isoelectronic with that for nitric oxide dioxygenases [Fe(III)(O2•−) + NO], affords an iron(IV)-oxo complex, [FeIV(14-TMC)(O)]2+, and nitrogen dioxide (NO2), followed by conversion to an iron(III)-nitrato complex, [FeIII(14-TMC)(NO3)(F)]+.

  2. Synergistic solvent extraction of Eu(III) and Tb(III) with mixtures of various organophosphorus extractants

    International Nuclear Information System (INIS)

    Reddy, B.V.; Reddy, L.K.; Reddy, A.S.


    Synergistic solvent extraction of Eu(III) and Tb(III) from thiocyanate solutions with mixtures of 2-ethylhexylphosphonic acid mono-2-ethylhexyl ester (EHPNA) and di-2-ethylhexylphosphoric acid (DEHPA) or tributyl phosphate (TBP) or trioctylphosphine oxide (TOPO) or triphenylphosphine oxide (TPhPO) in benzene has been studied. The mechanism of extraction can be explained by a simple chemically based model. The equilibrium constants of the mixed-ligand species of the various neutral donors have been determined by non-linear regression analysis. (author) 13 refs.; 9 figs.; 2 tabs

  3. WISC-III e WAIS-III na avaliação da inteligência de cegos


    Nascimento, Elizabeth do; Flores-Mendoza, Carmen Elvira


    Diante da escassez de pesquisas nacionais e de testes psicológicos destinados a avaliar pessoas cegas, desenvolveu-se um estudo psicométrico com as escalas verbais dos testes WISC-III e WAIS-III. Após as adaptações de alguns estímulos e das instruções, os testes foram aplicados em crianças (N = 120) e adultos (N = 52) residentes em Belo Horizonte. Os resultados indicaram que as escalas verbais modificadas apresentam uma boa consistência interna (alfa> 0,80). Além disso, a investigação da vali...

  4. Extraction of Dy(III and Sm(III with N,N’-dimethyl-N,N’-dioctylsuccinamide

    Directory of Open Access Journals (Sweden)



    Full Text Available This work was focused on the applicability of a new diamide N,N’-dimethyl- N,N’-dioctylsuccinamide (DMDOSA employing cyclohexane as the diluent to extract Dy(III and Sm(III from nitric acid solutions. The extraction from HNO3 was investigated by distributionmeasurements. The stoichiometry of the predominant adducts of DMDOSA with HNO3 is 1:1 (HNO3 .DMDOSA under the studied conditions. The effect of the concentrations of nitric acid, lithium nitrate and extractant on the distribution ratio was investigated. An IR spectral study was also made of the extracted species.

  5. Alpha Radiolysis of Nuclear Solvent Extraction Ligands Used for An(III) and Ln(III) Separations

    Energy Technology Data Exchange (ETDEWEB)

    Mezyk, Stephen P. [California State Univ. (CalState), Long Beach, CA (United States); Mincher, Bruce J. [Idaho National Lab. (INL), Idaho Falls, ID (United States); Nilsson, Mikael [Univ. of California, Irvine, CA (United States)


    This document is the final report for the Nuclear Energy Universities Program (NEUP) grant 10-910 (DE-AC07-05ID14517) “Alpha Radiolysis of Nuclear Solvent Extraction Ligands used for An(III) and Ln(III) Separations”. The goal of this work was to obtain a quantitative understanding of the impacts of both low Linear Energy Transfer (LET, gamma-rays) and high LET (alpha particles) radiation chemistry occurring in future large-scale separations processes. This quantitative understanding of the major radiation effects on diluents and ligands is essential for optimal process implementation, and could result in significant cost savings in the future.

  6. Lanthanum(III) and praseodymium(III) complexes with bidentate and tetradentate Schiff base ligands containing indole ring

    International Nuclear Information System (INIS)

    Rai, Anita; Sengupta, Soumitra Kumar; Pandey, Om Prakash


    Complexes of lanthanum(III) and praseodymium(III) with Schiff bases, prepared from isatin with aniline, 4-chloroaniline, 2- bromoaniline, 2-nitroaniline (Hl), ethylenediamine, o- phenylenediamine and 4-methyl-o-phenylenediamine (H 2 L') have been synthesised and their physico-chemical properties investigated using elemental analysis, molar conductivities, magnetic susceptibility measurements and spectral (visible, infrared and 1 H NMR) data. The Schiff bases HL bind in a bidentate manner while schiff bases H 2 L' bind in a tetradentate manner. The probable structures of the complexes are proposed. (author)

  7. Spectral intensities and bonding parameters for some praseodymium(III) and neodymium(III) complexes with benzimidazoles

    Energy Technology Data Exchange (ETDEWEB)

    Vyas, P C; Ojha, C K; Mittal, S; Joshi, G K


    The electronic spectral intensity parameters (Judd-Ofelt; Tsub(lambda)) calculated from absorption spectral data for the complexes of praseodymium(III) and neodymium(III) nitrates with benzimidazole and 2-methyl-, 2-ethyl- and 2-n-propyl-benzimidazoles are reported. The conductance of these derivatives in dimethylformamide suggests 1:1 electrolytic nature. The infrared spectral data indicate the presence of Csub(2v) as well Dsub(2h)-nitrate ions in the complexes. The correlation of the intensity of hypersensitive transitions with bonding (nephelauxetic ratio and degree of covalency) parameters are also reported. (author). 13 refs., 2 tables.

  8. Kinetic Study on the Sorption of Te (IV), Ce (III) and Eu (III) on some Inorganic Ion Exchangers

    International Nuclear Information System (INIS)

    El-Sweify, F.H.; Shehata, M.K.K.; El-Shazly, E.A.A.


    The sorption behaviour of Te (IV), Ce (III) and Eu (III) on zirconium phosphate (Zr P) and ceric tungstate under various conditions was studied. Some factors affecting the sorption kinetics of the aforementioned metal ions on both ion exchangers were investigated. These factors were: hydrogen ion concentration in the absence of complexing agents, contact time, particle size of the two mentioned ion exchangers, metal in concentration and temperature. Radioactive isotopes were used for tracing the corresponding elements. Some physical parameters related to the sorption process were calculated from the obtained data

  9. Level III Reliability methods feasible for complex structures

    NARCIS (Netherlands)

    Waarts, P.H.; Boer, A. de


    The paper describes the comparison between three types of reliability methods: code type level I used by a designer, full level I and a level III method. Two cases that are typical for civil engineering practise, a cable-stayed subjected to traffic load and the installation of a soil retaining sheet

  10. Room-temperature ballistic transport in III-nitride heterostructures. (United States)

    Matioli, Elison; Palacios, Tomás


    Room-temperature (RT) ballistic transport of electrons is experimentally observed and theoretically investigated in III-nitrides. This has been largely investigated at low temperatures in low band gap III-V materials due to their high electron mobilities. However, their application to RT ballistic devices is limited by their low optical phonon energies, close to KT at 300 K. In addition, the short electron mean-free-path at RT requires nanoscale devices for which surface effects are a limitation in these materials. We explore the unique properties of wide band-gap III-nitride semiconductors to demonstrate RT ballistic devices. A theoretical model is proposed to corroborate experimentally their optical phonon energy of 92 meV, which is ∼4× larger than in other III-V semiconductors. This allows RT ballistic devices operating at larger voltages and currents. An additional model is described to determine experimentally a characteristic dimension for ballistic transport of 188 nm. Another remarkable property is their short carrier depletion at device sidewalls, down to 13 nm, which allows top-down nanofabrication of very narrow ballistic devices. These results open a wealth of new systems and basic transport studies possible at RT.

  11. Emittance growth and tune spectra at PETRA III

    International Nuclear Information System (INIS)

    Wanzenberg, R.


    At DESY the PETRA ring has been converted into a synchrotron radiation facility, called PETRA III. 20 damping wigglers have been installed to achieve an emittance of 1 nm. The commissioning with beam started in April 2009 and user runs have been started in 2010. The design current is 100 mA and the bunch to bunch distance is 8 ns for one particular filling pattern with 960 bunches. At a current of about 50 mA a strong vertical emittance increase has been observed. During machine studies it was found that the emittance increase depends strongly on the bunch filling pattern. For the user operation a filling scheme has been found which mitigates the increase of the vertical emittance. In August 2010 PETRA III has been operated without damping wigglers for one week. The vertical emittance growth was not significantly smaller without wigglers. Furthermore tune spectra at PETRA III show characteristic lines which have been observed at other storage rings in the connection with electron clouds. Measurements at PETRA III are presented for different bunch filling patterns and with and without wiggler magnets. (orig.)

  12. Tris(O-cyclohexyl dithiocarbonato-κSantimony(III

    Directory of Open Access Journals (Sweden)

    Wenkuan Li


    Full Text Available In the molecule of the title compound, [Sb(C7H11OS23], the antimony(III is coordinated by the S atoms of three O-alkyl xanthate groups acting as monodentate ligands, forming a distorted trigonal-pyramidal coordination.

  13. FutureTox III: Bridges for Translation | Science Inventory | US ... (United States)

    The present document describes key discussion points and outcomes of a Society of Toxicology (SOT) Contemporary Concepts in Toxicology (CCT) Workshop, entitled FutureTox III1,2 that was held in Crystal City, Virginia, November 19-20, 2015. The workshop built on the many lessons learned from the first 10 years of TT21 and the first two workshops in the FutureTox series (for summary of FutureTox II see (Knudsen et al., 2015); for summary of FutureTox I see (Rowlands et al., 2014)). FutureTox III was attended in person and via webcast by more than 300 scientists from government research and regulatory agencies, research institutes, academia, and the chemical and pharmaceutical industries in Europe, Canada, and the United States. The meeting materials for FutureTox III, currently available to meeting registrants at, will be open to the public on November 29, 2016. At this workshop, participants reviewed and discussed the state of the science in toxicology and human risk and exposure assessment with a focus on moving TT21 science into the arena of regulatory decision-making. This manuscript describes the outcome of the FutureTox III 'contemporary concepts in toxicology' conference of the Society Toxicology, held November 2015 in Crystal City VA.

  14. Electrical properties of dislocations in III-Nitrides

    Energy Technology Data Exchange (ETDEWEB)

    Cavalcoli, D.; Minj, A.; Pandey, S.; Cavallini, A. [Physics and Astronomy Dept. University of Bologna, Italy viale C Berti Pichat 6/II, Bologna (Italy)


    Research on GaN, AlN, InN (III-N) and their alloys is achieving new heights due their high potential applications in photonics and electronics. III-N semiconductors are mostly grown epitaxially on sapphire, and due to the large lattice mismatch and the differences in the thermal expansion coefficients, the structures usually contain many threading dislocations (TDs). While their structural properties have been widely investigated, their electrical characteristics and their role in the transport properties of the devices are still debated. In the present contribution we will show conductive AFM studies of TDs in GaN and Al/In GaN ternary alloys to evidence the role of strain, different surface polarity and composition on their electrical properties. Local I-V curves measured at TDs allowed us to clarify their role in the macroscopic electrical properties (leakage current, mobilities) of III-N based devices. Samples obtained by different growers (AIXTRON, III-V Lab) were studied. The comparison between the results obtained in the different alloys allowed us to understand the role of In and Al on the TDs electrical properties.

  15. Electrical properties of dislocations in III-Nitrides (United States)

    Cavalcoli, D.; Minj, A.; Pandey, S.; Cavallini, A.


    Research on GaN, AlN, InN (III-N) and their alloys is achieving new heights due their high potential applications in photonics and electronics. III-N semiconductors are mostly grown epitaxially on sapphire, and due to the large lattice mismatch and the differences in the thermal expansion coefficients, the structures usually contain many threading dislocations (TDs). While their structural properties have been widely investigated, their electrical characteristics and their role in the transport properties of the devices are still debated. In the present contribution we will show conductive AFM studies of TDs in GaN and Al/In GaN ternary alloys to evidence the role of strain, different surface polarity and composition on their electrical properties. Local I-V curves measured at TDs allowed us to clarify their role in the macroscopic electrical properties (leakage current, mobilities) of III-N based devices. Samples obtained by different growers (AIXTRON, III-V Lab) were studied. The comparison between the results obtained in the different alloys allowed us to understand the role of In and Al on the TDs electrical properties.

  16. Laparoscopic treatment of type III para-oesophageal hernia | Van ...

    African Journals Online (AJOL)

    Type III congenital para-oesophageal hernia is a rare condition in children and is ... portion of the stomach and the gastro-oesophageal junction into the chest. ... in the hands of paediatric surgeons familiar with laparoscopic anti-reflux surgery.

  17. Joint probability of statistical success of multiple phase III trials. (United States)

    Zhang, Jianliang; Zhang, Jenny J


    In drug development, after completion of phase II proof-of-concept trials, the sponsor needs to make a go/no-go decision to start expensive phase III trials. The probability of statistical success (PoSS) of the phase III trials based on data from earlier studies is an important factor in that decision-making process. Instead of statistical power, the predictive power of a phase III trial, which takes into account the uncertainty in the estimation of treatment effect from earlier studies, has been proposed to evaluate the PoSS of a single trial. However, regulatory authorities generally require statistical significance in two (or more) trials for marketing licensure. We show that the predictive statistics of two future trials are statistically correlated through use of the common observed data from earlier studies. Thus, the joint predictive power should not be evaluated as a simplistic product of the predictive powers of the individual trials. We develop the relevant formulae for the appropriate evaluation of the joint predictive power and provide numerical examples. Our methodology is further extended to the more complex phase III development scenario comprising more than two (K > 2) trials, that is, the evaluation of the PoSS of at least k₀ (k₀≤ K) trials from a program of K total trials. Copyright © 2013 John Wiley & Sons, Ltd.

  18. Tanzania 1895-1920 : Part III: 1914-1920s

    NARCIS (Netherlands)

    Dietz, A.J.


    An earlier version of this African Postal Heritage Paper was published as African Studies Centre Leiden Working Paper 119 / 2015: "A postal history of the First World War in Africa and its aftermath - German colonies; III Deutsch Ostafrika / German East Africa", written by Ton Dietz.

  19. Parametric Sensitivity Analysis of the WAVEWATCH III Model

    Directory of Open Access Journals (Sweden)

    Beng-Chun Lee


    Full Text Available The parameters in numerical wave models need to be calibrated be fore a model can be applied to a specific region. In this study, we selected the 8 most important parameters from the source term of the WAVEWATCH III model and subjected them to sensitivity analysis to evaluate the sensitivity of the WAVEWATCH III model to the selected parameters to determine how many of these parameters should be considered for further discussion, and to justify the significance priority of each parameter. After ranking each parameter by sensitivity and assessing their cumulative impact, we adopted the ARS method to search for the optimal values of those parameters to which the WAVEWATCH III model is most sensitive by comparing modeling results with ob served data at two data buoys off the coast of north eastern Taiwan; the goal being to find optimal parameter values for improved modeling of wave development. The procedure adopting optimal parameters in wave simulations did improve the accuracy of the WAVEWATCH III model in comparison to default runs based on field observations at two buoys.

  20. Precipitation of plutonium (III) oxalate and calcination to plutonium oxide

    International Nuclear Information System (INIS)

    Esteban, A.; Orosco, E.H.; Cassaniti, P.; Greco, L.; Adelfang, P.


    The plutonium based fuel fabrication requires the conversion of the plutonium nitrate solution from nuclear fuel reprocessing into pure PuO2. The conversion method based on the precipitation of plutonium (III) oxalate and subsequent calcination has been studied in detail. In this procedure, plutonium (III) oxalate is precipitated, at room temperature, by the slow addition of 1M oxalic acid to the feed solution, containing from 5-100 g/l of plutonium in 1M nitric acid. Before precipitation, the plutonium is adjusted to trivalent state by addition of 1M ascorbic acid in the presence of an oxidation inhibitor such as hydrazine. Finally, the precipitate is calcinated at 700 deg C to obtain PuO2. A flowsheet is proposed in this paper including: a) A study about the conditions to adjust the plutonium valence. b) Solubility data of plutonium (III) oxalate and measurements of plutonium losses to the filtrate and wash solution. c) Characterization of the obtained products. Plutonium (III) oxalate has several potential advantages over similar conversion processes. These include: 1) Formation of small particle sizes powder with good pellets fabrication characteristics. 2) The process is rather insensitive to most process variables, except nitric acid concentration. 3) Ambient temperature operations. 4) The losses of plutonium to the filtrate are less than in other conversion processes. (Author) [es