WorldWideScience

Sample records for hhh hhh hhh

  1. 40 CFR Appendix: Table 1 to... - List of Hazardous Air Pollutants (HAP) for Subpart HHH

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 11 2010-07-01 2010-07-01 true List of Hazardous Air Pollutants (HAP) for Subpart HHH Table Appendix: Table 1 to Subpart HHH of Part 63 Protection of Environment... HHH of Part 63—List of Hazardous Air Pollutants (HAP) for Subpart HHH CAS Number a Chemical name 75070...

  2. Diagnosis and high incidence of hyperornithinemia-hyperammonemia-homocitrullinemia (HHH) syndrome in northern Saskatchewan.

    Science.gov (United States)

    Sokoro, AbdulRazaq A H; Lepage, Joyce; Antonishyn, Nick; McDonald, Ryan; Rockman-Greenberg, Cheryl; Irvine, James; Lehotay, Denis C

    2010-12-01

    Mutations in the SLC25A15 gene, encoding the human inner mitochondrial membrane ornithine transporter, are thought to be responsible for hyperornithinemia-hyperammonemia-homocitrullinemia (HHH) syndrome, a rare autosomal recessive condition. HHH syndrome has been detected in several small, isolated communities in northern Saskatchewan (SK). To determine the incidence of HHH syndrome in these communities, a PCR method was set up to detect F188Δ, the common French-Canadian mutation. Neonatal blood spots collected from all newborns from the high risk area were genotyped for the F188Δ mutation for seven consecutive years. Using DNA analysis, we estimated that the heterozygote frequency for the mutant allele for HHH syndrome to be about 1 in 19 individuals, predicting one affected child with HHH syndrome for approximately every 1,500 individuals (1 in 1,550 live births; 1 child every 12 years) in this isolated population. The frequency for the mutant allele for HHH syndrome in this isolated community is probably the highest in the world for this rare disorder. We determined that ornithine levels, by tandem mass spectrometry, were not abnormal in newborns with F188Δ mutation, carriers and normals. Ornithine rises to abnormally high levels at some time after birth well past the time that the newborn screening blood spot is collected. The timing or the reasons for the delayed rise of ornithine in affected children with HHH syndrome have not been determined. Newborn screening for HHH Syndrome in this high risk population is only possible by detection of the mutant allele using DNA analysis.

  3. Insights into the mutation-induced HHH syndrome from modeling human mitochondrial ornithine transporter-1.

    Directory of Open Access Journals (Sweden)

    Jing-Fang Wang

    Full Text Available Human mitochondrial ornithine transporter-1 is reported in coupling with the hyperornithinemia-hyperammonemia-homocitrullinuria (HHH syndrome, which is a rare autosomal recessive disorder. For in-depth understanding of the molecular mechanism of the disease, it is crucially important to acquire the 3D structure of human mitochondrial ornithine transporter-1. Since no such structure is available in the current protein structure database, we have developed it via computational approaches based on the recent NMR structure of human mitochondrial uncoupling protein (Berardi MJ, Chou JJ, et al. Nature 2011, 476:109-113. Subsequently, we docked the ligand L-ornithine into the computational structure to search for the favorable binding mode. It was observed that the binding interaction for the most favorable binding mode is featured by six remarkable hydrogen bonds between the receptor and ligand, and that the most favorable binding mode shared the same ligand-binding site with most of the homologous mitochondrial carriers from different organisms, implying that the ligand-binding sites are quite conservative in the mitochondrial carriers family although their sequences similarity is very low with 20% or so. Moreover, according to our structural analysis, the relationship between the disease-causing mutations of human mitochondrial ornithine transporter-1 and the HHH syndrome can be classified into the following three categories: (i the mutation occurs in the pseudo-repeat regions so as to change the region of the protein closer to the mitochondrial matrix; (ii the mutation is directly affecting the substrate binding pocket so as to reduce the substrate binding affinity; (iii the mutation is located in the structural region closer to the intermembrane space that can significantly break the salt bridge networks of the protein. These findings may provide useful insights for in-depth understanding of the molecular mechanism of the HHH syndrome and

  4. Structure-guided mutational analysis of the OB, HhH, and BRCT domains of Escherichia coli DNA ligase.

    Science.gov (United States)

    Wang, Li Kai; Nair, Pravin A; Shuman, Stewart

    2008-08-22

    NAD(+)-dependent DNA ligases (LigAs) are ubiquitous in bacteria and essential for growth. LigA enzymes have a modular structure in which a central catalytic core composed of nucleotidyltransferase and oligonucleotide-binding (OB) domains is linked via a tetracysteine zinc finger to distal helix-hairpin-helix (HhH) and BRCT (BRCA1-like C-terminal) domains. The OB and HhH domains contribute prominently to the protein clamp formed by LigA around nicked duplex DNA. Here we conducted a structure-function analysis of the OB and HhH domains of Escherichia coli LigA by alanine scanning and conservative substitutions, entailing 43 mutations at 22 amino acids. We thereby identified essential functional groups in the OB domain that engage the DNA phosphodiester backbone flanking the nick (Arg(333)); penetrate the minor grove and distort the nick (Val(383) and Ile(384)); or stabilize the OB fold (Arg(379)). The essential constituents of the HhH domain include: four glycines (Gly(455), Gly(489), Gly(521), Gly(553)), which bind the phosphate backbone across the minor groove at the outer margins of the LigA-DNA interface; Arg(487), which penetrates the minor groove at the outer margin on the 3 (R)-OH side of the nick; and Arg(446), which promotes protein clamp formation via contacts to the nucleotidyltransferase domain. We find that the BRCT domain is required in its entirety for effective nick sealing and AMP-dependent supercoil relaxation.

  5. Summary of CARE-HHH Mini-Workshop on LHC Crab Cavity Validation, 21 August 2008

    CERN Document Server

    Calaga, R; Garoby, R; Linnecar, T; Tomás, R; Zimmermann, F; CERN. Geneva. BE Department

    2008-01-01

    A global LHC crab-cavity collaboration is rapidly advancing the R&D of a complete crab cavity cryomodule and performing the associated beam dynamics simulations compatible with a prototype test in the phase 0/I upgrade with the aim of establishing a full crab crossing scheme for the phase II upgrade of the LHC. A one day CARE-HHH mini-workshop was held on August 21, 2008 at CERN to discuss crab crossing in the LHC phase 0/I & II upgrades and this reports summarizes the activities of the four sessions that took place during the workshop. The goals of this crab-cavity workshop were fourfold: (1) to discuss prospects of crab cavities in LHC upgrades (2) to review the status of the cryomodule development and beam dynamics, (3) to establish validity requirements for LHC crab cavities which need to be demonstrated prior to their installation into the LHC, and (4) to provide guidance & coordination for the global collaborators.

  6. CARE-HHH-APD Workshop on Finalizing the Roadmap for the Upgrade of the CERN and GSI Accelerator Complex

    CERN Document Server

    Zimmermann, Frank; BEAM'07; BEAM 2007; Finalizing the Roadmap for the Upgrade of the LHC and GSI Accelerator Complex

    2008-01-01

    This report contains the Proceedings of the CARE-HHH-APD Event BEAM’07, “Finalizing the Roadmap for the Upgrade of the CERN & GSI Accelerator Complex,” which was held at CERN in Geneva, Switzerland, from 1 to 5 October 2007. BEAM’07 was primarily devoted to beam dynamics limitations for the two, or three, alternative baseline scenarios of the LHC luminosity upgrade and to critical design choices for the upgrade of the LHC injector complex at CERN and for the FAIR complex at GSI. It comprised five parts: (1) a Mini-Workshop on LHC+ Beam Performance, (2) a CERN-GSI Meeting on Collective Effects, (3) the Francesco Ruggiero Memorial Symposium, (4) a Mini-Workshop on the LHC Injectors Upgrade, and (5) the BEAM’07 Summaries. Topics addressed in the first mini-workshop of BEAM’07 ranged from the luminosity performance reach of the upgraded LHC in different scenarios, over the generation and stability of the future LHC beams, the turnaround time, beam–beam effects, luminosity levelling methods, and ...

  7. Joint CARE-ELAN, CARE-HHH-APD, and EUROTEV-WP3 Workshop on Electron Cloud Clearing

    CERN Document Server

    Scandale, Walter; Schulte, D; Zimmermann, F; Electron Cloud Effects and Technological Consequences; ECL2

    2007-01-01

    This report contains the Proceedings of the joint CARE-HHH-APD, CARE-ELAN, and EUROTEV-WP3 Mini-Workshop on 'Electron Cloud Clearing - Electron Cloud and Technical Consequences', "ECL2", held at CERN in Geneva, Switzerland, 1-2 March 2007). The ECL2 workshop explored novel technological remedies against electron-cloud formation in an accelerator beam pipe. A primary motivation for the workshop was the expected harmful electron-cloud effects in the upgraded LHC injectors and in future linear colliders, as well as recent beam observations in operating facilities like ANKA, CESR, KEKB, RHIC, and SPS. The solutions discussed at ECL2 included enamel-based clearing electrodes, slotted vacuum chambers, NEG coating, and grooves. Several of the proposed cures were assessed in terms of their clearing efficiency and the associated beam impedance. The workshop also reviewed new simulation tools like the 3D electron-ion build-up 'Faktor', modeling assumptions, analytical calculations, beam experiments, and laboratory meas...

  8. Evidence of CP violation in B -> hhh charmless decays

    CERN Multimedia

    CERN. Geneva

    2012-01-01

    We present the first evidence of CP violation in the B+→ pi+pi-pi+,  B+→ K+pi+pi-, B+→ K+K-pi+ and B+→K+K-K+ decays using the 1.0 fb-1 of data collected by the LHCb experiment during 2011. The results show that the 3pi and Kpipi channels present a positive asymmetry while the KKpi and KKK modes present a negative asymmetry. We also study the variation of the CP violation effects in the phase space of each three-body decay.  We find significant inhomogeneities that reveal regions with particularly large asymmetries in the pipi and KK low mass regions in B+→pi+pi-pi+ and B+→K+K-pi+ respectively.

  9. Improved measurements of the two-body decays B → hh(h = K, π)

    International Nuclear Information System (INIS)

    Mohanty, Gagan

    2013-01-01

    We report improved measurements of the branching fractions and CP violation asymmetries for B → Kπ,ππ and K K decays based on the final data sample 772 million BB pairs collected with the Belle detector. We set a 90% confidence-level upper limit for B 0 →K + K; all other decays are observed with branching fraction ranging from 10 6 to 10 5

  10. Summy of the working groupI of the care HHH LUMI-2005 workshop

    CERN Document Server

    Brüning, Oliver Sim

    2006-01-01

    The working group I of the LUMI-2005 workshop was asked to put together a catalogue of basic design options for the IR solutions for an LHC-upgrade. The goal of the working group was to discuss the different solutions with respect to the maximum beta-functions inside the first focusing quadrupole magnets and the resulting required quadrupole apertures the chromatic aberrations on the one hand and the implications for the magnet technology on the other hand. Such a comparison requires a wide range of input data ranging from the expected loss patterns at the magnetic elements and the resulting peak and average heat deposition to the obtainable peak magnetic field and quench limits for different magnet design options and the correct ability of the chromatic aberrations for a given optics design. Given the wide spectrum of relevant input data the working group could not yet prepare a final ranking of the various design options. Rather the working group succeeded in fixing some of the key boundary conditions in or...

  11. Study of CP violation in the B0 → h+h-(h = π, K) decay by the BaBar detector at SLAC

    International Nuclear Information System (INIS)

    Pivk, Muriel

    2003-01-01

    The absence of antimatter in the universe imposes the study of the CP symmetry violation. This phenomenon first uncovered in the K meson systems has been recently evidenced in the B meson systems. The B factories PEP-II and KEK-B produce e + e - in the Υ(4S) resonance, which undergoes a decay into charged or neutral BB-bar pairs. Evidencing the CP violation requires a measurement of the difference between the B meson decays towards a precise final state and the B-bar meson decay, i.e. of the CP conjugate antiparticle of B. The work described in this thesis has been carried out since January 2001 with the detector BABAR. Namely, the subject matter of the thesis was the study of the neutral B meson decay into two charmless bodies in the final state B 0 /B 0 -bar → h + h - (h = π, K). Since events in these channels are extremely rare a major task of the analysis is to lower the background as much as possible. The decays allow studying the CP violation namely, through the α angle of the unitarity triangle describing the CP violation in the Standard Model. This new information added to the β angle and to other CKM matrix parameters, already measured, permits strengthening the constraints on the Standard Model parameters. This thesis is structured in three parts. The first one deals with the theory. First it presents a general description of the weak interaction within in the frame of the Standard Model, as well as a description of the B 0 /B 0 -bar system. The second chapter presents the B 0 → π + π - decay which is indeed the core of this thesis. Four theoretical models studied for the interpretation of the results are also described. The second part is devoted to the experimental setup. The PEP-II collider and the BABAR detector are described thoroughly to comprehend the key points of the analysis. The third part presents details of the analysis of experimental results from the data acquisition up to extraction of measurement magnitudes. The chapter four gives a general outlook of the analysis particularly of the event selection. The fundamental variables are here defined and exposed is the principle of the likelihood method used for extraction of the information in the last stage of the analysis. The chapter five is devoted to the fight against the background. The following chapter presents the adjustment made to shape the final stage of analysis which allows extraction of the branching ratios and parameters which measure the CP violation. Finally, the last chapter deals with the interpretation of the results in terms of constraints on parameters of CKM matrix of the Standard Model. Also, the results of Belle experiment are discussed. In conclusion, the following values were obtained for the branching ratios: B(B 0 → π + π - ) = 4.7 ± 0.6 ± 0.2 10 -6 ; B(B 0 → K + π - ) = 17.9 ± 0.9 ± 0.7 10 -6 ; B(B 0 → K + K - ) -6 (90%). These values are in good agreement with the data previously published but they have a higher precision. In the last case only an upper limit is given because the signal is as expected very low. The results for the parameters measuring the CP violation are: A Kπ = - 0.10 ± 0.05 ± 0.02; S ππ = 0.02 ± 0.34 ± 0.05; C ππ = - 0.30 ± 0.25 ± 0.04. These three values are compatible with the absence of CP violation. The interpretation of these results show that is still difficult to constrain significantly the alpha angle with the current statistics and isospin symmetry which is the only solid theoretical frame. Hopefully, the statistics of BABAR will increase till 2006 by a factor of five and the B 0 → π 0 π 0 ) decay branching will be measured sufficiently accurately to allow reaching the α angle. To get stronger constraints the theoretical models should be further elaborated and experimentally checked

  12. Deconstructing the mammal species richness pattern in Europe - towards and understanding of the relative importance of climate, biogeographic history, habitat heterogeneity and humans

    DEFF Research Database (Denmark)

    Fløjgaard, Camilla; Normand, Signe; Skov, Flemming

    2011-01-01

    partitioning to assess the importance of macroclimate and HHH variables. The HHH variables included two historical factors, estimated by novel methodologies: (1) ice-age-driven dynamics, represented by accessibility to recolonization from hindcasting-estimated glacial refugia, and (2) biogeographic peninsular...

  13. Data of evolutionary structure change: 1A5CB-2QUUC [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 2QUU C 2QUUC ...in>C 2QUUC INKCPLLKPWAence> HHH...>2 2QUU C 2QUUC LKIGE--HTPSA...1A5CB-2QUUC 1A5C 2QUU B C ------LPADVAEELATTAQKLVQAGKGILAADESTQTI.../pdbChain> 1A5CB ence>LFGTK-GLGKFence> HHH -

  14. Data of evolutionary structure change: 1ACLA-1LPOA [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available entryIDChain>1ACLA DEQFP-GFSGS > - HHH...O A 1LPOA PEGTYEENLPK ...> HHH> ATOM 474 CA PRO A 65 69.013 60.208 -6.968 1...Chain>A 1LPOA GSASD--KLACL re> --HHHHH...CLA NLNSDEELIHCL > HHHHHHHH

  15. Data of evolutionary structure change: 1EP8B-1FAAA [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1EP8B-1FAAA 1EP8 1FAA B A -------------GGSVIVIDSKAAWDAQLAKGKEEHKP...IVVAFTATWCGPCKMIAPLFETLSNDYAGKVIFLKVDVD-AVAAVAEAAGITAMPTFHVYKDGVKADDLVGASQDKLKALVAKHAAA LELALGT.../pdbChain> 1FAAA KLDCNQENKTL EEE HHH 1 1FAA A 1FAAA

  16. Dicty_cDB: AFH258 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 6. 2 Translated Amino Acid sequence gllxskinikqi*k*kcqvvemvvii*kilaiilkkllfnhqkkqlql*ynkilmilk...vrqfqs*wvlinckl*iqsmvgfhqrcnkqimilkscllvf ywvplmhl*fgkvqerpq*fvdslkihfgvnkiisssirhqaqvmnisplsil*nlvipm vqyws...*nkkkl* Frame B: gllxskinikqi*k*kcqvvemvvii*kilaiilkkllfnhqkkqlql*ynkilmilkq* hhh*SQNPLVAVLVKINHHHHHHVVVVVIK

  17. The Use of Dexamethasone in Support of High-Altitude Ground Operations and Physical Performance: Review of the Literature

    Science.gov (United States)

    2014-12-01

    rates vary dramatically, the physiological effect of hypobaric high-altitude hypoxia (HHH) is ubiquitous.1,2 Symptoms of less severe cases of HHH...staff member on a quarterly basis at the UHM Fellowship Program and Multiplace Hyperbaric Chamber Wilford Hall San Anto- nio MHS, Texas. Initially...oc- cupational, and undersea hyperbaric medicine. Lt Col (Ret) Wright, PhD, CAsP, is a full-time faculty member at the USAF School of Aerospace

  18. Higgs boson pair production at the photon linear collider in the two Higgs doublet model

    International Nuclear Information System (INIS)

    Asakawa, Eri; Harada, Daisuke; Okada, Yasuhiro; Kanemura, Shinya; Tsumura, Koji

    2009-02-01

    We calculate the cross section of the lightest Higgs boson pair production at the Photon Linear Collider in the two Higgs doublet model. We focus on the scenario in which the lightest Higgs boson has the standard model like couplings to gauge bosons. We take into account the one-loop correction to the hhh coupling as well as additional one-loop diagrams due to charged bosons to the γγ → hh helicity amplitudes. We discuss the impact of these corrections on the hhh coupling measurement at the Photon Linear Collider. (author)

  19. The Fanconi anemia associated protein FAAP24 uses two substrate specific binding surfaces for DNA recognition

    NARCIS (Netherlands)

    Wienk, H.L.J.; Slootweg, J.C.; Speerstra, S.; Kaptein, R.; Boelens, R.; Folkers, G.E.

    2013-01-01

    To maintain the integrity of the genome, multiple DNA repair systems exist to repair damaged DNA. Recognition of altered DNA, including bulky adducts, pyrimidine dimers and interstrand crosslinks (ICL), partially depends on proteins containing helix-hairpin-helix (HhH) domains. To understand how ICL

  20. Accelerator Physics Code Web Repository

    CERN Document Server

    Zimmermann, Frank; Bellodi, G; Benedetto, E; Dorda, U; Giovannozzi, Massimo; Papaphilippou, Y; Pieloni, T; Ruggiero, F; Rumolo, G; Schmidt, F; Todesco, E; Zotter, Bruno W; Payet, J; Bartolini, R; Farvacque, L; Sen, T; Chin, Y H; Ohmi, K; Oide, K; Furman, M; Qiang, J; Sabbi, G L; Seidl, P A; Vay, J L; Friedman, A; Grote, D P; Cousineau, S M; Danilov, V; Holmes, J A; Shishlo, A; Kim, E S; Cai, Y; Pivi, M; Kaltchev, D I; Abell, D T; Katsouleas, Thomas C; Boine-Frankenheim, O; Franchetti, G; Hofmann, I; Machida, S; Wei, J

    2006-01-01

    In the framework of the CARE HHH European Network, we have developed a web-based dynamic acceleratorphysics code repository. We describe the design, structure and contents of this repository, illustrate its usage, and discuss our future plans, with emphasis on code benchmarking.

  1. Solution structure and DNA-binding properties of the C-terminal domain of UvrC from E.coli

    NARCIS (Netherlands)

    Singh, S.; Folkers, G.E.; Bonvin, A.M.J.J.; Boelens, R.; Wechselberger, R.W.; Niztayev, A.; Kaptein, R.

    2002-01-01

    The C-terminal domain of the UvrC protein (UvrC CTD) is essential for 5' incision in the prokaryotic nucleotide excision repair process. We have determined the three-dimensional structure of the UvrC CTD using heteronuclear NMR techniques. The structure shows two helix±hairpin±helix (HhH) motifs

  2. Data of evolutionary structure change: 1VL8A-2UVDE [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1VL8A-2UVDE 1VL8 2UVD A E FDLRGRVALVTGGSRGLGFGIAQGLAEAGCSVVVASRN-...eq1> -MLKGKVALVTGASRGIGRAIAIDLAKQGANVVVNYAGNEQKANEVVDEIKKL-GSDAIAVRADVANAED...>E 2UVDE VNYAGNEQKAN EEE H...in>E 2UVDE EIKKL-GSDAI HHH...yChain> 2UVD E 2UVDE VGVTG-NPGQA<

  3. Data of evolutionary structure change: 1A5CB-2QUTC [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 8 2QUT C 2QUTC ...ain>C 2QUTC ence>INKCPLLKPWA HH...T C 2QUTC ence>LKIGE--HTPSA...1A5CB-2QUTC 1A5C 2QUT B C ------LPADVAEELATTAQKLVQAGKGILAADESTQTI... 1A5CB LFGTK-GLGKFence> HHH - <

  4. Data of evolutionary structure change: 1CG5A-2QU0C [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available D> C 2QU0C ence>YFPHF-DLSHGence> 0 A C VLSSQNKKAIEELGNLIKANAEAWGADALARLFELHPQT...n> 1CG5 A 1CG5A ence>VNLQA-FTPVT...line> THR CA 269 2QU0 C 2QU...0C ence>CHLPNDFTPAVence> HHHH HHH

  5. Data of evolutionary structure change: 1CG8A-2QU0A [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available /pdbChain> 2QU0A ence>YFPHF-DLSHGence> G - 0 A A VLSSQNKKAIEELGNLIKANAEAWGADALARLFELHPQT...hain> 1CG8 A 1CG8A ence>VNLQA-FTPVT...ine>THR CA 278 2QU0 A 2QU...0A ence>CHLPNDFTPAV HH HHHH HHH

  6. Data of evolutionary structure change: 1A5CB-2QUVA [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available n14> 2QUV A 2QUVA ...V A 2QUVA ... 2QUVA LKIGE--HTPSAence> E -- H...1A5CB-2QUVA 1A5C 2QUV B A ------LPADVAEELATTAQKLVQAGKGILAADESTQTI... 1A5CB ence>LFGTK-GLGKFence> HHH -

  7. Data of evolutionary structure change: 2QU0A-2DXMB [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available n>A 2QU0A WGKVGGNAGAYGence> HHH...2QU0A-2DXMB 2QU0 2DXM A B -VLSAADKSNVKAAWGKVGGNAGAYGAEALERMFLSFPT...ID> 0 2DXM B 2DXMB ...ence>WGKVN--VDEVGence> GGG --HHHHH VAL CA 716 GLY CA 753 2QU0

  8. Data of evolutionary structure change: 1A5CB-2QUTA [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 4> 2QUT A 2QUTA ...yChain> 2QUT A 2QUTA ...hain>A 2QUTA ence>LKIGE--HTPSAence> ...1A5CB-2QUTA 1A5C 2QUT B A ------LPADVAEELATTAQKLVQAGKGILAADESTQTI...entryIDChain>1A5CB ence>LFGTK-GLGKFence> HHH -

  9. Data of evolutionary structure change: 1BYPA-1FA4A [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available dbChain>A 1BYPA SVTLT---EKGTY cture...>EEEE --- EEE> ATOM 522 CA SER A ...n> STTFPADAPAGEY ucture>EE ture...ucture> -- cture> ATOM 860 CA LYS A 57 7.87...yIDChain> TKISMPEEDLLN >HHH >

  10. Safety of Mixed Model Access Control in a Multilevel System

    Science.gov (United States)

    2014-06-01

    42  H.  FIREWALL AND IPS LANGUAGES...Research Laboratory AIS automated information system ANOA advance notice of arrival APT advanced persistent threat BFM boundary flow modeling...of Investigation FW firewall GENSER general service xvi GUI graphical user interface HAG high-assurance guard HGS high-grade service H-H-H High

  11. Data of evolutionary structure change: 1PVDA-2VBIA [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1PVDA-2VBIA 1PVD 2VBI A A SEITLGKYLFERLKQVNVNTVFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADGYARIKGMSCIITTFGVGELSALNGIAGSYAEHVG.../ss_2> 0 1PVD A 1PVDA SFNDN-SKIRM HHH ... 1PVD A 1PVD...A 233 ARG CA 308 GLN CA 388 1PVD

  12. Data of evolutionary structure change: 1PVDA-2VBIG [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1PVDA-2VBIG 1PVD 2VBI A G SEITLGKYLFERLKQVNVNTVFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADGYARIKGMSCIITTFGVGELSALNGIAGSYAEHVG.../ss_2> 0 1PVD A 1PVDA SFNDN-SKIRM HHH ...ine>PRO CA 225 GLU CA 183 1PVD... A 1PVDA LQTPIDMSLKP

  13. ACCELERATION PHYSICS CODE WEB REPOSITORY.

    Energy Technology Data Exchange (ETDEWEB)

    WEI, J.

    2006-06-26

    In the framework of the CARE HHH European Network, we have developed a web-based dynamic accelerator-physics code repository. We describe the design, structure and contents of this repository, illustrate its usage, and discuss our future plans, with emphasis on code benchmarking.

  14. Data of evolutionary structure change: 1EWOA-5PADA [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1EWOA-5PADA 1EWO 5PAD A A APAAVDWRARGAVTAVKDQGQCGSCWAFSAIGNVECQWF...ryChain> 5PAD A 5PADA...>5PAD A 5PADA KRGTGNSYGVCGLY ...>A 5PADA LVAQY---GIHYR HHH...Chain>A 5PADA TYPYE---GVQRY

  15. A CSMP Commutation Model for Design Study of a Brushless DC Motor Power Conditioner for a Cruise Missile Fin Control Actuator.

    Science.gov (United States)

    1985-06-01

    miU PICJ 4- 00 OH ~0HH tiiI~ H L10 iP. iiiiUiiIIL’ Of 04 c HHHHHH go) 0000 MM3M M M HHII 1:0P 000000 01011 k-4 -4 000 ..44muWNWmu-4MU HHHHH H...14343(. HL4OH Qu).. "-(UI ) 06-40 k-iHU2(./24HUHw HHHHHHQ 71 H NO %0 00HNN 004H Hw* *4 HAQ* -4- 04W34 0104 c FIH EM *Ln2M N rz + 8 -14 Im HHHHHH ...HHH U) * * 02TC4 r4 A 4r1my (𔃾(N1 01010 wM1 ; -0w= .4 mm W004r rzl p HHHHHH P 110 pw Mm22 01 + + 0193 CDJ~ D CD 04 C00000 Q HHH -H" 0 00+0 Z: 010’ )CaM

  16. A Comparison between the Rhesus Monkey and the Human on the Effect of Atropine on the Electroencephalogram. Volume 2. Preliminary Statistical Analysis of Spectral EEG Waveforms in Rhesus Monkeys Exposed to Atropine.

    Science.gov (United States)

    1994-11-01

    000000 000000 000000 000000 000000 C) H rHI HHHH HHHHH - rIr- - rIr H HHHHH 1 1 l H HHHHH- rIr- -I ri - HHHHHH H E-1~~ o~o ~ N H W~r ~ ~ W~MqU) co ýH H aiI...NMlCMMH’DHOO I-NNNMNIr- I- NNNNOnMH U) toH H H z. 000000000 000000000 Cl) H HHHHHH HHHHHHqHHH H- E-4 N MWr-N H Mr- N wMn0~r-oMMN Wl MNHOMM0O’ ro m olq~w H...ý C4k 44 4 ýL 4C 00000 HHH.-4 1- HH H HHHH HHHH U) /u) co* o nvr r-IO NOHM H0(-if0 m i c4 HooD- 00 Z 0000 000000000 00000 VI) H HHHHHH HHHHH HHHH 1

  17. Higgs Pair Production in the $H(\\rightarrow \\tau\\tau)H(\\rightarrow b\\bar{b})$ channel at the High-Luminosity LHC

    CERN Document Server

    The ATLAS collaboration

    2015-01-01

    Prospects studies are presented for the observation of double Higgs production in the channel $H(\\rightarrow b \\overline{b})H(\\rightarrow \\tau \\tau)$ for a total integrated luminosity of 3000~fb$ ^{-1}$ of $\\sqrt{s}=$14~TeV proton-proton collisions at the HL-LHC. A cut-based analysis strategy using MC data and a parametrisation of the ATLAS detector provide assessment to the measurement prospects performed under different assumptions for the trilinear Higgs couplings values. Assuming SM background and SM signal, we expect to set an upper limit of the cross section for the di-Higgs production of $4.3 \\times \\sigma(HH \\rightarrow b\\bar{b}\\tau^+\\tau^-)$ at 95\\% Confidence Level. Using an effective Lagrangian for the Higgs potential, and allowing its trilinear coupling to vary, we can project an exclusion of $\\lambda_{HHH}/\\lambda_{SM} \\leq -4$ and $\\lambda_{HHH}/\\lambda_{SM} \\geq 12$.

  18. Coronary Arteries Segmentation Based on the 3D Discrete Wavelet Transform and 3D Neutrosophic Transform

    OpenAIRE

    Shuo-Tsung Chen; Tzung-Dau Wang; Wen-Jeng Lee; Tsai-Wei Huang; Pei-Kai Hung; Cheng-Yu Wei; Chung-Ming Chen; Woon-Man Kung

    2015-01-01

    Purpose. Most applications in the field of medical image processing require precise estimation. To improve the accuracy of segmentation, this study aimed to propose a novel segmentation method for coronary arteries to allow for the automatic and accurate detection of coronary pathologies. Methods. The proposed segmentation method included 2 parts. First, 3D region growing was applied to give the initial segmentation of coronary arteries. Next, the location of vessel information, HHH subband c...

  19. Development of a Distributed Breach for the Conical Shock Tube.

    Science.gov (United States)

    1983-01-01

    Ti - «<M’»<Mosm —vocvicocviosm —VO(VI cr»—vo •*— ro cvi ro • * m m is. vo N OO CO OS <c<c<c<c<r<c<coc<c<E<c«<c<c<coc<coi hht-HHI-1-Khhhl- hHhhHh

  20. The global quantum duality principle: theory, examples, and applications

    OpenAIRE

    Gavarini, Fabio

    2003-01-01

    Let R be an integral domain, h non-zero in R such that R/hR is a field, and HA the category of torsionless (or flat) Hopf algebras over R. We call any H in HA "quantized function algebra" (=QFA), resp. "quantized (restricted) universal enveloping algebra" (=QrUEA), at h if H/hH is the function algebra of a connected Poisson group, resp. the (restricted, if R/hR has positive characteristic) universal enveloping algebra of a (restricted) Lie bialgebra. We establish an "inner" Galois' correspond...

  1. Quimera de ADN polimerasa del fago ϕ29

    OpenAIRE

    Salas, Margarita; Vega, Miguel de; Lázaro, José M.; Blanco, Luis; Mencía, Mario

    2010-01-01

    Quimera de ADN polimerasa del fago 29. La presente invención se encuadra dentro del campo de la biotecnología. Específicamente, se refiere a una quimera de ADN polimerasa que comprende una región aminoterminal (N-terminal), que codifica para una ADN polimerasa del tipo 29, y una región carboxilo-terminal (C-terminal), que comprende, al menos, un dominio HhH, que se encuentran unidas mediante una secuencia aminoacídica conectora y a su uso para la replicación, amplifi...

  2. The neutral Higgs self-couplings in the (h)MSSM

    Science.gov (United States)

    Chalons, G.; Djouadi, A.; Quevillon, J.

    2018-05-01

    We consider the Minimal Supersymmetric extension of the Standard Model in the regime where the supersymmetric breaking scale is extremely large. In this MSSM, not only the Higgs masses will be affected by large radiative corrections, the dominant part of which is provided by the third generation quark/squark sector, but also the various self-couplings among the Higgs states. In this note, assuming that squarks are extremely heavy, we evaluate the next-to-leading order radiative corrections to the two neutral CP-even Higgs self-couplings λHhh and λhhh and to the partial decay width Γ (H → hh) that are most relevant at the LHC. The calculation is performed using an effective field theory approach that resums the large logarithmic squark contributions and allows to keep under control the perturbative expansion. Since the direct loop vertex corrections are generally missing in this effective approach, we have properly renormalised the effective theory to take them into account. Finally, we perform a comparison of the results in this effective MSSM with those obtained in a much simpler way in the so-called hMSSM approach in which the mass value for the lightest Higgs boson Mh = 125 GeV is used as an input. We show that the hMSSM provides a reasonably good approximation of the corrected self-couplings and H → hh decay rate and, hence, it can be used also in these cases.

  3. Terminal Area Forecasts, FY 1993-2005

    Science.gov (United States)

    1993-07-01

    4 6 0 H -4 ~ M 0~) mo~io oo o o moo- ~ ~ 7~I~~ HHHHH HHHH H H HHHHHH H H C~6HHHHHHH- HHHH H H 0 I Iv En 6O 01~0 0 0HH H HH H H H0 HHHNHHHH 0H0H H H Ci...OD o IWWWn W 0no-D A % MMH NM ww H mo 1-4IHr- i14 4H - ’ H~~ H. HOHOHHH 444 HHH N H r, In~o- v v𔃺wr, - - C4~~4CC( C44Ce (4 C4C M4 C NMVMV NNNm HHHHHH ...HHHH H ei I ~ u~o- O~0H a)I 4 HHHHHH HHHH r-4 Nl H xmoHmm virewee o In HHnw Hwm0H HHH H HnW 0 H 0C4lHO 1HH H HM M M MMMMO 0 0 0 0 4HHHH-OHHHHHN N

  4. Cooperation between catalytic and DNA binding domains enhances thermostability and supports DNA synthesis at higher temperatures by thermostable DNA polymerases.

    Science.gov (United States)

    Pavlov, Andrey R; Pavlova, Nadejda V; Kozyavkin, Sergei A; Slesarev, Alexei I

    2012-03-13

    We have previously introduced a general kinetic approach for comparative study of processivity, thermostability, and resistance to inhibitors of DNA polymerases [Pavlov, A. R., et al. (2002) Proc. Natl. Acad. Sci. U.S.A.99, 13510-13515]. The proposed method was successfully applied to characterize hybrid DNA polymerases created by fusing catalytic DNA polymerase domains with various sequence-nonspecific DNA binding domains. Here we use the developed kinetic analysis to assess basic parameters of DNA elongation by DNA polymerases and to further study the interdomain interactions in both previously constructed and new chimeric DNA polymerases. We show that connecting helix-hairpin-helix (HhH) domains to catalytic polymerase domains can increase thermostability, not only of DNA polymerases from extremely thermophilic species but also of the enzyme from a faculatative thermophilic bacterium Bacillus stearothermophilus. We also demonstrate that addition of Topo V HhH domains extends efficient DNA synthesis by chimerical polymerases up to 105 °C by maintaining processivity of DNA synthesis at high temperatures. We found that reversible high-temperature structural transitions in DNA polymerases decrease the rates of binding of these enzymes to the templates. Furthermore, activation energies and pre-exponential factors of the Arrhenius equation suggest that the mechanism of electrostatic enhancement of diffusion-controlled association plays a minor role in binding of templates to DNA polymerases.

  5. Cooperation between Catalytic and DNA-binding Domains Enhances Thermostability and Supports DNA Synthesis at Higher Temperatures by Thermostable DNA Polymerases

    Science.gov (United States)

    Pavlov, Andrey R.; Pavlova, Nadejda V.; Kozyavkin, Sergei A.; Slesarev, Alexei I.

    2012-01-01

    We have previously introduced a general kinetic approach for comparative study of processivity, thermostability, and resistance to inhibitors of DNA polymerases (Pavlov et. al., (2002) Proc. Natl. Acad. Sci. USA 99, 13510–13515). The proposed method was successfully applied to characterize hybrid DNA polymerases created by fusing catalytic DNA polymerase domains with various non-specific DNA binding domains. Here we use the developed kinetic analysis to assess basic parameters of DNA elongation by DNA polymerases and to further study the interdomain interactions in both previously constructed and new chimeric DNA polymerases. We show that connecting Helix-hairpin-Helix (HhH) domains to catalytic polymerase domains can increase thermostability, not only of DNA polymerases from extremely thermophilic species, but also of the enzyme from a faculatative thermophilic bacterium Bacillus stearothermophilus. We also demonstrate that addition of TopoV HhH domains extends efficient DNA synthesis by chimerical polymerases up to 105°C by maintaining processivity of DNA synthesis at high temperatures. We also found that reversible high-temperature structural transitions in DNA polymerases decrease the rates of binding of these enzymes to the templates. Furthermore, activation energies and pre-exponential factors of the Arrhenius equation suggest that the mechanism of electrostatic enhancement of diffusion-controlled association plays a minor role in binding templates to DNA polymerases. PMID:22320201

  6. Changing man-land interrelations in China's farming area under urbanization and its implications for food security.

    Science.gov (United States)

    Long, Hualou; Ge, Dazhuan; Zhang, Yingnan; Tu, Shuangshuang; Qu, Yi; Ma, Li

    2018-03-01

    The Huang-Huai-Hai Plain (HHH) is typical of China's farming area, and was predicted as one of the fastest growing areas of urbanization in the world. Since the turn of the new millennium, construction land and farmland transitions in this region driven by rapid urbanization have resulted in dramatic loss of farmland, which triggered a serious threat to regional even national food security. In this paper, the coupling relationships between per capita construction land transition (PCCT) and per capita farmland transition (PCFT) in the HHH and their implications for regional food security are analyzed. During 2000-2015, the farmland decreased by 8.59%, 72.25% of which were occupied by construction land. There are two major coupling types between PCCT and PCFT, one is the double increasing of per capita construction land area (PCCA) and per capita farmland area (PCFA); another is the increasing of PCCA and the decreasing of PCFA. The fluctuant increasing of PCCT and decreasing of PCFT coexisted and presented symmetrical coupling characteristics in space. Physical, location, transportation and socio-economic factors play significantly different roles in driving PCCT and PCFT. The implications for ensuring food security involve promoting the reclamation and redevelopment of inefficient and unused urban-rural construction land, reducing inefficient occupation of farmland resources, developing appropriate scale management of agriculture, and establishing a better social security system to smoothly settle down the floating rural population in the city. Copyright © 2017 Elsevier Ltd. All rights reserved.

  7. Synchrotron measurement of the 3D shape of X-ray reflections from the {gamma}/{gamma}{sup '}-microstructure of nickel-base superalloys

    Energy Technology Data Exchange (ETDEWEB)

    Epishin, Alexander; Link, Thomas; Ulbricht, Alexander; Bansal, Mamta [Technical Univ. of Berlin (Germany). Inst. of Material Science and Technology; Zizak, Ivo [Helmholtz-Zentrum Berlin for Materials and Energy BESSY II, Berlin (Germany)

    2011-12-15

    The 3D shape of X-ray reflections from the {gamma}/{gamma}{sup '}-microstructure of a nickel-base superalloy was investigated using synchrotron X-ray radiation and a position sensitive area detector. The measurements were performed on the 4{sup th} generation single-crystal nickel-base superalloy TMS138. The results show that X-ray reflections from non-cubic crystallographic planes have a complex 3D shape which changes during rafting. The 3D intensity distributions contain information about the spacing of the planes and their orientation as well. Whereas h00 reflections show the usual splitting into a {gamma}{sup '} and one {gamma}-subreflection, the hh0 and hhh reflections show two and three {gamma}-peaks respectively, resulting from the different types of {l_brace}100{r_brace} matrix channels. Therefore, these 3D diffraction measurements supply additional information about the spatial distribution of microstrains. (orig.)

  8. Calculations of multi-particle processes at the one-loop level: precise predictions for the LHC

    International Nuclear Information System (INIS)

    Karg, Stefan

    2007-01-01

    We present a calculation of the loop-induced processes gg→HH and gg→HHH, and investigate the observability of multi-Higgs boson production at the LHC in the Standard Model and beyond. While the SM cross sections are too small to allow observation at the LHC, we demonstrate that physics beyond the SM can lead to amplified, observable cross sections. Furthermore, the applicability of the heavy top quark approximation in two- and three-Higgs boson production is investigated. The calculation of the process PP→VV+jet at NLO is an important background process to Higgs production in association with a jet at the LHC. We compute the virtual corrections to this process which form the ''bottleneck'' for obtaining a complete NLO prediction. The resulting analytic expressions are generated with highly automated computer routines and translated into a flexible Fortran code, which can be employed in the computation of differential cross sections of phenomenological interest. (orig.)

  9. CARE07 Coordinated Accelerator Research in Europe

    CERN Multimedia

    2007-01-01

    Annual Meeting, at CERN, 29-31 October 2007 The CARE project started on 1st January 2004 and will end on 31st December 2008. At the end of each year, the progress and status of its activities are reported in a general meeting. This year, the meeting takes place at CERN. The CARE objective is to generate structured and integrated European cooperation in the field of accelerator research and related R&D. The programme includes the most advanced scientific and technological developments, relevant to accelerator research for particle physics. It is articulated around three Networking Activities and four Joint Activities. The Networking Activities ELAN, BENE and HHH aim to better coordinate R&D efforts at the European level and to strengthen Europe’s ability to produce intense and high-energy particle beams (electrons and positrons, muons and neutrinos, protons and ions, respectively). The Joint Activities, SRF, PHIN, HIPPI and NED, aim at technical developments on s...

  10. CARE07 Coordinated Accelerator Research in Europe

    CERN Multimedia

    2007-01-01

    Annual Meeting, at CERN, 29-31 October 2007 The CARE project started on 1st January 2004 and will end on 31st December 2008. At the end of each year, the progress and status of its activities are reported in a general meeting. This year, the meeting is taking place at CERN. The CARE objective is to generate structured and integrated European cooperation in the field of accelerator research and related R&D. The programme includes the most advanced scientific and technological developments, relevant to accelerator research for particle physics. It is articulated around three Networking Activities and four Joint Activities. The Networking Activities ELAN, BENE and HHH aim to better coordinate R&D efforts at the European level and to strengthen Europe’s ability to produce intense and high-energy particle beams (electrons and positrons, muons and neutrinos, protons and ions, respectively). The Joint Activities, SRF, PHIN, HIPPI and NED, aim at technical developments ...

  11. Probing anomalous couplings using di-Higgs production in electron–proton collisions

    Directory of Open Access Journals (Sweden)

    Mukesh Kumar

    2017-01-01

    Full Text Available A proposed high energy Future Circular Hadron-Electron Collider would provide sufficient energy in a clean environment to probe di-Higgs production. Using this channel we show that the azimuthal angle correlation between the missing transverse energy and the forward jet is a very good probe for the non-standard hhh and hhWW couplings. We give the exclusion limits on these couplings as a function of integrated luminosity at a 95% C.L. using the fiducial cross sections. With appropriate error fitting methodology we find that the Higgs boson self coupling could be measured to be ghhh(1=1.00−0.17(0.12+0.24(0.14 of its expected Standard Model value at s=3.5(5.0 TeV for an ultimate 10 ab−1 of integrated luminosity.

  12. The Higgs vacuum uplifted. Revisiting the electroweak phase transition with a second Higgs doublet

    Energy Technology Data Exchange (ETDEWEB)

    Dorsch, G.C. [Deutsches Elektronen-Synchrotron (DESY), Hamburg (Germany); Huber, S.J. [Sussex Univ., Brighton (United Kingdom). Dept. of Physics and Astronomy; Mimasu, K. [Sussex Univ., Brighton (United Kingdom). Dept. of Physics and Astronomy; Louvain Univ. Catholique, Louvain-la-Neuve (Belgium). Center for Cosmology, Particle Physics and Phenomenology; No, J.M. [King' s College, London (United Kingdom). Dept. of Physics; Sussex Univ., Brighton (United Kingdom). Dept. of Physics and Astronomy

    2017-05-25

    The existence of a second Higgs doublet in Nature could lead to a cosmological first order electroweak phase transition and explain the origin of the matter-antimatter asymmetry in the Universe. We explore the parameter space of such a two-Higgs-doublet-model and show that a first order electroweak phase transition strongly correlates with a significant uplifting of the Higgs vacuum w.r.t. its Standard Model value. We then obtain the spectrum and properties of the new scalars H{sub 0}, A{sub 0} and H{sup ±} that signal such a phase transition, showing that the decay A{sub 0}→H{sub 0}Z at the LHC and a sizable deviation in the Higgs self-coupling λ{sub hhh} from its SM value are sensitive indicators of a strongly first order electroweak phase transition in the 2HDM.

  13. Survey of Foods to Improve Logistic Support and Extend Mission Endurance of Submarines

    Science.gov (United States)

    1981-12-01

    OrfiioKiM-<njrvj(Mio»o , jj o o 3 I * » X 30333-*HHHH-< HHHHHH ^l|rl|K1J.l|^ IJ V _! OvJ iM -• <\\ t\\ >- < <’JH J/IOJSH’J J £ <v <o (M...3x»N""»"""io«"io»x»<ij»po»"""ioiO""ir>"""H""<\\i-"-"»"Oj""""fij«"Cij-"»"<\\jcij-"<\\jio*"io»"«"»"Ki»0""p"> loooooooHHH-Hrt- HHHHHH

  14. General/Flag Officer Worldwide Roster, December 1986

    Science.gov (United States)

    1986-12-01

    H O t- ON O o O H 00 H J" 00 00 00 cO H ON O ^r CO t>*- in ITN o o o O vH NO VD vo ^t CO CO CO CO 8 S § § o HHHHHH ^HHHH OOOOOOOOOOO...8 e § u. OS r.% ̂ l^J^,^^ a üJ H (0 O DC UJ a i D -I a O $ a UJ ü o -J < cc UJ z UJ o 8 HHHHHH <MHHr-»r-(HHH...4h-HN r4 r4 r4 T4 CM H O O OOOO o o CM <n t- H o m H H H O O H H O lT\\\\f\\)0 CM CO CO CO CO \\0 CM H H CO 00 CO GO HHHHHH -SON-H OOOOOOCMHHO

  15. Workshop on Accelerator Magnet Superconductors, Design and Optimization

    CERN Document Server

    WAMSDO Workshop

    2009-01-01

    This report contains the proceedings of the CARE-HHH-AMT Workshop on Accelerator Magnet Superconductors, Design and Optimization (WAMSDO) held at CERN from 19 to 23 May 2008. The needs in terms of superconducting magnets for the accelerator projects were discussed, mainly for the LHC interaction regions and injector upgrades, and for the GSI FAIR complex. The first part of the workshop focused on the development of superconductor and cables, i.e., low-loss Nb-Ti cables, Nb$_{3}$Sn and high-temperature superconductors. An industry session summarized the actual plans and status of the activities in the main European industries. Then, a worldwide status of the high field magnets programme was presented. A special session was devoted to fast cycled magnets, including FAIR facilities and LHC injector upgrades. A final session focused on the optimization methods and numerical tools for magnet design.

  16. Effect of Thickener and Gasoline Quality on the Properties of Napalm Fuels

    Science.gov (United States)

    1945-01-01

    6 ’ So H S3 lOCDCCtDOnroO) )««0 0)<E«DO «Hf-IG)IQ|Q0l*-<OO«[> P"iS OOONQHC O «3 IO HHO ’ »O «TOO «XOHCOOilNHIOIOOOIOC- 1’ 01 CD...OOO0JC0O’OCDtf> Cpl0rHl0*OtQlGDtH£CUO>Q O^CUi-KO .O »tOO» »on feCDOl HH(«niQ9 »HHH(0 HHO « I l«KJB* ©HN«(Dlf^V®Ct

  17. GIS-measured walkability, transit, and recreation environments in relation to older Adults' physical activity: A latent profile analysis.

    Science.gov (United States)

    Todd, Michael; Adams, Marc A; Kurka, Jonathan; Conway, Terry L; Cain, Kelli L; Buman, Matthew P; Frank, Lawrence D; Sallis, James F; King, Abby C

    2016-12-01

    An infrequently studied question is how diverse combinations of built environment (BE) features relate to physical activity (PA) for older adults. We derived patterns of geographic information systems- (GIS) measured BE features and explored how they accounted for differences in objective and self-reported PA, sedentary time, and BMI in a sample of older adults. Senior Neighborhood Quality of Life Study participants (N=714, aged 66-97years, 52.1% women, 29.7% racial/ethnic minority) were sampled in 2005-2008 from the Seattle-King County, WA and Baltimore, MD-Washington, DC regions. Participants' home addresses were geocoded, and net residential density, land use mix, retail floor area ratio, intersection density, public transit density, and public park and private recreation facility density measures for 1-km network buffers were derived. Latent profile analyses (LPAs) were estimated from these GIS-based measures. In multilevel regression models, profiles were compared on accelerometer-measured moderate-to-vigorous PA (MVPA) and sedentary time and self-reported PA, adjusting for covariates and clustering. Analyses were conducted in 2014-2015. LPAs yielded three profiles: low walkability/transit/recreation (L-L-L); mean walkability/transit/recreation (M-M-M); and high walkability/transit/recreation (H-H-H). Three PA outcomes were more favorable in the HHH than the LLL profile group (difference of 7.2min/day for MVPA, 97.8min/week for walking for errands, and 79.2min/week for walking for exercise; all pswalkability index, suggesting that diverse BE features are important for healthy aging. Copyright © 2016 Elsevier Inc. All rights reserved.

  18. Patterns of Walkability, Transit, and Recreation Environment for Physical Activity.

    Science.gov (United States)

    Adams, Marc A; Todd, Michael; Kurka, Jonathan; Conway, Terry L; Cain, Kelli L; Frank, Lawrence D; Sallis, James F

    2015-12-01

    Diverse combinations of built environment (BE) features for physical activity (PA) are understudied. This study explored whether patterns of GIS-derived BE features explained objective and self-reported PA, sedentary behavior, and BMI. Neighborhood Quality of Life Study participants (N=2,199, aged 20-65 years, 48.2% female, 26% ethnic minority) were sampled in 2001-2005 from Seattle / King County WA and Baltimore MD / Washington DC regions. Their addresses were geocoded to compute net residential density, land use mix, retail floor area ratio, intersection density, public transit, and public park and private recreation facility densities using a 1-km network buffer. Latent profile analyses (LPAs) were estimated from these variables. Multilevel regression models compared profiles on accelerometer-measured moderate to vigorous PA (MVPA) and self-reported PA, adjusting for covariates and clustering. Analyses were conducted in 2013-2014. Seattle region LPAs yielded four profiles, including low walkability/transit/recreation (L-L-L); mean walkability/transit/recreation (M-M-M); moderately high walkability/transit/recreation (MH-MH-MH); and high walkability/transit/recreation (H-HH). All measures were higher in the HHH than the LLL profile (difference of 17.1 minutes/day for MVPA, 146.5 minutes/week for walking for transportation, 58.2 minutes/week for leisure-time PA, and 2.2 BMI points; all pwalkability index. Copyright © 2015 American Journal of Preventive Medicine. Published by Elsevier Inc. All rights reserved.

  19. Comorbid trajectories of substance use as predictors of Antisocial Personality Disorder, Major Depressive Episode, and Generalized Anxiety Disorder.

    Science.gov (United States)

    Brook, Judith S; Zhang, Chenshu; Rubenstone, Elizabeth; Primack, Brian A; Brook, David W

    2016-11-01

    To determine longitudinal associations between patterns of comorbid cigarette, alcohol, and marijuana use and Antisocial Personality Disorder (ASPD), Major Depressive Episode (MDE), and Generalized Anxiety Disorder (GAD) in adulthood. A random community-based sample [X̅ age=36.6 (SD=2.8)] from the Children and Adults in the Community Study, an on-going investigation of substance use and psychiatric disorders. Data were collected at six time waves. Conjoint trajectories of cigarette, alcohol, and marijuana use spanning adolescence to adulthood were determined; multivariable logistic regression analyses assessed associations between trajectory group membership and having ASPD, MDE, or GAD in adulthood. Five conjoint trajectory groups were obtained: HHH (chronic cigarette, alcohol, and marijuana use), DDD (delayed/late-starting cigarette, alcohol, and marijuana use), LML (low/no smoking, moderate alcohol use, occasional marijuana use), HMN (chronic smoking, moderate alcohol use, no marijuana use), and NON (occasional alcohol use only). Compared with members of the NON group, those in the HHH group had significantly greater odds for having ASPD (Adjusted Odds Ratio [AOR]=28.52, 95% Confidence Interval [CI]=9.44-86.17), MDE (AOR=2.67, 95% CI=1.14-6.26), and GAD (AOR=6.39, 95% CI=2.62-15.56). Members of the DDD, LML, and HMN groups had weaker and less consistent associations with the three psychiatric outcomes. In a large, community-based sample, long-term concurrent use of more than one substance was associated with both externalizing and internalizing psychiatric disorders in adulthood. Prevention and treatment programs might target individuals in the community and general clinical populations with comorbid substance use, even if they haven't been identified as having a substance use disorder. Copyright © 2016 Elsevier Ltd. All rights reserved.

  20. One-loop radiative correction to the triple Higgs coupling in the Higgs singlet model

    Directory of Open Access Journals (Sweden)

    Shi-Ping He

    2017-01-01

    Full Text Available Though the 125 GeV Higgs boson is consistent with the standard model (SM prediction until now, the triple Higgs coupling can deviate from the SM value in the physics beyond the SM (BSM. In this paper, the radiative correction to the triple Higgs coupling is calculated in the minimal extension of the SM by adding a real gauge singlet scalar. In this model there are two scalars h and H and both of them are mixing states of the doublet and singlet. Provided that the mixing angle is set to be zero, namely the SM limit, h is the pure left-over of the doublet and its behavior is the same as that of the SM at the tree level. However the loop corrections can alter h-related couplings. In this SM limit case, the effect of the singlet H may show up in the h-related couplings, especially the triple h coupling. Our numerical results show that the deviation is sizable. For λΦS=1 (see text for the parameter definition, the deviation δhhh(1 can be 40%. For λΦS=1.5, the δhhh(1 can reach 140%. The sizable radiative correction is mainly caused by three reasons: the magnitude of the coupling λΦS, light mass of the additional scalar and the threshold enhancement. The radiative corrections for the hVV, hff couplings are from the counter-terms, which are the universal correction in this model and always at O(1%. The hZZ coupling, which can be precisely measured, may be a complementarity to the triple h coupling to search for the BSM. In the optimal case, the triple h coupling is very sensitive to the BSM physics, and this model can be tested at future high luminosity hadron colliders and electron–positron colliders.

  1. What Factors Affect Voluntary Uptake of Community-Based Health Insurance Schemes in Low- and Middle-Income Countries? A Systematic Review and Meta-Analysis.

    Directory of Open Access Journals (Sweden)

    David Mark Dror

    Full Text Available This research article reports on factors influencing initial voluntary uptake of community-based health insurance (CBHI schemes in low- and middle-income countries (LMIC, and renewal decisions.Following PRISMA protocol, we conducted a comprehensive search of academic and gray literature, including academic databases in social science, economics and medical sciences (e.g., Econlit, Global health, Medline, Proquest and other electronic resources (e.g., Eldis and Google scholar. Search strategies were developed using the thesaurus or index terms (e.g., MeSH specific to the databases, combined with free text terms related to CBHI or health insurance. Searches were conducted from May 2013 to November 2013 in English, French, German, and Spanish. From the initial search yield of 15,770 hits, 54 relevant studies were retained for analysis of factors influencing enrolment and renewal decisions. The quantitative synthesis (informed by meta-analysis and the qualitative analysis (informed by thematic synthesis were compared to gain insight for an overall synthesis of findings/statements.Meta-analysis suggests that enrolments in CBHI were positively associated with household income, education and age of the household head (HHH, household size, female-headed household, married HHH and chronic illness episodes in the household. The thematic synthesis suggests the following factors as enablers for enrolment: (a knowledge and understanding of insurance and CBHI, (b quality of healthcare, (c trust in scheme management. Factors found to be barriers to enrolment include: (a inappropriate benefits package, (b cultural beliefs, (c affordability, (d distance to healthcare facility, (e lack of adequate legal and policy frameworks to support CBHI, and (f stringent rules of some CBHI schemes. HHH education, household size and trust in the scheme management were positively associated with member renewal decisions. Other motivators were: (a knowledge and understanding of

  2. Neutron scattering investigations of frustated magnets

    Science.gov (United States)

    Fennell, Tom

    This thesis describes the experimental investigation of frustrated magnetic systems based on the pyrochlore lattice of corner-sharing tetrahedra. Ho2Ti207 and Dy2Ti207 are examples of spin ices, in which the manifold of disordered magnetic groundstates maps onto that of the proton positions in ice. Using single crystal neutron scattering to measure Bragg and diffuse scattering, the effect of applying magnetic fields along different directions in the crystal was investigated. Different schemes of degeneracy removal were observed for different directions. Long and short range order, and the coexistence of both could be observed by this technique.The field and temperature dependence of magnetic ordering was studied in Ho2Ti207 and Dy2Ti207. Ho2Ti2()7 has been more extensively investigated. The field was applied on [00l], [hh0], [hhh] and [hh2h]. Dy2Ti207 was studied with the field applied on [00l] and [hho] but more detailed information about the evolution of the scattering pattern across a large area of reciprocal space was obtained.With the field applied on [00l] both materials showed complete degeneracy removal. A long range ordered structure was formed. Any magnetic diffuse scattering vanished and was entirely replaced by strong magnetic Bragg scattering. At T =0.05 K both materials show unusual magnetization curves, with a prominent step and hysteresis. This was attributed to the extremely slow dynamics of spin ice materials at this temperature.Both materials were studied in greatest detail with the field applied on [hh0]. The coexistence of long and short range order was observed when the field was raised at T = 0.05 K. The application of a field in this direction separated the spin system into two populations. One could be ordered by the field, and one remained disordered. However, via spin-spin interactions, the field restricted the degeneracy of the disordered spin population. The neutron scattering pattern of Dy2Ti207 shows that the spin system was separated

  3. What Factors Affect Voluntary Uptake of Community-Based Health Insurance Schemes in Low- and Middle-Income Countries? A Systematic Review and Meta-Analysis

    Science.gov (United States)

    Hossain, S. A. Shahed; Pérez Koehlmoos, Tracey Lynn; John, Denny

    2016-01-01

    Introduction This research article reports on factors influencing initial voluntary uptake of community-based health insurance (CBHI) schemes in low- and middle-income countries (LMIC), and renewal decisions. Methods Following PRISMA protocol, we conducted a comprehensive search of academic and gray literature, including academic databases in social science, economics and medical sciences (e.g., Econlit, Global health, Medline, Proquest) and other electronic resources (e.g., Eldis and Google scholar). Search strategies were developed using the thesaurus or index terms (e.g., MeSH) specific to the databases, combined with free text terms related to CBHI or health insurance. Searches were conducted from May 2013 to November 2013 in English, French, German, and Spanish. From the initial search yield of 15,770 hits, 54 relevant studies were retained for analysis of factors influencing enrolment and renewal decisions. The quantitative synthesis (informed by meta-analysis) and the qualitative analysis (informed by thematic synthesis) were compared to gain insight for an overall synthesis of findings/statements. Results Meta-analysis suggests that enrolments in CBHI were positively associated with household income, education and age of the household head (HHH), household size, female-headed household, married HHH and chronic illness episodes in the household. The thematic synthesis suggests the following factors as enablers for enrolment: (a) knowledge and understanding of insurance and CBHI, (b) quality of healthcare, (c) trust in scheme management. Factors found to be barriers to enrolment include: (a) inappropriate benefits package, (b) cultural beliefs, (c) affordability, (d) distance to healthcare facility, (e) lack of adequate legal and policy frameworks to support CBHI, and (f) stringent rules of some CBHI schemes. HHH education, household size and trust in the scheme management were positively associated with member renewal decisions. Other motivators were: (a

  4. Mammary sensitivity to protein restriction and re-alimentation.

    Science.gov (United States)

    Goodwill, M G; Jessop, N S; Oldham, J D

    1996-09-01

    The present study tested the influence of protein undernutrition and re-alimentation on mammary gland size and secretory cell activity in lactating rats. During gestation, female Sprague-Dawley rats were offered a high-protein diet (215 g crude protein (N x 6.25; CP)/kg DM; H); litters were standardized to twelve pups at parturition. During lactation, two diets were offered ad libitum, diet H and a low-protein diet (90 g CP/kg DM; L). Lactational dietary treatments were the supply ad libitum of either diet H (HHH) or diet L (LLL) for the first 12 d of lactation, or diet L transferring to diet H on either day 6 (LHH) or 9 (LLH) of lactation. On days 1, 6, 9 and 12 of lactation, rats from each group (n > or = 6) were used to estimate mammary dry mass, fat, protein, DNA and RNA; the activities of lactose synthetase (EC 2.4.1.22) enzyme and Na+,K(+)-ATPase (EC 3.6.1.37) were also measured. Rats offered a diet considered protein sufficient (H) from day 1 of lactation showed a decrease in mammary dry mass and fat but an increase in DNA, RNA and protein on day 6, after which there was no further change, except for mammary protein which continued to increase. However, rats offered diet L showed a steady loss in mammary mass and fat throughout the 12 d lactation period and no change in mammary DNA, RNA or protein. Rats previously protein restricted for either the first 6 or 9 d of lactation had their mammary dry mass and mammary fat loss halted and showed a rapid increase in mammary DNA, RNA and protein on re-alimentation. Lactose production in group HHH, as measured by lactose synthetase activity, was similar on days 1 and 6 of lactation, after which a significant increase was seen. Protein-restricted rats showed no change in lactose synthetase activity during the 12 d experimental period. Changing from diet L to diet H led to a significant increase in lactose synthetase activity to levels comparable with those offered diet H from day 1. These results show that rats

  5. Special structures and properties of hydrogen nanowire confined in a single walled carbon nanotube at extreme high pressure

    Directory of Open Access Journals (Sweden)

    Yueyuan Xia

    2012-06-01

    Full Text Available Extensive ab initio molecular dynamics simulations indicate that hydrogen can be confined in single walled carbon nanotubes to form high density and high pressure H2 molecular lattice, which has peculiar shell and axial structures depending on the density or pressure. The band gap of the confined H2 lattice is sensitive to the pressure. Heating the system at 2000K, the H2 lattice is firstly melted to form H2 molecular liquid, and then some of the H2 molecules dissociate accompanied by drastic molecular and atomic reactions, which have essential effect on the electronic structure of the hydrogen system. The liquid hydrogen system at 2000K is found to be a particular mixed liquid, which consists of H2 molecules, H atoms, and H-H-H trimers. The dissociated H atoms and the trimers in the liquid contribute resonance electron states at the Fermi energy to change the material properties substantially. Rapidly cooling the system from 2000K to 0.01 K, the mixed liquid is frozen to form a mixed solid melt with a clear trend of band gap closure. It indicates that this solid melt may become a superconducting nanowire when it is further compressed.

  6. Scenarios for the LHC Upgrade

    CERN Document Server

    Scandale, Walter

    2008-01-01

    The projected lifetime of the LHC low-beta quadrupoles, the evolution of the statistical error halving time, and the physics potential all call for an LHC luminosity upgrade by the middle of the coming decade. In the framework of the CARE-HHH network three principal scenarios have been developed for increasing the LHC peak luminosity by more than a factor of 10, to values above 1035 cm−2s−1. All scenarios imply a rebuilding of the high-luminosity interaction regions (IRs) in combination with a consistent change of beam parameters. However, their respective features, bunch structures, IR layouts, merits and challenges, and luminosity variation with β∗ differ substantially. In all scenarios luminosity leveling during a store would be advantageous for the physics experiments. An injector upgrade must complement the upgrade measures in the LHC proper in order to provide the beam intensity and brightness needed as well as to reduce the LHC turnaround time for higher integrated luminosity.

  7. High-pressure structure of Pb-based relaxor ferroelectrics

    Energy Technology Data Exchange (ETDEWEB)

    Maier, Bernd J.; Mihailova, Boriana; Paulmann, Carsten; Welsch, Anna-Maria; Bismayer, Ulrich [Mineralogisch-Petrographisches Institut, Universitaet Hamburg (Germany); Angel, Ross J. [Crystallography Laboratory, Virgina Tech, Blacksburg (United States); Marshall, William G. [ISIS Neutron Facility, STFC Rutherford Appleton Laboratory, Chilton, Didcot, Oxon (United Kingdom); Engel, Jens M. [Institut fuer Werkstoffwissenschaft, Technische Universitaet Dresden (Germany); Gospodinov, Marin [Institute of Solid State Physics, Bulgarian Academy of Sciences, Sofia (Bulgaria); Petrova, Dimitrina [Institute of Solid State Physics, Bulgarian Academy of Sciences, Sofia (Bulgaria); South-West University Neofit Rilski, Blagoevgrad (Bulgaria)

    2010-07-01

    The pressure-induced phase transitions that occur in the perovskite-type relaxor ferroelectric PbSc{sub 0.5}Ta{sub 0.5}O{sub 3} (PST) and Pb{sub 0.78}Ba{sub 0.22}Sc{sub 0.5}Ta{sub 0.5}O{sub 3} (PST-Ba) were studied with combined neutron powder diffraction and single-crystal X-ray diffraction. An increase in the intensities of h,k,l=all odd reflections is observed while the intensity of h,h,h peaks, h=2n+1, does not change with pressure, indicating a glide-plane pseudo-symmetry of the structural distortion along the left angle 111 right angle cubic directions. Rietveld refinement to the neutron powder data shows that the high-pressure phase has either R anti 3c or R anti 3 symmetry, depending on whether the presence of 1:1 octahedral cation ordering is neglected or taken into account, and comprises anti-phase octahedral tilts of type a{sup -}a{sup -}a{sup -} that continuously evolve with pressure.

  8. CARE05 coordinated accelerator research in Europe

    CERN Multimedia

    2005-01-01

    Annual Meeting at CERN, 23-25 November 2005 CARE started on 1st January 2004 and will last for five years. At the end of each year it holds a general meeting to report on the progress and status of its activities. This year, the CARE annual meeting is taking place at CERN The objective of the CARE project is to generate structured and integrated European cooperation in the field of accelerator research and related R&D. The program includes the most advanced scientific and technological developments, relevant to accelerator research for Particle Physics. It is articulated around three Networking Activities and four Joint Activities. The Networking Activities ELAN, BENE and HHH aim to better coordinate R&D efforts at the European level and to strengthen Europe's ability to evaluate and develop methods of producing intense and high energy beams of electrons, protons, muons and neutrinos. These activities are embedded in world-wide efforts towards future e+e- linear colliders, superior neutrino beam fa...

  9. Coronary Arteries Segmentation Based on the 3D Discrete Wavelet Transform and 3D Neutrosophic Transform

    Directory of Open Access Journals (Sweden)

    Shuo-Tsung Chen

    2015-01-01

    Full Text Available Purpose. Most applications in the field of medical image processing require precise estimation. To improve the accuracy of segmentation, this study aimed to propose a novel segmentation method for coronary arteries to allow for the automatic and accurate detection of coronary pathologies. Methods. The proposed segmentation method included 2 parts. First, 3D region growing was applied to give the initial segmentation of coronary arteries. Next, the location of vessel information, HHH subband coefficients of the 3D DWT, was detected by the proposed vessel-texture discrimination algorithm. Based on the initial segmentation, 3D DWT integrated with the 3D neutrosophic transformation could accurately detect the coronary arteries. Results. Each subbranch of the segmented coronary arteries was segmented correctly by the proposed method. The obtained results are compared with those ground truth values obtained from the commercial software from GE Healthcare and the level-set method proposed by Yang et al., 2007. Results indicate that the proposed method is better in terms of efficiency analyzed. Conclusion. Based on the initial segmentation of coronary arteries obtained from 3D region growing, one-level 3D DWT and 3D neutrosophic transformation can be applied to detect coronary pathologies accurately.

  10. Coronary arteries segmentation based on the 3D discrete wavelet transform and 3D neutrosophic transform.

    Science.gov (United States)

    Chen, Shuo-Tsung; Wang, Tzung-Dau; Lee, Wen-Jeng; Huang, Tsai-Wei; Hung, Pei-Kai; Wei, Cheng-Yu; Chen, Chung-Ming; Kung, Woon-Man

    2015-01-01

    Most applications in the field of medical image processing require precise estimation. To improve the accuracy of segmentation, this study aimed to propose a novel segmentation method for coronary arteries to allow for the automatic and accurate detection of coronary pathologies. The proposed segmentation method included 2 parts. First, 3D region growing was applied to give the initial segmentation of coronary arteries. Next, the location of vessel information, HHH subband coefficients of the 3D DWT, was detected by the proposed vessel-texture discrimination algorithm. Based on the initial segmentation, 3D DWT integrated with the 3D neutrosophic transformation could accurately detect the coronary arteries. Each subbranch of the segmented coronary arteries was segmented correctly by the proposed method. The obtained results are compared with those ground truth values obtained from the commercial software from GE Healthcare and the level-set method proposed by Yang et al., 2007. Results indicate that the proposed method is better in terms of efficiency analyzed. Based on the initial segmentation of coronary arteries obtained from 3D region growing, one-level 3D DWT and 3D neutrosophic transformation can be applied to detect coronary pathologies accurately.

  11. A study of the picostructure of sputtered ZrN films

    International Nuclear Information System (INIS)

    Perry, A.J.; Schaffer, J.P.; Brunner, J.; Sproul, W.D.

    1991-01-01

    Stoichiometric zirconium nitride films deposited onto cemented carbide and stainless steel substrates as a function of the applied substrate bias were studied by X-ray diffraction (XRD Bragg-Brentano goniometer) and positron annihilation spectroscopy (PAS). Microhardness and color measurements were also carried out. The results at low bias levels show that the crystal lattice has no deviant behavior in the strain distribution or lattice parameters; such differences which are observed in the latter are due to the X-ray elastic constants. Shear stresses are found on the (h00) family of planes and probably on the (hhh) family at bias levels more negative than -70 V. The microhardness and residual stress are then constant. The PAS data indicate that the vacancy defect fraction is below the limit of detection at bias levels less negative than approximately -80 V; a low concentration of vacancies exists at more negative bias values. The color of the films is not affected by the bias applied during deposition, and is only slightly affected by annealing when deposited at low bias values. In view of the change in lattice parameters on annealing, it is concluded that the results do not correspond with those expected from the simple ionic model. (orig.)

  12. Radiative corrections to the triple Higgs coupling in the inert Higgs doublet model

    International Nuclear Information System (INIS)

    Arhrib, Abdesslam; Benbrik, Rachid; Falaki, Jaouad El; Jueid, Adil

    2015-01-01

    We investigate the implication of the recent discovery of a Higgs-like particle in the first phase of the LHC Run 1 on the Inert Higgs Doublet Model (IHDM). The determination of the Higgs couplings to SM particles and its intrinsic properties will get improved during the new LHC Run 2 starting this year. The new LHC Run 2 would also shade some light on the triple Higgs coupling. Such measurement is very important in order to establish the details of the electroweak symmetry breaking mechanism. Given the importance of the Higgs couplings both at the LHC and e + e − Linear Collider machines, accurate theoretical predictions are required. We study the radiative corrections to the triple Higgs coupling hhh and to hZZ, hWW couplings in the context of the IHDM. By combining several theoretical and experimental constraints on parameter space, we show that extra particles might modify the triple Higgs coupling near threshold regions. Finally, we discuss the effect of these corrections on the double Higgs production signal at the e + e − LC and show that they can be rather important.

  13. Radiative corrections to the Higgs couplings in the triplet model

    International Nuclear Information System (INIS)

    KIKUCHI, M.

    2014-01-01

    The feature of extended Higgs models can appear in the pattern of deviations from the Standard Model (SM) predictions in coupling constants of the SM-like Higgs boson (h). We can thus discriminate extended Higgs models by precisely measuring the pattern of deviations in the coupling constants of h, even when extra bosons are not found directly. In order to compare the theoretical predictions to the future precision data at the ILC, we must evaluate the theoretical predictions with radiative corrections in various extended Higgs models. In this paper, we give our comprehensive study for radiative corrections to various Higgs boson couplings of h in the minimal Higgs triplet model (HTM). First, we define renormalization conditions in the model, and we calculate the Higgs coupling; gγγ, hWW, hZZ and hhh at the one loop level. We then evaluate deviations in coupling constants of the SM-like Higgs boson from the predictions in the SM. We find that one-loop contributions to these couplings are substantial as compared to their expected measurement accuracies at the ILC. Therefore the HTM has a possibility to be distinguished from the other models by comparing the pattern of deviations in the Higgs boson couplings.

  14. Evaluation of halothane as stressor agent in poultry / Avaliação do halotano como agente estressor em frangos

    Directory of Open Access Journals (Sweden)

    Massami Shimokomaki

    2010-07-01

    Full Text Available Studies have been demonstrating in poultry, the existence of at least two causes for the formation of PSE meat: genetic through the sensibility towards halothane and the environmental factor in particular the temperature as the main factor. Thus the objective of this work was to evaluate halothane as stressor agent for broiler concomitantly to evaluating the PSE incidence by submitting these birds to thermal stress. In this experiment, 24 broilers of commercial lineage were divided in 6 animals for 4 treatments: HHH, broilers submitted to halothane test and slaughtered 1h after this test; HET broilers submitted to halothane at 35°C/1h after 48h of halothane test followed by the birds slaughtering; EET, broilers submitted to thermal stress and slaughtered immediately after this treatment, and finally the control treatment (CCC where broilers were not submitted to halothane test nor to thermal stress as control. The initial pH of Pectoralis major m, was evaluated 30 min post mortem and the pH final, color, (L*, a*, b* water holding capacity (WHC, and R value analysis were carried out after 24h of storage of fillet samples at 40C. The pH24h was higher (p ? 0.05 for CCC samples in comparison to other treatments and R value was higher for birds under HET and EET treatments in comparison to CCC (p ? 0.05 suggesting that the rigor mortis was more rapid in samples from birds submitted to thermal stress. The HHH, HET, and EET treatments presented 4 birds each with PSE meat and 2 broilers from CCC treatment originated PSE meat showing the influence not only halothane but also the thermal stress over broilers welfare. Finally, results demonstrated that halothane is a stressor agent as well as the thermal stress and both promoted dramatic biochemical changes bringing about the formation of broiler PSE meat. Resultados vêm mostrando uma direta relação entre a sensibilidade ao halotano e a ocorrência de filés PSE em aves, que pode ser originado pela

  15. Resistance and Stock Propulsion on the High Speed Sealift (HSS) Hybrid Contra-Rotating Shaft-Pod (HCRSP) Concept, Model 5653-3A

    Science.gov (United States)

    2008-09-01

    34 0N mD " ’ H 0 WMaH MW0WN N m 1-4 ~ ~ ~ Hq H4- 4 4r4 H H H H H mN( OD.D o t-)(~(aHr(arC0~)N(HAa((NLH ri) H 0~~ W-- HHHHHH "HHH(m((N(N m 1-4CC’ C ) LA...34 0000000000000000000000000000 OO OO HH HH HHHHHH iH H r,cl NC14ONmO W. M~ W W WWMWWkD-4IDM V-Wr-M 0WW W -4r- - MM C ; a) 000000000000000000000000000 w N mNwom- o oo0...82174HNO.~O.LflWN(4LAO.OW.4 + 0 - HHHHHHHHH HHHHHH H 00 ~~~~~1 ~ ~ r 0;c A bIDH~.L ~C C 0’ M,IDO r- 0(1 M - H W 0 M* 0 ~H H H H H H4 H 0 MU C AW4W 00 D WV

  16. Threefold rotational symmetry in hexagonally shaped core-shell (In,Ga)As/GaAs nanowires revealed by coherent X-ray diffraction imaging.

    Science.gov (United States)

    Davtyan, Arman; Krause, Thilo; Kriegner, Dominik; Al-Hassan, Ali; Bahrami, Danial; Mostafavi Kashani, Seyed Mohammad; Lewis, Ryan B; Küpers, Hanno; Tahraoui, Abbes; Geelhaar, Lutz; Hanke, Michael; Leake, Steven John; Loffeld, Otmar; Pietsch, Ullrich

    2017-06-01

    Coherent X-ray diffraction imaging at symmetric hhh Bragg reflections was used to resolve the structure of GaAs/In 0.15 Ga 0.85 As/GaAs core-shell-shell nanowires grown on a silicon (111) substrate. Diffraction amplitudes in the vicinity of GaAs 111 and GaAs 333 reflections were used to reconstruct the lost phase information. It is demonstrated that the structure of the core-shell-shell nanowire can be identified by means of phase contrast. Interestingly, it is found that both scattered intensity in the (111) plane and the reconstructed scattering phase show an additional threefold symmetry superimposed with the shape function of the investigated hexagonal nanowires. In order to find the origin of this threefold symmetry, elasticity calculations were performed using the finite element method and subsequent kinematic diffraction simulations. These suggest that a non-hexagonal (In,Ga)As shell covering the hexagonal GaAs core might be responsible for the observation.

  17. Calculations of multi-particle processes at the one-loop level: precise predictions for the LHC

    Energy Technology Data Exchange (ETDEWEB)

    Karg, Stefan

    2007-07-01

    We present a calculation of the loop-induced processes gg{yields}HH and gg{yields}HHH, and investigate the observability of multi-Higgs boson production at the LHC in the Standard Model and beyond. While the SM cross sections are too small to allow observation at the LHC, we demonstrate that physics beyond the SM can lead to amplified, observable cross sections. Furthermore, the applicability of the heavy top quark approximation in two- and three-Higgs boson production is investigated. The calculation of the process PP{yields}VV+jet at NLO is an important background process to Higgs production in association with a jet at the LHC. We compute the virtual corrections to this process which form the ''bottleneck'' for obtaining a complete NLO prediction. The resulting analytic expressions are generated with highly automated computer routines and translated into a flexible Fortran code, which can be employed in the computation of differential cross sections of phenomenological interest. (orig.)

  18. Aminoacidopathies: Prevalence, Etiology, Screening, and Treatment Options.

    Science.gov (United States)

    Wasim, Muhammad; Awan, Fazli Rabbi; Khan, Haq Nawaz; Tawab, Abdul; Iqbal, Mazhar; Ayesha, Hina

    2018-04-01

    Inborn errors of metabolism (IEMs) are a group of inherited metabolic disorders which are caused by mutations in the specific genes that lead to impaired proteins or enzymes production. Different metabolic pathways are perturbed due to the deficiency or lack of enzymes. To date, more than 500 IEMs have been reported with most of them being untreatable. However, fortunately 91 such disorders are potentially treatable, if diagnosed at an earlier stage of life. IEMs have been classified into different categories and one class of IEMs, characterized by the physiological disturbances of amino acids is called as aminoacidopathies. Out of 91 treatable IEM, thirteen disorders are amino acid related. Aminoacidopathies can be detected by chromatography and mass spectrometry based analytical techniques (e.g., HPLC, GC-MS, LC-MS/MS) for amino acid level changes, and through genetic assays (e.g., PCR, TaqMan Genotyping, DNA sequencing) at the mutation level in the corresponding genes. Hence, this review is focused to describe thirteen common aminoacidopathies namely: Phenylketonuria (PKU), Maple Syrup Urine Disease (MSUD), Homocystinuria/Methylene Tetrahydrofolate Reductase (MTHFR) deficiency, Tyrosinemia type II, Citrullinemia type I and type II, Argininosuccinic aciduria, Carbamoyl Phosphate Synthetase I (CPS) deficiency, Argininemia (arginase deficiency), Hyperornithinemia-Hyperammonemia-Homocitrullinuria (HHH) syndrome, N-Acetylglutamate Synthase (NAGS) deficiency, Ornithine Transcarbamylase (OTC) deficiency, and Pyruvate Dehydrogenase (PDH) complex deficiency. Furthermore, the etiology, prevalence and commonly used analytical techniques for screening of aminoacidopathies are briefly described. This information would be helpful to researchers and clinicians especially from developing countries to initiate newborn screening programs for aminoacidopathies.

  19. Higgs particles in the standard model and supersymmetric theories

    International Nuclear Information System (INIS)

    Muehlleitner, M.M.

    2000-08-01

    This thesis presents a theoretical analysis of the properties of the Higgs bosons in the standard model (SM) and the minimal supersymmetric extension (MSSM), which can be investigated at the LHC and e + e - linear colliders. The final goal is the reconstruction of the Higgs potential and thus the verification of the Higgs mechanism. MSSM Higgs boson production processes at future γγ colliders are calculated in several decay channels. Heavy scalar and pseudoscalar Higgs bosons can be discovered in the bb final state in the investigated mass range 200 to 800 GeV for moderate and large values of tanβ. The τ + τ - channel provides a heavy Higgs boson discovery potential for large values of tanβ. Several mechanisms that can be exploited at e + e - linear colliders for the measurement of the lifetime of a SM Higgs boson in the intermediate mass range are analysed. In the WW mode, the lifetime of Higgs scalars with masses below ∝160 GeV can be determined with an error less than 10%. The reconstruction of the Higgs potential requires the measurement of the Higgs self-couplings. The SM and MSSM trilinear Higgs self-couplings are accessible in double and triple Higgs production. A theoretical analysis is presented in the relevant channels at the LHC and e + e - linear colliders. For high luminosities, the SM trilinear Higgs self-coupling can be measured with an accuracy of 20% at a 500 GeV e + e - linear collider. The MSSM coupling among three light Higgs bosons has to be extracted from continuum production. The other trilinear Higgs couplings are measurable in a restricted range of the MSSM parameter space. At the LHC, the Hhh coupling can be probed in resonant decays. (orig.)

  20. Search for Double Higgs Production in the Final State with Two Photons and Two Bottom Quarks at the CMS Detector

    Science.gov (United States)

    Hebda, Philip Robert

    A search for the production of Higgs pairs in the decay channel with two photons and two bottom quarks is reported for both resonant and nonresonant cases. The data corresponds to an integrated luminosity of 19.7 /fb of proton-proton collisions at a center-of-mass energy of 8 TeV collected by the CMS detector at the CERN Large Hardron Collider. The candidate events are selected by requiring two photons and two jets and are classified according to the number of jets tagged as coming from the hadronization of a bottom quark. The search for resonance production of two Higgs bosons through a new particle as hypothesized in extensions to the Standard Model involving a Radion or KK-graviton from models with warped extra dimensions or involving a heavy Higgs from models with supersymmetry, is performed on the resonant mass range from 260 GeV to 1100 GeV. The search for Standard Model nonresonant production of two Higgs bosons is performed; in addition a theoretical framework is explored for the analysis of anomalous values of the couplings tt¯H, HHH, and tt¯HH. The observations are consistent with background expectations. Upper limits at the 95% confidence level are extracted on the production cross section of resonant and SM nonresonant production. In particular, the Radion with a vacuum expectation of 1 TeV is observed (expected) to be excluded with masses below 0.97 TeV (0.88 TeV), while the analysis is not sensitive to the Radion with a vacuum expectation of 3 TeV. The nonresonant double Higgs cross section is observed (expected) to be excluded at 1.91 fb (1.59 fb) or 72.9 (60.7) times the NNLO Standard Model value.